F488740
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1037 | 383 | 1019 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300025903|Ga0207680_10221044|Ga0207680_102210442 |
| Length | 246 |
| Sequence | VQGIAGSDRVSCRHAASALSGRLTVARSKSSARWLKEHFSDPYVKRAQAEGWRSRAVFKLEELLERDRLLKPGIVVVDLGAAPGGWSQMVRESLRERGQDTGRVMALDILPMQGIGGVEFIEGDFREESVLKQLEALLNSQPVDLVLSDMAPNISGVESVDQARAMHLAELAQAFAAAHLKPGGAFLTKLFQGRGFDDYLRGLRADFERVSIRKPKASRARSAEVYALATGRRGTDAVGSLPKVPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 3 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 4 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 5 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 6 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 7 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 8 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 9 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 10 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 11 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 12 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 13 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 14 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 15 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 130 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 198 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 199 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 208 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 209 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 240 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 241 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 242 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 243 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 246 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 247 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 248 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 249 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 370 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 371 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 374 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 381 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 382 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 383 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.69 |
| Metatranscriptomes | 0.58 |
| Isolates | 1.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.22 |
| Nodule | 0 |
| Rhizoplane | 4.73 |
| Rhizosphere | 87.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_136925 | 2162886007 | Bacteria | 3390 |
| 2 | JGI24743J22301_10044081 | 3300001991 | Bacteria | 900 |
| 3 | Ga0055536_1005660 | 3300003781 | Bacteria | 6045 |
| 4 | Ga0055531_10024585 | 3300003794 | Bacteria | 2217 |
| 5 | Ga0058863_11775536 | 3300004799 | Bacteria | 1320 |
| 6 | Ga0065704_10074187 | 3300005289 | Bacteria | 6463 |
| 7 | Ga0065704_10074217 | 3300005289 | Bacteria | 6447 |
| 8 | Ga0070658_10129147 | 3300005327 | Bacteria | 2105 |
| 9 | Ga0070658_10183396 | 3300005327 | Bacteria | 1762 |
| 10 | Ga0070658_10316884 | 3300005327 | Bacteria | 1331 |
| 11 | Ga0070676_10027579 | 3300005328 | Bacteria | 3221 |
| 12 | Ga0070683_100589297 | 3300005329 | Bacteria | 1064 |
| 13 | Ga0070690_100012274 | 3300005330 | Bacteria | 5039 |
| 14 | Ga0070690_100291850 | 3300005330 | Bacteria | 1166 |
| 15 | Ga0070670_100003232 | 3300005331 | Bacteria | 13458 |
| 16 | Ga0070670_100021104 | 3300005331 | Bacteria | 5602 |
| 17 | Ga0070670_100026260 | 3300005331 | Bacteria | 5014 |
| 18 | Ga0070670_100066426 | 3300005331 | Bacteria | 3095 |
| 19 | Ga0070670_100184825 | 3300005331 | Bacteria | 1810 |
| 20 | Ga0068869_100104729 | 3300005334 | Bacteria | 2145 |
| 21 | Ga0068869_100143932 | 3300005334 | Bacteria | 1843 |
| 22 | Ga0068869_100146300 | 3300005334 | Bacteria | 1829 |
| 23 | Ga0068869_100177272 | 3300005334 | Bacteria | 1669 |
| 24 | Ga0068869_100357235 | 3300005334 | Bacteria | 1192 |
| 25 | Ga0070666_10021006 | 3300005335 | Bacteria | 4227 |
| 26 | Ga0070666_10154259 | 3300005335 | Bacteria | 1603 |
| 27 | Ga0070666_10214078 | 3300005335 | Bacteria | 1358 |
| 28 | Ga0070666_10273246 | 3300005335 | Bacteria | 1200 |
| 29 | Ga0070680_100035599 | 3300005336 | Bacteria | 4020 |
| 30 | Ga0070680_100188167 | 3300005336 | Bacteria | 1739 |
| 31 | Ga0070682_100001003 | 3300005337 | Bacteria | 16333 |
| 32 | Ga0070682_100013088 | 3300005337 | Bacteria | 4766 |
| 33 | Ga0070682_100113715 | 3300005337 | Bacteria | 1808 |
| 34 | Ga0070682_100184641 | 3300005337 | Bacteria | 1459 |
| 35 | Ga0070682_100437538 | 3300005337 | Bacteria | 998 |
| 36 | Ga0068868_100003997 | 3300005338 | Bacteria | 10290 |
| 37 | Ga0068868_100062603 | 3300005338 | Bacteria | 2949 |
| 38 | Ga0068868_100125813 | 3300005338 | Bacteria | 2094 |
| 39 | Ga0068868_100200423 | 3300005338 | Bacteria | 1664 |
| 40 | Ga0068868_100307562 | 3300005338 | Bacteria | 1348 |
| 41 | Ga0070660_100860189 | 3300005339 | Bacteria | 764 |
| 42 | Ga0070689_100239447 | 3300005340 | Bacteria | 1494 |
| 43 | Ga0070689_100253351 | 3300005340 | Bacteria | 1453 |
| 44 | Ga0070691_10100303 | 3300005341 | Bacteria | 1437 |
| 45 | Ga0070661_100026423 | 3300005344 | Bacteria | 4175 |
| 46 | Ga0070661_100027894 | 3300005344 | Bacteria | 4069 |
| 47 | Ga0070661_100053518 | 3300005344 | Bacteria | 2954 |
| 48 | Ga0070661_100142059 | 3300005344 | Bacteria | 1810 |
| 49 | Ga0070661_100158823 | 3300005344 | Bacteria | 1711 |
| 50 | Ga0070661_100194320 | 3300005344 | Bacteria | 1548 |
| 51 | Ga0070661_100521705 | 3300005344 | Bacteria | 953 |
| 52 | Ga0070692_10002864 | 3300005345 | Bacteria | 6835 |
| 53 | Ga0070692_10091172 | 3300005345 | Bacteria | 1657 |
| 54 | Ga0070692_10159184 | 3300005345 | Bacteria | 1292 |
| 55 | Ga0070668_100045299 | 3300005347 | Bacteria | 3376 |
| 56 | Ga0070668_100206196 | 3300005347 | Bacteria | 1615 |
| 57 | Ga0070669_100090318 | 3300005353 | Bacteria | 2296 |
| 58 | Ga0070675_100024532 | 3300005354 | Bacteria | 4830 |
| 59 | Ga0070675_100125898 | 3300005354 | Bacteria | 2180 |
| 60 | Ga0070671_100108553 | 3300005355 | Bacteria | 2330 |
| 61 | Ga0070671_100116529 | 3300005355 | Bacteria | 2246 |
| 62 | Ga0070671_100289817 | 3300005355 | Bacteria | 1393 |
| 63 | Ga0070674_100099394 | 3300005356 | Bacteria | 2117 |
| 64 | Ga0070673_100027257 | 3300005364 | Bacteria | 4234 |
| 65 | Ga0070673_100028362 | 3300005364 | Bacteria | 4163 |
| 66 | Ga0070673_100182693 | 3300005364 | Bacteria | 1796 |
| 67 | Ga0070688_100362286 | 3300005365 | Bacteria | 1064 |
| 68 | Ga0070659_100003413 | 3300005366 | Bacteria | 11320 |
| 69 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 70 | Ga0070667_100062337 | 3300005367 | Bacteria | 3158 |
| 71 | Ga0070667_100079369 | 3300005367 | Bacteria | 2805 |
| 72 | Ga0070667_100080731 | 3300005367 | Bacteria | 2782 |
| 73 | Ga0070667_100097600 | 3300005367 | Bacteria | 2535 |
| 74 | Ga0070667_100128838 | 3300005367 | Bacteria | 2207 |
| 75 | Ga0070667_100138220 | 3300005367 | Bacteria | 2131 |
| 76 | Ga0070667_100152010 | 3300005367 | Bacteria | 2034 |
| 77 | Ga0070667_100168594 | 3300005367 | Bacteria | 1932 |
| 78 | Ga0070709_10003340 | 3300005434 | Bacteria | 8631 |
| 79 | Ga0070714_100000034 | 3300005435 | Bacteria | 130742 |
| 80 | Ga0070711_100069150 | 3300005439 | Bacteria | 2483 |
| 81 | Ga0070711_100360920 | 3300005439 | Bacteria | 1170 |
| 82 | Ga0070700_100102054 | 3300005441 | Bacteria | 1892 |
| 83 | Ga0070694_100075030 | 3300005444 | Bacteria | 2338 |
| 84 | Ga0070694_100116435 | 3300005444 | Bacteria | 1912 |
| 85 | Ga0070694_100604327 | 3300005444 | Bacteria | 884 |
| 86 | Ga0070663_100004878 | 3300005455 | Bacteria | 7916 |
| 87 | Ga0070663_100009056 | 3300005455 | Bacteria | 6150 |
| 88 | Ga0070663_100024628 | 3300005455 | Bacteria | 4054 |
| 89 | Ga0070663_100055331 | 3300005455 | Bacteria | 2839 |
| 90 | Ga0070663_100172682 | 3300005455 | Bacteria | 1672 |
| 91 | Ga0070663_100194361 | 3300005455 | Bacteria | 1581 |
| 92 | Ga0070663_100228774 | 3300005455 | Bacteria | 1463 |
| 93 | Ga0070663_100335658 | 3300005455 | Bacteria | 1220 |
| 94 | Ga0070663_100741370 | 3300005455 | Bacteria | 838 |
| 95 | Ga0070678_100020450 | 3300005456 | Bacteria | 4344 |
| 96 | Ga0070678_100117199 | 3300005456 | Bacteria | 2094 |
| 97 | Ga0070678_100408866 | 3300005456 | Bacteria | 1181 |
| 98 | Ga0070662_100008490 | 3300005457 | Bacteria | 6704 |
| 99 | Ga0070662_100493055 | 3300005457 | Bacteria | 1021 |
| 100 | Ga0070681_10000344 | 3300005458 | Bacteria | 37503 |
| 101 | Ga0070681_10002489 | 3300005458 | Bacteria | 16870 |
| 102 | Ga0070681_10037443 | 3300005458 | Bacteria | 4868 |
| 103 | Ga0070681_10042418 | 3300005458 | Bacteria | 4559 |
| 104 | Ga0070681_10047300 | 3300005458 | Bacteria | 4300 |
| 105 | Ga0068867_100032358 | 3300005459 | Bacteria | 3782 |
| 106 | Ga0070685_10003480 | 3300005466 | Bacteria | 8011 |
| 107 | Ga0070685_10025507 | 3300005466 | Bacteria | 3255 |
| 108 | Ga0070679_100033446 | 3300005530 | Bacteria | 5091 |
| 109 | Ga0070679_100055197 | 3300005530 | Bacteria | 3956 |
| 110 | Ga0070679_100178635 | 3300005530 | Bacteria | 2095 |
| 111 | Ga0070679_100221925 | 3300005530 | Bacteria | 1851 |
| 112 | Ga0070679_100328945 | 3300005530 | Bacteria | 1477 |
| 113 | Ga0070684_100071094 | 3300005535 | Bacteria | 3063 |
| 114 | Ga0068853_100001206 | 3300005539 | Bacteria | 18434 |
| 115 | Ga0068853_100003367 | 3300005539 | Bacteria | 12234 |
| 116 | Ga0068853_100004939 | 3300005539 | Bacteria | 10386 |
| 117 | Ga0068853_100020363 | 3300005539 | Bacteria | 5516 |
| 118 | Ga0068853_100039275 | 3300005539 | Bacteria | 4036 |
| 119 | Ga0068853_100043183 | 3300005539 | Bacteria | 3857 |
| 120 | Ga0068853_100046651 | 3300005539 | Bacteria | 3716 |
| 121 | Ga0068853_100062215 | 3300005539 | Bacteria | 3229 |
| 122 | Ga0068853_100080405 | 3300005539 | Bacteria | 2851 |
| 123 | Ga0068853_100131158 | 3300005539 | Bacteria | 2243 |
| 124 | Ga0068853_100145952 | 3300005539 | Bacteria | 2126 |
| 125 | Ga0068853_100206934 | 3300005539 | Bacteria | 1787 |
| 126 | Ga0068853_100274007 | 3300005539 | Bacteria | 1554 |
| 127 | Ga0068853_100321467 | 3300005539 | Bacteria | 1434 |
| 128 | Ga0068853_100547944 | 3300005539 | Bacteria | 1095 |
| 129 | Ga0070672_100006538 | 3300005543 | Bacteria | 7838 |
| 130 | Ga0070672_100278654 | 3300005543 | Bacteria | 1413 |
| 131 | Ga0070672_100328539 | 3300005543 | Bacteria | 1301 |
| 132 | Ga0070672_100396620 | 3300005543 | Bacteria | 1182 |
| 133 | Ga0070686_100293412 | 3300005544 | Bacteria | 1204 |
| 134 | Ga0070696_100002465 | 3300005546 | Bacteria | 12261 |
| 135 | Ga0070696_100003766 | 3300005546 | Bacteria | 10129 |
| 136 | Ga0070693_100005909 | 3300005547 | Bacteria | 5916 |
| 137 | Ga0070665_100000062 | 3300005548 | Bacteria | 220304 |
| 138 | Ga0070665_100001482 | 3300005548 | Bacteria | 27442 |
| 139 | Ga0070665_100005179 | 3300005548 | Bacteria | 13491 |
| 140 | Ga0070665_100022022 | 3300005548 | Bacteria | 6412 |
| 141 | Ga0070665_100181726 | 3300005548 | Bacteria | 2104 |
| 142 | Ga0070665_100210823 | 3300005548 | Bacteria | 1943 |
| 143 | Ga0070665_100252158 | 3300005548 | Bacteria | 1766 |
| 144 | Ga0070704_100343010 | 3300005549 | Bacteria | 1258 |
| 145 | Ga0068855_100009974 | 3300005563 | Bacteria | 11447 |
| 146 | Ga0068855_100013534 | 3300005563 | Bacteria | 9838 |
| 147 | Ga0068855_100022716 | 3300005563 | Bacteria | 7516 |
| 148 | Ga0068855_100059017 | 3300005563 | Bacteria | 4490 |
| 149 | Ga0068855_100109324 | 3300005563 | Bacteria | 3175 |
| 150 | Ga0068855_100187908 | 3300005563 | Bacteria | 2332 |
| 151 | Ga0068855_100212061 | 3300005563 | Bacteria | 2175 |
| 152 | Ga0068855_100374393 | 3300005563 | Bacteria | 1564 |
| 153 | Ga0068855_100398516 | 3300005563 | Bacteria | 1508 |
| 154 | Ga0068855_100430770 | 3300005563 | Bacteria | 1442 |
| 155 | Ga0068855_100753137 | 3300005563 | Bacteria | 1038 |
| 156 | Ga0070664_100004667 | 3300005564 | Bacteria | 10997 |
| 157 | Ga0070664_100083939 | 3300005564 | Bacteria | 2749 |
| 158 | Ga0070664_100176940 | 3300005564 | Bacteria | 1895 |
| 159 | Ga0070664_100524934 | 3300005564 | Bacteria | 1093 |
| 160 | Ga0068857_100059380 | 3300005577 | Bacteria | 3397 |
| 161 | Ga0068857_100120536 | 3300005577 | Bacteria | 2361 |
| 162 | Ga0068857_100241676 | 3300005577 | Bacteria | 1653 |
| 163 | Ga0068857_100282547 | 3300005577 | Bacteria | 1527 |
| 164 | Ga0068854_100049360 | 3300005578 | Bacteria | 3006 |
| 165 | Ga0068854_100153046 | 3300005578 | Bacteria | 1780 |
| 166 | Ga0068856_100007871 | 3300005614 | Bacteria | 10408 |
| 167 | Ga0068856_100040580 | 3300005614 | Bacteria | 4572 |
| 168 | Ga0068856_100082877 | 3300005614 | Bacteria | 3183 |
| 169 | Ga0068856_100117830 | 3300005614 | Bacteria | 2656 |
| 170 | Ga0068856_100169761 | 3300005614 | Bacteria | 2193 |
| 171 | Ga0070702_100072672 | 3300005615 | Bacteria | 2036 |
| 172 | Ga0068852_100005452 | 3300005616 | Bacteria | 9098 |
| 173 | Ga0068852_100042880 | 3300005616 | Bacteria | 3833 |
| 174 | Ga0068852_100136432 | 3300005616 | Bacteria | 2266 |
| 175 | Ga0068852_100167428 | 3300005616 | Bacteria | 2057 |
| 176 | Ga0068852_100277398 | 3300005616 | Bacteria | 1615 |
| 177 | Ga0068852_100652465 | 3300005616 | Bacteria | 1060 |
| 178 | Ga0068859_100000265 | 3300005617 | Bacteria | 52351 |
| 179 | Ga0068859_100008663 | 3300005617 | Bacteria | 10281 |
| 180 | Ga0068859_100169678 | 3300005617 | Bacteria | 2263 |
| 181 | Ga0068859_100344807 | 3300005617 | Bacteria | 1584 |
| 182 | Ga0068864_100005830 | 3300005618 | Bacteria | 10101 |
| 183 | Ga0068864_100006173 | 3300005618 | Bacteria | 9826 |
| 184 | Ga0068864_100046404 | 3300005618 | Bacteria | 3728 |
| 185 | Ga0068864_100225814 | 3300005618 | Bacteria | 1730 |
| 186 | Ga0068861_100036281 | 3300005719 | Bacteria | 3658 |
| 187 | Ga0068861_100068799 | 3300005719 | Bacteria | 2737 |
| 188 | Ga0068861_100756616 | 3300005719 | Bacteria | 908 |
| 189 | Ga0068851_10011387 | 3300005834 | Bacteria | 4169 |
| 190 | Ga0068851_10047128 | 3300005834 | Bacteria | 2182 |
| 191 | Ga0068851_10067424 | 3300005834 | Bacteria | 1845 |
| 192 | Ga0068851_10068612 | 3300005834 | Bacteria | 1830 |
| 193 | Ga0068851_10090317 | 3300005834 | Bacteria | 1612 |
| 194 | Ga0068870_10074338 | 3300005840 | Bacteria | 1862 |
| 195 | Ga0068863_100016749 | 3300005841 | Bacteria | 7032 |
| 196 | Ga0068863_100035993 | 3300005841 | Bacteria | 4714 |
| 197 | Ga0068863_100045714 | 3300005841 | Bacteria | 4155 |
| 198 | Ga0068863_100109182 | 3300005841 | Bacteria | 2633 |
| 199 | Ga0068863_100167612 | 3300005841 | Bacteria | 2106 |
| 200 | Ga0068863_100189952 | 3300005841 | Bacteria | 1974 |
| 201 | Ga0068863_100335364 | 3300005841 | Bacteria | 1470 |
| 202 | Ga0068863_100432497 | 3300005841 | Bacteria | 1290 |
| 203 | Ga0068858_100001325 | 3300005842 | Bacteria | 25564 |
| 204 | Ga0068858_100014128 | 3300005842 | Bacteria | 7530 |
| 205 | Ga0068858_100042643 | 3300005842 | Bacteria | 4207 |
| 206 | Ga0068858_100064412 | 3300005842 | Bacteria | 3392 |
| 207 | Ga0068858_100124970 | 3300005842 | Bacteria | 2408 |
| 208 | Ga0068858_100233568 | 3300005842 | Bacteria | 1744 |
| 209 | Ga0068860_100019554 | 3300005843 | Bacteria | 6565 |
| 210 | Ga0068860_100048149 | 3300005843 | Bacteria | 4063 |
| 211 | Ga0068860_100119696 | 3300005843 | Bacteria | 2521 |
| 212 | Ga0068860_100707764 | 3300005843 | Bacteria | 1017 |
| 213 | Ga0068862_100000447 | 3300005844 | Bacteria | 44742 |
| 214 | Ga0068862_100289079 | 3300005844 | Bacteria | 1505 |
| 215 | Ga0068862_100400602 | 3300005844 | Bacteria | 1284 |
| 216 | Ga0081455_10045286 | 3300005937 | Bacteria | 3829 |
| 217 | Ga0081540_1004799 | 3300005983 | Bacteria | 10189 |
| 218 | Ga0097621_100009176 | 3300006237 | Bacteria | 7170 |
| 219 | Ga0097621_100101376 | 3300006237 | Bacteria | 2422 |
| 220 | Ga0097621_100118942 | 3300006237 | Bacteria | 2239 |
| 221 | Ga0097621_100242261 | 3300006237 | Bacteria | 1577 |
| 222 | Ga0097621_100339840 | 3300006237 | Bacteria | 1333 |
| 223 | Ga0097621_100520190 | 3300006237 | Bacteria | 1080 |
| 224 | Ga0068871_100005841 | 3300006358 | Bacteria | 8651 |
| 225 | Ga0068871_100039070 | 3300006358 | Bacteria | 3795 |
| 226 | Ga0068871_100064954 | 3300006358 | Bacteria | 2988 |
| 227 | Ga0068871_100150903 | 3300006358 | Bacteria | 1982 |
| 228 | Ga0068871_100196340 | 3300006358 | Bacteria | 1741 |
| 229 | Ga0068871_100297362 | 3300006358 | Bacteria | 1416 |
| 230 | Ga0075428_100003215 | 3300006844 | Bacteria | 17873 |
| 231 | Ga0075430_100013050 | 3300006846 | Bacteria | 7081 |
| 232 | Ga0075433_10031019 | 3300006852 | Bacteria | 4566 |
| 233 | Ga0075434_100738905 | 3300006871 | Bacteria | 1001 |
| 234 | Ga0068865_100024619 | 3300006881 | Bacteria | 3951 |
| 235 | Ga0068865_100059895 | 3300006881 | Bacteria | 2664 |
| 236 | Ga0068865_100116570 | 3300006881 | Bacteria | 1978 |
| 237 | Ga0068865_100201766 | 3300006881 | Bacteria | 1544 |
| 238 | Ga0097620_100000265 | 3300006931 | Bacteria | 52351 |
| 239 | Ga0097620_100008663 | 3300006931 | Bacteria | 10281 |
| 240 | Ga0097620_100169686 | 3300006931 | Bacteria | 2263 |
| 241 | Ga0097620_100344832 | 3300006931 | Bacteria | 1584 |
| 242 | Ga0099794_10081435 | 3300007265 | Bacteria | 1597 |
| 243 | Ga0099795_10000064 | 3300007788 | Bacteria | 18756 |
| 244 | Ga0099795_10050150 | 3300007788 | Bacteria | 1517 |
| 245 | Ga0099795_10078744 | 3300007788 | Bacteria | 1257 |
| 246 | Ga0105251_10002861 | 3300009011 | Bacteria | 13030 |
| 247 | Ga0105251_10127723 | 3300009011 | Bacteria | 1153 |
| 248 | Ga0105240_10001278 | 3300009093 | Bacteria | 43550 |
| 249 | Ga0105240_10061336 | 3300009093 | Bacteria | 4686 |
| 250 | Ga0105240_10122181 | 3300009093 | Bacteria | 3134 |
| 251 | Ga0105240_10163453 | 3300009093 | Bacteria | 2642 |
| 252 | Ga0105240_10405029 | 3300009093 | Bacteria | 1536 |
| 253 | Ga0105240_10439147 | 3300009093 | Bacteria | 1463 |
| 254 | Ga0105240_10554704 | 3300009093 | Bacteria | 1271 |
| 255 | Ga0105240_10573559 | 3300009093 | Bacteria | 1245 |
| 256 | Ga0111539_10018132 | 3300009094 | Bacteria | 8718 |
| 257 | Ga0111539_11223966 | 3300009094 | Bacteria | 872 |
| 258 | Ga0111539_11339585 | 3300009094 | Bacteria | 831 |
| 259 | Ga0105245_10003531 | 3300009098 | Bacteria | 13979 |
| 260 | Ga0105245_10363834 | 3300009098 | Bacteria | 1436 |
| 261 | Ga0105245_10757196 | 3300009098 | Bacteria | 1007 |
| 262 | Ga0105245_10773967 | 3300009098 | Bacteria | 997 |
| 263 | Ga0105247_10014315 | 3300009101 | Bacteria | 4762 |
| 264 | Ga0105247_10021024 | 3300009101 | Bacteria | 3926 |
| 265 | Ga0105247_10176893 | 3300009101 | Bacteria | 1422 |
| 266 | Ga0105243_11067241 | 3300009148 | Bacteria | 814 |
| 267 | Ga0105241_10016408 | 3300009174 | Bacteria | 5432 |
| 268 | Ga0105241_10067168 | 3300009174 | Bacteria | 2775 |
| 269 | Ga0105241_10096475 | 3300009174 | Bacteria | 2342 |
| 270 | Ga0105241_10564590 | 3300009174 | Bacteria | 1023 |
| 271 | Ga0105242_10004235 | 3300009176 | Bacteria | 11187 |
| 272 | Ga0105242_10130728 | 3300009176 | Bacteria | 2167 |
| 273 | Ga0105242_10359063 | 3300009176 | Bacteria | 1348 |
| 274 | Ga0105248_10002061 | 3300009177 | Bacteria | 22267 |
| 275 | Ga0105248_10010033 | 3300009177 | Bacteria | 10429 |
| 276 | Ga0105248_10129409 | 3300009177 | Bacteria | 2848 |
| 277 | Ga0105248_10251166 | 3300009177 | Bacteria | 1991 |
| 278 | Ga0105248_10296624 | 3300009177 | Bacteria | 1820 |
| 279 | Ga0105237_10004780 | 3300009545 | Bacteria | 15572 |
| 280 | Ga0105237_10025841 | 3300009545 | Bacteria | 6004 |
| 281 | Ga0105237_10030200 | 3300009545 | Bacteria | 5507 |
| 282 | Ga0105237_10195837 | 3300009545 | Bacteria | 2021 |
| 283 | Ga0105237_10305845 | 3300009545 | Bacteria | 1593 |
| 284 | Ga0105237_10442532 | 3300009545 | Bacteria | 1305 |
| 285 | Ga0105237_11012795 | 3300009545 | Bacteria | 837 |
| 286 | Ga0105238_10014138 | 3300009551 | Bacteria | 8072 |
| 287 | Ga0105238_10024550 | 3300009551 | Bacteria | 6144 |
| 288 | Ga0105238_10032728 | 3300009551 | Bacteria | 5292 |
| 289 | Ga0105238_10055319 | 3300009551 | Bacteria | 3983 |
| 290 | Ga0105238_10086971 | 3300009551 | Bacteria | 3113 |
| 291 | Ga0105238_10092552 | 3300009551 | Bacteria | 3011 |
| 292 | Ga0105238_10167385 | 3300009551 | Bacteria | 2174 |
| 293 | Ga0105238_10268181 | 3300009551 | Bacteria | 1687 |
| 294 | Ga0105238_10326225 | 3300009551 | Bacteria | 1521 |
| 295 | Ga0105238_10367898 | 3300009551 | Bacteria | 1428 |
| 296 | Ga0105238_10924708 | 3300009551 | Bacteria | 891 |
| 297 | Ga0105249_10002473 | 3300009553 | Bacteria | 16002 |
| 298 | Ga0105249_10025839 | 3300009553 | Bacteria | 5289 |
| 299 | Ga0105249_10101054 | 3300009553 | Bacteria | 2712 |
| 300 | Ga0105249_10216145 | 3300009553 | Bacteria | 1884 |
| 301 | Ga0105249_10365161 | 3300009553 | Bacteria | 1466 |
| 302 | Ga0105249_10417158 | 3300009553 | Bacteria | 1375 |
| 303 | Ga0099796_10000064 | 3300010159 | Bacteria | 18870 |
| 304 | Ga0105239_10010293 | 3300010375 | Bacteria | 10475 |
| 305 | Ga0105239_10018289 | 3300010375 | Bacteria | 7748 |
| 306 | Ga0105239_10023801 | 3300010375 | Bacteria | 6744 |
| 307 | Ga0105239_10067815 | 3300010375 | Bacteria | 3920 |
| 308 | Ga0105239_10106229 | 3300010375 | Bacteria | 3110 |
| 309 | Ga0105239_10125127 | 3300010375 | Bacteria | 2857 |
| 310 | Ga0105239_10144450 | 3300010375 | Bacteria | 2653 |
| 311 | Ga0105239_10221435 | 3300010375 | Bacteria | 2122 |
| 312 | Ga0105239_10325273 | 3300010375 | Bacteria | 1734 |
| 313 | Ga0105246_10020552 | 3300011119 | Bacteria | 4236 |
| 314 | Ga0105246_10729468 | 3300011119 | Bacteria | 872 |
| 315 | Ga0157373_10072564 | 3300013100 | Bacteria | 2430 |
| 316 | Ga0157373_10077267 | 3300013100 | Bacteria | 2349 |
| 317 | Ga0157373_10155666 | 3300013100 | Bacteria | 1608 |
| 318 | Ga0157371_10005748 | 3300013102 | Bacteria | 10390 |
| 319 | Ga0157371_10300654 | 3300013102 | Bacteria | 1162 |
| 320 | Ga0157371_10645570 | 3300013102 | Bacteria | 790 |
| 321 | Ga0157370_10007947 | 3300013104 | Bacteria | 11490 |
| 322 | Ga0157370_10060548 | 3300013104 | Bacteria | 3594 |
| 323 | Ga0157370_10222091 | 3300013104 | Bacteria | 1750 |
| 324 | Ga0157370_10453721 | 3300013104 | Bacteria | 1178 |
| 325 | Ga0157369_10000032 | 3300013105 | Bacteria | 202272 |
| 326 | Ga0157369_10020635 | 3300013105 | Bacteria | 7367 |
| 327 | Ga0157369_10164205 | 3300013105 | Bacteria | 2343 |
| 328 | Ga0157369_10252566 | 3300013105 | Bacteria | 1840 |
| 329 | Ga0157369_10406855 | 3300013105 | Bacteria | 1411 |
| 330 | Ga0157374_10002676 | 3300013296 | Bacteria | 14991 |
| 331 | Ga0157374_10052356 | 3300013296 | Bacteria | 3802 |
| 332 | Ga0157374_10223638 | 3300013296 | Bacteria | 1848 |
| 333 | Ga0157378_10221819 | 3300013297 | Bacteria | 1797 |
| 334 | Ga0157378_10375160 | 3300013297 | Bacteria | 1395 |
| 335 | Ga0163162_10000015 | 3300013306 | Bacteria | 261996 |
| 336 | Ga0163162_10007195 | 3300013306 | Bacteria | 10809 |
| 337 | Ga0163162_10080190 | 3300013306 | Bacteria | 3331 |
| 338 | Ga0163162_10179018 | 3300013306 | Bacteria | 2246 |
| 339 | Ga0163162_10195409 | 3300013306 | Bacteria | 2152 |
| 340 | Ga0163162_10603941 | 3300013306 | Bacteria | 1223 |
| 341 | Ga0163162_10722167 | 3300013306 | Bacteria | 1117 |
| 342 | Ga0157372_10004512 | 3300013307 | Bacteria | 14851 |
| 343 | Ga0157372_10007227 | 3300013307 | Bacteria | 11826 |
| 344 | Ga0157372_10007958 | 3300013307 | Bacteria | 11270 |
| 345 | Ga0157372_10189198 | 3300013307 | Bacteria | 2384 |
| 346 | Ga0157372_10193754 | 3300013307 | Bacteria | 2354 |
| 347 | Ga0157372_10531026 | 3300013307 | Bacteria | 1371 |
| 348 | Ga0157372_10960657 | 3300013307 | Bacteria | 990 |
| 349 | Ga0157375_10000102 | 3300013308 | Bacteria | 86408 |
| 350 | Ga0157375_10001413 | 3300013308 | Bacteria | 20668 |
| 351 | Ga0157375_10049038 | 3300013308 | Bacteria | 4135 |
| 352 | Ga0157375_11043307 | 3300013308 | Bacteria | 955 |
| 353 | Ga0157375_11094181 | 3300013308 | Bacteria | 933 |
| 354 | Ga0157375_11096410 | 3300013308 | Bacteria | 932 |
| 355 | Ga0163163_10000714 | 3300014325 | Bacteria | 28173 |
| 356 | Ga0163163_10015604 | 3300014325 | Bacteria | 7027 |
| 357 | Ga0163163_10047685 | 3300014325 | Bacteria | 4212 |
| 358 | Ga0163163_10593421 | 3300014325 | Bacteria | 1171 |
| 359 | Ga0157380_10130820 | 3300014326 | Bacteria | 2141 |
| 360 | Ga0157380_11087087 | 3300014326 | Bacteria | 838 |
| 361 | Ga0182008_10012022 | 3300014497 | Bacteria | 4583 |
| 362 | Ga0182008_10044098 | 3300014497 | Bacteria | 2219 |
| 363 | Ga0157377_10125033 | 3300014745 | Bacteria | 1563 |
| 364 | Ga0157379_10052017 | 3300014968 | Bacteria | 3657 |
| 365 | Ga0157379_10452806 | 3300014968 | Bacteria | 1185 |
| 366 | Ga0157376_10001668 | 3300014969 | Bacteria | 14744 |
| 367 | Ga0157376_10070476 | 3300014969 | Bacteria | 2967 |
| 368 | Ga0157376_10134518 | 3300014969 | Bacteria | 2211 |
| 369 | Ga0157376_10164688 | 3300014969 | Bacteria | 2013 |
| 370 | Ga0157376_10456447 | 3300014969 | Bacteria | 1248 |
| 371 | Ga0182006_1000072 | 3300015261 | Bacteria | 133681 |
| 372 | Ga0182007_10014466 | 3300015262 | Bacteria | 2974 |
| 373 | Ga0182005_1002561 | 3300015265 | Bacteria | 6456 |
| 374 | Ga0182005_1008905 | 3300015265 | Bacteria | 2943 |
| 375 | Ga0163161_10003999 | 3300017792 | Bacteria | 10318 |
| 376 | Ga0206356_10153146 | 3300020070 | Bacteria | 1263 |
| 377 | Ga0206354_10250691 | 3300020081 | Bacteria | 880 |
| 378 | Ga0224572_1041748 | 3300024225 | Bacteria | 863 |
| 379 | Ga0209676_1000034 | 3300025292 | Bacteria | 460125 |
| 380 | Ga0209050_1064702 | 3300025298 | Bacteria | 846 |
| 381 | Ga0207426_1008053 | 3300025302 | Bacteria | 4319 |
| 382 | Ga0209051_1013016 | 3300025303 | Bacteria | 3983 |
| 383 | Ga0209257_1000302 | 3300025304 | Bacteria | 108038 |
| 384 | Ga0209257_1000585 | 3300025304 | Bacteria | 61004 |
| 385 | Ga0207656_10001827 | 3300025321 | Bacteria | 7069 |
| 386 | Ga0207656_10026626 | 3300025321 | Bacteria | 2360 |
| 387 | Ga0207656_10062648 | 3300025321 | Bacteria | 1635 |
| 388 | Ga0207656_10096211 | 3300025321 | Bacteria | 1351 |
| 389 | Ga0207713_1000890 | 3300025735 | Bacteria | 27092 |
| 390 | Ga0207680_10001037 | 3300025903 | Bacteria | 13116 |
| 391 | Ga0207680_10003078 | 3300025903 | Bacteria | 7827 |
| 392 | Ga0207680_10048120 | 3300025903 | Bacteria | 2531 |
| 393 | Ga0207680_10109953 | 3300025903 | Bacteria | 1786 |
| 394 | Ga0207680_10199425 | 3300025903 | Bacteria | 1363 |
| 395 | Ga0207680_10221044 | 3300025903 | Bacteria | 1299 |
| 396 | Ga0207680_10226315 | 3300025903 | Bacteria | 1284 |
| 397 | Ga0207680_10246437 | 3300025903 | Bacteria | 1233 |
| 398 | Ga0207647_10004843 | 3300025904 | Bacteria | 9954 |
| 399 | Ga0207647_10008817 | 3300025904 | Bacteria | 7199 |
| 400 | Ga0207645_10020277 | 3300025907 | Bacteria | 4353 |
| 401 | Ga0207645_10105181 | 3300025907 | Bacteria | 1823 |
| 402 | Ga0207643_10006508 | 3300025908 | Bacteria | 6256 |
| 403 | Ga0207705_10110203 | 3300025909 | Bacteria | 2033 |
| 404 | Ga0207705_10156265 | 3300025909 | Bacteria | 1711 |
| 405 | Ga0207654_10000418 | 3300025911 | Bacteria | 24401 |
| 406 | Ga0207654_10129466 | 3300025911 | Bacteria | 1596 |
| 407 | Ga0207654_10410006 | 3300025911 | Bacteria | 944 |
| 408 | Ga0207707_10000128 | 3300025912 | Bacteria | 78104 |
| 409 | Ga0207707_10000933 | 3300025912 | Bacteria | 28273 |
| 410 | Ga0207707_10143369 | 3300025912 | Bacteria | 2088 |
| 411 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 412 | Ga0207695_10000536 | 3300025913 | Bacteria | 79171 |
| 413 | Ga0207695_10005921 | 3300025913 | Bacteria | 16024 |
| 414 | Ga0207695_10007552 | 3300025913 | Bacteria | 13782 |
| 415 | Ga0207695_10034290 | 3300025913 | Bacteria | 5523 |
| 416 | Ga0207695_10069938 | 3300025913 | Bacteria | 3591 |
| 417 | Ga0207695_10184901 | 3300025913 | Bacteria | 2003 |
| 418 | Ga0207695_10446241 | 3300025913 | Bacteria | 1177 |
| 419 | Ga0207671_10003137 | 3300025914 | Bacteria | 16775 |
| 420 | Ga0207671_10004488 | 3300025914 | Bacteria | 13293 |
| 421 | Ga0207671_10013246 | 3300025914 | Bacteria | 6578 |
| 422 | Ga0207671_10017813 | 3300025914 | Bacteria | 5465 |
| 423 | Ga0207671_10034031 | 3300025914 | Bacteria | 3788 |
| 424 | Ga0207671_10065136 | 3300025914 | Bacteria | 2710 |
| 425 | Ga0207671_10076557 | 3300025914 | Bacteria | 2504 |
| 426 | Ga0207671_10114039 | 3300025914 | Bacteria | 2059 |
| 427 | Ga0207660_10012771 | 3300025917 | Bacteria | 5499 |
| 428 | Ga0207660_10251721 | 3300025917 | Bacteria | 1394 |
| 429 | Ga0207660_10308039 | 3300025917 | Bacteria | 1262 |
| 430 | Ga0207660_10413363 | 3300025917 | Bacteria | 1087 |
| 431 | Ga0207657_10001316 | 3300025919 | Bacteria | 26382 |
| 432 | Ga0207657_10188169 | 3300025919 | Bacteria | 1666 |
| 433 | Ga0207657_10329127 | 3300025919 | Bacteria | 1207 |
| 434 | Ga0207657_10527203 | 3300025919 | Bacteria | 924 |
| 435 | Ga0207649_10009882 | 3300025920 | Bacteria | 5229 |
| 436 | Ga0207649_10014164 | 3300025920 | Bacteria | 4463 |
| 437 | Ga0207649_10041331 | 3300025920 | Bacteria | 2806 |
| 438 | Ga0207649_10200821 | 3300025920 | Bacteria | 1408 |
| 439 | Ga0207649_10370334 | 3300025920 | Bacteria | 1065 |
| 440 | Ga0207649_10388196 | 3300025920 | Bacteria | 1042 |
| 441 | Ga0207652_10002665 | 3300025921 | Bacteria | 14980 |
| 442 | Ga0207652_10059229 | 3300025921 | Bacteria | 3300 |
| 443 | Ga0207652_10252094 | 3300025921 | Bacteria | 1592 |
| 444 | Ga0207652_10320833 | 3300025921 | Bacteria | 1398 |
| 445 | Ga0207652_10596818 | 3300025921 | Bacteria | 990 |
| 446 | Ga0207681_10085431 | 3300025923 | Bacteria | 2239 |
| 447 | Ga0207681_10706039 | 3300025923 | Bacteria | 839 |
| 448 | Ga0207694_10002668 | 3300025924 | Bacteria | 14456 |
| 449 | Ga0207694_10003738 | 3300025924 | Bacteria | 12061 |
| 450 | Ga0207694_10005276 | 3300025924 | Bacteria | 9958 |
| 451 | Ga0207694_10006609 | 3300025924 | Bacteria | 8815 |
| 452 | Ga0207694_10013765 | 3300025924 | Bacteria | 6098 |
| 453 | Ga0207694_10128108 | 3300025924 | Bacteria | 2032 |
| 454 | Ga0207694_10138376 | 3300025924 | Bacteria | 1957 |
| 455 | Ga0207694_10663357 | 3300025924 | Bacteria | 879 |
| 456 | Ga0207650_10002390 | 3300025925 | Bacteria | 13068 |
| 457 | Ga0207650_10009991 | 3300025925 | Bacteria | 6497 |
| 458 | Ga0207650_10040606 | 3300025925 | Bacteria | 3405 |
| 459 | Ga0207650_10090521 | 3300025925 | Bacteria | 2337 |
| 460 | Ga0207650_10153251 | 3300025925 | Bacteria | 1820 |
| 461 | Ga0207650_10228861 | 3300025925 | Bacteria | 1499 |
| 462 | Ga0207659_10089319 | 3300025926 | Bacteria | 2298 |
| 463 | Ga0207659_10204061 | 3300025926 | Bacteria | 1581 |
| 464 | Ga0207687_10018293 | 3300025927 | Bacteria | 4624 |
| 465 | Ga0207687_10353911 | 3300025927 | Bacteria | 1197 |
| 466 | Ga0207664_10000021 | 3300025929 | Bacteria | 216875 |
| 467 | Ga0207644_10005307 | 3300025931 | Bacteria | 8411 |
| 468 | Ga0207644_10050387 | 3300025931 | Bacteria | 2984 |
| 469 | Ga0207644_10105070 | 3300025931 | Bacteria | 2127 |
| 470 | Ga0207690_10000734 | 3300025932 | Bacteria | 21131 |
| 471 | Ga0207690_10005653 | 3300025932 | Bacteria | 7387 |
| 472 | Ga0207690_10069040 | 3300025932 | Bacteria | 2430 |
| 473 | Ga0207706_10035735 | 3300025933 | Bacteria | 4416 |
| 474 | Ga0207706_10052916 | 3300025933 | Bacteria | 3584 |
| 475 | Ga0207706_10059192 | 3300025933 | Bacteria | 3374 |
| 476 | Ga0207706_10119408 | 3300025933 | Bacteria | 2318 |
| 477 | Ga0207706_10145804 | 3300025933 | Bacteria | 2082 |
| 478 | Ga0207686_10009012 | 3300025934 | Bacteria | 5402 |
| 479 | Ga0207670_10490945 | 3300025936 | Bacteria | 996 |
| 480 | Ga0207669_10406243 | 3300025937 | Bacteria | 1068 |
| 481 | Ga0207704_10009199 | 3300025938 | Bacteria | 4756 |
| 482 | Ga0207704_10057192 | 3300025938 | Bacteria | 2394 |
| 483 | Ga0207704_10088448 | 3300025938 | Bacteria | 2026 |
| 484 | Ga0207691_10032756 | 3300025940 | Bacteria | 4843 |
| 485 | Ga0207691_10238619 | 3300025940 | Bacteria | 1572 |
| 486 | Ga0207691_10388861 | 3300025940 | Bacteria | 1190 |
| 487 | Ga0207691_10480311 | 3300025940 | Bacteria | 1056 |
| 488 | Ga0207711_10000470 | 3300025941 | Bacteria | 41566 |
| 489 | Ga0207711_10007410 | 3300025941 | Bacteria | 9182 |
| 490 | Ga0207711_10135621 | 3300025941 | Bacteria | 2210 |
| 491 | Ga0207711_10162642 | 3300025941 | Bacteria | 2022 |
| 492 | Ga0207711_10187333 | 3300025941 | Bacteria | 1884 |
| 493 | Ga0207711_10261887 | 3300025941 | Bacteria | 1589 |
| 494 | Ga0207689_10031609 | 3300025942 | Bacteria | 4405 |
| 495 | Ga0207689_10054480 | 3300025942 | Bacteria | 3293 |
| 496 | Ga0207689_10086585 | 3300025942 | Bacteria | 2575 |
| 497 | Ga0207689_10100713 | 3300025942 | Bacteria | 2373 |
| 498 | Ga0207689_10128956 | 3300025942 | Bacteria | 2081 |
| 499 | Ga0207689_10378563 | 3300025942 | Bacteria | 1178 |
| 500 | Ga0207661_10229204 | 3300025944 | Bacteria | 1644 |
| 501 | Ga0207679_10180849 | 3300025945 | Bacteria | 1744 |
| 502 | Ga0207679_10183613 | 3300025945 | Bacteria | 1732 |
| 503 | Ga0207679_10215560 | 3300025945 | Bacteria | 1612 |
| 504 | Ga0207667_10002731 | 3300025949 | Bacteria | 21813 |
| 505 | Ga0207667_10027065 | 3300025949 | Bacteria | 6252 |
| 506 | Ga0207667_10120945 | 3300025949 | Bacteria | 2698 |
| 507 | Ga0207667_10136837 | 3300025949 | Bacteria | 2522 |
| 508 | Ga0207667_10295027 | 3300025949 | Bacteria | 1656 |
| 509 | Ga0207667_10689581 | 3300025949 | Bacteria | 1024 |
| 510 | Ga0207667_11111797 | 3300025949 | Bacteria | 773 |
| 511 | Ga0207651_10129993 | 3300025960 | Bacteria | 1926 |
| 512 | Ga0207712_10000165 | 3300025961 | Bacteria | 68118 |
| 513 | Ga0207712_10000771 | 3300025961 | Bacteria | 23954 |
| 514 | Ga0207712_10057473 | 3300025961 | Bacteria | 2745 |
| 515 | Ga0207712_10469630 | 3300025961 | Bacteria | 1070 |
| 516 | Ga0207668_10027253 | 3300025972 | Bacteria | 3721 |
| 517 | Ga0207640_10108250 | 3300025981 | Bacteria | 1964 |
| 518 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 519 | Ga0207658_10016117 | 3300025986 | Bacteria | 5134 |
| 520 | Ga0207658_10043114 | 3300025986 | Bacteria | 3278 |
| 521 | Ga0207658_10048019 | 3300025986 | Bacteria | 3128 |
| 522 | Ga0207658_10129629 | 3300025986 | Bacteria | 2024 |
| 523 | Ga0207658_10485345 | 3300025986 | Bacteria | 1098 |
| 524 | Ga0207677_10060979 | 3300026023 | Bacteria | 2610 |
| 525 | Ga0207677_10201183 | 3300026023 | Bacteria | 1583 |
| 526 | Ga0207677_10218081 | 3300026023 | Bacteria | 1528 |
| 527 | Ga0207677_10415334 | 3300026023 | Bacteria | 1145 |
| 528 | Ga0207677_10415658 | 3300026023 | Bacteria | 1144 |
| 529 | Ga0207703_10000553 | 3300026035 | Bacteria | 38426 |
| 530 | Ga0207703_10028956 | 3300026035 | Bacteria | 4370 |
| 531 | Ga0207703_10134529 | 3300026035 | Bacteria | 2139 |
| 532 | Ga0207639_10000217 | 3300026041 | Bacteria | 42907 |
| 533 | Ga0207639_10000643 | 3300026041 | Bacteria | 24069 |
| 534 | Ga0207639_10004497 | 3300026041 | Bacteria | 9405 |
| 535 | Ga0207639_10023741 | 3300026041 | Bacteria | 4430 |
| 536 | Ga0207639_10070097 | 3300026041 | Bacteria | 2737 |
| 537 | Ga0207639_10088687 | 3300026041 | Bacteria | 2469 |
| 538 | Ga0207639_10124736 | 3300026041 | Bacteria | 2122 |
| 539 | Ga0207639_10143638 | 3300026041 | Bacteria | 1991 |
| 540 | Ga0207639_10187967 | 3300026041 | Bacteria | 1762 |
| 541 | Ga0207639_10189556 | 3300026041 | Bacteria | 1755 |
| 542 | Ga0207639_10273645 | 3300026041 | Bacteria | 1482 |
| 543 | Ga0207639_10294512 | 3300026041 | Bacteria | 1432 |
| 544 | Ga0207639_10391885 | 3300026041 | Bacteria | 1249 |
| 545 | Ga0207639_10502556 | 3300026041 | Bacteria | 1108 |
| 546 | Ga0207678_10001340 | 3300026067 | Bacteria | 22694 |
| 547 | Ga0207678_10005262 | 3300026067 | Bacteria | 11593 |
| 548 | Ga0207678_10060058 | 3300026067 | Bacteria | 3271 |
| 549 | Ga0207678_10073285 | 3300026067 | Bacteria | 2935 |
| 550 | Ga0207678_10179595 | 3300026067 | Bacteria | 1807 |
| 551 | Ga0207678_10201565 | 3300026067 | Bacteria | 1702 |
| 552 | Ga0207678_10226119 | 3300026067 | Bacteria | 1602 |
| 553 | Ga0207678_10259792 | 3300026067 | Bacteria | 1488 |
| 554 | Ga0207678_10401985 | 3300026067 | Bacteria | 1186 |
| 555 | Ga0207678_10806208 | 3300026067 | Bacteria | 829 |
| 556 | Ga0207708_10015570 | 3300026075 | Bacteria | 5702 |
| 557 | Ga0207702_10002671 | 3300026078 | Bacteria | 16744 |
| 558 | Ga0207702_10060529 | 3300026078 | Bacteria | 3228 |
| 559 | Ga0207702_10128052 | 3300026078 | Bacteria | 2282 |
| 560 | Ga0207702_10306825 | 3300026078 | Bacteria | 1508 |
| 561 | Ga0207702_10911004 | 3300026078 | Bacteria | 871 |
| 562 | Ga0207641_10015458 | 3300026088 | Bacteria | 6253 |
| 563 | Ga0207641_10016935 | 3300026088 | Bacteria | 5967 |
| 564 | Ga0207641_10201191 | 3300026088 | Bacteria | 1836 |
| 565 | Ga0207641_10291447 | 3300026088 | Bacteria | 1538 |
| 566 | Ga0207641_10401933 | 3300026088 | Bacteria | 1315 |
| 567 | Ga0207641_10615933 | 3300026088 | Bacteria | 1064 |
| 568 | Ga0207641_10905676 | 3300026088 | Bacteria | 876 |
| 569 | Ga0207648_10048941 | 3300026089 | Bacteria | 3700 |
| 570 | Ga0207648_10122708 | 3300026089 | Bacteria | 2285 |
| 571 | Ga0207676_10031766 | 3300026095 | Bacteria | 3972 |
| 572 | Ga0207676_10051657 | 3300026095 | Bacteria | 3210 |
| 573 | Ga0207676_10120531 | 3300026095 | Bacteria | 2211 |
| 574 | Ga0207674_10003941 | 3300026116 | Bacteria | 18068 |
| 575 | Ga0207674_10009055 | 3300026116 | Bacteria | 11433 |
| 576 | Ga0207674_10127511 | 3300026116 | Bacteria | 2509 |
| 577 | Ga0207674_10189246 | 3300026116 | Bacteria | 2008 |
| 578 | Ga0207675_100008268 | 3300026118 | Bacteria | 9801 |
| 579 | Ga0207675_100050463 | 3300026118 | Bacteria | 3882 |
| 580 | Ga0207675_100327665 | 3300026118 | Bacteria | 1496 |
| 581 | Ga0207675_100545995 | 3300026118 | Bacteria | 1158 |
| 582 | Ga0207683_10045586 | 3300026121 | Bacteria | 3834 |
| 583 | Ga0207683_10191731 | 3300026121 | Bacteria | 1856 |
| 584 | Ga0207683_10568027 | 3300026121 | Bacteria | 1049 |
| 585 | Ga0207698_10004066 | 3300026142 | Bacteria | 8879 |
| 586 | Ga0207698_10043839 | 3300026142 | Bacteria | 3356 |
| 587 | Ga0207698_10138025 | 3300026142 | Bacteria | 2095 |
| 588 | Ga0207698_10182890 | 3300026142 | Bacteria | 1859 |
| 589 | Ga0207698_10210449 | 3300026142 | Bacteria | 1749 |
| 590 | Ga0207698_10223943 | 3300026142 | Bacteria | 1702 |
| 591 | Ga0207698_10400302 | 3300026142 | Bacteria | 1312 |
| 592 | Ga0207698_10507817 | 3300026142 | Bacteria | 1174 |
| 593 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 594 | Ga0209179_1000062 | 3300027512 | Bacteria | 19549 |
| 595 | Ga0209966_1029318 | 3300027695 | Bacteria | 1108 |
| 596 | Ga0207428_10015745 | 3300027907 | Bacteria | 6530 |
| 597 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 598 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 599 | Ga0268266_10004292 | 3300028379 | Bacteria | 13723 |
| 600 | Ga0268266_10019047 | 3300028379 | Bacteria | 5846 |
| 601 | Ga0268266_10043867 | 3300028379 | Bacteria | 3822 |
| 602 | Ga0268266_10068858 | 3300028379 | Bacteria | 3065 |
| 603 | Ga0268266_10099202 | 3300028379 | Bacteria | 2564 |
| 604 | Ga0268266_10135762 | 3300028379 | Bacteria | 2203 |
| 605 | Ga0268266_10262737 | 3300028379 | Bacteria | 1600 |
| 606 | Ga0268266_10284648 | 3300028379 | Bacteria | 1538 |
| 607 | Ga0268266_10362936 | 3300028379 | Bacteria | 1363 |
| 608 | Ga0268265_10000608 | 3300028380 | Bacteria | 35821 |
| 609 | Ga0268264_10001065 | 3300028381 | Bacteria | 27234 |
| 610 | Ga0268264_10026185 | 3300028381 | Bacteria | 4763 |
| 611 | Ga0268264_10072417 | 3300028381 | Bacteria | 2922 |
| 612 | Ga0268264_10100170 | 3300028381 | Bacteria | 2516 |
| 613 | Ga0268264_10370134 | 3300028381 | Bacteria | 1369 |
| 614 | Ga0268264_10540004 | 3300028381 | Bacteria | 1142 |
| 615 | Ga0268264_10603014 | 3300028381 | Bacteria | 1082 |
| 616 | Ga0307515_10144069 | 3300028794 | Bacteria | 2536 |
| 617 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 618 | Ga0265327_10001299 | 3300031251 | Bacteria | 32719 |
| 619 | Ga0307508_10290933 | 3300031616 | Bacteria | 1227 |
| 620 | Ga0316575_10188527 | 3300031665 | Bacteria | 857 |
| 621 | Ga0316579_10006748 | 3300031691 | Bacteria | 4700 |
| 622 | Ga0316579_10074782 | 3300031691 | Bacteria | 1609 |
| 623 | Ga0316579_10148270 | 3300031691 | Bacteria | 1131 |
| 624 | Ga0316576_10014556 | 3300031727 | Bacteria | 5256 |
| 625 | Ga0316576_10111114 | 3300031727 | Bacteria | 2054 |
| 626 | Ga0316578_10020751 | 3300031728 | Bacteria | 3636 |
| 627 | Ga0316578_10048071 | 3300031728 | Bacteria | 2490 |
| 628 | Ga0316578_10107553 | 3300031728 | Bacteria | 1674 |
| 629 | Ga0316578_10108756 | 3300031728 | Bacteria | 1665 |
| 630 | Ga0316578_10123309 | 3300031728 | Bacteria | 1558 |
| 631 | Ga0316578_10167457 | 3300031728 | Bacteria | 1324 |
| 632 | Ga0307516_10035322 | 3300031730 | Bacteria | 5016 |
| 633 | Ga0307516_10038403 | 3300031730 | Bacteria | 4779 |
| 634 | Ga0316577_10020308 | 3300031733 | Bacteria | 3683 |
| 635 | Ga0316577_10108346 | 3300031733 | Bacteria | 1558 |
| 636 | Ga0316577_10149675 | 3300031733 | Bacteria | 1315 |
| 637 | Ga0307413_10089612 | 3300031824 | Bacteria | 1999 |
| 638 | Ga0307412_10289834 | 3300031911 | Bacteria | 1289 |
| 639 | Ga0307414_10002380 | 3300032004 | Bacteria | 9831 |
| 640 | Ga0307414_10260042 | 3300032004 | Bacteria | 1448 |
| 641 | Ga0316583_10003904 | 3300032133 | Bacteria | 5302 |
| 642 | Ga0316583_10038033 | 3300032133 | Bacteria | 1706 |
| 643 | Ga0316585_10002747 | 3300032137 | Bacteria | 4778 |
| 644 | Ga0316593_10016512 | 3300032168 | Bacteria | 2239 |
| 645 | Ga0316593_10030131 | 3300032168 | Bacteria | 1759 |
| 646 | Ga0316586_1014900 | 3300033527 | Bacteria | 1233 |
| 647 | Ga0373953_0063289 | 3300035117 | Bacteria | 1516 |
| 648 | Ga0373955_0028400 | 3300035172 | Bacteria | 2899 |
| 649 | Ga0316574_0003830 | 3300035398 | Bacteria | 7810 |
| 650 | Ga0316574_0004019 | 3300035398 | Bacteria | 7666 |
| 651 | Ga0316574_0005371 | 3300035398 | Bacteria | 6829 |
| 652 | Ga0316574_0005837 | 3300035398 | Bacteria | 6606 |
| 653 | Ga0316574_0006179 | 3300035398 | Bacteria | 6451 |
| 654 | Ga0316574_0040972 | 3300035398 | Bacteria | 2853 |
| 655 | Ga0316574_0057540 | 3300035398 | Bacteria | 2434 |
| 656 | Ga0316574_0060045 | 3300035398 | Bacteria | 2385 |
| 657 | Ga0316574_0066076 | 3300035398 | Bacteria | 2278 |
| 658 | Ga0316574_0384521 | 3300035398 | Bacteria | 885 |
| 659 | Ga0373924_0018094 | 3300035410 | Bacteria | 2713 |
| 660 | Ga0373935_0105935 | 3300035692 | Bacteria | 1860 |
| 661 | Ga0373933_0271513 | 3300035724 | Unclassified | 1094 |
| 662 | Ga0373937_0020829 | 3300036401 | Bacteria | 5882 |
| 663 | Ga0373937_0036733 | 3300036401 | Bacteria | 4464 |
| 664 | Ga0373937_0102030 | 3300036401 | Bacteria | 2663 |
| 665 | Ga0316582_0003307 | 3300036647 | Bacteria | 7867 |
| 666 | Ga0316582_0003479 | 3300036647 | Bacteria | 7733 |
| 667 | Ga0316582_0021067 | 3300036647 | Bacteria | 3843 |
| 668 | Ga0316582_0062775 | 3300036647 | Bacteria | 2386 |
| 669 | Ga0316584_0001131 | 3300036712 | Bacteria | 15666 |
| 670 | Ga0316584_0002666 | 3300036712 | Bacteria | 11391 |
| 671 | Ga0316584_0034789 | 3300036712 | Bacteria | 3735 |
| 672 | Ga0316584_0042038 | 3300036712 | Bacteria | 3408 |
| 673 | Ga0316584_0071174 | 3300036712 | Bacteria | 2606 |
| 674 | Ga0316584_0104210 | 3300036712 | Bacteria | 2123 |
| 675 | Ga0316584_0133854 | 3300036712 | Bacteria | 1851 |
| 676 | Ga0316584_0141162 | 3300036712 | Bacteria | 1796 |
| 677 | Ga0316584_0358700 | 3300036712 | Bacteria | 1045 |
| 678 | Ga0316584_0548402 | 3300036712 | Bacteria | 807 |
| 679 | Ga0373925_0231289 | 3300037068 | Bacteria | 1478 |
| 680 | Ga0395900_0000590 | 3300037418 | Bacteria | 49754 |
| 681 | Ga0395900_0005906 | 3300037418 | Bacteria | 12783 |
| 682 | Ga0395898_0313103 | 3300037466 | Bacteria | 1498 |
| 683 | Ga0316581_0000030 | 3300037588 | Bacteria | 15125 |
| 684 | Ga0316581_0039133 | 3300037588 | Bacteria | 1443 |
| 685 | Ga0316581_0060041 | 3300037588 | Bacteria | 1166 |
| 686 | Ga0395901_0625910 | 3300038443 | Bacteria | 1082 |
| 687 | Ga0436365_0481947 | 3300039437 | Bacteria | 2291 |
| 688 | Ga0436363_1278302 | 3300039450 | Bacteria | 1054 |
| 689 | Ga0451787_375813 | 3300041441 | Bacteria | 1073 |
| 690 | Ga0451787_424847 | 3300041441 | Bacteria | 1000 |
| 691 | Ga0451789_0324187 | 3300041443 | Bacteria | 1815 |
| 692 | Ga0451789_1305691 | 3300041443 | Bacteria | 1051 |
| 693 | Ga0451791_0734992 | 3300041451 | Bacteria | 4680 |
| 694 | Ga0451791_0977198 | 3300041451 | Bacteria | 1096 |
| 695 | Ga0451791_1698871 | 3300041451 | Bacteria | 1349 |
| 696 | Ga0451793_0203707 | 3300041452 | Bacteria | 1446 |
| 697 | Ga0451793_0331580 | 3300041452 | Bacteria | 1634 |
| 698 | Ga0451793_1036736 | 3300041452 | Bacteria | 4071 |
| 699 | Ga0451793_1074463 | 3300041452 | Bacteria | 1541 |
| 700 | Ga0451793_1912156 | 3300041452 | Bacteria | 1632 |
| 701 | Ga0451797_0696143 | 3300041453 | Bacteria | 1630 |
| 702 | Ga0451797_0907429 | 3300041453 | Bacteria | 1770 |
| 703 | Ga0451795_0402747 | 3300041456 | Bacteria | 1827 |
| 704 | Ga0451795_0613894 | 3300041456 | Bacteria | 2313 |
| 705 | Ga0451795_1282306 | 3300041456 | Bacteria | 1780 |
| 706 | Ga0451798_0587288 | 3300041458 | Bacteria | 1089 |
| 707 | Ga0451800_0416075 | 3300041459 | Bacteria | 5098 |
| 708 | Ga0451800_1239448 | 3300041459 | Bacteria | 920 |
| 709 | Ga0451802_0653047 | 3300041460 | Bacteria | 929 |
| 710 | Ga0451802_0842713 | 3300041460 | Bacteria | 722 |
| 711 | Ga0451802_1409802 | 3300041460 | Bacteria | 1486 |
| 712 | Ga0451802_1663798 | 3300041460 | Bacteria | 1535 |
| 713 | Ga0451806_051010 | 3300041462 | Bacteria | 2759 |
| 714 | Ga0451804_0778980 | 3300041463 | Bacteria | 2428 |
| 715 | Ga0451807_0052036 | 3300041486 | Bacteria | 2212 |
| 716 | Ga0451807_1276735 | 3300041486 | Bacteria | 1528 |
| 717 | Ga0451807_1727819 | 3300041486 | Bacteria | 2982 |
| 718 | Ga0451807_2045398 | 3300041486 | Bacteria | 5221 |
| 719 | Ga0451837_0211328 | 3300041494 | Bacteria | 1916 |
| 720 | Ga0451837_1594622 | 3300041494 | Bacteria | 1117 |
| 721 | Ga0451839_1349525 | 3300041496 | Bacteria | 976 |
| 722 | Ga0451841_0486514 | 3300041498 | Bacteria | 1046 |
| 723 | Ga0451847_0708482 | 3300041503 | Bacteria | 1408 |
| 724 | Ga0451843_0541203 | 3300041509 | Bacteria | 2219 |
| 725 | Ga0451843_0832695 | 3300041509 | Bacteria | 1786 |
| 726 | Ga0451843_1620786 | 3300041509 | Bacteria | 1529 |
| 727 | Ga0451853_0536472 | 3300041512 | Bacteria | 990 |
| 728 | Ga0451853_0542427 | 3300041512 | Bacteria | 1523 |
| 729 | Ga0439433_0018730 | 3300041999 | Bacteria | 1542 |
| 730 | Ga0439437_001897 | 3300042000 | Bacteria | 2221 |
| 731 | Ga0439448_0071872 | 3300042005 | Bacteria | 1153 |
| 732 | Ga0439449_0063355 | 3300042007 | Bacteria | 1364 |
| 733 | Ga0450908_000100 | 3300042184 | Bacteria | 17277 |
| 734 | Ga0439434_0134681 | 3300042435 | Bacteria | 812 |
| 735 | Ga0451577_0000543 | 3300042876 | Bacteria | 61740 |
| 736 | Ga0451577_0256247 | 3300042876 | Bacteria | 1584 |
| 737 | Ga0466969_0155589 | 3300044656 | Bacteria | 1052 |
| 738 | Ga0466972_0004200 | 3300044658 | Bacteria | 7196 |
| 739 | Ga0466965_0018370 | 3300044683 | Bacteria | 3351 |
| 740 | Ga0466966_0000529 | 3300044684 | Bacteria | 24396 |
| 741 | Ga0466961_0000944 | 3300044693 | Bacteria | 18003 |
| 742 | Ga0466963_0049646 | 3300044694 | Bacteria | 2776 |
| 743 | Ga0466963_0181154 | 3300044694 | Bacteria | 1471 |
| 744 | Ga0453684_0000533 | 3300044712 | Bacteria | 144782 |
| 745 | Ga0466971_0003453 | 3300044719 | Bacteria | 6749 |
| 746 | Ga0466957_0109288 | 3300044842 | Bacteria | 1752 |
| 747 | Ga0466959_0004692 | 3300045049 | Bacteria | 9203 |
| 748 | Ga0466959_0070150 | 3300045049 | Bacteria | 2539 |
| 749 | Ga0466959_0125006 | 3300045049 | Bacteria | 1826 |
| 750 | Ga0451576_0027440 | 3300045051 | Bacteria | 6114 |
| 751 | Ga0451576_0042101 | 3300045051 | Bacteria | 4823 |
| 752 | Ga0451576_0102593 | 3300045051 | Bacteria | 2976 |
| 753 | Ga0451576_0329324 | 3300045051 | Bacteria | 1599 |
| 754 | Ga0466958_0024993 | 3300045836 | Bacteria | 3517 |
| 755 | Ga0466967_0215672 | 3300045976 | Bacteria | 1822 |
| 756 | Ga0495617_007162 | 3300046452 | Bacteria | 3885 |
| 757 | Ga0495617_009741 | 3300046452 | Bacteria | 3296 |
| 758 | Ga0495629_0360024 | 3300046459 | Bacteria | 992 |
| 759 | Ga0495638_0000146 | 3300046460 | Bacteria | 111558 |
| 760 | Ga0495638_0083807 | 3300046460 | Bacteria | 1930 |
| 761 | Ga0495638_0135010 | 3300046460 | Bacteria | 1446 |
| 762 | Ga0495650_0005392 | 3300046471 | Bacteria | 8320 |
| 763 | Ga0495650_0070421 | 3300046471 | Bacteria | 1373 |
| 764 | Ga0495580_0145739 | 3300046472 | Bacteria | 1641 |
| 765 | Ga0495582_0015290 | 3300046473 | Bacteria | 4218 |
| 766 | Ga0495605_0053908 | 3300046474 | Bacteria | 1949 |
| 767 | Ga0495584_0000823 | 3300046491 | Bacteria | 20364 |
| 768 | Ga0495584_0188245 | 3300046491 | Bacteria | 1049 |
| 769 | Ga0495585_0005197 | 3300046492 | Bacteria | 8253 |
| 770 | Ga0495585_0306575 | 3300046492 | Bacteria | 779 |
| 771 | Ga0495594_0361525 | 3300046499 | Bacteria | 826 |
| 772 | Ga0495607_0000122 | 3300046501 | Bacteria | 81489 |
| 773 | Ga0495607_0000837 | 3300046501 | Bacteria | 29060 |
| 774 | Ga0495583_0073334 | 3300046506 | Bacteria | 1500 |
| 775 | Ga0495606_0032598 | 3300046507 | Bacteria | 3606 |
| 776 | Ga0495606_0036205 | 3300046507 | Bacteria | 3364 |
| 777 | Ga0495606_0037699 | 3300046507 | Bacteria | 3279 |
| 778 | Ga0495610_0027392 | 3300046512 | Bacteria | 3029 |
| 779 | Ga0495616_0000565 | 3300046513 | Bacteria | 28011 |
| 780 | Ga0495620_0003610 | 3300046515 | Bacteria | 8838 |
| 781 | Ga0495620_0034989 | 3300046515 | Bacteria | 2264 |
| 782 | Ga0495631_0000808 | 3300046518 | Bacteria | 19998 |
| 783 | Ga0495632_0009510 | 3300046519 | Bacteria | 5854 |
| 784 | Ga0495648_0002534 | 3300046524 | Bacteria | 16751 |
| 785 | Ga0495648_0084069 | 3300046524 | Bacteria | 1802 |
| 786 | Ga0495663_0007180 | 3300046525 | Bacteria | 3074 |
| 787 | Ga0495586_0148323 | 3300046535 | Bacteria | 1319 |
| 788 | Ga0495609_0003075 | 3300046538 | Bacteria | 9784 |
| 789 | Ga0495622_0111740 | 3300046557 | Bacteria | 1251 |
| 790 | Ga0495668_0003466 | 3300046616 | Bacteria | 11779 |
| 791 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 792 | Ga0495611_0000952 | 3300046648 | Bacteria | 15498 |
| 793 | Ga0495625_0000022 | 3300046660 | Bacteria | 278823 |
| 794 | Ga0495625_0086013 | 3300046660 | Bacteria | 2181 |
| 795 | Ga0495625_0387271 | 3300046660 | Bacteria | 876 |
| 796 | Ga0495635_0065355 | 3300046663 | Bacteria | 2496 |
| 797 | Ga0495659_0131686 | 3300046664 | Bacteria | 992 |
| 798 | Ga0495661_0006772 | 3300046665 | Bacteria | 8034 |
| 799 | Ga0495599_0438045 | 3300046678 | Bacteria | 775 |
| 800 | Ga0495647_0133369 | 3300046681 | Bacteria | 1054 |
| 801 | Ga0495658_0014949 | 3300046683 | Bacteria | 3976 |
| 802 | Ga0495670_0012505 | 3300046691 | Bacteria | 4176 |
| 803 | Ga0495670_0280257 | 3300046691 | Bacteria | 891 |
| 804 | Ga0495671_0002998 | 3300046692 | Bacteria | 10490 |
| 805 | Ga0495671_0016012 | 3300046692 | Bacteria | 4011 |
| 806 | Ga0495589_0000137 | 3300046794 | Bacteria | 67614 |
| 807 | Ga0495660_0003625 | 3300046810 | Bacteria | 9505 |
| 808 | Ga0495660_0028700 | 3300046810 | Bacteria | 3140 |
| 809 | Ga0495604_0229304 | 3300047317 | Bacteria | 1275 |
| 810 | Ga0495683_0001586 | 3300047323 | Bacteria | 14650 |
| 811 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 812 | Ga0495673_0000202 | 3300047469 | Bacteria | 90523 |
| 813 | Ga0495673_0020879 | 3300047469 | Bacteria | 3249 |
| 814 | Ga0495673_0021499 | 3300047469 | Bacteria | 3183 |
| 815 | Ga0495686_0008876 | 3300047472 | Bacteria | 7313 |
| 816 | Ga0495686_0031480 | 3300047472 | Bacteria | 3439 |
| 817 | Ga0495686_0224267 | 3300047472 | Bacteria | 1067 |
| 818 | Ga0495686_0356009 | 3300047472 | Bacteria | 794 |
| 819 | Ga0495686_0356015 | 3300047472 | Bacteria | 794 |
| 820 | Ga0496100_0089591 | 3300048903 | Bacteria | 2096 |
| 821 | Ga0496100_0283629 | 3300048903 | Bacteria | 1235 |
| 822 | Ga0496101_0002136 | 3300048904 | Bacteria | 12065 |
| 823 | Ga0496101_0152250 | 3300048904 | Bacteria | 1770 |
| 824 | Ga0496101_0261736 | 3300048904 | Bacteria | 1349 |
| 825 | Ga0496102_0263654 | 3300048905 | Bacteria | 1624 |
| 826 | Ga0496104_0000022 | 3300048907 | Bacteria | 237390 |
| 827 | Ga0496104_0062004 | 3300048907 | Bacteria | 3545 |
| 828 | Ga0496105_0000012 | 3300048908 | Bacteria | 261713 |
| 829 | Ga0496106_0001864 | 3300048909 | Bacteria | 15779 |
| 830 | Ga0496107_0211521 | 3300048910 | Bacteria | 1442 |
| 831 | Ga0496108_0021655 | 3300048911 | Bacteria | 5284 |
| 832 | Ga0496109_0042225 | 3300048912 | Bacteria | 4130 |
| 833 | Ga0496110_0301681 | 3300048913 | Bacteria | 1459 |
| 834 | Ga0496112_0015148 | 3300048915 | Bacteria | 7185 |
| 835 | Ga0496113_0079264 | 3300048916 | Bacteria | 2514 |
| 836 | Ga0496113_0265200 | 3300048916 | Bacteria | 1372 |
| 837 | Ga0496115_0249327 | 3300048918 | Bacteria | 1462 |
| 838 | Ga0496115_0505030 | 3300048918 | Bacteria | 971 |
| 839 | Ga0496117_0000446 | 3300048920 | Bacteria | 68559 |
| 840 | Ga0496117_0008490 | 3300048920 | Bacteria | 9748 |
| 841 | Ga0496117_0036780 | 3300048920 | Bacteria | 3658 |
| 842 | Ga0496117_0044342 | 3300048920 | Bacteria | 3223 |
| 843 | Ga0496117_0070480 | 3300048920 | Bacteria | 2348 |
| 844 | Ga0496118_0000177 | 3300048921 | Bacteria | 114183 |
| 845 | Ga0496118_0004944 | 3300048921 | Bacteria | 15450 |
| 846 | Ga0496118_0043362 | 3300048921 | Bacteria | 3537 |
| 847 | Ga0496118_0076525 | 3300048921 | Bacteria | 2379 |
| 848 | Ga0496118_0099723 | 3300048921 | Bacteria | 1967 |
| 849 | Ga0496119_0017246 | 3300048922 | Bacteria | 5441 |
| 850 | Ga0496120_0000102 | 3300048923 | Bacteria | 142902 |
| 851 | Ga0496121_0055034 | 3300048924 | Bacteria | 3319 |
| 852 | Ga0496121_0063603 | 3300048924 | Bacteria | 3013 |
| 853 | Ga0496121_0065807 | 3300048924 | Bacteria | 2946 |
| 854 | Ga0496122_0000158 | 3300048925 | Bacteria | 159352 |
| 855 | Ga0496122_0000487 | 3300048925 | Bacteria | 82253 |
| 856 | Ga0496122_0006129 | 3300048925 | Bacteria | 13994 |
| 857 | Ga0496122_0025404 | 3300048925 | Bacteria | 5144 |
| 858 | Ga0496122_0088252 | 3300048925 | Bacteria | 2126 |
| 859 | Ga0496123_0000120 | 3300048926 | Bacteria | 159406 |
| 860 | Ga0496123_0000151 | 3300048926 | Bacteria | 141062 |
| 861 | Ga0496123_0000296 | 3300048926 | Bacteria | 97428 |
| 862 | Ga0496123_0032847 | 3300048926 | Bacteria | 3747 |
| 863 | Ga0496123_0074909 | 3300048926 | Bacteria | 2092 |
| 864 | Ga0496124_0001894 | 3300048927 | Bacteria | 28749 |
| 865 | Ga0496124_0097064 | 3300048927 | Bacteria | 2393 |
| 866 | Ga0496125_0136041 | 3300048928 | Bacteria | 1719 |
| 867 | Ga0496126_0037693 | 3300048929 | Bacteria | 4508 |
| 868 | Ga0496126_0144798 | 3300048929 | Bacteria | 2042 |
| 869 | Ga0496126_0295312 | 3300048929 | Bacteria | 1339 |
| 870 | Ga0496126_0296237 | 3300048929 | Bacteria | 1336 |
| 871 | Ga0495678_000099 | 3300049459 | Bacteria | 106223 |
| 872 | Ga0495682_0008463 | 3300049460 | Bacteria | 4051 |
| 873 | Ga0495682_0010599 | 3300049460 | Bacteria | 3563 |
| 874 | Ga0501031_0033304 | 3300049568 | Bacteria | 3360 |
| 875 | Ga0501032_0013770 | 3300049569 | Bacteria | 5739 |
| 876 | Ga0501032_0043293 | 3300049569 | Bacteria | 3050 |
| 877 | Ga0501033_0000324 | 3300049570 | Bacteria | 45439 |
| 878 | Ga0501033_0015186 | 3300049570 | Bacteria | 5844 |
| 879 | Ga0501033_0019531 | 3300049570 | Bacteria | 5123 |
| 880 | Ga0501033_0105324 | 3300049570 | Bacteria | 2056 |
| 881 | Ga0501034_0002776 | 3300049571 | Bacteria | 20531 |
| 882 | Ga0501034_0005361 | 3300049571 | Bacteria | 14039 |
| 883 | Ga0501034_0021375 | 3300049571 | Bacteria | 6597 |
| 884 | Ga0501034_0048739 | 3300049571 | Bacteria | 4275 |
| 885 | Ga0501034_0242138 | 3300049571 | Bacteria | 1750 |
| 886 | Ga0501034_0384902 | 3300049571 | Bacteria | 1327 |
| 887 | Ga0501036_0004120 | 3300049572 | Bacteria | 11698 |
| 888 | Ga0501036_0060031 | 3300049572 | Bacteria | 3221 |
| 889 | Ga0501036_0067456 | 3300049572 | Bacteria | 3027 |
| 890 | Ga0501036_0132295 | 3300049572 | Bacteria | 2105 |
| 891 | Ga0501036_0152823 | 3300049572 | Bacteria | 1947 |
| 892 | Ga0501036_0191382 | 3300049572 | Bacteria | 1721 |
| 893 | Ga0501036_0348525 | 3300049572 | Bacteria | 1236 |
| 894 | Ga0501037_0000499 | 3300049573 | Bacteria | 31684 |
| 895 | Ga0501037_0007006 | 3300049573 | Bacteria | 8231 |
| 896 | Ga0501037_0009963 | 3300049573 | Bacteria | 6969 |
| 897 | Ga0501037_0076353 | 3300049573 | Bacteria | 2432 |
| 898 | Ga0501037_0255125 | 3300049573 | Bacteria | 1226 |
| 899 | Ga0501038_0003249 | 3300049574 | Bacteria | 15157 |
| 900 | Ga0501038_0003315 | 3300049574 | Bacteria | 15016 |
| 901 | Ga0501038_0187986 | 3300049574 | Bacteria | 1663 |
| 902 | Ga0501038_0291379 | 3300049574 | Bacteria | 1283 |
| 903 | Ga0501039_0018424 | 3300049575 | Bacteria | 5358 |
| 904 | Ga0501039_0033038 | 3300049575 | Bacteria | 3991 |
| 905 | Ga0501039_0143181 | 3300049575 | Bacteria | 1878 |
| 906 | Ga0501039_0248540 | 3300049575 | Bacteria | 1399 |
| 907 | Ga0501040_0145074 | 3300049576 | Bacteria | 1673 |
| 908 | Ga0501041_0113511 | 3300049577 | Bacteria | 1682 |
| 909 | Ga0501042_0158072 | 3300049578 | Bacteria | 1635 |
| 910 | Ga0501042_0543193 | 3300049578 | Bacteria | 844 |
| 911 | Ga0501043_0007141 | 3300049579 | Bacteria | 8886 |
| 912 | Ga0501043_0045881 | 3300049579 | Bacteria | 3436 |
| 913 | Ga0501043_0215980 | 3300049579 | Bacteria | 1485 |
| 914 | Ga0501046_0003027 | 3300049580 | Bacteria | 15530 |
| 915 | Ga0501046_0014037 | 3300049580 | Bacteria | 6765 |
| 916 | Ga0501046_0113853 | 3300049580 | Bacteria | 2064 |
| 917 | Ga0501046_0184279 | 3300049580 | Bacteria | 1559 |
| 918 | Ga0501046_0442008 | 3300049580 | Bacteria | 936 |
| 919 | Ga0501047_0001523 | 3300049581 | Bacteria | 22634 |
| 920 | Ga0501047_0019332 | 3300049581 | Bacteria | 6535 |
| 921 | Ga0501047_0072956 | 3300049581 | Bacteria | 3304 |
| 922 | Ga0501047_0120904 | 3300049581 | Bacteria | 2501 |
| 923 | Ga0501047_0152962 | 3300049581 | Bacteria | 2182 |
| 924 | Ga0501047_0198195 | 3300049581 | Bacteria | 1869 |
| 925 | Ga0501047_0252344 | 3300049581 | Bacteria | 1612 |
| 926 | Ga0501048_0008263 | 3300049582 | Bacteria | 7874 |
| 927 | Ga0501048_0110392 | 3300049582 | Bacteria | 1942 |
| 928 | Ga0501067_0000619 | 3300049583 | Bacteria | 19144 |
| 929 | Ga0501067_0034617 | 3300049583 | Bacteria | 2803 |
| 930 | Ga0501068_0078802 | 3300049584 | Bacteria | 2019 |
| 931 | Ga0501069_0012755 | 3300049585 | Bacteria | 4473 |
| 932 | Ga0501069_0050775 | 3300049585 | Bacteria | 2306 |
| 933 | Ga0501069_0064299 | 3300049585 | Bacteria | 2050 |
| 934 | Ga0501069_0065715 | 3300049585 | Bacteria | 2028 |
| 935 | Ga0501069_0106378 | 3300049585 | Bacteria | 1595 |
| 936 | Ga0501070_0003167 | 3300049586 | Bacteria | 14312 |
| 937 | Ga0501070_0038613 | 3300049586 | Bacteria | 3984 |
| 938 | Ga0501070_0044700 | 3300049586 | Bacteria | 3683 |
| 939 | Ga0501070_0086050 | 3300049586 | Bacteria | 2602 |
| 940 | Ga0501070_0143052 | 3300049586 | Bacteria | 1974 |
| 941 | Ga0501070_0330286 | 3300049586 | Bacteria | 1239 |
| 942 | Ga0501070_0504069 | 3300049586 | Bacteria | 972 |
| 943 | Ga0501071_0008965 | 3300049587 | Bacteria | 6636 |
| 944 | Ga0501072_0030064 | 3300049588 | Bacteria | 4246 |
| 945 | Ga0501073_0001312 | 3300049589 | Bacteria | 18293 |
| 946 | Ga0501073_0002117 | 3300049589 | Bacteria | 14877 |
| 947 | Ga0501073_0006715 | 3300049589 | Bacteria | 8566 |
| 948 | Ga0501073_0139117 | 3300049589 | Bacteria | 1682 |
| 949 | Ga0501073_0294392 | 3300049589 | Bacteria | 1120 |
| 950 | Ga0501073_0309049 | 3300049589 | Bacteria | 1090 |
| 951 | Ga0501074_0019787 | 3300049590 | Bacteria | 4889 |
| 952 | Ga0501074_0037584 | 3300049590 | Bacteria | 3509 |
| 953 | Ga0501074_0065373 | 3300049590 | Bacteria | 2618 |
| 954 | Ga0501074_0160531 | 3300049590 | Bacteria | 1605 |
| 955 | Ga0501074_0181615 | 3300049590 | Bacteria | 1501 |
| 956 | Ga0501075_0301460 | 3300049591 | Bacteria | 1221 |
| 957 | Ga0501076_0799392 | 3300049592 | Bacteria | 778 |
| 958 | Ga0501077_0229963 | 3300049593 | Bacteria | 1179 |
| 959 | Ga0501257_027282 | 3300049686 | Bacteria | 1366 |
| 960 | Ga0501257_077332 | 3300049686 | Bacteria | 855 |
| 961 | Ga0501079_0034838 | 3300049741 | Bacteria | 3873 |
| 962 | Ga0501079_0051130 | 3300049741 | Bacteria | 3190 |
| 963 | Ga0501079_0165261 | 3300049741 | Bacteria | 1726 |
| 964 | Ga0501079_0533878 | 3300049741 | Bacteria | 922 |
| 965 | Ga0501080_0000739 | 3300049742 | Bacteria | 26414 |
| 966 | Ga0501080_0001727 | 3300049742 | Bacteria | 18680 |
| 967 | Ga0501080_0013993 | 3300049742 | Bacteria | 7384 |
| 968 | Ga0501080_0015445 | 3300049742 | Bacteria | 7039 |
| 969 | Ga0501080_0035297 | 3300049742 | Bacteria | 4667 |
| 970 | Ga0501080_0060091 | 3300049742 | Bacteria | 3537 |
| 971 | Ga0501080_0100031 | 3300049742 | Bacteria | 2690 |
| 972 | Ga0501080_0224665 | 3300049742 | Bacteria | 1717 |
| 973 | Ga0501080_0537872 | 3300049742 | Bacteria | 1041 |
| 974 | Ga0501080_1013980 | 3300049742 | Bacteria | 719 |
| 975 | Ga0501083_0007418 | 3300049744 | Bacteria | 7778 |
| 976 | Ga0501083_0040020 | 3300049744 | Bacteria | 3182 |
| 977 | Ga0501083_0143256 | 3300049744 | Bacteria | 1565 |
| 978 | Ga0501035_0017155 | 3300049822 | Bacteria | 6672 |
| 979 | Ga0501035_0037489 | 3300049822 | Bacteria | 4390 |
| 980 | Ga0501035_0078260 | 3300049822 | Bacteria | 2921 |
| 981 | Ga0501035_0189958 | 3300049822 | Bacteria | 1766 |
| 982 | Ga0501035_0326996 | 3300049822 | Bacteria | 1287 |
| 983 | Ga0501044_0006294 | 3300049823 | Bacteria | 13122 |
| 984 | Ga0501044_0015031 | 3300049823 | Bacteria | 8344 |
| 985 | Ga0501044_0024216 | 3300049823 | Bacteria | 6449 |
| 986 | Ga0501044_0088409 | 3300049823 | Bacteria | 3127 |
| 987 | Ga0501044_0092312 | 3300049823 | Bacteria | 3053 |
| 988 | Ga0501044_0176063 | 3300049823 | Bacteria | 2108 |
| 989 | Ga0501044_0622550 | 3300049823 | Bacteria | 971 |
| 990 | nmdc:mga0qj67_91052_c1 | 3300050509 | Bacteria | 2451 |
| 991 | nmdc:mga08y16_11439_c1 | 3300050511 | Bacteria | 9324 |
| 992 | nmdc:mga08y16_1174852_c1 | 3300050511 | Bacteria | 739 |
| 993 | nmdc:mga08y16_196714_c1 | 3300050511 | Bacteria | 2089 |
| 994 | nmdc:mga0a205_22852_c1 | 3300050515 | Bacteria | 5928 |
| 995 | Ga0495601_0027161 | 3300053077 | Bacteria | 3538 |
| 996 | Ga0500610_0003430 | 3300053079 | Bacteria | 6086 |
| 997 | Ga0500643_000118 | 3300053087 | Bacteria | 82138 |
| 998 | Ga0500643_005173 | 3300053087 | Bacteria | 5690 |
| 999 | Ga0500583_0061072 | 3300053092 | Bacteria | 1779 |
| 1000 | Ga0500651_0000301 | 3300053093 | Bacteria | 28575 |
| 1001 | Ga0500651_0020652 | 3300053093 | Bacteria | 4101 |
| 1002 | Ga0500651_0102806 | 3300053093 | Bacteria | 1750 |
| 1003 | Ga0500651_0117828 | 3300053093 | Bacteria | 1615 |
| 1004 | Ga0500555_000715 | 3300053103 | Bacteria | 12482 |
| 1005 | Ga0500597_000335 | 3300053120 | Bacteria | 9709 |
| 1006 | Ga0500614_037085 | 3300053123 | Bacteria | 1222 |
| 1007 | Ga0500658_0220297 | 3300053134 | Bacteria | 870 |
| 1008 | Ga0500568_0000952 | 3300053139 | Bacteria | 19915 |
| 1009 | Ga0500633_0003369 | 3300053160 | Bacteria | 3476 |
| 1010 | Ga0501084_0086233 | 3300054114 | Bacteria | 2636 |
| 1011 | Ga0501084_0131217 | 3300054114 | Bacteria | 2109 |
| 1012 | Ga0501084_0149041 | 3300054114 | Bacteria | 1971 |
| 1013 | Ga0500661_021664 | 3300055283 | Bacteria | 1140 |
| 1014 | Ga0501082_0012969 | 3300060353 | Bacteria | 7164 |
| 1015 | Ga0501082_0104835 | 3300060353 | Bacteria | 2446 |
| 1016 | Ga0501082_0208114 | 3300060353 | Bacteria | 1702 |
| 1017 | Ga0501082_0215244 | 3300060353 | Bacteria | 1671 |
| 1018 | Ga0501082_0301485 | 3300060353 | Bacteria | 1395 |
| 1019 | Ga0466962_0010495 | 3300061719 | Bacteria | 4454 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0040972 | Ga0316574_0040972_2294_2818 | 174 |
| 2 | 3300041441 | Ga0451787_375813 | Ga0451787_375813_511_1035 | 174 |
| 3 | 3300036712 | Ga0316584_0358700 | Ga0316584_0358700_221_844 | 185 |
| 4 | 3300031727 | Ga0316576_10014556 | Ga0316576_100145564 | 187 |
| 5 | 3300031728 | Ga0316578_10108756 | Ga0316578_101087563 | 187 |
| 6 | 3300036712 | Ga0316584_0133854 | Ga0316584_0133854_1234_1797 | 187 |
| 7 | 3300025913 | Ga0207695_10069938 | Ga0207695_100699382 | 188 |
| 8 | 3300009551 | Ga0105238_10092552 | Ga0105238_100925522 | 195 |
| 9 | 3300013296 | Ga0157374_10223638 | Ga0157374_102236382 | 195 |
| 10 | 3300031251 | Ga0265327_10001299 | Ga0265327_1000129913 | 196 |
| 11 | 3300031691 | Ga0316579_10074782 | Ga0316579_100747823 | 196 |
| 12 | 3300032168 | Ga0316593_10016512 | Ga0316593_100165123 | 196 |
| 13 | 3300048904 | Ga0496101_0152250 | Ga0496101_0152250_219_812 | 197 |
| 14 | 3300048920 | Ga0496117_0044342 | Ga0496117_0044342_1598_2239 | 197 |
| 15 | 3300048921 | Ga0496118_0000177 | Ga0496118_0000177_10513_11154 | 197 |
| 16 | 3300026118 | Ga0207675_100327665 | Ga0207675_1003276652 | 199 |
| 17 | 3300041459 | Ga0451800_1239448 | Ga0451800_1239448_304_906 | 199 |
| 18 | 3300041458 | Ga0451798_0587288 | Ga0451798_0587288_113_718 | 201 |
| 19 | 3300005335 | Ga0070666_10154259 | Ga0070666_101542592 | 204 |
| 20 | 3300013102 | Ga0157371_10300654 | Ga0157371_103006542 | 204 |
| 21 | 3300013306 | Ga0163162_10195409 | Ga0163162_101954092 | 204 |
| 22 | 3300014325 | Ga0163163_10000714 | Ga0163163_1000071411 | 204 |
| 23 | 3300014325 | Ga0163163_10047685 | Ga0163163_100476854 | 204 |
| 24 | 3300025903 | Ga0207680_10001037 | Ga0207680_1000103712 | 204 |
| 25 | 3300025903 | Ga0207680_10199425 | Ga0207680_101994252 | 204 |
| 26 | 3300025911 | Ga0207654_10000418 | Ga0207654_1000041821 | 204 |
| 27 | 3300046663 | Ga0495635_0065355 | Ga0495635_0065355_627_1253 | 204 |
| 28 | 3300049571 | Ga0501034_0242138 | Ga0501034_0242138_237_854 | 204 |
| 29 | 3300049572 | Ga0501036_0152823 | Ga0501036_0152823_633_1250 | 204 |
| 30 | 3300049579 | Ga0501043_0215980 | Ga0501043_0215980_477_1094 | 204 |
| 31 | 3300049581 | Ga0501047_0072956 | Ga0501047_0072956_1986_2603 | 204 |
| 32 | 3300049585 | Ga0501069_0106378 | Ga0501069_0106378_470_1087 | 204 |
| 33 | 3300049590 | Ga0501074_0037584 | Ga0501074_0037584_228_845 | 204 |
| 34 | 3300049742 | Ga0501080_0100031 | Ga0501080_0100031_1177_1794 | 204 |
| 35 | 3300049742 | Ga0501080_1013980 | Ga0501080_1013980_39_656 | 204 |
| 36 | 3300060353 | Ga0501082_0208114 | Ga0501082_0208114_594_1211 | 204 |
| 37 | 3300005337 | Ga0070682_100113715 | Ga0070682_1001137153 | 205 |
| 38 | 3300005455 | Ga0070663_100055331 | Ga0070663_1000553311 | 205 |
| 39 | 3300005456 | Ga0070678_100408866 | Ga0070678_1004088662 | 205 |
| 40 | 3300005539 | Ga0068853_100062215 | Ga0068853_1000622155 | 205 |
| 41 | 3300005539 | Ga0068853_100321467 | Ga0068853_1003214673 | 205 |
| 42 | 3300005614 | Ga0068856_100040580 | Ga0068856_1000405803 | 205 |
| 43 | 3300005616 | Ga0068852_100167428 | Ga0068852_1001674281 | 205 |
| 44 | 3300005841 | Ga0068863_100432497 | Ga0068863_1004324972 | 205 |
| 45 | 3300006358 | Ga0068871_100039070 | Ga0068871_1000390703 | 205 |
| 46 | 3300006358 | Ga0068871_100196340 | Ga0068871_1001963403 | 205 |
| 47 | 3300009093 | Ga0105240_10554704 | Ga0105240_105547041 | 205 |
| 48 | 3300009093 | Ga0105240_10573559 | Ga0105240_105735592 | 205 |
| 49 | 3300009098 | Ga0105245_10363834 | Ga0105245_103638342 | 205 |
| 50 | 3300009177 | Ga0105248_10296624 | Ga0105248_102966241 | 205 |
| 51 | 3300009545 | Ga0105237_10195837 | Ga0105237_101958373 | 205 |
| 52 | 3300009551 | Ga0105238_10086971 | Ga0105238_100869713 | 205 |
| 53 | 3300009551 | Ga0105238_10326225 | Ga0105238_103262252 | 205 |
| 54 | 3300013297 | Ga0157378_10221819 | Ga0157378_102218192 | 205 |
| 55 | 3300013308 | Ga0157375_11043307 | Ga0157375_110433071 | 205 |
| 56 | 3300014969 | Ga0157376_10164688 | Ga0157376_101646881 | 205 |
| 57 | 3300025914 | Ga0207671_10114039 | Ga0207671_101140393 | 205 |
| 58 | 3300025924 | Ga0207694_10005276 | Ga0207694_100052764 | 205 |
| 59 | 3300025941 | Ga0207711_10135621 | Ga0207711_101356212 | 205 |
| 60 | 3300026041 | Ga0207639_10391885 | Ga0207639_103918853 | 205 |
| 61 | 3300026078 | Ga0207702_10002671 | Ga0207702_1000267115 | 205 |
| 62 | 3300026088 | Ga0207641_10401933 | Ga0207641_104019332 | 205 |
| 63 | 3300026121 | Ga0207683_10568027 | Ga0207683_105680271 | 205 |
| 64 | 3300026142 | Ga0207698_10043839 | Ga0207698_100438392 | 205 |
| 65 | 3300028379 | Ga0268266_10262737 | Ga0268266_102627372 | 205 |
| 66 | 3300031730 | Ga0307516_10035322 | Ga0307516_100353224 | 205 |
| 67 | 3300042876 | Ga0451577_0000543 | Ga0451577_0000543_54064_54681 | 205 |
| 68 | 3300044712 | Ga0453684_0000533 | Ga0453684_0000533_3554_4171 | 205 |
| 69 | 3300045051 | Ga0451576_0102593 | Ga0451576_0102593_2330_2947 | 205 |
| 70 | 3300048918 | Ga0496115_0505030 | Ga0496115_0505030_173_790 | 205 |
| 71 | 3300048929 | Ga0496126_0295312 | Ga0496126_0295312_673_1290 | 205 |
| 72 | 3300049569 | Ga0501032_0043293 | Ga0501032_0043293_397_1014 | 205 |
| 73 | 3300049570 | Ga0501033_0015186 | Ga0501033_0015186_1445_2062 | 205 |
| 74 | 3300049571 | Ga0501034_0002776 | Ga0501034_0002776_11237_11857 | 205 |
| 75 | 3300049572 | Ga0501036_0132295 | Ga0501036_0132295_922_1539 | 205 |
| 76 | 3300049572 | Ga0501036_0348525 | Ga0501036_0348525_517_1137 | 205 |
| 77 | 3300049573 | Ga0501037_0076353 | Ga0501037_0076353_409_1026 | 205 |
| 78 | 3300049573 | Ga0501037_0255125 | Ga0501037_0255125_117_734 | 205 |
| 79 | 3300049574 | Ga0501038_0187986 | Ga0501038_0187986_649_1266 | 205 |
| 80 | 3300049575 | Ga0501039_0018424 | Ga0501039_0018424_1632_2249 | 205 |
| 81 | 3300049576 | Ga0501040_0145074 | Ga0501040_0145074_988_1605 | 205 |
| 82 | 3300049579 | Ga0501043_0045881 | Ga0501043_0045881_158_778 | 205 |
| 83 | 3300049580 | Ga0501046_0184279 | Ga0501046_0184279_271_888 | 205 |
| 84 | 3300049580 | Ga0501046_0442008 | Ga0501046_0442008_147_767 | 205 |
| 85 | 3300049581 | Ga0501047_0001523 | Ga0501047_0001523_11059_11679 | 205 |
| 86 | 3300049582 | Ga0501048_0008263 | Ga0501048_0008263_6998_7615 | 205 |
| 87 | 3300049583 | Ga0501067_0000619 | Ga0501067_0000619_11433_12053 | 205 |
| 88 | 3300049584 | Ga0501068_0078802 | Ga0501068_0078802_1123_1740 | 205 |
| 89 | 3300049585 | Ga0501069_0012755 | Ga0501069_0012755_750_1367 | 205 |
| 90 | 3300049585 | Ga0501069_0050775 | Ga0501069_0050775_269_889 | 205 |
| 91 | 3300049586 | Ga0501070_0003167 | Ga0501070_0003167_12327_12947 | 205 |
| 92 | 3300049586 | Ga0501070_0044700 | Ga0501070_0044700_1661_2278 | 205 |
| 93 | 3300049587 | Ga0501071_0008965 | Ga0501071_0008965_327_944 | 205 |
| 94 | 3300049588 | Ga0501072_0030064 | Ga0501072_0030064_2642_3259 | 205 |
| 95 | 3300049589 | Ga0501073_0001312 | Ga0501073_0001312_9343_9963 | 205 |
| 96 | 3300049589 | Ga0501073_0309049 | Ga0501073_0309049_397_1014 | 205 |
| 97 | 3300049590 | Ga0501074_0019787 | Ga0501074_0019787_1251_1871 | 205 |
| 98 | 3300049590 | Ga0501074_0181615 | Ga0501074_0181615_373_990 | 205 |
| 99 | 3300049741 | Ga0501079_0034838 | Ga0501079_0034838_1142_1759 | 205 |
| 100 | 3300049741 | Ga0501079_0533878 | Ga0501079_0533878_77_694 | 205 |
| 101 | 3300049742 | Ga0501080_0001727 | Ga0501080_0001727_4279_4899 | 205 |
| 102 | 3300049742 | Ga0501080_0537872 | Ga0501080_0537872_395_1012 | 205 |
| 103 | 3300049744 | Ga0501083_0007418 | Ga0501083_0007418_2167_2787 | 205 |
| 104 | 3300049744 | Ga0501083_0040020 | Ga0501083_0040020_1883_2500 | 205 |
| 105 | 3300049822 | Ga0501035_0078260 | Ga0501035_0078260_76_693 | 205 |
| 106 | 3300049823 | Ga0501044_0006294 | Ga0501044_0006294_1398_2018 | 205 |
| 107 | 3300049823 | Ga0501044_0024216 | Ga0501044_0024216_4643_5260 | 205 |
| 108 | 3300053139 | Ga0500568_0000952 | Ga0500568_0000952_7794_8411 | 205 |
| 109 | 3300054114 | Ga0501084_0086233 | Ga0501084_0086233_1049_1666 | 205 |
| 110 | 3300060353 | Ga0501082_0104835 | Ga0501082_0104835_931_1548 | 205 |
| 111 | 3300060353 | Ga0501082_0301485 | Ga0501082_0301485_77_694 | 205 |
| 112 | iso_pu_bacteria | 2537561836 | 2538834623 | 205 |
| 113 | iso_pu_bacteria | 2734482264 | 2735833353 | 205 |
| 114 | iso_pu_bacteria | 2734482264 | 2735837799 | 205 |
| 115 | iso_pu_bacteria | 2738543009 | 2739228393 | 205 |
| 116 | iso_pu_bacteria | 2939611941 | 2939614636 | 205 |
| 117 | 3300004799 | Ga0058863_11775536 | Ga0058863_117755362 | 206 |
| 118 | 3300005327 | Ga0070658_10129147 | Ga0070658_101291472 | 206 |
| 119 | 3300005327 | Ga0070658_10316884 | Ga0070658_103168841 | 206 |
| 120 | 3300005331 | Ga0070670_100003232 | Ga0070670_10000323210 | 206 |
| 121 | 3300005331 | Ga0070670_100184825 | Ga0070670_1001848253 | 206 |
| 122 | 3300005335 | Ga0070666_10021006 | Ga0070666_100210065 | 206 |
| 123 | 3300005336 | Ga0070680_100188167 | Ga0070680_1001881672 | 206 |
| 124 | 3300005338 | Ga0068868_100307562 | Ga0068868_1003075622 | 206 |
| 125 | 3300005344 | Ga0070661_100026423 | Ga0070661_1000264235 | 206 |
| 126 | 3300005344 | Ga0070661_100158823 | Ga0070661_1001588232 | 206 |
| 127 | 3300005344 | Ga0070661_100521705 | Ga0070661_1005217051 | 206 |
| 128 | 3300005364 | Ga0070673_100027257 | Ga0070673_1000272573 | 206 |
| 129 | 3300005367 | Ga0070667_100000005 | Ga0070667_100000005101 | 206 |
| 130 | 3300005367 | Ga0070667_100062337 | Ga0070667_1000623372 | 206 |
| 131 | 3300005367 | Ga0070667_100097600 | Ga0070667_1000976002 | 206 |
| 132 | 3300005367 | Ga0070667_100138220 | Ga0070667_1001382202 | 206 |
| 133 | 3300005439 | Ga0070711_100069150 | Ga0070711_1000691502 | 206 |
| 134 | 3300005455 | Ga0070663_100004878 | Ga0070663_1000048782 | 206 |
| 135 | 3300005455 | Ga0070663_100009056 | Ga0070663_1000090561 | 206 |
| 136 | 3300005455 | Ga0070663_100024628 | Ga0070663_1000246284 | 206 |
| 137 | 3300005455 | Ga0070663_100335658 | Ga0070663_1003356582 | 206 |
| 138 | 3300005457 | Ga0070662_100008490 | Ga0070662_1000084902 | 206 |
| 139 | 3300005458 | Ga0070681_10042418 | Ga0070681_100424182 | 206 |
| 140 | 3300005466 | Ga0070685_10003480 | Ga0070685_100034805 | 206 |
| 141 | 3300005530 | Ga0070679_100055197 | Ga0070679_1000551975 | 206 |
| 142 | 3300005530 | Ga0070679_100221925 | Ga0070679_1002219252 | 206 |
| 143 | 3300005539 | Ga0068853_100003367 | Ga0068853_1000033672 | 206 |
| 144 | 3300005539 | Ga0068853_100020363 | Ga0068853_1000203632 | 206 |
| 145 | 3300005539 | Ga0068853_100039275 | Ga0068853_1000392754 | 206 |
| 146 | 3300005539 | Ga0068853_100145952 | Ga0068853_1001459523 | 206 |
| 147 | 3300005539 | Ga0068853_100547944 | Ga0068853_1005479442 | 206 |
| 148 | 3300005547 | Ga0070693_100005909 | Ga0070693_1000059092 | 206 |
| 149 | 3300005548 | Ga0070665_100000062 | Ga0070665_100000062102 | 206 |
| 150 | 3300005548 | Ga0070665_100001482 | Ga0070665_1000014822 | 206 |
| 151 | 3300005563 | Ga0068855_100212061 | Ga0068855_1002120612 | 206 |
| 152 | 3300005564 | Ga0070664_100524934 | Ga0070664_1005249342 | 206 |
| 153 | 3300005577 | Ga0068857_100241676 | Ga0068857_1002416762 | 206 |
| 154 | 3300005577 | Ga0068857_100282547 | Ga0068857_1002825473 | 206 |
| 155 | 3300005614 | Ga0068856_100169761 | Ga0068856_1001697613 | 206 |
| 156 | 3300005616 | Ga0068852_100005452 | Ga0068852_1000054529 | 206 |
| 157 | 3300005616 | Ga0068852_100136432 | Ga0068852_1001364322 | 206 |
| 158 | 3300005616 | Ga0068852_100277398 | Ga0068852_1002773982 | 206 |
| 159 | 3300005834 | Ga0068851_10047128 | Ga0068851_100471284 | 206 |
| 160 | 3300005841 | Ga0068863_100335364 | Ga0068863_1003353642 | 206 |
| 161 | 3300005842 | Ga0068858_100001325 | Ga0068858_10000132517 | 206 |
| 162 | 3300005842 | Ga0068858_100233568 | Ga0068858_1002335682 | 206 |
| 163 | 3300005844 | Ga0068862_100400602 | Ga0068862_1004006021 | 206 |
| 164 | 3300005937 | Ga0081455_10045286 | Ga0081455_100452863 | 206 |
| 165 | 3300006237 | Ga0097621_100101376 | Ga0097621_1001013764 | 206 |
| 166 | 3300006358 | Ga0068871_100064954 | Ga0068871_1000649542 | 206 |
| 167 | 3300006881 | Ga0068865_100201766 | Ga0068865_1002017662 | 206 |
| 168 | 3300009011 | Ga0105251_10127723 | Ga0105251_101277232 | 206 |
| 169 | 3300009093 | Ga0105240_10001278 | Ga0105240_100012789 | 206 |
| 170 | 3300009093 | Ga0105240_10439147 | Ga0105240_104391472 | 206 |
| 171 | 3300009098 | Ga0105245_10773967 | Ga0105245_107739672 | 206 |
| 172 | 3300009174 | Ga0105241_10096475 | Ga0105241_100964754 | 206 |
| 173 | 3300009177 | Ga0105248_10002061 | Ga0105248_1000206123 | 206 |
| 174 | 3300009177 | Ga0105248_10129409 | Ga0105248_101294092 | 206 |
| 175 | 3300009177 | Ga0105248_10251166 | Ga0105248_102511663 | 206 |
| 176 | 3300009545 | Ga0105237_10004780 | Ga0105237_1000478020 | 206 |
| 177 | 3300009545 | Ga0105237_11012795 | Ga0105237_110127952 | 206 |
| 178 | 3300009551 | Ga0105238_10032728 | Ga0105238_100327282 | 206 |
| 179 | 3300009551 | Ga0105238_10055319 | Ga0105238_100553195 | 206 |
| 180 | 3300009553 | Ga0105249_10002473 | Ga0105249_1000247320 | 206 |
| 181 | 3300009553 | Ga0105249_10025839 | Ga0105249_100258396 | 206 |
| 182 | 3300010375 | Ga0105239_10106229 | Ga0105239_101062291 | 206 |
| 183 | 3300010375 | Ga0105239_10125127 | Ga0105239_101251272 | 206 |
| 184 | 3300010375 | Ga0105239_10221435 | Ga0105239_102214353 | 206 |
| 185 | 3300010375 | Ga0105239_10325273 | Ga0105239_103252732 | 206 |
| 186 | 3300011119 | Ga0105246_10729468 | Ga0105246_107294682 | 206 |
| 187 | 3300013100 | Ga0157373_10155666 | Ga0157373_101556662 | 206 |
| 188 | 3300013102 | Ga0157371_10645570 | Ga0157371_106455701 | 206 |
| 189 | 3300013104 | Ga0157370_10222091 | Ga0157370_102220912 | 206 |
| 190 | 3300013104 | Ga0157370_10453721 | Ga0157370_104537212 | 206 |
| 191 | 3300013105 | Ga0157369_10164205 | Ga0157369_101642054 | 206 |
| 192 | 3300013105 | Ga0157369_10406855 | Ga0157369_104068552 | 206 |
| 193 | 3300013296 | Ga0157374_10052356 | Ga0157374_100523565 | 206 |
| 194 | 3300013307 | Ga0157372_10189198 | Ga0157372_101891983 | 206 |
| 195 | 3300013307 | Ga0157372_10193754 | Ga0157372_101937545 | 206 |
| 196 | 3300013308 | Ga0157375_11096410 | Ga0157375_110964102 | 206 |
| 197 | 3300014325 | Ga0163163_10593421 | Ga0163163_105934211 | 206 |
| 198 | 3300014969 | Ga0157376_10134518 | Ga0157376_101345182 | 206 |
| 199 | 3300020070 | Ga0206356_10153146 | Ga0206356_101531462 | 206 |
| 200 | 3300020081 | Ga0206354_10250691 | Ga0206354_102506912 | 206 |
| 201 | 3300025303 | Ga0209051_1013016 | Ga0209051_10130164 | 206 |
| 202 | 3300025321 | Ga0207656_10001827 | Ga0207656_100018275 | 206 |
| 203 | 3300025321 | Ga0207656_10062648 | Ga0207656_100626482 | 206 |
| 204 | 3300025903 | Ga0207680_10003078 | Ga0207680_1000307810 | 206 |
| 205 | 3300025909 | Ga0207705_10110203 | Ga0207705_101102032 | 206 |
| 206 | 3300025911 | Ga0207654_10129466 | Ga0207654_101294662 | 206 |
| 207 | 3300025912 | Ga0207707_10143369 | Ga0207707_101433692 | 206 |
| 208 | 3300025913 | Ga0207695_10000033 | Ga0207695_10000033362 | 206 |
| 209 | 3300025913 | Ga0207695_10005921 | Ga0207695_100059212 | 206 |
| 210 | 3300025913 | Ga0207695_10034290 | Ga0207695_100342903 | 206 |
| 211 | 3300025913 | Ga0207695_10446241 | Ga0207695_104462412 | 206 |
| 212 | 3300025914 | Ga0207671_10004488 | Ga0207671_100044885 | 206 |
| 213 | 3300025914 | Ga0207671_10013246 | Ga0207671_100132465 | 206 |
| 214 | 3300025914 | Ga0207671_10034031 | Ga0207671_100340312 | 206 |
| 215 | 3300025917 | Ga0207660_10251721 | Ga0207660_102517212 | 206 |
| 216 | 3300025920 | Ga0207649_10009882 | Ga0207649_100098824 | 206 |
| 217 | 3300025920 | Ga0207649_10041331 | Ga0207649_100413315 | 206 |
| 218 | 3300025921 | Ga0207652_10059229 | Ga0207652_100592295 | 206 |
| 219 | 3300025924 | Ga0207694_10002668 | Ga0207694_100026688 | 206 |
| 220 | 3300025924 | Ga0207694_10003738 | Ga0207694_100037386 | 206 |
| 221 | 3300025925 | Ga0207650_10009991 | Ga0207650_100099915 | 206 |
| 222 | 3300025933 | Ga0207706_10052916 | Ga0207706_100529165 | 206 |
| 223 | 3300025938 | Ga0207704_10088448 | Ga0207704_100884483 | 206 |
| 224 | 3300025941 | Ga0207711_10000470 | Ga0207711_100004703 | 206 |
| 225 | 3300025941 | Ga0207711_10162642 | Ga0207711_101626422 | 206 |
| 226 | 3300025949 | Ga0207667_10120945 | Ga0207667_101209452 | 206 |
| 227 | 3300025949 | Ga0207667_11111797 | Ga0207667_111117971 | 206 |
| 228 | 3300025961 | Ga0207712_10000165 | Ga0207712_1000016529 | 206 |
| 229 | 3300025961 | Ga0207712_10000771 | Ga0207712_1000077112 | 206 |
| 230 | 3300025986 | Ga0207658_10000006 | Ga0207658_10000006271 | 206 |
| 231 | 3300025986 | Ga0207658_10016117 | Ga0207658_100161172 | 206 |
| 232 | 3300025986 | Ga0207658_10129629 | Ga0207658_101296293 | 206 |
| 233 | 3300026023 | Ga0207677_10060979 | Ga0207677_100609794 | 206 |
| 234 | 3300026035 | Ga0207703_10000553 | Ga0207703_100005537 | 206 |
| 235 | 3300026041 | Ga0207639_10000217 | Ga0207639_1000021720 | 206 |
| 236 | 3300026041 | Ga0207639_10004497 | Ga0207639_100044975 | 206 |
| 237 | 3300026041 | Ga0207639_10124736 | Ga0207639_101247362 | 206 |
| 238 | 3300026041 | Ga0207639_10143638 | Ga0207639_101436382 | 206 |
| 239 | 3300026067 | Ga0207678_10001340 | Ga0207678_100013409 | 206 |
| 240 | 3300026067 | Ga0207678_10005262 | Ga0207678_1000526213 | 206 |
| 241 | 3300026067 | Ga0207678_10073285 | Ga0207678_100732852 | 206 |
| 242 | 3300026067 | Ga0207678_10401985 | Ga0207678_104019852 | 206 |
| 243 | 3300026078 | Ga0207702_10060529 | Ga0207702_100605295 | 206 |
| 244 | 3300026088 | Ga0207641_10905676 | Ga0207641_109056762 | 206 |
| 245 | 3300026116 | Ga0207674_10127511 | Ga0207674_101275111 | 206 |
| 246 | 3300026142 | Ga0207698_10138025 | Ga0207698_101380253 | 206 |
| 247 | 3300026142 | Ga0207698_10210449 | Ga0207698_102104492 | 206 |
| 248 | 3300026142 | Ga0207698_10223943 | Ga0207698_102239432 | 206 |
| 249 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011780 | 206 |
| 250 | 3300028379 | Ga0268266_10000006 | Ga0268266_100000061156 | 206 |
| 251 | 3300031665 | Ga0316575_10188527 | Ga0316575_101885271 | 206 |
| 252 | 3300031691 | Ga0316579_10006748 | Ga0316579_100067485 | 206 |
| 253 | 3300031728 | Ga0316578_10167457 | Ga0316578_101674572 | 206 |
| 254 | 3300031733 | Ga0316577_10149675 | Ga0316577_101496751 | 206 |
| 255 | 3300035398 | Ga0316574_0003830 | Ga0316574_0003830_2701_3321 | 206 |
| 256 | 3300035398 | Ga0316574_0384521 | Ga0316574_0384521_138_758 | 206 |
| 257 | 3300036647 | Ga0316582_0003307 | Ga0316582_0003307_3481_4101 | 206 |
| 258 | 3300036647 | Ga0316582_0003479 | Ga0316582_0003479_6353_6973 | 206 |
| 259 | 3300036647 | Ga0316582_0021067 | Ga0316582_0021067_2963_3583 | 206 |
| 260 | 3300036712 | Ga0316584_0001131 | Ga0316584_0001131_13391_14011 | 206 |
| 261 | 3300036712 | Ga0316584_0071174 | Ga0316584_0071174_1738_2358 | 206 |
| 262 | 3300036712 | Ga0316584_0104210 | Ga0316584_0104210_1011_1631 | 206 |
| 263 | 3300036712 | Ga0316584_0548402 | Ga0316584_0548402_58_678 | 206 |
| 264 | 3300037418 | Ga0395900_0005906 | Ga0395900_0005906_1631_2302 | 206 |
| 265 | 3300037588 | Ga0316581_0000030 | Ga0316581_0000030_13468_14088 | 206 |
| 266 | 3300037588 | Ga0316581_0039133 | Ga0316581_0039133_709_1329 | 206 |
| 267 | 3300039450 | Ga0436363_1278302 | Ga0436363_1278302_258_881 | 206 |
| 268 | 3300041441 | Ga0451787_424847 | Ga0451787_424847_349_969 | 206 |
| 269 | 3300041452 | Ga0451793_0203707 | Ga0451793_0203707_332_952 | 206 |
| 270 | 3300041453 | Ga0451797_0696143 | Ga0451797_0696143_951_1571 | 206 |
| 271 | 3300041460 | Ga0451802_0653047 | Ga0451802_0653047_245_865 | 206 |
| 272 | 3300041486 | Ga0451807_0052036 | Ga0451807_0052036_729_1349 | 206 |
| 273 | 3300041486 | Ga0451807_1727819 | Ga0451807_1727819_174_794 | 206 |
| 274 | 3300041494 | Ga0451837_0211328 | Ga0451837_0211328_437_1057 | 206 |
| 275 | 3300041494 | Ga0451837_1594622 | Ga0451837_1594622_41_661 | 206 |
| 276 | 3300041509 | Ga0451843_0832695 | Ga0451843_0832695_735_1355 | 206 |
| 277 | 3300045976 | Ga0466967_0215672 | Ga0466967_0215672_757_1377 | 206 |
| 278 | 3300047472 | Ga0495686_0008876 | Ga0495686_0008876_914_1534 | 206 |
| 279 | 3300048910 | Ga0496107_0211521 | Ga0496107_0211521_494_1114 | 206 |
| 280 | 3300048916 | Ga0496113_0265200 | Ga0496113_0265200_201_821 | 206 |
| 281 | 3300048920 | Ga0496117_0036780 | Ga0496117_0036780_564_1184 | 206 |
| 282 | 3300048920 | Ga0496117_0070480 | Ga0496117_0070480_1015_1653 | 206 |
| 283 | 3300048921 | Ga0496118_0076525 | Ga0496118_0076525_956_1594 | 206 |
| 284 | 3300048924 | Ga0496121_0055034 | Ga0496121_0055034_1108_1728 | 206 |
| 285 | 3300048925 | Ga0496122_0000487 | Ga0496122_0000487_3137_3757 | 206 |
| 286 | 3300048926 | Ga0496123_0000296 | Ga0496123_0000296_62385_63005 | 206 |
| 287 | 3300048928 | Ga0496125_0136041 | Ga0496125_0136041_464_1084 | 206 |
| 288 | 3300048929 | Ga0496126_0296237 | Ga0496126_0296237_380_1000 | 206 |
| 289 | 3300049568 | Ga0501031_0033304 | Ga0501031_0033304_1518_2138 | 206 |
| 290 | 3300049569 | Ga0501032_0013770 | Ga0501032_0013770_234_854 | 206 |
| 291 | 3300049570 | Ga0501033_0019531 | Ga0501033_0019531_1084_1704 | 206 |
| 292 | 3300049571 | Ga0501034_0048739 | Ga0501034_0048739_233_853 | 206 |
| 293 | 3300049572 | Ga0501036_0060031 | Ga0501036_0060031_896_1516 | 206 |
| 294 | 3300049573 | Ga0501037_0000499 | Ga0501037_0000499_28697_29317 | 206 |
| 295 | 3300049574 | Ga0501038_0003315 | Ga0501038_0003315_13609_14229 | 206 |
| 296 | 3300049578 | Ga0501042_0158072 | Ga0501042_0158072_54_674 | 206 |
| 297 | 3300049578 | Ga0501042_0543193 | Ga0501042_0543193_211_831 | 206 |
| 298 | 3300049579 | Ga0501043_0007141 | Ga0501043_0007141_2368_2988 | 206 |
| 299 | 3300049580 | Ga0501046_0003027 | Ga0501046_0003027_1074_1694 | 206 |
| 300 | 3300049581 | Ga0501047_0019332 | Ga0501047_0019332_2368_2988 | 206 |
| 301 | 3300049581 | Ga0501047_0152962 | Ga0501047_0152962_1300_1920 | 206 |
| 302 | 3300049582 | Ga0501048_0110392 | Ga0501048_0110392_251_871 | 206 |
| 303 | 3300049583 | Ga0501067_0034617 | Ga0501067_0034617_410_1030 | 206 |
| 304 | 3300049586 | Ga0501070_0038613 | Ga0501070_0038613_1979_2599 | 206 |
| 305 | 3300049589 | Ga0501073_0002117 | Ga0501073_0002117_3225_3845 | 206 |
| 306 | 3300049590 | Ga0501074_0065373 | Ga0501074_0065373_516_1136 | 206 |
| 307 | 3300049742 | Ga0501080_0013993 | Ga0501080_0013993_1709_2329 | 206 |
| 308 | 3300049742 | Ga0501080_0035297 | Ga0501080_0035297_95_715 | 206 |
| 309 | 3300049822 | Ga0501035_0017155 | Ga0501035_0017155_3924_4544 | 206 |
| 310 | 3300049822 | Ga0501035_0189958 | Ga0501035_0189958_278_898 | 206 |
| 311 | 3300049823 | Ga0501044_0015031 | Ga0501044_0015031_5171_5791 | 206 |
| 312 | 3300049823 | Ga0501044_0176063 | Ga0501044_0176063_625_1245 | 206 |
| 313 | 3300049823 | Ga0501044_0622550 | Ga0501044_0622550_277_906 | 206 |
| 314 | 3300053087 | Ga0500643_005173 | Ga0500643_005173_970_1590 | 206 |
| 315 | 3300053093 | Ga0500651_0102806 | Ga0500651_0102806_247_867 | 206 |
| 316 | 3300053120 | Ga0500597_000335 | Ga0500597_000335_602_1222 | 206 |
| 317 | 3300055283 | Ga0500661_021664 | Ga0500661_021664_80_715 | 206 |
| 318 | iso_pu_bacteria | 2643221579 | 2643908888 | 206 |
| 319 | iso_pu_bacteria | 2643221581 | 2643915428 | 206 |
| 320 | iso_pu_bacteria | 2747842501 | 2748015618 | 206 |
| 321 | iso_pu_bacteria | 2923516293 | 2923519023 | 206 |
| 322 | 3300005334 | Ga0068869_100143932 | Ga0068869_1001439322 | 207 |
| 323 | 3300005334 | Ga0068869_100357235 | Ga0068869_1003572352 | 207 |
| 324 | 3300005340 | Ga0070689_100239447 | Ga0070689_1002394472 | 207 |
| 325 | 3300005345 | Ga0070692_10091172 | Ga0070692_100911721 | 207 |
| 326 | 3300005364 | Ga0070673_100182693 | Ga0070673_1001826933 | 207 |
| 327 | 3300005441 | Ga0070700_100102054 | Ga0070700_1001020543 | 207 |
| 328 | 3300005444 | Ga0070694_100075030 | Ga0070694_1000750303 | 207 |
| 329 | 3300005444 | Ga0070694_100116435 | Ga0070694_1001164353 | 207 |
| 330 | 3300005456 | Ga0070678_100117199 | Ga0070678_1001171993 | 207 |
| 331 | 3300005457 | Ga0070662_100493055 | Ga0070662_1004930551 | 207 |
| 332 | 3300005543 | Ga0070672_100278654 | Ga0070672_1002786542 | 207 |
| 333 | 3300005543 | Ga0070672_100396620 | Ga0070672_1003966202 | 207 |
| 334 | 3300005549 | Ga0070704_100343010 | Ga0070704_1003430102 | 207 |
| 335 | 3300005617 | Ga0068859_100169678 | Ga0068859_1001696782 | 207 |
| 336 | 3300005618 | Ga0068864_100225814 | Ga0068864_1002258142 | 207 |
| 337 | 3300005719 | Ga0068861_100036281 | Ga0068861_1000362812 | 207 |
| 338 | 3300005719 | Ga0068861_100068799 | Ga0068861_1000687992 | 207 |
| 339 | 3300005841 | Ga0068863_100189952 | Ga0068863_1001899523 | 207 |
| 340 | 3300005844 | Ga0068862_100289079 | Ga0068862_1002890793 | 207 |
| 341 | 3300006237 | Ga0097621_100118942 | Ga0097621_1001189422 | 207 |
| 342 | 3300006237 | Ga0097621_100520190 | Ga0097621_1005201901 | 207 |
| 343 | 3300006844 | Ga0075428_100003215 | Ga0075428_10000321515 | 207 |
| 344 | 3300006846 | Ga0075430_100013050 | Ga0075430_1000130508 | 207 |
| 345 | 3300006852 | Ga0075433_10031019 | Ga0075433_100310192 | 207 |
| 346 | 3300006881 | Ga0068865_100116570 | Ga0068865_1001165702 | 207 |
| 347 | 3300006931 | Ga0097620_100169686 | Ga0097620_1001696862 | 207 |
| 348 | 3300009093 | Ga0105240_10061336 | Ga0105240_100613363 | 207 |
| 349 | 3300009093 | Ga0105240_10405029 | Ga0105240_104050292 | 207 |
| 350 | 3300009094 | Ga0111539_10018132 | Ga0111539_100181323 | 207 |
| 351 | 3300009094 | Ga0111539_11223966 | Ga0111539_112239661 | 207 |
| 352 | 3300009094 | Ga0111539_11339585 | Ga0111539_113395851 | 207 |
| 353 | 3300009551 | Ga0105238_10024550 | Ga0105238_100245503 | 207 |
| 354 | 3300009553 | Ga0105249_10101054 | Ga0105249_101010542 | 207 |
| 355 | 3300010375 | Ga0105239_10018289 | Ga0105239_100182899 | 207 |
| 356 | 3300013105 | Ga0157369_10000032 | Ga0157369_1000003259 | 207 |
| 357 | 3300013307 | Ga0157372_10007958 | Ga0157372_1000795815 | 207 |
| 358 | 3300014326 | Ga0157380_10130820 | Ga0157380_101308202 | 207 |
| 359 | 3300014968 | Ga0157379_10052017 | Ga0157379_100520172 | 207 |
| 360 | 3300014969 | Ga0157376_10456447 | Ga0157376_104564472 | 207 |
| 361 | 3300025903 | Ga0207680_10109953 | Ga0207680_101099533 | 207 |
| 362 | 3300025907 | Ga0207645_10105181 | Ga0207645_101051812 | 207 |
| 363 | 3300025913 | Ga0207695_10007552 | Ga0207695_1000755212 | 207 |
| 364 | 3300025914 | Ga0207671_10003137 | Ga0207671_100031373 | 207 |
| 365 | 3300025917 | Ga0207660_10413363 | Ga0207660_104133631 | 207 |
| 366 | 3300025919 | Ga0207657_10188169 | Ga0207657_101881692 | 207 |
| 367 | 3300025923 | Ga0207681_10706039 | Ga0207681_107060391 | 207 |
| 368 | 3300025924 | Ga0207694_10006609 | Ga0207694_100066095 | 207 |
| 369 | 3300025931 | Ga0207644_10005307 | Ga0207644_100053074 | 207 |
| 370 | 3300025940 | Ga0207691_10238619 | Ga0207691_102386192 | 207 |
| 371 | 3300025940 | Ga0207691_10388861 | Ga0207691_103888612 | 207 |
| 372 | 3300025942 | Ga0207689_10054480 | Ga0207689_100544802 | 207 |
| 373 | 3300025961 | Ga0207712_10057473 | Ga0207712_100574732 | 207 |
| 374 | 3300026075 | Ga0207708_10015570 | Ga0207708_100155702 | 207 |
| 375 | 3300026118 | Ga0207675_100008268 | Ga0207675_1000082688 | 207 |
| 376 | 3300026118 | Ga0207675_100050463 | Ga0207675_1000504635 | 207 |
| 377 | 3300026121 | Ga0207683_10191731 | Ga0207683_101917312 | 207 |
| 378 | 3300027695 | Ga0209966_1029318 | Ga0209966_10293182 | 207 |
| 379 | 3300027907 | Ga0207428_10015745 | Ga0207428_100157453 | 207 |
| 380 | 3300028381 | Ga0268264_10540004 | Ga0268264_105400042 | 207 |
| 381 | 3300031911 | Ga0307412_10289834 | Ga0307412_102898342 | 207 |
| 382 | 3300035398 | Ga0316574_0005837 | Ga0316574_0005837_156_779 | 207 |
| 383 | 3300035398 | Ga0316574_0006179 | Ga0316574_0006179_3098_3721 | 207 |
| 384 | 3300035398 | Ga0316574_0057540 | Ga0316574_0057540_1695_2318 | 207 |
| 385 | 3300042876 | Ga0451577_0256247 | Ga0451577_0256247_636_1259 | 207 |
| 386 | 3300044656 | Ga0466969_0155589 | Ga0466969_0155589_77_700 | 207 |
| 387 | 3300045051 | Ga0451576_0027440 | Ga0451576_0027440_2467_3090 | 207 |
| 388 | 3300046499 | Ga0495594_0361525 | Ga0495594_0361525_67_690 | 207 |
| 389 | 3300046664 | Ga0495659_0131686 | Ga0495659_0131686_73_696 | 207 |
| 390 | 3300049572 | Ga0501036_0067456 | Ga0501036_0067456_1977_2600 | 207 |
| 391 | 3300049575 | Ga0501039_0143181 | Ga0501039_0143181_1036_1659 | 207 |
| 392 | 3300049577 | Ga0501041_0113511 | Ga0501041_0113511_300_923 | 207 |
| 393 | 3300049586 | Ga0501070_0504069 | Ga0501070_0504069_51_677 | 207 |
| 394 | 3300049591 | Ga0501075_0301460 | Ga0501075_0301460_312_935 | 207 |
| 395 | 3300050509 | nmdc:mga0qj67_91052_c1 | nmdc:mga0qj67_91052_c1_1348_1971 | 207 |
| 396 | 3300050511 | nmdc:mga08y16_11439_c1 | nmdc:mga08y16_11439_c1_2796_3419 | 207 |
| 397 | 3300050511 | nmdc:mga08y16_1174852_c1 | nmdc:mga08y16_1174852_c1_37_660 | 207 |
| 398 | 3300050511 | nmdc:mga08y16_196714_c1 | nmdc:mga08y16_196714_c1_1448_2071 | 207 |
| 399 | 3300050515 | nmdc:mga0a205_22852_c1 | nmdc:mga0a205_22852_c1_2950_3573 | 207 |
| 400 | 3300005330 | Ga0070690_100012274 | Ga0070690_1000122742 | 208 |
| 401 | 3300005331 | Ga0070670_100066426 | Ga0070670_1000664262 | 208 |
| 402 | 3300005334 | Ga0068869_100146300 | Ga0068869_1001463002 | 208 |
| 403 | 3300005338 | Ga0068868_100003997 | Ga0068868_1000039973 | 208 |
| 404 | 3300005339 | Ga0070660_100860189 | Ga0070660_1008601891 | 208 |
| 405 | 3300005364 | Ga0070673_100028362 | Ga0070673_1000283622 | 208 |
| 406 | 3300005367 | Ga0070667_100079369 | Ga0070667_1000793692 | 208 |
| 407 | 3300005434 | Ga0070709_10003340 | Ga0070709_100033408 | 208 |
| 408 | 3300005439 | Ga0070711_100360920 | Ga0070711_1003609202 | 208 |
| 409 | 3300005466 | Ga0070685_10025507 | Ga0070685_100255073 | 208 |
| 410 | 3300005543 | Ga0070672_100328539 | Ga0070672_1003285392 | 208 |
| 411 | 3300005544 | Ga0070686_100293412 | Ga0070686_1002934121 | 208 |
| 412 | 3300005548 | Ga0070665_100022022 | Ga0070665_1000220224 | 208 |
| 413 | 3300005564 | Ga0070664_100004667 | Ga0070664_1000046672 | 208 |
| 414 | 3300005615 | Ga0070702_100072672 | Ga0070702_1000726722 | 208 |
| 415 | 3300005617 | Ga0068859_100008663 | Ga0068859_1000086638 | 208 |
| 416 | 3300005618 | Ga0068864_100005830 | Ga0068864_1000058306 | 208 |
| 417 | 3300005719 | Ga0068861_100756616 | Ga0068861_1007566161 | 208 |
| 418 | 3300005841 | Ga0068863_100035993 | Ga0068863_1000359933 | 208 |
| 419 | 3300005842 | Ga0068858_100014128 | Ga0068858_1000141283 | 208 |
| 420 | 3300005843 | Ga0068860_100019554 | Ga0068860_1000195542 | 208 |
| 421 | 3300006237 | Ga0097621_100009176 | Ga0097621_1000091762 | 208 |
| 422 | 3300006358 | Ga0068871_100005841 | Ga0068871_1000058413 | 208 |
| 423 | 3300006871 | Ga0075434_100738905 | Ga0075434_1007389052 | 208 |
| 424 | 3300006931 | Ga0097620_100008663 | Ga0097620_1000086638 | 208 |
| 425 | 3300007265 | Ga0099794_10081435 | Ga0099794_100814352 | 208 |
| 426 | 3300007788 | Ga0099795_10000064 | Ga0099795_100000649 | 208 |
| 427 | 3300007788 | Ga0099795_10050150 | Ga0099795_100501502 | 208 |
| 428 | 3300007788 | Ga0099795_10078744 | Ga0099795_100787441 | 208 |
| 429 | 3300009093 | Ga0105240_10163453 | Ga0105240_101634533 | 208 |
| 430 | 3300009098 | Ga0105245_10003531 | Ga0105245_1000353111 | 208 |
| 431 | 3300009101 | Ga0105247_10021024 | Ga0105247_100210242 | 208 |
| 432 | 3300009148 | Ga0105243_11067241 | Ga0105243_110672412 | 208 |
| 433 | 3300009176 | Ga0105242_10359063 | Ga0105242_103590632 | 208 |
| 434 | 3300009177 | Ga0105248_10010033 | Ga0105248_100100332 | 208 |
| 435 | 3300009545 | Ga0105237_10442532 | Ga0105237_104425322 | 208 |
| 436 | 3300009551 | Ga0105238_10367898 | Ga0105238_103678982 | 208 |
| 437 | 3300009553 | Ga0105249_10216145 | Ga0105249_102161452 | 208 |
| 438 | 3300010159 | Ga0099796_10000064 | Ga0099796_1000006411 | 208 |
| 439 | 3300011119 | Ga0105246_10020552 | Ga0105246_100205522 | 208 |
| 440 | 3300013296 | Ga0157374_10002676 | Ga0157374_100026767 | 208 |
| 441 | 3300013297 | Ga0157378_10375160 | Ga0157378_103751603 | 208 |
| 442 | 3300013306 | Ga0163162_10007195 | Ga0163162_100071953 | 208 |
| 443 | 3300013308 | Ga0157375_10049038 | Ga0157375_100490383 | 208 |
| 444 | 3300014325 | Ga0163163_10015604 | Ga0163163_100156043 | 208 |
| 445 | 3300014326 | Ga0157380_11087087 | Ga0157380_110870871 | 208 |
| 446 | 3300014745 | Ga0157377_10125033 | Ga0157377_101250332 | 208 |
| 447 | 3300014968 | Ga0157379_10452806 | Ga0157379_104528061 | 208 |
| 448 | 3300014969 | Ga0157376_10070476 | Ga0157376_100704762 | 208 |
| 449 | 3300025913 | Ga0207695_10184901 | Ga0207695_101849012 | 208 |
| 450 | 3300025919 | Ga0207657_10527203 | Ga0207657_105272032 | 208 |
| 451 | 3300025925 | Ga0207650_10040606 | Ga0207650_100406063 | 208 |
| 452 | 3300025927 | Ga0207687_10018293 | Ga0207687_100182933 | 208 |
| 453 | 3300025933 | Ga0207706_10059192 | Ga0207706_100591923 | 208 |
| 454 | 3300025940 | Ga0207691_10480311 | Ga0207691_104803112 | 208 |
| 455 | 3300025941 | Ga0207711_10007410 | Ga0207711_100074105 | 208 |
| 456 | 3300025942 | Ga0207689_10100713 | Ga0207689_101007132 | 208 |
| 457 | 3300025945 | Ga0207679_10215560 | Ga0207679_102155602 | 208 |
| 458 | 3300026023 | Ga0207677_10218081 | Ga0207677_102180812 | 208 |
| 459 | 3300026035 | Ga0207703_10028956 | Ga0207703_100289562 | 208 |
| 460 | 3300026041 | Ga0207639_10502556 | Ga0207639_105025562 | 208 |
| 461 | 3300026067 | Ga0207678_10259792 | Ga0207678_102597922 | 208 |
| 462 | 3300026088 | Ga0207641_10016935 | Ga0207641_100169352 | 208 |
| 463 | 3300026088 | Ga0207641_10615933 | Ga0207641_106159332 | 208 |
| 464 | 3300026089 | Ga0207648_10048941 | Ga0207648_100489411 | 208 |
| 465 | 3300026095 | Ga0207676_10031766 | Ga0207676_100317662 | 208 |
| 466 | 3300026118 | Ga0207675_100545995 | Ga0207675_1005459952 | 208 |
| 467 | 3300027512 | Ga0209179_1000062 | Ga0209179_10000622 | 208 |
| 468 | 3300028379 | Ga0268266_10043867 | Ga0268266_100438673 | 208 |
| 469 | 3300028381 | Ga0268264_10100170 | Ga0268264_101001702 | 208 |
| 470 | 3300031733 | Ga0316577_10020308 | Ga0316577_100203084 | 208 |
| 471 | 3300035117 | Ga0373953_0063289 | Ga0373953_0063289_583_1209 | 208 |
| 472 | 3300035172 | Ga0373955_0028400 | Ga0373955_0028400_1433_2059 | 208 |
| 473 | 3300035398 | Ga0316574_0060045 | Ga0316574_0060045_260_886 | 208 |
| 474 | 3300035410 | Ga0373924_0018094 | Ga0373924_0018094_492_1118 | 208 |
| 475 | 3300035724 | Ga0373933_0271513 | Ga0373933_0271513_390_1016 | 208 |
| 476 | 3300036401 | Ga0373937_0036733 | Ga0373937_0036733_2143_2769 | 208 |
| 477 | 3300036401 | Ga0373937_0102030 | Ga0373937_0102030_58_684 | 208 |
| 478 | 3300036712 | Ga0316584_0141162 | Ga0316584_0141162_24_650 | 208 |
| 479 | 3300045049 | Ga0466959_0070150 | Ga0466959_0070150_208_834 | 208 |
| 480 | 3300045051 | Ga0451576_0042101 | Ga0451576_0042101_3564_4190 | 208 |
| 481 | 3300046678 | Ga0495599_0438045 | Ga0495599_0438045_133_759 | 208 |
| 482 | 3300048903 | Ga0496100_0283629 | Ga0496100_0283629_182_808 | 208 |
| 483 | 3300048904 | Ga0496101_0261736 | Ga0496101_0261736_550_1176 | 208 |
| 484 | 3300048907 | Ga0496104_0062004 | Ga0496104_0062004_2101_2727 | 208 |
| 485 | 3300048911 | Ga0496108_0021655 | Ga0496108_0021655_3327_3953 | 208 |
| 486 | 3300048912 | Ga0496109_0042225 | Ga0496109_0042225_839_1465 | 208 |
| 487 | 3300048913 | Ga0496110_0301681 | Ga0496110_0301681_755_1381 | 208 |
| 488 | 3300048915 | Ga0496112_0015148 | Ga0496112_0015148_6024_6650 | 208 |
| 489 | 3300048916 | Ga0496113_0079264 | Ga0496113_0079264_1514_2140 | 208 |
| 490 | 3300049585 | Ga0501069_0065715 | Ga0501069_0065715_914_1540 | 208 |
| 491 | 3300053077 | Ga0495601_0027161 | Ga0495601_0027161_2029_2655 | 208 |
| 492 | 3300005327 | Ga0070658_10183396 | Ga0070658_101833962 | 209 |
| 493 | 3300005329 | Ga0070683_100589297 | Ga0070683_1005892971 | 209 |
| 494 | 3300005330 | Ga0070690_100291850 | Ga0070690_1002918502 | 209 |
| 495 | 3300005334 | Ga0068869_100104729 | Ga0068869_1001047294 | 209 |
| 496 | 3300005335 | Ga0070666_10273246 | Ga0070666_102732461 | 209 |
| 497 | 3300005336 | Ga0070680_100035599 | Ga0070680_1000355995 | 209 |
| 498 | 3300005337 | Ga0070682_100001003 | Ga0070682_10000100310 | 209 |
| 499 | 3300005337 | Ga0070682_100013088 | Ga0070682_1000130884 | 209 |
| 500 | 3300005337 | Ga0070682_100184641 | Ga0070682_1001846412 | 209 |
| 501 | 3300005338 | Ga0068868_100200423 | Ga0068868_1002004233 | 209 |
| 502 | 3300005340 | Ga0070689_100253351 | Ga0070689_1002533511 | 209 |
| 503 | 3300005341 | Ga0070691_10100303 | Ga0070691_101003033 | 209 |
| 504 | 3300005344 | Ga0070661_100142059 | Ga0070661_1001420594 | 209 |
| 505 | 3300005345 | Ga0070692_10002864 | Ga0070692_100028642 | 209 |
| 506 | 3300005345 | Ga0070692_10159184 | Ga0070692_101591842 | 209 |
| 507 | 3300005354 | Ga0070675_100125898 | Ga0070675_1001258981 | 209 |
| 508 | 3300005355 | Ga0070671_100289817 | Ga0070671_1002898172 | 209 |
| 509 | 3300005356 | Ga0070674_100099394 | Ga0070674_1000993944 | 209 |
| 510 | 3300005365 | Ga0070688_100362286 | Ga0070688_1003622862 | 209 |
| 511 | 3300005366 | Ga0070659_100003413 | Ga0070659_1000034138 | 209 |
| 512 | 3300005367 | Ga0070667_100152010 | Ga0070667_1001520104 | 209 |
| 513 | 3300005367 | Ga0070667_100168594 | Ga0070667_1001685942 | 209 |
| 514 | 3300005435 | Ga0070714_100000034 | Ga0070714_100000034130 | 209 |
| 515 | 3300005444 | Ga0070694_100604327 | Ga0070694_1006043271 | 209 |
| 516 | 3300005455 | Ga0070663_100228774 | Ga0070663_1002287742 | 209 |
| 517 | 3300005458 | Ga0070681_10002489 | Ga0070681_1000248914 | 209 |
| 518 | 3300005458 | Ga0070681_10037443 | Ga0070681_100374436 | 209 |
| 519 | 3300005458 | Ga0070681_10047300 | Ga0070681_100473007 | 209 |
| 520 | 3300005459 | Ga0068867_100032358 | Ga0068867_1000323582 | 209 |
| 521 | 3300005530 | Ga0070679_100033446 | Ga0070679_1000334462 | 209 |
| 522 | 3300005530 | Ga0070679_100178635 | Ga0070679_1001786353 | 209 |
| 523 | 3300005530 | Ga0070679_100328945 | Ga0070679_1003289452 | 209 |
| 524 | 3300005539 | Ga0068853_100001206 | Ga0068853_10000120611 | 209 |
| 525 | 3300005539 | Ga0068853_100046651 | Ga0068853_1000466516 | 209 |
| 526 | 3300005539 | Ga0068853_100131158 | Ga0068853_1001311584 | 209 |
| 527 | 3300005539 | Ga0068853_100206934 | Ga0068853_1002069343 | 209 |
| 528 | 3300005539 | Ga0068853_100274007 | Ga0068853_1002740071 | 209 |
| 529 | 3300005546 | Ga0070696_100002465 | Ga0070696_10000246514 | 209 |
| 530 | 3300005546 | Ga0070696_100003766 | Ga0070696_10000376610 | 209 |
| 531 | 3300005563 | Ga0068855_100013534 | Ga0068855_1000135347 | 209 |
| 532 | 3300005563 | Ga0068855_100022716 | Ga0068855_10002271611 | 209 |
| 533 | 3300005563 | Ga0068855_100374393 | Ga0068855_1003743932 | 209 |
| 534 | 3300005563 | Ga0068855_100753137 | Ga0068855_1007531372 | 209 |
| 535 | 3300005577 | Ga0068857_100059380 | Ga0068857_1000593805 | 209 |
| 536 | 3300006881 | Ga0068865_100059895 | Ga0068865_1000598952 | 209 |
| 537 | 3300009098 | Ga0105245_10757196 | Ga0105245_107571962 | 209 |
| 538 | 3300009101 | Ga0105247_10014315 | Ga0105247_100143157 | 209 |
| 539 | 3300009174 | Ga0105241_10067168 | Ga0105241_100671684 | 209 |
| 540 | 3300009174 | Ga0105241_10564590 | Ga0105241_105645902 | 209 |
| 541 | 3300009551 | Ga0105238_10014138 | Ga0105238_1001413811 | 209 |
| 542 | 3300009551 | Ga0105238_10268181 | Ga0105238_102681812 | 209 |
| 543 | 3300010375 | Ga0105239_10144450 | Ga0105239_101444504 | 209 |
| 544 | 3300013100 | Ga0157373_10072564 | Ga0157373_100725642 | 209 |
| 545 | 3300013102 | Ga0157371_10005748 | Ga0157371_100057482 | 209 |
| 546 | 3300013105 | Ga0157369_10252566 | Ga0157369_102525661 | 209 |
| 547 | 3300013306 | Ga0163162_10000015 | Ga0163162_10000015143 | 209 |
| 548 | 3300013306 | Ga0163162_10179018 | Ga0163162_101790182 | 209 |
| 549 | 3300013306 | Ga0163162_10603941 | Ga0163162_106039412 | 209 |
| 550 | 3300013306 | Ga0163162_10722167 | Ga0163162_107221672 | 209 |
| 551 | 3300013307 | Ga0157372_10007227 | Ga0157372_1000722714 | 209 |
| 552 | 3300013307 | Ga0157372_10531026 | Ga0157372_105310262 | 209 |
| 553 | 3300013308 | Ga0157375_11094181 | Ga0157375_110941812 | 209 |
| 554 | 3300014497 | Ga0182008_10012022 | Ga0182008_100120227 | 209 |
| 555 | 3300014497 | Ga0182008_10044098 | Ga0182008_100440984 | 209 |
| 556 | 3300015261 | Ga0182006_1000072 | Ga0182006_100007265 | 209 |
| 557 | 3300015262 | Ga0182007_10014466 | Ga0182007_100144664 | 209 |
| 558 | 3300015265 | Ga0182005_1008905 | Ga0182005_10089052 | 209 |
| 559 | 3300017792 | Ga0163161_10003999 | Ga0163161_1000399911 | 209 |
| 560 | 3300025302 | Ga0207426_1008053 | Ga0207426_10080534 | 209 |
| 561 | 3300025903 | Ga0207680_10226315 | Ga0207680_102263152 | 209 |
| 562 | 3300025904 | Ga0207647_10008817 | Ga0207647_100088176 | 209 |
| 563 | 3300025909 | Ga0207705_10156265 | Ga0207705_101562652 | 209 |
| 564 | 3300025912 | Ga0207707_10000933 | Ga0207707_1000093316 | 209 |
| 565 | 3300025914 | Ga0207671_10076557 | Ga0207671_100765574 | 209 |
| 566 | 3300025917 | Ga0207660_10012771 | Ga0207660_100127717 | 209 |
| 567 | 3300025919 | Ga0207657_10329127 | Ga0207657_103291272 | 209 |
| 568 | 3300025920 | Ga0207649_10370334 | Ga0207649_103703342 | 209 |
| 569 | 3300025921 | Ga0207652_10002665 | Ga0207652_1000266516 | 209 |
| 570 | 3300025921 | Ga0207652_10252094 | Ga0207652_102520942 | 209 |
| 571 | 3300025921 | Ga0207652_10596818 | Ga0207652_105968182 | 209 |
| 572 | 3300025924 | Ga0207694_10013765 | Ga0207694_100137651 | 209 |
| 573 | 3300025925 | Ga0207650_10153251 | Ga0207650_101532514 | 209 |
| 574 | 3300025926 | Ga0207659_10204061 | Ga0207659_102040613 | 209 |
| 575 | 3300025929 | Ga0207664_10000021 | Ga0207664_1000002193 | 209 |
| 576 | 3300025932 | Ga0207690_10000734 | Ga0207690_1000073424 | 209 |
| 577 | 3300025932 | Ga0207690_10005653 | Ga0207690_100056538 | 209 |
| 578 | 3300025933 | Ga0207706_10035735 | Ga0207706_100357356 | 209 |
| 579 | 3300025934 | Ga0207686_10009012 | Ga0207686_100090126 | 209 |
| 580 | 3300025936 | Ga0207670_10490945 | Ga0207670_104909452 | 209 |
| 581 | 3300025937 | Ga0207669_10406243 | Ga0207669_104062432 | 209 |
| 582 | 3300025942 | Ga0207689_10128956 | Ga0207689_101289564 | 209 |
| 583 | 3300025949 | Ga0207667_10136837 | Ga0207667_101368374 | 209 |
| 584 | 3300026023 | Ga0207677_10415334 | Ga0207677_104153342 | 209 |
| 585 | 3300026041 | Ga0207639_10023741 | Ga0207639_100237412 | 209 |
| 586 | 3300026041 | Ga0207639_10070097 | Ga0207639_100700972 | 209 |
| 587 | 3300026041 | Ga0207639_10187967 | Ga0207639_101879672 | 209 |
| 588 | 3300026041 | Ga0207639_10294512 | Ga0207639_102945121 | 209 |
| 589 | 3300026067 | Ga0207678_10060058 | Ga0207678_100600585 | 209 |
| 590 | 3300026089 | Ga0207648_10122708 | Ga0207648_101227083 | 209 |
| 591 | 3300026095 | Ga0207676_10120531 | Ga0207676_101205313 | 209 |
| 592 | 3300026116 | Ga0207674_10009055 | Ga0207674_1000905512 | 209 |
| 593 | 3300028379 | Ga0268266_10099202 | Ga0268266_100992022 | 209 |
| 594 | 3300028379 | Ga0268266_10284648 | Ga0268266_102846481 | 209 |
| 595 | 3300028381 | Ga0268264_10001065 | Ga0268264_1000106513 | 209 |
| 596 | 3300028381 | Ga0268264_10370134 | Ga0268264_103701342 | 209 |
| 597 | 3300031691 | Ga0316579_10148270 | Ga0316579_101482702 | 209 |
| 598 | 3300031727 | Ga0316576_10111114 | Ga0316576_101111142 | 209 |
| 599 | 3300031728 | Ga0316578_10020751 | Ga0316578_100207512 | 209 |
| 600 | 3300031728 | Ga0316578_10048071 | Ga0316578_100480715 | 209 |
| 601 | 3300031728 | Ga0316578_10107553 | Ga0316578_101075531 | 209 |
| 602 | 3300031728 | Ga0316578_10123309 | Ga0316578_101233093 | 209 |
| 603 | 3300031730 | Ga0307516_10038403 | Ga0307516_100384032 | 209 |
| 604 | 3300031733 | Ga0316577_10108346 | Ga0316577_101083462 | 209 |
| 605 | 3300031824 | Ga0307413_10089612 | Ga0307413_100896124 | 209 |
| 606 | 3300032004 | Ga0307414_10260042 | Ga0307414_102600422 | 209 |
| 607 | 3300032133 | Ga0316583_10003904 | Ga0316583_100039044 | 209 |
| 608 | 3300032133 | Ga0316583_10038033 | Ga0316583_100380332 | 209 |
| 609 | 3300032168 | Ga0316593_10030131 | Ga0316593_100301312 | 209 |
| 610 | 3300033527 | Ga0316586_1014900 | Ga0316586_10149002 | 209 |
| 611 | 3300035398 | Ga0316574_0004019 | Ga0316574_0004019_1117_1749 | 209 |
| 612 | 3300035398 | Ga0316574_0005371 | Ga0316574_0005371_748_1380 | 209 |
| 613 | 3300035398 | Ga0316574_0066076 | Ga0316574_0066076_476_1117 | 209 |
| 614 | 3300036647 | Ga0316582_0062775 | Ga0316582_0062775_185_817 | 209 |
| 615 | 3300036712 | Ga0316584_0002666 | Ga0316584_0002666_457_1089 | 209 |
| 616 | 3300036712 | Ga0316584_0034789 | Ga0316584_0034789_2871_3503 | 209 |
| 617 | 3300036712 | Ga0316584_0042038 | Ga0316584_0042038_664_1296 | 209 |
| 618 | 3300037418 | Ga0395900_0000590 | Ga0395900_0000590_45764_46459 | 209 |
| 619 | 3300037466 | Ga0395898_0313103 | Ga0395898_0313103_664_1359 | 209 |
| 620 | 3300037588 | Ga0316581_0060041 | Ga0316581_0060041_221_853 | 209 |
| 621 | 3300038443 | Ga0395901_0625910 | Ga0395901_0625910_13_666 | 209 |
| 622 | 3300039437 | Ga0436365_0481947 | Ga0436365_0481947_792_1427 | 209 |
| 623 | 3300041443 | Ga0451789_1305691 | Ga0451789_1305691_141_773 | 209 |
| 624 | 3300041452 | Ga0451793_0331580 | Ga0451793_0331580_345_977 | 209 |
| 625 | 3300041456 | Ga0451795_0402747 | Ga0451795_0402747_377_1006 | 209 |
| 626 | 3300041460 | Ga0451802_0842713 | Ga0451802_0842713_76_708 | 209 |
| 627 | 3300041486 | Ga0451807_1276735 | Ga0451807_1276735_658_1290 | 209 |
| 628 | 3300041512 | Ga0451853_0542427 | Ga0451853_0542427_591_1220 | 209 |
| 629 | 3300042000 | Ga0439437_001897 | Ga0439437_001897_924_1574 | 209 |
| 630 | 3300042184 | Ga0450908_000100 | Ga0450908_000100_4522_5151 | 209 |
| 631 | 3300044658 | Ga0466972_0004200 | Ga0466972_0004200_2358_2987 | 209 |
| 632 | 3300044683 | Ga0466965_0018370 | Ga0466965_0018370_864_1514 | 209 |
| 633 | 3300044693 | Ga0466961_0000944 | Ga0466961_0000944_5619_6269 | 209 |
| 634 | 3300044694 | Ga0466963_0049646 | Ga0466963_0049646_108_758 | 209 |
| 635 | 3300044719 | Ga0466971_0003453 | Ga0466971_0003453_3795_4445 | 209 |
| 636 | 3300044842 | Ga0466957_0109288 | Ga0466957_0109288_227_877 | 209 |
| 637 | 3300045049 | Ga0466959_0004692 | Ga0466959_0004692_5339_5989 | 209 |
| 638 | 3300045836 | Ga0466958_0024993 | Ga0466958_0024993_2004_2654 | 209 |
| 639 | 3300046452 | Ga0495617_007162 | Ga0495617_007162_438_1067 | 209 |
| 640 | 3300046452 | Ga0495617_009741 | Ga0495617_009741_2339_2968 | 209 |
| 641 | 3300046460 | Ga0495638_0000146 | Ga0495638_0000146_445_1074 | 209 |
| 642 | 3300046460 | Ga0495638_0083807 | Ga0495638_0083807_1010_1639 | 209 |
| 643 | 3300046471 | Ga0495650_0005392 | Ga0495650_0005392_222_851 | 209 |
| 644 | 3300046471 | Ga0495650_0070421 | Ga0495650_0070421_674_1303 | 209 |
| 645 | 3300046474 | Ga0495605_0053908 | Ga0495605_0053908_521_1150 | 209 |
| 646 | 3300046491 | Ga0495584_0000823 | Ga0495584_0000823_15357_15986 | 209 |
| 647 | 3300046491 | Ga0495584_0188245 | Ga0495584_0188245_360_989 | 209 |
| 648 | 3300046492 | Ga0495585_0005197 | Ga0495585_0005197_7550_8179 | 209 |
| 649 | 3300046492 | Ga0495585_0306575 | Ga0495585_0306575_75_704 | 209 |
| 650 | 3300046501 | Ga0495607_0000122 | Ga0495607_0000122_49702_50331 | 209 |
| 651 | 3300046501 | Ga0495607_0000837 | Ga0495607_0000837_10746_11396 | 209 |
| 652 | 3300046506 | Ga0495583_0073334 | Ga0495583_0073334_407_1036 | 209 |
| 653 | 3300046507 | Ga0495606_0032598 | Ga0495606_0032598_2838_3467 | 209 |
| 654 | 3300046507 | Ga0495606_0036205 | Ga0495606_0036205_769_1398 | 209 |
| 655 | 3300046507 | Ga0495606_0037699 | Ga0495606_0037699_2511_3140 | 209 |
| 656 | 3300046512 | Ga0495610_0027392 | Ga0495610_0027392_1835_2464 | 209 |
| 657 | 3300046513 | Ga0495616_0000565 | Ga0495616_0000565_24966_25595 | 209 |
| 658 | 3300046515 | Ga0495620_0003610 | Ga0495620_0003610_1291_1920 | 209 |
| 659 | 3300046515 | Ga0495620_0034989 | Ga0495620_0034989_225_854 | 209 |
| 660 | 3300046518 | Ga0495631_0000808 | Ga0495631_0000808_11853_12482 | 209 |
| 661 | 3300046519 | Ga0495632_0009510 | Ga0495632_0009510_4151_4780 | 209 |
| 662 | 3300046524 | Ga0495648_0002534 | Ga0495648_0002534_13950_14579 | 209 |
| 663 | 3300046524 | Ga0495648_0084069 | Ga0495648_0084069_430_1059 | 209 |
| 664 | 3300046538 | Ga0495609_0003075 | Ga0495609_0003075_5591_6220 | 209 |
| 665 | 3300046557 | Ga0495622_0111740 | Ga0495622_0111740_207_836 | 209 |
| 666 | 3300046616 | Ga0495668_0003466 | Ga0495668_0003466_1455_2084 | 209 |
| 667 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2033473_2034102 | 209 |
| 668 | 3300046648 | Ga0495611_0000952 | Ga0495611_0000952_2702_3331 | 209 |
| 669 | 3300046660 | Ga0495625_0000022 | Ga0495625_0000022_222697_223326 | 209 |
| 670 | 3300046660 | Ga0495625_0086013 | Ga0495625_0086013_100_729 | 209 |
| 671 | 3300046665 | Ga0495661_0006772 | Ga0495661_0006772_6001_6630 | 209 |
| 672 | 3300046691 | Ga0495670_0012505 | Ga0495670_0012505_453_1082 | 209 |
| 673 | 3300046691 | Ga0495670_0280257 | Ga0495670_0280257_167_796 | 209 |
| 674 | 3300046692 | Ga0495671_0002998 | Ga0495671_0002998_9327_9956 | 209 |
| 675 | 3300046794 | Ga0495589_0000137 | Ga0495589_0000137_33418_34047 | 209 |
| 676 | 3300046810 | Ga0495660_0003625 | Ga0495660_0003625_8432_9061 | 209 |
| 677 | 3300046810 | Ga0495660_0028700 | Ga0495660_0028700_48_677 | 209 |
| 678 | 3300047323 | Ga0495683_0001586 | Ga0495683_0001586_2737_3366 | 209 |
| 679 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_144223_144852 | 209 |
| 680 | 3300047469 | Ga0495673_0000202 | Ga0495673_0000202_24317_24946 | 209 |
| 681 | 3300047469 | Ga0495673_0020879 | Ga0495673_0020879_347_976 | 209 |
| 682 | 3300047469 | Ga0495673_0021499 | Ga0495673_0021499_47_676 | 209 |
| 683 | 3300047472 | Ga0495686_0031480 | Ga0495686_0031480_2558_3187 | 209 |
| 684 | 3300047472 | Ga0495686_0224267 | Ga0495686_0224267_361_990 | 209 |
| 685 | 3300047472 | Ga0495686_0356009 | Ga0495686_0356009_140_769 | 209 |
| 686 | 3300047472 | Ga0495686_0356015 | Ga0495686_0356015_26_655 | 209 |
| 687 | 3300048903 | Ga0496100_0089591 | Ga0496100_0089591_559_1188 | 209 |
| 688 | 3300048904 | Ga0496101_0002136 | Ga0496101_0002136_10172_10801 | 209 |
| 689 | 3300048905 | Ga0496102_0263654 | Ga0496102_0263654_326_955 | 209 |
| 690 | 3300048909 | Ga0496106_0001864 | Ga0496106_0001864_2354_2983 | 209 |
| 691 | 3300048924 | Ga0496121_0063603 | Ga0496121_0063603_75_704 | 209 |
| 692 | 3300048924 | Ga0496121_0065807 | Ga0496121_0065807_75_704 | 209 |
| 693 | 3300048926 | Ga0496123_0032847 | Ga0496123_0032847_921_1550 | 209 |
| 694 | 3300048927 | Ga0496124_0097064 | Ga0496124_0097064_500_1150 | 209 |
| 695 | 3300049459 | Ga0495678_000099 | Ga0495678_000099_74511_75140 | 209 |
| 696 | 3300049460 | Ga0495682_0008463 | Ga0495682_0008463_2300_2929 | 209 |
| 697 | 3300049460 | Ga0495682_0010599 | Ga0495682_0010599_43_672 | 209 |
| 698 | 3300049570 | Ga0501033_0105324 | Ga0501033_0105324_836_1489 | 209 |
| 699 | 3300049571 | Ga0501034_0005361 | Ga0501034_0005361_9290_9943 | 209 |
| 700 | 3300049571 | Ga0501034_0021375 | Ga0501034_0021375_882_1511 | 209 |
| 701 | 3300049572 | Ga0501036_0191382 | Ga0501036_0191382_278_931 | 209 |
| 702 | 3300049573 | Ga0501037_0009963 | Ga0501037_0009963_893_1546 | 209 |
| 703 | 3300049586 | Ga0501070_0086050 | Ga0501070_0086050_597_1250 | 209 |
| 704 | 3300049686 | Ga0501257_027282 | Ga0501257_027282_553_1182 | 209 |
| 705 | 3300049686 | Ga0501257_077332 | Ga0501257_077332_47_679 | 209 |
| 706 | 3300049822 | Ga0501035_0326996 | Ga0501035_0326996_542_1195 | 209 |
| 707 | 3300049823 | Ga0501044_0092312 | Ga0501044_0092312_1185_1838 | 209 |
| 708 | 3300053079 | Ga0500610_0003430 | Ga0500610_0003430_4795_5424 | 209 |
| 709 | 3300053087 | Ga0500643_000118 | Ga0500643_000118_55634_56263 | 209 |
| 710 | 3300053092 | Ga0500583_0061072 | Ga0500583_0061072_190_819 | 209 |
| 711 | 3300053093 | Ga0500651_0000301 | Ga0500651_0000301_8045_8686 | 209 |
| 712 | 3300053093 | Ga0500651_0117828 | Ga0500651_0117828_272_901 | 209 |
| 713 | 3300053103 | Ga0500555_000715 | Ga0500555_000715_206_835 | 209 |
| 714 | 3300053160 | Ga0500633_0003369 | Ga0500633_0003369_2202_2831 | 209 |
| 715 | 3300061719 | Ga0466962_0010495 | Ga0466962_0010495_1668_2318 | 209 |
| 716 | 3300001991 | JGI24743J22301_10044081 | JGI24743J22301_100440812 | 210 |
| 717 | 3300003781 | Ga0055536_1005660 | Ga0055536_10056605 | 210 |
| 718 | 3300003794 | Ga0055531_10024585 | Ga0055531_100245852 | 210 |
| 719 | 3300005337 | Ga0070682_100437538 | Ga0070682_1004375382 | 210 |
| 720 | 3300005344 | Ga0070661_100027894 | Ga0070661_1000278942 | 210 |
| 721 | 3300005539 | Ga0068853_100004939 | Ga0068853_1000049399 | 210 |
| 722 | 3300005548 | Ga0070665_100181726 | Ga0070665_1001817263 | 210 |
| 723 | 3300005563 | Ga0068855_100059017 | Ga0068855_1000590174 | 210 |
| 724 | 3300005563 | Ga0068855_100187908 | Ga0068855_1001879082 | 210 |
| 725 | 3300005564 | Ga0070664_100083939 | Ga0070664_1000839394 | 210 |
| 726 | 3300005577 | Ga0068857_100120536 | Ga0068857_1001205362 | 210 |
| 727 | 3300005578 | Ga0068854_100049360 | Ga0068854_1000493602 | 210 |
| 728 | 3300005614 | Ga0068856_100007871 | Ga0068856_1000078717 | 210 |
| 729 | 3300005614 | Ga0068856_100117830 | Ga0068856_1001178302 | 210 |
| 730 | 3300005617 | Ga0068859_100344807 | Ga0068859_1003448072 | 210 |
| 731 | 3300005618 | Ga0068864_100006173 | Ga0068864_1000061737 | 210 |
| 732 | 3300005834 | Ga0068851_10068612 | Ga0068851_100686122 | 210 |
| 733 | 3300005841 | Ga0068863_100045714 | Ga0068863_1000457146 | 210 |
| 734 | 3300005842 | Ga0068858_100042643 | Ga0068858_1000426435 | 210 |
| 735 | 3300005843 | Ga0068860_100119696 | Ga0068860_1001196962 | 210 |
| 736 | 3300006237 | Ga0097621_100339840 | Ga0097621_1003398402 | 210 |
| 737 | 3300006358 | Ga0068871_100297362 | Ga0068871_1002973623 | 210 |
| 738 | 3300006931 | Ga0097620_100344832 | Ga0097620_1003448322 | 210 |
| 739 | 3300009011 | Ga0105251_10002861 | Ga0105251_100028614 | 210 |
| 740 | 3300009093 | Ga0105240_10122181 | Ga0105240_101221815 | 210 |
| 741 | 3300009174 | Ga0105241_10016408 | Ga0105241_100164082 | 210 |
| 742 | 3300009545 | Ga0105237_10025841 | Ga0105237_100258415 | 210 |
| 743 | 3300009551 | Ga0105238_10167385 | Ga0105238_101673853 | 210 |
| 744 | 3300010375 | Ga0105239_10067815 | Ga0105239_100678155 | 210 |
| 745 | 3300013104 | Ga0157370_10060548 | Ga0157370_100605486 | 210 |
| 746 | 3300013105 | Ga0157369_10020635 | Ga0157369_100206355 | 210 |
| 747 | 3300013307 | Ga0157372_10004512 | Ga0157372_100045125 | 210 |
| 748 | 3300025292 | Ga0209676_1000034 | Ga0209676_100003439 | 210 |
| 749 | 3300025298 | Ga0209050_1064702 | Ga0209050_10647021 | 210 |
| 750 | 3300025304 | Ga0209257_1000302 | Ga0209257_100030292 | 210 |
| 751 | 3300025304 | Ga0209257_1000585 | Ga0209257_100058549 | 210 |
| 752 | 3300025321 | Ga0207656_10096211 | Ga0207656_100962112 | 210 |
| 753 | 3300025904 | Ga0207647_10004843 | Ga0207647_100048432 | 210 |
| 754 | 3300025911 | Ga0207654_10410006 | Ga0207654_104100062 | 210 |
| 755 | 3300025913 | Ga0207695_10000536 | Ga0207695_100005365 | 210 |
| 756 | 3300025914 | Ga0207671_10065136 | Ga0207671_100651362 | 210 |
| 757 | 3300025917 | Ga0207660_10308039 | Ga0207660_103080392 | 210 |
| 758 | 3300025919 | Ga0207657_10001316 | Ga0207657_1000131614 | 210 |
| 759 | 3300025920 | Ga0207649_10014164 | Ga0207649_100141644 | 210 |
| 760 | 3300025920 | Ga0207649_10200821 | Ga0207649_102008213 | 210 |
| 761 | 3300025921 | Ga0207652_10320833 | Ga0207652_103208332 | 210 |
| 762 | 3300025924 | Ga0207694_10128108 | Ga0207694_101281082 | 210 |
| 763 | 3300025927 | Ga0207687_10353911 | Ga0207687_103539112 | 210 |
| 764 | 3300025932 | Ga0207690_10069040 | Ga0207690_100690402 | 210 |
| 765 | 3300025933 | Ga0207706_10145804 | Ga0207706_101458042 | 210 |
| 766 | 3300025938 | Ga0207704_10057192 | Ga0207704_100571922 | 210 |
| 767 | 3300025942 | Ga0207689_10031609 | Ga0207689_100316093 | 210 |
| 768 | 3300025944 | Ga0207661_10229204 | Ga0207661_102292042 | 210 |
| 769 | 3300025945 | Ga0207679_10183613 | Ga0207679_101836132 | 210 |
| 770 | 3300025949 | Ga0207667_10002731 | Ga0207667_1000273120 | 210 |
| 771 | 3300025949 | Ga0207667_10027065 | Ga0207667_100270655 | 210 |
| 772 | 3300025986 | Ga0207658_10043114 | Ga0207658_100431142 | 210 |
| 773 | 3300026041 | Ga0207639_10189556 | Ga0207639_101895562 | 210 |
| 774 | 3300026041 | Ga0207639_10273645 | Ga0207639_102736452 | 210 |
| 775 | 3300026067 | Ga0207678_10226119 | Ga0207678_102261192 | 210 |
| 776 | 3300026078 | Ga0207702_10911004 | Ga0207702_109110042 | 210 |
| 777 | 3300026116 | Ga0207674_10003941 | Ga0207674_100039415 | 210 |
| 778 | 3300026142 | Ga0207698_10004066 | Ga0207698_100040667 | 210 |
| 779 | 3300026142 | Ga0207698_10182890 | Ga0207698_101828902 | 210 |
| 780 | 3300028379 | Ga0268266_10068858 | Ga0268266_100688584 | 210 |
| 781 | 3300028381 | Ga0268264_10072417 | Ga0268264_100724175 | 210 |
| 782 | 3300028794 | Ga0307515_10144069 | Ga0307515_101440691 | 210 |
| 783 | 3300032004 | Ga0307414_10002380 | Ga0307414_100023802 | 210 |
| 784 | 3300041443 | Ga0451789_0324187 | Ga0451789_0324187_851_1483 | 210 |
| 785 | 3300041451 | Ga0451791_0734992 | Ga0451791_0734992_3301_3933 | 210 |
| 786 | 3300041451 | Ga0451791_0977198 | Ga0451791_0977198_132_764 | 210 |
| 787 | 3300041451 | Ga0451791_1698871 | Ga0451791_1698871_323_955 | 210 |
| 788 | 3300041452 | Ga0451793_1036736 | Ga0451793_1036736_786_1418 | 210 |
| 789 | 3300041452 | Ga0451793_1912156 | Ga0451793_1912156_391_1023 | 210 |
| 790 | 3300041456 | Ga0451795_0613894 | Ga0451795_0613894_1372_2004 | 210 |
| 791 | 3300041456 | Ga0451795_1282306 | Ga0451795_1282306_972_1604 | 210 |
| 792 | 3300041459 | Ga0451800_0416075 | Ga0451800_0416075_3123_3755 | 210 |
| 793 | 3300041460 | Ga0451802_1409802 | Ga0451802_1409802_244_876 | 210 |
| 794 | 3300041460 | Ga0451802_1663798 | Ga0451802_1663798_110_742 | 210 |
| 795 | 3300041462 | Ga0451806_051010 | Ga0451806_051010_1563_2195 | 210 |
| 796 | 3300041463 | Ga0451804_0778980 | Ga0451804_0778980_1227_1859 | 210 |
| 797 | 3300041486 | Ga0451807_2045398 | Ga0451807_2045398_1338_1970 | 210 |
| 798 | 3300041496 | Ga0451839_1349525 | Ga0451839_1349525_177_809 | 210 |
| 799 | 3300041509 | Ga0451843_0541203 | Ga0451843_0541203_613_1245 | 210 |
| 800 | 3300041509 | Ga0451843_1620786 | Ga0451843_1620786_396_1028 | 210 |
| 801 | 3300041512 | Ga0451853_0536472 | Ga0451853_0536472_117_749 | 210 |
| 802 | 3300041999 | Ga0439433_0018730 | Ga0439433_0018730_30_662 | 210 |
| 803 | 3300042007 | Ga0439449_0063355 | Ga0439449_0063355_83_715 | 210 |
| 804 | 3300042435 | Ga0439434_0134681 | Ga0439434_0134681_155_787 | 210 |
| 805 | 3300044684 | Ga0466966_0000529 | Ga0466966_0000529_7270_7902 | 210 |
| 806 | 3300046460 | Ga0495638_0135010 | Ga0495638_0135010_364_996 | 210 |
| 807 | 3300046525 | Ga0495663_0007180 | Ga0495663_0007180_2078_2710 | 210 |
| 808 | 3300046660 | Ga0495625_0387271 | Ga0495625_0387271_27_689 | 210 |
| 809 | 3300046692 | Ga0495671_0016012 | Ga0495671_0016012_2422_3054 | 210 |
| 810 | 3300048920 | Ga0496117_0000446 | Ga0496117_0000446_8101_8733 | 210 |
| 811 | 3300048921 | Ga0496118_0099723 | Ga0496118_0099723_113_745 | 210 |
| 812 | 3300048922 | Ga0496119_0017246 | Ga0496119_0017246_4296_4928 | 210 |
| 813 | 3300048923 | Ga0496120_0000102 | Ga0496120_0000102_101250_101882 | 210 |
| 814 | 3300048925 | Ga0496122_0000158 | Ga0496122_0000158_115191_115823 | 210 |
| 815 | 3300048925 | Ga0496122_0006129 | Ga0496122_0006129_12804_13436 | 210 |
| 816 | 3300048925 | Ga0496122_0025404 | Ga0496122_0025404_3793_4425 | 210 |
| 817 | 3300048925 | Ga0496122_0088252 | Ga0496122_0088252_931_1563 | 210 |
| 818 | 3300048926 | Ga0496123_0000120 | Ga0496123_0000120_43530_44162 | 210 |
| 819 | 3300048926 | Ga0496123_0000151 | Ga0496123_0000151_139865_140497 | 210 |
| 820 | 3300048926 | Ga0496123_0074909 | Ga0496123_0074909_1049_1681 | 210 |
| 821 | 3300048927 | Ga0496124_0001894 | Ga0496124_0001894_5630_6262 | 210 |
| 822 | 3300049570 | Ga0501033_0000324 | Ga0501033_0000324_19155_19859 | 210 |
| 823 | 3300049571 | Ga0501034_0384902 | Ga0501034_0384902_336_998 | 210 |
| 824 | 3300049572 | Ga0501036_0004120 | Ga0501036_0004120_10209_10913 | 210 |
| 825 | 3300049573 | Ga0501037_0007006 | Ga0501037_0007006_1317_2021 | 210 |
| 826 | 3300049574 | Ga0501038_0003249 | Ga0501038_0003249_1871_2575 | 210 |
| 827 | 3300049575 | Ga0501039_0033038 | Ga0501039_0033038_1653_2357 | 210 |
| 828 | 3300049580 | Ga0501046_0113853 | Ga0501046_0113853_592_1239 | 210 |
| 829 | 3300049581 | Ga0501047_0198195 | Ga0501047_0198195_922_1626 | 210 |
| 830 | 3300049581 | Ga0501047_0252344 | Ga0501047_0252344_859_1506 | 210 |
| 831 | 3300049585 | Ga0501069_0064299 | Ga0501069_0064299_935_1639 | 210 |
| 832 | 3300049586 | Ga0501070_0143052 | Ga0501070_0143052_568_1272 | 210 |
| 833 | 3300049586 | Ga0501070_0330286 | Ga0501070_0330286_477_1124 | 210 |
| 834 | 3300049589 | Ga0501073_0006715 | Ga0501073_0006715_5888_6592 | 210 |
| 835 | 3300049589 | Ga0501073_0139117 | Ga0501073_0139117_540_1202 | 210 |
| 836 | 3300049590 | Ga0501074_0160531 | Ga0501074_0160531_512_1216 | 210 |
| 837 | 3300049592 | Ga0501076_0799392 | Ga0501076_0799392_16_720 | 210 |
| 838 | 3300049593 | Ga0501077_0229963 | Ga0501077_0229963_484_1146 | 210 |
| 839 | 3300049742 | Ga0501080_0000739 | Ga0501080_0000739_11689_12336 | 210 |
| 840 | 3300049742 | Ga0501080_0015445 | Ga0501080_0015445_3400_4104 | 210 |
| 841 | 3300049822 | Ga0501035_0037489 | Ga0501035_0037489_704_1408 | 210 |
| 842 | 3300049823 | Ga0501044_0088409 | Ga0501044_0088409_847_1551 | 210 |
| 843 | 3300053134 | Ga0500658_0220297 | Ga0500658_0220297_92_724 | 210 |
| 844 | 3300054114 | Ga0501084_0131217 | Ga0501084_0131217_577_1281 | 210 |
| 845 | 3300060353 | Ga0501082_0215244 | Ga0501082_0215244_755_1402 | 210 |
| 846 | 3300005331 | Ga0070670_100026260 | Ga0070670_1000262602 | 211 |
| 847 | 3300005335 | Ga0070666_10214078 | Ga0070666_102140782 | 211 |
| 848 | 3300005338 | Ga0068868_100062603 | Ga0068868_1000626032 | 211 |
| 849 | 3300005344 | Ga0070661_100053518 | Ga0070661_1000535184 | 211 |
| 850 | 3300005344 | Ga0070661_100194320 | Ga0070661_1001943202 | 211 |
| 851 | 3300005355 | Ga0070671_100108553 | Ga0070671_1001085533 | 211 |
| 852 | 3300005367 | Ga0070667_100080731 | Ga0070667_1000807314 | 211 |
| 853 | 3300005455 | Ga0070663_100194361 | Ga0070663_1001943612 | 211 |
| 854 | 3300005535 | Ga0070684_100071094 | Ga0070684_1000710944 | 211 |
| 855 | 3300005539 | Ga0068853_100080405 | Ga0068853_1000804055 | 211 |
| 856 | 3300005563 | Ga0068855_100109324 | Ga0068855_1001093244 | 211 |
| 857 | 3300005563 | Ga0068855_100398516 | Ga0068855_1003985162 | 211 |
| 858 | 3300005564 | Ga0070664_100176940 | Ga0070664_1001769402 | 211 |
| 859 | 3300005614 | Ga0068856_100082877 | Ga0068856_1000828772 | 211 |
| 860 | 3300005616 | Ga0068852_100042880 | Ga0068852_1000428803 | 211 |
| 861 | 3300005618 | Ga0068864_100046404 | Ga0068864_1000464046 | 211 |
| 862 | 3300005834 | Ga0068851_10090317 | Ga0068851_100903172 | 211 |
| 863 | 3300005841 | Ga0068863_100109182 | Ga0068863_1001091824 | 211 |
| 864 | 3300005842 | Ga0068858_100064412 | Ga0068858_1000644124 | 211 |
| 865 | 3300005983 | Ga0081540_1004799 | Ga0081540_10047997 | 211 |
| 866 | 3300006237 | Ga0097621_100242261 | Ga0097621_1002422612 | 211 |
| 867 | 3300006358 | Ga0068871_100150903 | Ga0068871_1001509032 | 211 |
| 868 | 3300006881 | Ga0068865_100024619 | Ga0068865_1000246194 | 211 |
| 869 | 3300009176 | Ga0105242_10130728 | Ga0105242_101307283 | 211 |
| 870 | 3300025903 | Ga0207680_10048120 | Ga0207680_100481204 | 211 |
| 871 | 3300025920 | Ga0207649_10388196 | Ga0207649_103881962 | 211 |
| 872 | 3300025925 | Ga0207650_10090521 | Ga0207650_100905214 | 211 |
| 873 | 3300025925 | Ga0207650_10228861 | Ga0207650_102288612 | 211 |
| 874 | 3300025931 | Ga0207644_10050387 | Ga0207644_100503872 | 211 |
| 875 | 3300025938 | Ga0207704_10009199 | Ga0207704_100091998 | 211 |
| 876 | 3300025941 | Ga0207711_10261887 | Ga0207711_102618872 | 211 |
| 877 | 3300025942 | Ga0207689_10378563 | Ga0207689_103785632 | 211 |
| 878 | 3300025945 | Ga0207679_10180849 | Ga0207679_101808492 | 211 |
| 879 | 3300025949 | Ga0207667_10689581 | Ga0207667_106895811 | 211 |
| 880 | 3300025960 | Ga0207651_10129993 | Ga0207651_101299932 | 211 |
| 881 | 3300025986 | Ga0207658_10485345 | Ga0207658_104853452 | 211 |
| 882 | 3300026023 | Ga0207677_10415658 | Ga0207677_104156582 | 211 |
| 883 | 3300026041 | Ga0207639_10088687 | Ga0207639_100886874 | 211 |
| 884 | 3300026078 | Ga0207702_10128052 | Ga0207702_101280522 | 211 |
| 885 | 3300026088 | Ga0207641_10201191 | Ga0207641_102011913 | 211 |
| 886 | 3300026095 | Ga0207676_10051657 | Ga0207676_100516572 | 211 |
| 887 | 3300026116 | Ga0207674_10189246 | Ga0207674_101892462 | 211 |
| 888 | 3300026142 | Ga0207698_10507817 | Ga0207698_105078171 | 211 |
| 889 | 3300035692 | Ga0373935_0105935 | Ga0373935_0105935_491_1138 | 211 |
| 890 | 3300036401 | Ga0373937_0020829 | Ga0373937_0020829_21_668 | 211 |
| 891 | 3300037068 | Ga0373925_0231289 | Ga0373925_0231289_647_1294 | 211 |
| 892 | 3300042005 | Ga0439448_0071872 | Ga0439448_0071872_103_768 | 211 |
| 893 | 3300045051 | Ga0451576_0329324 | Ga0451576_0329324_531_1205 | 211 |
| 894 | 3300046459 | Ga0495629_0360024 | Ga0495629_0360024_177_824 | 211 |
| 895 | 3300046472 | Ga0495580_0145739 | Ga0495580_0145739_163_810 | 211 |
| 896 | 3300046473 | Ga0495582_0015290 | Ga0495582_0015290_826_1473 | 211 |
| 897 | 3300046535 | Ga0495586_0148323 | Ga0495586_0148323_454_1101 | 211 |
| 898 | 3300046681 | Ga0495647_0133369 | Ga0495647_0133369_378_1025 | 211 |
| 899 | 3300046683 | Ga0495658_0014949 | Ga0495658_0014949_434_1081 | 211 |
| 900 | 3300047317 | Ga0495604_0229304 | Ga0495604_0229304_115_762 | 211 |
| 901 | 3300048918 | Ga0496115_0249327 | Ga0496115_0249327_141_809 | 211 |
| 902 | 3300049574 | Ga0501038_0291379 | Ga0501038_0291379_507_1172 | 211 |
| 903 | 3300049575 | Ga0501039_0248540 | Ga0501039_0248540_403_1053 | 211 |
| 904 | 3300049580 | Ga0501046_0014037 | Ga0501046_0014037_20_685 | 211 |
| 905 | 3300049581 | Ga0501047_0120904 | Ga0501047_0120904_480_1145 | 211 |
| 906 | 3300049589 | Ga0501073_0294392 | Ga0501073_0294392_142_804 | 211 |
| 907 | 3300049741 | Ga0501079_0051130 | Ga0501079_0051130_722_1387 | 211 |
| 908 | 3300049741 | Ga0501079_0165261 | Ga0501079_0165261_752_1414 | 211 |
| 909 | 3300049742 | Ga0501080_0060091 | Ga0501080_0060091_797_1462 | 211 |
| 910 | 3300049742 | Ga0501080_0224665 | Ga0501080_0224665_375_1037 | 211 |
| 911 | 3300049744 | Ga0501083_0143256 | Ga0501083_0143256_142_807 | 211 |
| 912 | 3300053123 | Ga0500614_037085 | Ga0500614_037085_410_1057 | 211 |
| 913 | 3300054114 | Ga0501084_0149041 | Ga0501084_0149041_1201_1866 | 211 |
| 914 | 3300060353 | Ga0501082_0012969 | Ga0501082_0012969_286_951 | 211 |
| 915 | 3300005347 | Ga0070668_100206196 | Ga0070668_1002061961 | 212 |
| 916 | 3300005367 | Ga0070667_100128838 | Ga0070667_1001288382 | 212 |
| 917 | 3300005548 | Ga0070665_100210823 | Ga0070665_1002108232 | 212 |
| 918 | 3300005563 | Ga0068855_100430770 | Ga0068855_1004307702 | 212 |
| 919 | 3300005617 | Ga0068859_100000265 | Ga0068859_10000026513 | 212 |
| 920 | 3300005834 | Ga0068851_10011387 | Ga0068851_100113872 | 212 |
| 921 | 3300005841 | Ga0068863_100167612 | Ga0068863_1001676123 | 212 |
| 922 | 3300005842 | Ga0068858_100124970 | Ga0068858_1001249704 | 212 |
| 923 | 3300005843 | Ga0068860_100048149 | Ga0068860_1000481492 | 212 |
| 924 | 3300005844 | Ga0068862_100000447 | Ga0068862_1000004475 | 212 |
| 925 | 3300006931 | Ga0097620_100000265 | Ga0097620_10000026513 | 212 |
| 926 | 3300009101 | Ga0105247_10176893 | Ga0105247_101768932 | 212 |
| 927 | 3300009545 | Ga0105237_10030200 | Ga0105237_100302008 | 212 |
| 928 | 3300009553 | Ga0105249_10417158 | Ga0105249_104171583 | 212 |
| 929 | 3300010375 | Ga0105239_10010293 | Ga0105239_100102932 | 212 |
| 930 | 3300025321 | Ga0207656_10026626 | Ga0207656_100266262 | 212 |
| 931 | 3300025986 | Ga0207658_10048019 | Ga0207658_100480195 | 212 |
| 932 | 3300026035 | Ga0207703_10134529 | Ga0207703_101345293 | 212 |
| 933 | 3300026088 | Ga0207641_10291447 | Ga0207641_102914472 | 212 |
| 934 | 3300028379 | Ga0268266_10362936 | Ga0268266_103629362 | 212 |
| 935 | 3300028380 | Ga0268265_10000608 | Ga0268265_1000060829 | 212 |
| 936 | 3300028381 | Ga0268264_10026185 | Ga0268264_100261854 | 212 |
| 937 | 3300009176 | Ga0105242_10004235 | Ga0105242_100042353 | 213 |
| 938 | 3300013306 | Ga0163162_10080190 | Ga0163162_100801902 | 213 |
| 939 | 3300013308 | Ga0157375_10000102 | Ga0157375_1000010265 | 213 |
| 940 | 3300014969 | Ga0157376_10001668 | Ga0157376_1000166815 | 213 |
| 941 | 3300041503 | Ga0451847_0708482 | Ga0451847_0708482_257_928 | 213 |
| 942 | 3300048907 | Ga0496104_0000022 | Ga0496104_0000022_178861_179517 | 213 |
| 943 | 3300048908 | Ga0496105_0000012 | Ga0496105_0000012_159387_160043 | 213 |
| 944 | 3300005355 | Ga0070671_100116529 | Ga0070671_1001165294 | 214 |
| 945 | 3300005458 | Ga0070681_10000344 | Ga0070681_100003447 | 214 |
| 946 | 3300005539 | Ga0068853_100043183 | Ga0068853_1000431835 | 214 |
| 947 | 3300013100 | Ga0157373_10077267 | Ga0157373_100772672 | 214 |
| 948 | 3300013307 | Ga0157372_10960657 | Ga0157372_109606571 | 214 |
| 949 | 3300013308 | Ga0157375_10001413 | Ga0157375_100014132 | 214 |
| 950 | 3300025903 | Ga0207680_10221044 | Ga0207680_102210442 | 214 |
| 951 | 3300025912 | Ga0207707_10000128 | Ga0207707_1000012837 | 214 |
| 952 | 3300025931 | Ga0207644_10105070 | Ga0207644_101050702 | 214 |
| 953 | 3300025933 | Ga0207706_10119408 | Ga0207706_101194082 | 214 |
| 954 | 3300025941 | Ga0207711_10187333 | Ga0207711_101873332 | 214 |
| 955 | 3300041498 | Ga0451841_0486514 | Ga0451841_0486514_186_902 | 214 |
| 956 | 3300044694 | Ga0466963_0181154 | Ga0466963_0181154_555_1214 | 214 |
| 957 | 3300005548 | Ga0070665_100252158 | Ga0070665_1002521583 | 215 |
| 958 | 3300005578 | Ga0068854_100153046 | Ga0068854_1001530462 | 215 |
| 959 | 3300013104 | Ga0157370_10007947 | Ga0157370_100079472 | 215 |
| 960 | 3300024225 | Ga0224572_1041748 | Ga0224572_10417482 | 215 |
| 961 | 3300025924 | Ga0207694_10138376 | Ga0207694_101383762 | 215 |
| 962 | 3300025981 | Ga0207640_10108250 | Ga0207640_101082502 | 215 |
| 963 | 3300026078 | Ga0207702_10306825 | Ga0207702_103068252 | 215 |
| 964 | 3300028379 | Ga0268266_10019047 | Ga0268266_100190472 | 215 |
| 965 | 3300053093 | Ga0500651_0020652 | Ga0500651_0020652_765_1469 | 215 |
| 966 | iso_pu_bacteria | 2643221562 | 2643829853 | 215 |
| 967 | iso_pu_bacteria | 2818991457 | 2819659776 | 215 |
| 968 | iso_pu_bacteria | 2852684882 | 2852685396 | 215 |
| 969 | iso_pu_bacteria | 2919130084 | 2919131511 | 215 |
| 970 | iso_pu_bacteria | 2929195423 | 2929198070 | 215 |
| 971 | iso_pu_bacteria | 8021622325 | 8021624413 | 215 |
| 972 | iso_pu_bacteria | 8021626552 | 8021628093 | 215 |
| 973 | iso_pu_bacteria | 8021648035 | 8021651015 | 215 |
| 974 | 3300005328 | Ga0070676_10027579 | Ga0070676_100275791 | 216 |
| 975 | 3300005334 | Ga0068869_100177272 | Ga0068869_1001772721 | 216 |
| 976 | 3300005338 | Ga0068868_100125813 | Ga0068868_1001258132 | 216 |
| 977 | 3300005347 | Ga0070668_100045299 | Ga0070668_1000452992 | 216 |
| 978 | 3300005353 | Ga0070669_100090318 | Ga0070669_1000903182 | 216 |
| 979 | 3300005354 | Ga0070675_100024532 | Ga0070675_1000245325 | 216 |
| 980 | 3300005455 | Ga0070663_100172682 | Ga0070663_1001726822 | 216 |
| 981 | 3300005455 | Ga0070663_100741370 | Ga0070663_1007413701 | 216 |
| 982 | 3300005456 | Ga0070678_100020450 | Ga0070678_1000204505 | 216 |
| 983 | 3300005543 | Ga0070672_100006538 | Ga0070672_1000065382 | 216 |
| 984 | 3300005548 | Ga0070665_100005179 | Ga0070665_1000051799 | 216 |
| 985 | 3300005563 | Ga0068855_100009974 | Ga0068855_1000099743 | 216 |
| 986 | 3300005616 | Ga0068852_100652465 | Ga0068852_1006524652 | 216 |
| 987 | 3300005840 | Ga0068870_10074338 | Ga0068870_100743382 | 216 |
| 988 | 3300005841 | Ga0068863_100016749 | Ga0068863_1000167492 | 216 |
| 989 | 3300005843 | Ga0068860_100707764 | Ga0068860_1007077642 | 216 |
| 990 | 3300009545 | Ga0105237_10305845 | Ga0105237_103058452 | 216 |
| 991 | 3300009551 | Ga0105238_10924708 | Ga0105238_109247082 | 216 |
| 992 | 3300009553 | Ga0105249_10365161 | Ga0105249_103651612 | 216 |
| 993 | 3300010375 | Ga0105239_10023801 | Ga0105239_100238012 | 216 |
| 994 | 3300025903 | Ga0207680_10246437 | Ga0207680_102464372 | 216 |
| 995 | 3300025907 | Ga0207645_10020277 | Ga0207645_100202772 | 216 |
| 996 | 3300025908 | Ga0207643_10006508 | Ga0207643_100065083 | 216 |
| 997 | 3300025914 | Ga0207671_10017813 | Ga0207671_1001781311 | 216 |
| 998 | 3300025923 | Ga0207681_10085431 | Ga0207681_100854313 | 216 |
| 999 | 3300025924 | Ga0207694_10663357 | Ga0207694_106633571 | 216 |
| 1000 | 3300025926 | Ga0207659_10089319 | Ga0207659_100893194 | 216 |
| 1001 | 3300025940 | Ga0207691_10032756 | Ga0207691_100327562 | 216 |
| 1002 | 3300025942 | Ga0207689_10086585 | Ga0207689_100865853 | 216 |
| 1003 | 3300025949 | Ga0207667_10295027 | Ga0207667_102950271 | 216 |
| 1004 | 3300025961 | Ga0207712_10469630 | Ga0207712_104696301 | 216 |
| 1005 | 3300025972 | Ga0207668_10027253 | Ga0207668_100272533 | 216 |
| 1006 | 3300026023 | Ga0207677_10201183 | Ga0207677_102011832 | 216 |
| 1007 | 3300026041 | Ga0207639_10000643 | Ga0207639_1000064322 | 216 |
| 1008 | 3300026067 | Ga0207678_10179595 | Ga0207678_101795952 | 216 |
| 1009 | 3300026067 | Ga0207678_10806208 | Ga0207678_108062082 | 216 |
| 1010 | 3300026088 | Ga0207641_10015458 | Ga0207641_100154582 | 216 |
| 1011 | 3300026121 | Ga0207683_10045586 | Ga0207683_100455862 | 216 |
| 1012 | 3300026142 | Ga0207698_10400302 | Ga0207698_104003022 | 216 |
| 1013 | 3300028379 | Ga0268266_10004292 | Ga0268266_100042923 | 216 |
| 1014 | 3300028379 | Ga0268266_10135762 | Ga0268266_101357622 | 216 |
| 1015 | 3300028381 | Ga0268264_10603014 | Ga0268264_106030141 | 216 |
| 1016 | 3300031616 | Ga0307508_10290933 | Ga0307508_102909332 | 216 |
| 1017 | 3300045049 | Ga0466959_0125006 | Ga0466959_0125006_979_1683 | 216 |
| 1018 | 3300048920 | Ga0496117_0008490 | Ga0496117_0008490_8604_9287 | 216 |
| 1019 | 3300048921 | Ga0496118_0004944 | Ga0496118_0004944_2843_3526 | 216 |
| 1020 | iso_pu_bacteria | 2718218334 | 2721026655 | 216 |
| 1021 | 3300032137 | Ga0316585_10002747 | Ga0316585_100027475 | 217 |
| 1022 | 3300005834 | Ga0068851_10067424 | Ga0068851_100674242 | 218 |
| 1023 | 3300026067 | Ga0207678_10201565 | Ga0207678_102015652 | 218 |
| 1024 | 2162886007 | SwRhRL2b_contig_136925 | SwRhRL2b_0185.00007400 | 219 |
| 1025 | 3300005289 | Ga0065704_10074187 | Ga0065704_100741875 | 219 |
| 1026 | 3300005289 | Ga0065704_10074217 | Ga0065704_100742179 | 219 |
| 1027 | 3300005331 | Ga0070670_100021104 | Ga0070670_1000211046 | 219 |
| 1028 | 3300015265 | Ga0182005_1002561 | Ga0182005_10025613 | 219 |
| 1029 | 3300025735 | Ga0207713_1000890 | Ga0207713_10008906 | 219 |
| 1030 | 3300025925 | Ga0207650_10002390 | Ga0207650_100023903 | 219 |
| 1031 | 3300027312 | Ga0209371_1000016 | Ga0209371_100001649 | 219 |
| 1032 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015521 | 219 |
| 1033 | 3300041452 | Ga0451793_1074463 | Ga0451793_1074463_121_834 | 219 |
| 1034 | 3300041453 | Ga0451797_0907429 | Ga0451797_0907429_353_1012 | 219 |
| 1035 | 3300048921 | Ga0496118_0043362 | Ga0496118_0043362_113_772 | 219 |
| 1036 | 3300048929 | Ga0496126_0037693 | Ga0496126_0037693_533_1192 | 219 |
| 1037 | 3300048929 | Ga0496126_0144798 | Ga0496126_0144798_211_906 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ej0-assembly1.cif.gz_A | ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative | 0.9835 | 39 | 215 |
| 1ej0-assembly1.cif.gz_A | ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative | 0.9621 | 39 | 215 |
| 7naf-assembly1.cif.gz_w | state e2 nucleolar 60s ribosomal biogenesis intermediate - spb1-mtd local model | 0.9587 | 27 | 219 |
| 8i9v-assembly1.cif.gz_CS | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 | 0.9571 | 27 | 219 |
| 7o9k-assembly1.cif.gz_n | human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu | 0.9553 | 38 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ej0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9835 | 39 | 215 | 3.40.50.150 |
| af_Q9VDT6_58_249_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9653 | 38 | 217 | 3.40.50.150 |
| 1ej0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9621 | 39 | 215 | 3.40.50.150 |
| af_Q5RJT2_23_207_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9557 | 38 | 219 | 3.40.50.150 |
| af_F4JTD2_19_207_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9545 | 37 | 219 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5M0A2-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9905 | 24 | 216 |
GO:0008650
|
| AF-A0A3C1XVZ4-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9897 | 84 | 219 |
GO:0008650
|
| AF-Q87F66-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9869 | 14 | 217 |
GO:0005737
GO:0008650 |
| AF-A0A3E1K5Q8-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9854 | 20 | 215 |
GO:0005737
GO:0008650 |
| AF-A0A3C0T5G8-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9844 | 126 | 214 |
GO:0008650
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar