F488740

General Info

Members Datasets Scaffolds Average Seq Length
1037 383 1019 213

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10221044|Ga0207680_102210442
Length 246
Sequence VQGIAGSDRVSCRHAASALSGRLTVARSKSSARWLKEHFSDPYVKRAQAEGWRSRAVFKLEELLERDRLLKPGIVVVDLGAAPGGWSQMVRESLRERGQDTGRVMALDILPMQGIGGVEFIEGDFREESVLKQLEALLNSQPVDLVLSDMAPNISGVESVDQARAMHLAELAQAFAAAHLKPGGAFLTKLFQGRGFDDYLRGLRADFERVSIRKPKASRARSAEVYALATGRRGTDAVGSLPKVPK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
7 2734482264 Dyella sp. AD052 Isolate Unclassified
8 2738543009 Luteibacter sp. OK325 Isolate Unclassified
9 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
10 2818991457 Xanthomonas translucens 569 Isolate Unclassified
11 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
12 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
13 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
14 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
15 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
199 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
208 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
209 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
233 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
234 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
235 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
236 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
237 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
240 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
241 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
242 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
243 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
246 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
304 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
370 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
371 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
372 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
373 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
374 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
381 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
382 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
383 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0.58
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 4.73
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_136925 2162886007 Bacteria 3390
2 JGI24743J22301_10044081 3300001991 Bacteria 900
3 Ga0055536_1005660 3300003781 Bacteria 6045
4 Ga0055531_10024585 3300003794 Bacteria 2217
5 Ga0058863_11775536 3300004799 Bacteria 1320
6 Ga0065704_10074187 3300005289 Bacteria 6463
7 Ga0065704_10074217 3300005289 Bacteria 6447
8 Ga0070658_10129147 3300005327 Bacteria 2105
9 Ga0070658_10183396 3300005327 Bacteria 1762
10 Ga0070658_10316884 3300005327 Bacteria 1331
11 Ga0070676_10027579 3300005328 Bacteria 3221
12 Ga0070683_100589297 3300005329 Bacteria 1064
13 Ga0070690_100012274 3300005330 Bacteria 5039
14 Ga0070690_100291850 3300005330 Bacteria 1166
15 Ga0070670_100003232 3300005331 Bacteria 13458
16 Ga0070670_100021104 3300005331 Bacteria 5602
17 Ga0070670_100026260 3300005331 Bacteria 5014
18 Ga0070670_100066426 3300005331 Bacteria 3095
19 Ga0070670_100184825 3300005331 Bacteria 1810
20 Ga0068869_100104729 3300005334 Bacteria 2145
21 Ga0068869_100143932 3300005334 Bacteria 1843
22 Ga0068869_100146300 3300005334 Bacteria 1829
23 Ga0068869_100177272 3300005334 Bacteria 1669
24 Ga0068869_100357235 3300005334 Bacteria 1192
25 Ga0070666_10021006 3300005335 Bacteria 4227
26 Ga0070666_10154259 3300005335 Bacteria 1603
27 Ga0070666_10214078 3300005335 Bacteria 1358
28 Ga0070666_10273246 3300005335 Bacteria 1200
29 Ga0070680_100035599 3300005336 Bacteria 4020
30 Ga0070680_100188167 3300005336 Bacteria 1739
31 Ga0070682_100001003 3300005337 Bacteria 16333
32 Ga0070682_100013088 3300005337 Bacteria 4766
33 Ga0070682_100113715 3300005337 Bacteria 1808
34 Ga0070682_100184641 3300005337 Bacteria 1459
35 Ga0070682_100437538 3300005337 Bacteria 998
36 Ga0068868_100003997 3300005338 Bacteria 10290
37 Ga0068868_100062603 3300005338 Bacteria 2949
38 Ga0068868_100125813 3300005338 Bacteria 2094
39 Ga0068868_100200423 3300005338 Bacteria 1664
40 Ga0068868_100307562 3300005338 Bacteria 1348
41 Ga0070660_100860189 3300005339 Bacteria 764
42 Ga0070689_100239447 3300005340 Bacteria 1494
43 Ga0070689_100253351 3300005340 Bacteria 1453
44 Ga0070691_10100303 3300005341 Bacteria 1437
45 Ga0070661_100026423 3300005344 Bacteria 4175
46 Ga0070661_100027894 3300005344 Bacteria 4069
47 Ga0070661_100053518 3300005344 Bacteria 2954
48 Ga0070661_100142059 3300005344 Bacteria 1810
49 Ga0070661_100158823 3300005344 Bacteria 1711
50 Ga0070661_100194320 3300005344 Bacteria 1548
51 Ga0070661_100521705 3300005344 Bacteria 953
52 Ga0070692_10002864 3300005345 Bacteria 6835
53 Ga0070692_10091172 3300005345 Bacteria 1657
54 Ga0070692_10159184 3300005345 Bacteria 1292
55 Ga0070668_100045299 3300005347 Bacteria 3376
56 Ga0070668_100206196 3300005347 Bacteria 1615
57 Ga0070669_100090318 3300005353 Bacteria 2296
58 Ga0070675_100024532 3300005354 Bacteria 4830
59 Ga0070675_100125898 3300005354 Bacteria 2180
60 Ga0070671_100108553 3300005355 Bacteria 2330
61 Ga0070671_100116529 3300005355 Bacteria 2246
62 Ga0070671_100289817 3300005355 Bacteria 1393
63 Ga0070674_100099394 3300005356 Bacteria 2117
64 Ga0070673_100027257 3300005364 Bacteria 4234
65 Ga0070673_100028362 3300005364 Bacteria 4163
66 Ga0070673_100182693 3300005364 Bacteria 1796
67 Ga0070688_100362286 3300005365 Bacteria 1064
68 Ga0070659_100003413 3300005366 Bacteria 11320
69 Ga0070667_100000005 3300005367 Bacteria 347268
70 Ga0070667_100062337 3300005367 Bacteria 3158
71 Ga0070667_100079369 3300005367 Bacteria 2805
72 Ga0070667_100080731 3300005367 Bacteria 2782
73 Ga0070667_100097600 3300005367 Bacteria 2535
74 Ga0070667_100128838 3300005367 Bacteria 2207
75 Ga0070667_100138220 3300005367 Bacteria 2131
76 Ga0070667_100152010 3300005367 Bacteria 2034
77 Ga0070667_100168594 3300005367 Bacteria 1932
78 Ga0070709_10003340 3300005434 Bacteria 8631
79 Ga0070714_100000034 3300005435 Bacteria 130742
80 Ga0070711_100069150 3300005439 Bacteria 2483
81 Ga0070711_100360920 3300005439 Bacteria 1170
82 Ga0070700_100102054 3300005441 Bacteria 1892
83 Ga0070694_100075030 3300005444 Bacteria 2338
84 Ga0070694_100116435 3300005444 Bacteria 1912
85 Ga0070694_100604327 3300005444 Bacteria 884
86 Ga0070663_100004878 3300005455 Bacteria 7916
87 Ga0070663_100009056 3300005455 Bacteria 6150
88 Ga0070663_100024628 3300005455 Bacteria 4054
89 Ga0070663_100055331 3300005455 Bacteria 2839
90 Ga0070663_100172682 3300005455 Bacteria 1672
91 Ga0070663_100194361 3300005455 Bacteria 1581
92 Ga0070663_100228774 3300005455 Bacteria 1463
93 Ga0070663_100335658 3300005455 Bacteria 1220
94 Ga0070663_100741370 3300005455 Bacteria 838
95 Ga0070678_100020450 3300005456 Bacteria 4344
96 Ga0070678_100117199 3300005456 Bacteria 2094
97 Ga0070678_100408866 3300005456 Bacteria 1181
98 Ga0070662_100008490 3300005457 Bacteria 6704
99 Ga0070662_100493055 3300005457 Bacteria 1021
100 Ga0070681_10000344 3300005458 Bacteria 37503
101 Ga0070681_10002489 3300005458 Bacteria 16870
102 Ga0070681_10037443 3300005458 Bacteria 4868
103 Ga0070681_10042418 3300005458 Bacteria 4559
104 Ga0070681_10047300 3300005458 Bacteria 4300
105 Ga0068867_100032358 3300005459 Bacteria 3782
106 Ga0070685_10003480 3300005466 Bacteria 8011
107 Ga0070685_10025507 3300005466 Bacteria 3255
108 Ga0070679_100033446 3300005530 Bacteria 5091
109 Ga0070679_100055197 3300005530 Bacteria 3956
110 Ga0070679_100178635 3300005530 Bacteria 2095
111 Ga0070679_100221925 3300005530 Bacteria 1851
112 Ga0070679_100328945 3300005530 Bacteria 1477
113 Ga0070684_100071094 3300005535 Bacteria 3063
114 Ga0068853_100001206 3300005539 Bacteria 18434
115 Ga0068853_100003367 3300005539 Bacteria 12234
116 Ga0068853_100004939 3300005539 Bacteria 10386
117 Ga0068853_100020363 3300005539 Bacteria 5516
118 Ga0068853_100039275 3300005539 Bacteria 4036
119 Ga0068853_100043183 3300005539 Bacteria 3857
120 Ga0068853_100046651 3300005539 Bacteria 3716
121 Ga0068853_100062215 3300005539 Bacteria 3229
122 Ga0068853_100080405 3300005539 Bacteria 2851
123 Ga0068853_100131158 3300005539 Bacteria 2243
124 Ga0068853_100145952 3300005539 Bacteria 2126
125 Ga0068853_100206934 3300005539 Bacteria 1787
126 Ga0068853_100274007 3300005539 Bacteria 1554
127 Ga0068853_100321467 3300005539 Bacteria 1434
128 Ga0068853_100547944 3300005539 Bacteria 1095
129 Ga0070672_100006538 3300005543 Bacteria 7838
130 Ga0070672_100278654 3300005543 Bacteria 1413
131 Ga0070672_100328539 3300005543 Bacteria 1301
132 Ga0070672_100396620 3300005543 Bacteria 1182
133 Ga0070686_100293412 3300005544 Bacteria 1204
134 Ga0070696_100002465 3300005546 Bacteria 12261
135 Ga0070696_100003766 3300005546 Bacteria 10129
136 Ga0070693_100005909 3300005547 Bacteria 5916
137 Ga0070665_100000062 3300005548 Bacteria 220304
138 Ga0070665_100001482 3300005548 Bacteria 27442
139 Ga0070665_100005179 3300005548 Bacteria 13491
140 Ga0070665_100022022 3300005548 Bacteria 6412
141 Ga0070665_100181726 3300005548 Bacteria 2104
142 Ga0070665_100210823 3300005548 Bacteria 1943
143 Ga0070665_100252158 3300005548 Bacteria 1766
144 Ga0070704_100343010 3300005549 Bacteria 1258
145 Ga0068855_100009974 3300005563 Bacteria 11447
146 Ga0068855_100013534 3300005563 Bacteria 9838
147 Ga0068855_100022716 3300005563 Bacteria 7516
148 Ga0068855_100059017 3300005563 Bacteria 4490
149 Ga0068855_100109324 3300005563 Bacteria 3175
150 Ga0068855_100187908 3300005563 Bacteria 2332
151 Ga0068855_100212061 3300005563 Bacteria 2175
152 Ga0068855_100374393 3300005563 Bacteria 1564
153 Ga0068855_100398516 3300005563 Bacteria 1508
154 Ga0068855_100430770 3300005563 Bacteria 1442
155 Ga0068855_100753137 3300005563 Bacteria 1038
156 Ga0070664_100004667 3300005564 Bacteria 10997
157 Ga0070664_100083939 3300005564 Bacteria 2749
158 Ga0070664_100176940 3300005564 Bacteria 1895
159 Ga0070664_100524934 3300005564 Bacteria 1093
160 Ga0068857_100059380 3300005577 Bacteria 3397
161 Ga0068857_100120536 3300005577 Bacteria 2361
162 Ga0068857_100241676 3300005577 Bacteria 1653
163 Ga0068857_100282547 3300005577 Bacteria 1527
164 Ga0068854_100049360 3300005578 Bacteria 3006
165 Ga0068854_100153046 3300005578 Bacteria 1780
166 Ga0068856_100007871 3300005614 Bacteria 10408
167 Ga0068856_100040580 3300005614 Bacteria 4572
168 Ga0068856_100082877 3300005614 Bacteria 3183
169 Ga0068856_100117830 3300005614 Bacteria 2656
170 Ga0068856_100169761 3300005614 Bacteria 2193
171 Ga0070702_100072672 3300005615 Bacteria 2036
172 Ga0068852_100005452 3300005616 Bacteria 9098
173 Ga0068852_100042880 3300005616 Bacteria 3833
174 Ga0068852_100136432 3300005616 Bacteria 2266
175 Ga0068852_100167428 3300005616 Bacteria 2057
176 Ga0068852_100277398 3300005616 Bacteria 1615
177 Ga0068852_100652465 3300005616 Bacteria 1060
178 Ga0068859_100000265 3300005617 Bacteria 52351
179 Ga0068859_100008663 3300005617 Bacteria 10281
180 Ga0068859_100169678 3300005617 Bacteria 2263
181 Ga0068859_100344807 3300005617 Bacteria 1584
182 Ga0068864_100005830 3300005618 Bacteria 10101
183 Ga0068864_100006173 3300005618 Bacteria 9826
184 Ga0068864_100046404 3300005618 Bacteria 3728
185 Ga0068864_100225814 3300005618 Bacteria 1730
186 Ga0068861_100036281 3300005719 Bacteria 3658
187 Ga0068861_100068799 3300005719 Bacteria 2737
188 Ga0068861_100756616 3300005719 Bacteria 908
189 Ga0068851_10011387 3300005834 Bacteria 4169
190 Ga0068851_10047128 3300005834 Bacteria 2182
191 Ga0068851_10067424 3300005834 Bacteria 1845
192 Ga0068851_10068612 3300005834 Bacteria 1830
193 Ga0068851_10090317 3300005834 Bacteria 1612
194 Ga0068870_10074338 3300005840 Bacteria 1862
195 Ga0068863_100016749 3300005841 Bacteria 7032
196 Ga0068863_100035993 3300005841 Bacteria 4714
197 Ga0068863_100045714 3300005841 Bacteria 4155
198 Ga0068863_100109182 3300005841 Bacteria 2633
199 Ga0068863_100167612 3300005841 Bacteria 2106
200 Ga0068863_100189952 3300005841 Bacteria 1974
201 Ga0068863_100335364 3300005841 Bacteria 1470
202 Ga0068863_100432497 3300005841 Bacteria 1290
203 Ga0068858_100001325 3300005842 Bacteria 25564
204 Ga0068858_100014128 3300005842 Bacteria 7530
205 Ga0068858_100042643 3300005842 Bacteria 4207
206 Ga0068858_100064412 3300005842 Bacteria 3392
207 Ga0068858_100124970 3300005842 Bacteria 2408
208 Ga0068858_100233568 3300005842 Bacteria 1744
209 Ga0068860_100019554 3300005843 Bacteria 6565
210 Ga0068860_100048149 3300005843 Bacteria 4063
211 Ga0068860_100119696 3300005843 Bacteria 2521
212 Ga0068860_100707764 3300005843 Bacteria 1017
213 Ga0068862_100000447 3300005844 Bacteria 44742
214 Ga0068862_100289079 3300005844 Bacteria 1505
215 Ga0068862_100400602 3300005844 Bacteria 1284
216 Ga0081455_10045286 3300005937 Bacteria 3829
217 Ga0081540_1004799 3300005983 Bacteria 10189
218 Ga0097621_100009176 3300006237 Bacteria 7170
219 Ga0097621_100101376 3300006237 Bacteria 2422
220 Ga0097621_100118942 3300006237 Bacteria 2239
221 Ga0097621_100242261 3300006237 Bacteria 1577
222 Ga0097621_100339840 3300006237 Bacteria 1333
223 Ga0097621_100520190 3300006237 Bacteria 1080
224 Ga0068871_100005841 3300006358 Bacteria 8651
225 Ga0068871_100039070 3300006358 Bacteria 3795
226 Ga0068871_100064954 3300006358 Bacteria 2988
227 Ga0068871_100150903 3300006358 Bacteria 1982
228 Ga0068871_100196340 3300006358 Bacteria 1741
229 Ga0068871_100297362 3300006358 Bacteria 1416
230 Ga0075428_100003215 3300006844 Bacteria 17873
231 Ga0075430_100013050 3300006846 Bacteria 7081
232 Ga0075433_10031019 3300006852 Bacteria 4566
233 Ga0075434_100738905 3300006871 Bacteria 1001
234 Ga0068865_100024619 3300006881 Bacteria 3951
235 Ga0068865_100059895 3300006881 Bacteria 2664
236 Ga0068865_100116570 3300006881 Bacteria 1978
237 Ga0068865_100201766 3300006881 Bacteria 1544
238 Ga0097620_100000265 3300006931 Bacteria 52351
239 Ga0097620_100008663 3300006931 Bacteria 10281
240 Ga0097620_100169686 3300006931 Bacteria 2263
241 Ga0097620_100344832 3300006931 Bacteria 1584
242 Ga0099794_10081435 3300007265 Bacteria 1597
243 Ga0099795_10000064 3300007788 Bacteria 18756
244 Ga0099795_10050150 3300007788 Bacteria 1517
245 Ga0099795_10078744 3300007788 Bacteria 1257
246 Ga0105251_10002861 3300009011 Bacteria 13030
247 Ga0105251_10127723 3300009011 Bacteria 1153
248 Ga0105240_10001278 3300009093 Bacteria 43550
249 Ga0105240_10061336 3300009093 Bacteria 4686
250 Ga0105240_10122181 3300009093 Bacteria 3134
251 Ga0105240_10163453 3300009093 Bacteria 2642
252 Ga0105240_10405029 3300009093 Bacteria 1536
253 Ga0105240_10439147 3300009093 Bacteria 1463
254 Ga0105240_10554704 3300009093 Bacteria 1271
255 Ga0105240_10573559 3300009093 Bacteria 1245
256 Ga0111539_10018132 3300009094 Bacteria 8718
257 Ga0111539_11223966 3300009094 Bacteria 872
258 Ga0111539_11339585 3300009094 Bacteria 831
259 Ga0105245_10003531 3300009098 Bacteria 13979
260 Ga0105245_10363834 3300009098 Bacteria 1436
261 Ga0105245_10757196 3300009098 Bacteria 1007
262 Ga0105245_10773967 3300009098 Bacteria 997
263 Ga0105247_10014315 3300009101 Bacteria 4762
264 Ga0105247_10021024 3300009101 Bacteria 3926
265 Ga0105247_10176893 3300009101 Bacteria 1422
266 Ga0105243_11067241 3300009148 Bacteria 814
267 Ga0105241_10016408 3300009174 Bacteria 5432
268 Ga0105241_10067168 3300009174 Bacteria 2775
269 Ga0105241_10096475 3300009174 Bacteria 2342
270 Ga0105241_10564590 3300009174 Bacteria 1023
271 Ga0105242_10004235 3300009176 Bacteria 11187
272 Ga0105242_10130728 3300009176 Bacteria 2167
273 Ga0105242_10359063 3300009176 Bacteria 1348
274 Ga0105248_10002061 3300009177 Bacteria 22267
275 Ga0105248_10010033 3300009177 Bacteria 10429
276 Ga0105248_10129409 3300009177 Bacteria 2848
277 Ga0105248_10251166 3300009177 Bacteria 1991
278 Ga0105248_10296624 3300009177 Bacteria 1820
279 Ga0105237_10004780 3300009545 Bacteria 15572
280 Ga0105237_10025841 3300009545 Bacteria 6004
281 Ga0105237_10030200 3300009545 Bacteria 5507
282 Ga0105237_10195837 3300009545 Bacteria 2021
283 Ga0105237_10305845 3300009545 Bacteria 1593
284 Ga0105237_10442532 3300009545 Bacteria 1305
285 Ga0105237_11012795 3300009545 Bacteria 837
286 Ga0105238_10014138 3300009551 Bacteria 8072
287 Ga0105238_10024550 3300009551 Bacteria 6144
288 Ga0105238_10032728 3300009551 Bacteria 5292
289 Ga0105238_10055319 3300009551 Bacteria 3983
290 Ga0105238_10086971 3300009551 Bacteria 3113
291 Ga0105238_10092552 3300009551 Bacteria 3011
292 Ga0105238_10167385 3300009551 Bacteria 2174
293 Ga0105238_10268181 3300009551 Bacteria 1687
294 Ga0105238_10326225 3300009551 Bacteria 1521
295 Ga0105238_10367898 3300009551 Bacteria 1428
296 Ga0105238_10924708 3300009551 Bacteria 891
297 Ga0105249_10002473 3300009553 Bacteria 16002
298 Ga0105249_10025839 3300009553 Bacteria 5289
299 Ga0105249_10101054 3300009553 Bacteria 2712
300 Ga0105249_10216145 3300009553 Bacteria 1884
301 Ga0105249_10365161 3300009553 Bacteria 1466
302 Ga0105249_10417158 3300009553 Bacteria 1375
303 Ga0099796_10000064 3300010159 Bacteria 18870
304 Ga0105239_10010293 3300010375 Bacteria 10475
305 Ga0105239_10018289 3300010375 Bacteria 7748
306 Ga0105239_10023801 3300010375 Bacteria 6744
307 Ga0105239_10067815 3300010375 Bacteria 3920
308 Ga0105239_10106229 3300010375 Bacteria 3110
309 Ga0105239_10125127 3300010375 Bacteria 2857
310 Ga0105239_10144450 3300010375 Bacteria 2653
311 Ga0105239_10221435 3300010375 Bacteria 2122
312 Ga0105239_10325273 3300010375 Bacteria 1734
313 Ga0105246_10020552 3300011119 Bacteria 4236
314 Ga0105246_10729468 3300011119 Bacteria 872
315 Ga0157373_10072564 3300013100 Bacteria 2430
316 Ga0157373_10077267 3300013100 Bacteria 2349
317 Ga0157373_10155666 3300013100 Bacteria 1608
318 Ga0157371_10005748 3300013102 Bacteria 10390
319 Ga0157371_10300654 3300013102 Bacteria 1162
320 Ga0157371_10645570 3300013102 Bacteria 790
321 Ga0157370_10007947 3300013104 Bacteria 11490
322 Ga0157370_10060548 3300013104 Bacteria 3594
323 Ga0157370_10222091 3300013104 Bacteria 1750
324 Ga0157370_10453721 3300013104 Bacteria 1178
325 Ga0157369_10000032 3300013105 Bacteria 202272
326 Ga0157369_10020635 3300013105 Bacteria 7367
327 Ga0157369_10164205 3300013105 Bacteria 2343
328 Ga0157369_10252566 3300013105 Bacteria 1840
329 Ga0157369_10406855 3300013105 Bacteria 1411
330 Ga0157374_10002676 3300013296 Bacteria 14991
331 Ga0157374_10052356 3300013296 Bacteria 3802
332 Ga0157374_10223638 3300013296 Bacteria 1848
333 Ga0157378_10221819 3300013297 Bacteria 1797
334 Ga0157378_10375160 3300013297 Bacteria 1395
335 Ga0163162_10000015 3300013306 Bacteria 261996
336 Ga0163162_10007195 3300013306 Bacteria 10809
337 Ga0163162_10080190 3300013306 Bacteria 3331
338 Ga0163162_10179018 3300013306 Bacteria 2246
339 Ga0163162_10195409 3300013306 Bacteria 2152
340 Ga0163162_10603941 3300013306 Bacteria 1223
341 Ga0163162_10722167 3300013306 Bacteria 1117
342 Ga0157372_10004512 3300013307 Bacteria 14851
343 Ga0157372_10007227 3300013307 Bacteria 11826
344 Ga0157372_10007958 3300013307 Bacteria 11270
345 Ga0157372_10189198 3300013307 Bacteria 2384
346 Ga0157372_10193754 3300013307 Bacteria 2354
347 Ga0157372_10531026 3300013307 Bacteria 1371
348 Ga0157372_10960657 3300013307 Bacteria 990
349 Ga0157375_10000102 3300013308 Bacteria 86408
350 Ga0157375_10001413 3300013308 Bacteria 20668
351 Ga0157375_10049038 3300013308 Bacteria 4135
352 Ga0157375_11043307 3300013308 Bacteria 955
353 Ga0157375_11094181 3300013308 Bacteria 933
354 Ga0157375_11096410 3300013308 Bacteria 932
355 Ga0163163_10000714 3300014325 Bacteria 28173
356 Ga0163163_10015604 3300014325 Bacteria 7027
357 Ga0163163_10047685 3300014325 Bacteria 4212
358 Ga0163163_10593421 3300014325 Bacteria 1171
359 Ga0157380_10130820 3300014326 Bacteria 2141
360 Ga0157380_11087087 3300014326 Bacteria 838
361 Ga0182008_10012022 3300014497 Bacteria 4583
362 Ga0182008_10044098 3300014497 Bacteria 2219
363 Ga0157377_10125033 3300014745 Bacteria 1563
364 Ga0157379_10052017 3300014968 Bacteria 3657
365 Ga0157379_10452806 3300014968 Bacteria 1185
366 Ga0157376_10001668 3300014969 Bacteria 14744
367 Ga0157376_10070476 3300014969 Bacteria 2967
368 Ga0157376_10134518 3300014969 Bacteria 2211
369 Ga0157376_10164688 3300014969 Bacteria 2013
370 Ga0157376_10456447 3300014969 Bacteria 1248
371 Ga0182006_1000072 3300015261 Bacteria 133681
372 Ga0182007_10014466 3300015262 Bacteria 2974
373 Ga0182005_1002561 3300015265 Bacteria 6456
374 Ga0182005_1008905 3300015265 Bacteria 2943
375 Ga0163161_10003999 3300017792 Bacteria 10318
376 Ga0206356_10153146 3300020070 Bacteria 1263
377 Ga0206354_10250691 3300020081 Bacteria 880
378 Ga0224572_1041748 3300024225 Bacteria 863
379 Ga0209676_1000034 3300025292 Bacteria 460125
380 Ga0209050_1064702 3300025298 Bacteria 846
381 Ga0207426_1008053 3300025302 Bacteria 4319
382 Ga0209051_1013016 3300025303 Bacteria 3983
383 Ga0209257_1000302 3300025304 Bacteria 108038
384 Ga0209257_1000585 3300025304 Bacteria 61004
385 Ga0207656_10001827 3300025321 Bacteria 7069
386 Ga0207656_10026626 3300025321 Bacteria 2360
387 Ga0207656_10062648 3300025321 Bacteria 1635
388 Ga0207656_10096211 3300025321 Bacteria 1351
389 Ga0207713_1000890 3300025735 Bacteria 27092
390 Ga0207680_10001037 3300025903 Bacteria 13116
391 Ga0207680_10003078 3300025903 Bacteria 7827
392 Ga0207680_10048120 3300025903 Bacteria 2531
393 Ga0207680_10109953 3300025903 Bacteria 1786
394 Ga0207680_10199425 3300025903 Bacteria 1363
395 Ga0207680_10221044 3300025903 Bacteria 1299
396 Ga0207680_10226315 3300025903 Bacteria 1284
397 Ga0207680_10246437 3300025903 Bacteria 1233
398 Ga0207647_10004843 3300025904 Bacteria 9954
399 Ga0207647_10008817 3300025904 Bacteria 7199
400 Ga0207645_10020277 3300025907 Bacteria 4353
401 Ga0207645_10105181 3300025907 Bacteria 1823
402 Ga0207643_10006508 3300025908 Bacteria 6256
403 Ga0207705_10110203 3300025909 Bacteria 2033
404 Ga0207705_10156265 3300025909 Bacteria 1711
405 Ga0207654_10000418 3300025911 Bacteria 24401
406 Ga0207654_10129466 3300025911 Bacteria 1596
407 Ga0207654_10410006 3300025911 Bacteria 944
408 Ga0207707_10000128 3300025912 Bacteria 78104
409 Ga0207707_10000933 3300025912 Bacteria 28273
410 Ga0207707_10143369 3300025912 Bacteria 2088
411 Ga0207695_10000033 3300025913 Bacteria 507477
412 Ga0207695_10000536 3300025913 Bacteria 79171
413 Ga0207695_10005921 3300025913 Bacteria 16024
414 Ga0207695_10007552 3300025913 Bacteria 13782
415 Ga0207695_10034290 3300025913 Bacteria 5523
416 Ga0207695_10069938 3300025913 Bacteria 3591
417 Ga0207695_10184901 3300025913 Bacteria 2003
418 Ga0207695_10446241 3300025913 Bacteria 1177
419 Ga0207671_10003137 3300025914 Bacteria 16775
420 Ga0207671_10004488 3300025914 Bacteria 13293
421 Ga0207671_10013246 3300025914 Bacteria 6578
422 Ga0207671_10017813 3300025914 Bacteria 5465
423 Ga0207671_10034031 3300025914 Bacteria 3788
424 Ga0207671_10065136 3300025914 Bacteria 2710
425 Ga0207671_10076557 3300025914 Bacteria 2504
426 Ga0207671_10114039 3300025914 Bacteria 2059
427 Ga0207660_10012771 3300025917 Bacteria 5499
428 Ga0207660_10251721 3300025917 Bacteria 1394
429 Ga0207660_10308039 3300025917 Bacteria 1262
430 Ga0207660_10413363 3300025917 Bacteria 1087
431 Ga0207657_10001316 3300025919 Bacteria 26382
432 Ga0207657_10188169 3300025919 Bacteria 1666
433 Ga0207657_10329127 3300025919 Bacteria 1207
434 Ga0207657_10527203 3300025919 Bacteria 924
435 Ga0207649_10009882 3300025920 Bacteria 5229
436 Ga0207649_10014164 3300025920 Bacteria 4463
437 Ga0207649_10041331 3300025920 Bacteria 2806
438 Ga0207649_10200821 3300025920 Bacteria 1408
439 Ga0207649_10370334 3300025920 Bacteria 1065
440 Ga0207649_10388196 3300025920 Bacteria 1042
441 Ga0207652_10002665 3300025921 Bacteria 14980
442 Ga0207652_10059229 3300025921 Bacteria 3300
443 Ga0207652_10252094 3300025921 Bacteria 1592
444 Ga0207652_10320833 3300025921 Bacteria 1398
445 Ga0207652_10596818 3300025921 Bacteria 990
446 Ga0207681_10085431 3300025923 Bacteria 2239
447 Ga0207681_10706039 3300025923 Bacteria 839
448 Ga0207694_10002668 3300025924 Bacteria 14456
449 Ga0207694_10003738 3300025924 Bacteria 12061
450 Ga0207694_10005276 3300025924 Bacteria 9958
451 Ga0207694_10006609 3300025924 Bacteria 8815
452 Ga0207694_10013765 3300025924 Bacteria 6098
453 Ga0207694_10128108 3300025924 Bacteria 2032
454 Ga0207694_10138376 3300025924 Bacteria 1957
455 Ga0207694_10663357 3300025924 Bacteria 879
456 Ga0207650_10002390 3300025925 Bacteria 13068
457 Ga0207650_10009991 3300025925 Bacteria 6497
458 Ga0207650_10040606 3300025925 Bacteria 3405
459 Ga0207650_10090521 3300025925 Bacteria 2337
460 Ga0207650_10153251 3300025925 Bacteria 1820
461 Ga0207650_10228861 3300025925 Bacteria 1499
462 Ga0207659_10089319 3300025926 Bacteria 2298
463 Ga0207659_10204061 3300025926 Bacteria 1581
464 Ga0207687_10018293 3300025927 Bacteria 4624
465 Ga0207687_10353911 3300025927 Bacteria 1197
466 Ga0207664_10000021 3300025929 Bacteria 216875
467 Ga0207644_10005307 3300025931 Bacteria 8411
468 Ga0207644_10050387 3300025931 Bacteria 2984
469 Ga0207644_10105070 3300025931 Bacteria 2127
470 Ga0207690_10000734 3300025932 Bacteria 21131
471 Ga0207690_10005653 3300025932 Bacteria 7387
472 Ga0207690_10069040 3300025932 Bacteria 2430
473 Ga0207706_10035735 3300025933 Bacteria 4416
474 Ga0207706_10052916 3300025933 Bacteria 3584
475 Ga0207706_10059192 3300025933 Bacteria 3374
476 Ga0207706_10119408 3300025933 Bacteria 2318
477 Ga0207706_10145804 3300025933 Bacteria 2082
478 Ga0207686_10009012 3300025934 Bacteria 5402
479 Ga0207670_10490945 3300025936 Bacteria 996
480 Ga0207669_10406243 3300025937 Bacteria 1068
481 Ga0207704_10009199 3300025938 Bacteria 4756
482 Ga0207704_10057192 3300025938 Bacteria 2394
483 Ga0207704_10088448 3300025938 Bacteria 2026
484 Ga0207691_10032756 3300025940 Bacteria 4843
485 Ga0207691_10238619 3300025940 Bacteria 1572
486 Ga0207691_10388861 3300025940 Bacteria 1190
487 Ga0207691_10480311 3300025940 Bacteria 1056
488 Ga0207711_10000470 3300025941 Bacteria 41566
489 Ga0207711_10007410 3300025941 Bacteria 9182
490 Ga0207711_10135621 3300025941 Bacteria 2210
491 Ga0207711_10162642 3300025941 Bacteria 2022
492 Ga0207711_10187333 3300025941 Bacteria 1884
493 Ga0207711_10261887 3300025941 Bacteria 1589
494 Ga0207689_10031609 3300025942 Bacteria 4405
495 Ga0207689_10054480 3300025942 Bacteria 3293
496 Ga0207689_10086585 3300025942 Bacteria 2575
497 Ga0207689_10100713 3300025942 Bacteria 2373
498 Ga0207689_10128956 3300025942 Bacteria 2081
499 Ga0207689_10378563 3300025942 Bacteria 1178
500 Ga0207661_10229204 3300025944 Bacteria 1644
501 Ga0207679_10180849 3300025945 Bacteria 1744
502 Ga0207679_10183613 3300025945 Bacteria 1732
503 Ga0207679_10215560 3300025945 Bacteria 1612
504 Ga0207667_10002731 3300025949 Bacteria 21813
505 Ga0207667_10027065 3300025949 Bacteria 6252
506 Ga0207667_10120945 3300025949 Bacteria 2698
507 Ga0207667_10136837 3300025949 Bacteria 2522
508 Ga0207667_10295027 3300025949 Bacteria 1656
509 Ga0207667_10689581 3300025949 Bacteria 1024
510 Ga0207667_11111797 3300025949 Bacteria 773
511 Ga0207651_10129993 3300025960 Bacteria 1926
512 Ga0207712_10000165 3300025961 Bacteria 68118
513 Ga0207712_10000771 3300025961 Bacteria 23954
514 Ga0207712_10057473 3300025961 Bacteria 2745
515 Ga0207712_10469630 3300025961 Bacteria 1070
516 Ga0207668_10027253 3300025972 Bacteria 3721
517 Ga0207640_10108250 3300025981 Bacteria 1964
518 Ga0207658_10000006 3300025986 Bacteria 392309
519 Ga0207658_10016117 3300025986 Bacteria 5134
520 Ga0207658_10043114 3300025986 Bacteria 3278
521 Ga0207658_10048019 3300025986 Bacteria 3128
522 Ga0207658_10129629 3300025986 Bacteria 2024
523 Ga0207658_10485345 3300025986 Bacteria 1098
524 Ga0207677_10060979 3300026023 Bacteria 2610
525 Ga0207677_10201183 3300026023 Bacteria 1583
526 Ga0207677_10218081 3300026023 Bacteria 1528
527 Ga0207677_10415334 3300026023 Bacteria 1145
528 Ga0207677_10415658 3300026023 Bacteria 1144
529 Ga0207703_10000553 3300026035 Bacteria 38426
530 Ga0207703_10028956 3300026035 Bacteria 4370
531 Ga0207703_10134529 3300026035 Bacteria 2139
532 Ga0207639_10000217 3300026041 Bacteria 42907
533 Ga0207639_10000643 3300026041 Bacteria 24069
534 Ga0207639_10004497 3300026041 Bacteria 9405
535 Ga0207639_10023741 3300026041 Bacteria 4430
536 Ga0207639_10070097 3300026041 Bacteria 2737
537 Ga0207639_10088687 3300026041 Bacteria 2469
538 Ga0207639_10124736 3300026041 Bacteria 2122
539 Ga0207639_10143638 3300026041 Bacteria 1991
540 Ga0207639_10187967 3300026041 Bacteria 1762
541 Ga0207639_10189556 3300026041 Bacteria 1755
542 Ga0207639_10273645 3300026041 Bacteria 1482
543 Ga0207639_10294512 3300026041 Bacteria 1432
544 Ga0207639_10391885 3300026041 Bacteria 1249
545 Ga0207639_10502556 3300026041 Bacteria 1108
546 Ga0207678_10001340 3300026067 Bacteria 22694
547 Ga0207678_10005262 3300026067 Bacteria 11593
548 Ga0207678_10060058 3300026067 Bacteria 3271
549 Ga0207678_10073285 3300026067 Bacteria 2935
550 Ga0207678_10179595 3300026067 Bacteria 1807
551 Ga0207678_10201565 3300026067 Bacteria 1702
552 Ga0207678_10226119 3300026067 Bacteria 1602
553 Ga0207678_10259792 3300026067 Bacteria 1488
554 Ga0207678_10401985 3300026067 Bacteria 1186
555 Ga0207678_10806208 3300026067 Bacteria 829
556 Ga0207708_10015570 3300026075 Bacteria 5702
557 Ga0207702_10002671 3300026078 Bacteria 16744
558 Ga0207702_10060529 3300026078 Bacteria 3228
559 Ga0207702_10128052 3300026078 Bacteria 2282
560 Ga0207702_10306825 3300026078 Bacteria 1508
561 Ga0207702_10911004 3300026078 Bacteria 871
562 Ga0207641_10015458 3300026088 Bacteria 6253
563 Ga0207641_10016935 3300026088 Bacteria 5967
564 Ga0207641_10201191 3300026088 Bacteria 1836
565 Ga0207641_10291447 3300026088 Bacteria 1538
566 Ga0207641_10401933 3300026088 Bacteria 1315
567 Ga0207641_10615933 3300026088 Bacteria 1064
568 Ga0207641_10905676 3300026088 Bacteria 876
569 Ga0207648_10048941 3300026089 Bacteria 3700
570 Ga0207648_10122708 3300026089 Bacteria 2285
571 Ga0207676_10031766 3300026095 Bacteria 3972
572 Ga0207676_10051657 3300026095 Bacteria 3210
573 Ga0207676_10120531 3300026095 Bacteria 2211
574 Ga0207674_10003941 3300026116 Bacteria 18068
575 Ga0207674_10009055 3300026116 Bacteria 11433
576 Ga0207674_10127511 3300026116 Bacteria 2509
577 Ga0207674_10189246 3300026116 Bacteria 2008
578 Ga0207675_100008268 3300026118 Bacteria 9801
579 Ga0207675_100050463 3300026118 Bacteria 3882
580 Ga0207675_100327665 3300026118 Bacteria 1496
581 Ga0207675_100545995 3300026118 Bacteria 1158
582 Ga0207683_10045586 3300026121 Bacteria 3834
583 Ga0207683_10191731 3300026121 Bacteria 1856
584 Ga0207683_10568027 3300026121 Bacteria 1049
585 Ga0207698_10004066 3300026142 Bacteria 8879
586 Ga0207698_10043839 3300026142 Bacteria 3356
587 Ga0207698_10138025 3300026142 Bacteria 2095
588 Ga0207698_10182890 3300026142 Bacteria 1859
589 Ga0207698_10210449 3300026142 Bacteria 1749
590 Ga0207698_10223943 3300026142 Bacteria 1702
591 Ga0207698_10400302 3300026142 Bacteria 1312
592 Ga0207698_10507817 3300026142 Bacteria 1174
593 Ga0209371_1000016 3300027312 Bacteria 646301
594 Ga0209179_1000062 3300027512 Bacteria 19549
595 Ga0209966_1029318 3300027695 Bacteria 1108
596 Ga0207428_10015745 3300027907 Bacteria 6530
597 Ga0268266_10000001 3300028379 Bacteria 4040580
598 Ga0268266_10000006 3300028379 Bacteria 1410021
599 Ga0268266_10004292 3300028379 Bacteria 13723
600 Ga0268266_10019047 3300028379 Bacteria 5846
601 Ga0268266_10043867 3300028379 Bacteria 3822
602 Ga0268266_10068858 3300028379 Bacteria 3065
603 Ga0268266_10099202 3300028379 Bacteria 2564
604 Ga0268266_10135762 3300028379 Bacteria 2203
605 Ga0268266_10262737 3300028379 Bacteria 1600
606 Ga0268266_10284648 3300028379 Bacteria 1538
607 Ga0268266_10362936 3300028379 Bacteria 1363
608 Ga0268265_10000608 3300028380 Bacteria 35821
609 Ga0268264_10001065 3300028381 Bacteria 27234
610 Ga0268264_10026185 3300028381 Bacteria 4763
611 Ga0268264_10072417 3300028381 Bacteria 2922
612 Ga0268264_10100170 3300028381 Bacteria 2516
613 Ga0268264_10370134 3300028381 Bacteria 1369
614 Ga0268264_10540004 3300028381 Bacteria 1142
615 Ga0268264_10603014 3300028381 Bacteria 1082
616 Ga0307515_10144069 3300028794 Bacteria 2536
617 Ga0268256_1000015 3300030500 Bacteria 646300
618 Ga0265327_10001299 3300031251 Bacteria 32719
619 Ga0307508_10290933 3300031616 Bacteria 1227
620 Ga0316575_10188527 3300031665 Bacteria 857
621 Ga0316579_10006748 3300031691 Bacteria 4700
622 Ga0316579_10074782 3300031691 Bacteria 1609
623 Ga0316579_10148270 3300031691 Bacteria 1131
624 Ga0316576_10014556 3300031727 Bacteria 5256
625 Ga0316576_10111114 3300031727 Bacteria 2054
626 Ga0316578_10020751 3300031728 Bacteria 3636
627 Ga0316578_10048071 3300031728 Bacteria 2490
628 Ga0316578_10107553 3300031728 Bacteria 1674
629 Ga0316578_10108756 3300031728 Bacteria 1665
630 Ga0316578_10123309 3300031728 Bacteria 1558
631 Ga0316578_10167457 3300031728 Bacteria 1324
632 Ga0307516_10035322 3300031730 Bacteria 5016
633 Ga0307516_10038403 3300031730 Bacteria 4779
634 Ga0316577_10020308 3300031733 Bacteria 3683
635 Ga0316577_10108346 3300031733 Bacteria 1558
636 Ga0316577_10149675 3300031733 Bacteria 1315
637 Ga0307413_10089612 3300031824 Bacteria 1999
638 Ga0307412_10289834 3300031911 Bacteria 1289
639 Ga0307414_10002380 3300032004 Bacteria 9831
640 Ga0307414_10260042 3300032004 Bacteria 1448
641 Ga0316583_10003904 3300032133 Bacteria 5302
642 Ga0316583_10038033 3300032133 Bacteria 1706
643 Ga0316585_10002747 3300032137 Bacteria 4778
644 Ga0316593_10016512 3300032168 Bacteria 2239
645 Ga0316593_10030131 3300032168 Bacteria 1759
646 Ga0316586_1014900 3300033527 Bacteria 1233
647 Ga0373953_0063289 3300035117 Bacteria 1516
648 Ga0373955_0028400 3300035172 Bacteria 2899
649 Ga0316574_0003830 3300035398 Bacteria 7810
650 Ga0316574_0004019 3300035398 Bacteria 7666
651 Ga0316574_0005371 3300035398 Bacteria 6829
652 Ga0316574_0005837 3300035398 Bacteria 6606
653 Ga0316574_0006179 3300035398 Bacteria 6451
654 Ga0316574_0040972 3300035398 Bacteria 2853
655 Ga0316574_0057540 3300035398 Bacteria 2434
656 Ga0316574_0060045 3300035398 Bacteria 2385
657 Ga0316574_0066076 3300035398 Bacteria 2278
658 Ga0316574_0384521 3300035398 Bacteria 885
659 Ga0373924_0018094 3300035410 Bacteria 2713
660 Ga0373935_0105935 3300035692 Bacteria 1860
661 Ga0373933_0271513 3300035724 Unclassified 1094
662 Ga0373937_0020829 3300036401 Bacteria 5882
663 Ga0373937_0036733 3300036401 Bacteria 4464
664 Ga0373937_0102030 3300036401 Bacteria 2663
665 Ga0316582_0003307 3300036647 Bacteria 7867
666 Ga0316582_0003479 3300036647 Bacteria 7733
667 Ga0316582_0021067 3300036647 Bacteria 3843
668 Ga0316582_0062775 3300036647 Bacteria 2386
669 Ga0316584_0001131 3300036712 Bacteria 15666
670 Ga0316584_0002666 3300036712 Bacteria 11391
671 Ga0316584_0034789 3300036712 Bacteria 3735
672 Ga0316584_0042038 3300036712 Bacteria 3408
673 Ga0316584_0071174 3300036712 Bacteria 2606
674 Ga0316584_0104210 3300036712 Bacteria 2123
675 Ga0316584_0133854 3300036712 Bacteria 1851
676 Ga0316584_0141162 3300036712 Bacteria 1796
677 Ga0316584_0358700 3300036712 Bacteria 1045
678 Ga0316584_0548402 3300036712 Bacteria 807
679 Ga0373925_0231289 3300037068 Bacteria 1478
680 Ga0395900_0000590 3300037418 Bacteria 49754
681 Ga0395900_0005906 3300037418 Bacteria 12783
682 Ga0395898_0313103 3300037466 Bacteria 1498
683 Ga0316581_0000030 3300037588 Bacteria 15125
684 Ga0316581_0039133 3300037588 Bacteria 1443
685 Ga0316581_0060041 3300037588 Bacteria 1166
686 Ga0395901_0625910 3300038443 Bacteria 1082
687 Ga0436365_0481947 3300039437 Bacteria 2291
688 Ga0436363_1278302 3300039450 Bacteria 1054
689 Ga0451787_375813 3300041441 Bacteria 1073
690 Ga0451787_424847 3300041441 Bacteria 1000
691 Ga0451789_0324187 3300041443 Bacteria 1815
692 Ga0451789_1305691 3300041443 Bacteria 1051
693 Ga0451791_0734992 3300041451 Bacteria 4680
694 Ga0451791_0977198 3300041451 Bacteria 1096
695 Ga0451791_1698871 3300041451 Bacteria 1349
696 Ga0451793_0203707 3300041452 Bacteria 1446
697 Ga0451793_0331580 3300041452 Bacteria 1634
698 Ga0451793_1036736 3300041452 Bacteria 4071
699 Ga0451793_1074463 3300041452 Bacteria 1541
700 Ga0451793_1912156 3300041452 Bacteria 1632
701 Ga0451797_0696143 3300041453 Bacteria 1630
702 Ga0451797_0907429 3300041453 Bacteria 1770
703 Ga0451795_0402747 3300041456 Bacteria 1827
704 Ga0451795_0613894 3300041456 Bacteria 2313
705 Ga0451795_1282306 3300041456 Bacteria 1780
706 Ga0451798_0587288 3300041458 Bacteria 1089
707 Ga0451800_0416075 3300041459 Bacteria 5098
708 Ga0451800_1239448 3300041459 Bacteria 920
709 Ga0451802_0653047 3300041460 Bacteria 929
710 Ga0451802_0842713 3300041460 Bacteria 722
711 Ga0451802_1409802 3300041460 Bacteria 1486
712 Ga0451802_1663798 3300041460 Bacteria 1535
713 Ga0451806_051010 3300041462 Bacteria 2759
714 Ga0451804_0778980 3300041463 Bacteria 2428
715 Ga0451807_0052036 3300041486 Bacteria 2212
716 Ga0451807_1276735 3300041486 Bacteria 1528
717 Ga0451807_1727819 3300041486 Bacteria 2982
718 Ga0451807_2045398 3300041486 Bacteria 5221
719 Ga0451837_0211328 3300041494 Bacteria 1916
720 Ga0451837_1594622 3300041494 Bacteria 1117
721 Ga0451839_1349525 3300041496 Bacteria 976
722 Ga0451841_0486514 3300041498 Bacteria 1046
723 Ga0451847_0708482 3300041503 Bacteria 1408
724 Ga0451843_0541203 3300041509 Bacteria 2219
725 Ga0451843_0832695 3300041509 Bacteria 1786
726 Ga0451843_1620786 3300041509 Bacteria 1529
727 Ga0451853_0536472 3300041512 Bacteria 990
728 Ga0451853_0542427 3300041512 Bacteria 1523
729 Ga0439433_0018730 3300041999 Bacteria 1542
730 Ga0439437_001897 3300042000 Bacteria 2221
731 Ga0439448_0071872 3300042005 Bacteria 1153
732 Ga0439449_0063355 3300042007 Bacteria 1364
733 Ga0450908_000100 3300042184 Bacteria 17277
734 Ga0439434_0134681 3300042435 Bacteria 812
735 Ga0451577_0000543 3300042876 Bacteria 61740
736 Ga0451577_0256247 3300042876 Bacteria 1584
737 Ga0466969_0155589 3300044656 Bacteria 1052
738 Ga0466972_0004200 3300044658 Bacteria 7196
739 Ga0466965_0018370 3300044683 Bacteria 3351
740 Ga0466966_0000529 3300044684 Bacteria 24396
741 Ga0466961_0000944 3300044693 Bacteria 18003
742 Ga0466963_0049646 3300044694 Bacteria 2776
743 Ga0466963_0181154 3300044694 Bacteria 1471
744 Ga0453684_0000533 3300044712 Bacteria 144782
745 Ga0466971_0003453 3300044719 Bacteria 6749
746 Ga0466957_0109288 3300044842 Bacteria 1752
747 Ga0466959_0004692 3300045049 Bacteria 9203
748 Ga0466959_0070150 3300045049 Bacteria 2539
749 Ga0466959_0125006 3300045049 Bacteria 1826
750 Ga0451576_0027440 3300045051 Bacteria 6114
751 Ga0451576_0042101 3300045051 Bacteria 4823
752 Ga0451576_0102593 3300045051 Bacteria 2976
753 Ga0451576_0329324 3300045051 Bacteria 1599
754 Ga0466958_0024993 3300045836 Bacteria 3517
755 Ga0466967_0215672 3300045976 Bacteria 1822
756 Ga0495617_007162 3300046452 Bacteria 3885
757 Ga0495617_009741 3300046452 Bacteria 3296
758 Ga0495629_0360024 3300046459 Bacteria 992
759 Ga0495638_0000146 3300046460 Bacteria 111558
760 Ga0495638_0083807 3300046460 Bacteria 1930
761 Ga0495638_0135010 3300046460 Bacteria 1446
762 Ga0495650_0005392 3300046471 Bacteria 8320
763 Ga0495650_0070421 3300046471 Bacteria 1373
764 Ga0495580_0145739 3300046472 Bacteria 1641
765 Ga0495582_0015290 3300046473 Bacteria 4218
766 Ga0495605_0053908 3300046474 Bacteria 1949
767 Ga0495584_0000823 3300046491 Bacteria 20364
768 Ga0495584_0188245 3300046491 Bacteria 1049
769 Ga0495585_0005197 3300046492 Bacteria 8253
770 Ga0495585_0306575 3300046492 Bacteria 779
771 Ga0495594_0361525 3300046499 Bacteria 826
772 Ga0495607_0000122 3300046501 Bacteria 81489
773 Ga0495607_0000837 3300046501 Bacteria 29060
774 Ga0495583_0073334 3300046506 Bacteria 1500
775 Ga0495606_0032598 3300046507 Bacteria 3606
776 Ga0495606_0036205 3300046507 Bacteria 3364
777 Ga0495606_0037699 3300046507 Bacteria 3279
778 Ga0495610_0027392 3300046512 Bacteria 3029
779 Ga0495616_0000565 3300046513 Bacteria 28011
780 Ga0495620_0003610 3300046515 Bacteria 8838
781 Ga0495620_0034989 3300046515 Bacteria 2264
782 Ga0495631_0000808 3300046518 Bacteria 19998
783 Ga0495632_0009510 3300046519 Bacteria 5854
784 Ga0495648_0002534 3300046524 Bacteria 16751
785 Ga0495648_0084069 3300046524 Bacteria 1802
786 Ga0495663_0007180 3300046525 Bacteria 3074
787 Ga0495586_0148323 3300046535 Bacteria 1319
788 Ga0495609_0003075 3300046538 Bacteria 9784
789 Ga0495622_0111740 3300046557 Bacteria 1251
790 Ga0495668_0003466 3300046616 Bacteria 11779
791 Ga0495611_0000001 3300046648 Bacteria 2628469
792 Ga0495611_0000952 3300046648 Bacteria 15498
793 Ga0495625_0000022 3300046660 Bacteria 278823
794 Ga0495625_0086013 3300046660 Bacteria 2181
795 Ga0495625_0387271 3300046660 Bacteria 876
796 Ga0495635_0065355 3300046663 Bacteria 2496
797 Ga0495659_0131686 3300046664 Bacteria 992
798 Ga0495661_0006772 3300046665 Bacteria 8034
799 Ga0495599_0438045 3300046678 Bacteria 775
800 Ga0495647_0133369 3300046681 Bacteria 1054
801 Ga0495658_0014949 3300046683 Bacteria 3976
802 Ga0495670_0012505 3300046691 Bacteria 4176
803 Ga0495670_0280257 3300046691 Bacteria 891
804 Ga0495671_0002998 3300046692 Bacteria 10490
805 Ga0495671_0016012 3300046692 Bacteria 4011
806 Ga0495589_0000137 3300046794 Bacteria 67614
807 Ga0495660_0003625 3300046810 Bacteria 9505
808 Ga0495660_0028700 3300046810 Bacteria 3140
809 Ga0495604_0229304 3300047317 Bacteria 1275
810 Ga0495683_0001586 3300047323 Bacteria 14650
811 Ga0495679_000004 3300047446 Bacteria 748056
812 Ga0495673_0000202 3300047469 Bacteria 90523
813 Ga0495673_0020879 3300047469 Bacteria 3249
814 Ga0495673_0021499 3300047469 Bacteria 3183
815 Ga0495686_0008876 3300047472 Bacteria 7313
816 Ga0495686_0031480 3300047472 Bacteria 3439
817 Ga0495686_0224267 3300047472 Bacteria 1067
818 Ga0495686_0356009 3300047472 Bacteria 794
819 Ga0495686_0356015 3300047472 Bacteria 794
820 Ga0496100_0089591 3300048903 Bacteria 2096
821 Ga0496100_0283629 3300048903 Bacteria 1235
822 Ga0496101_0002136 3300048904 Bacteria 12065
823 Ga0496101_0152250 3300048904 Bacteria 1770
824 Ga0496101_0261736 3300048904 Bacteria 1349
825 Ga0496102_0263654 3300048905 Bacteria 1624
826 Ga0496104_0000022 3300048907 Bacteria 237390
827 Ga0496104_0062004 3300048907 Bacteria 3545
828 Ga0496105_0000012 3300048908 Bacteria 261713
829 Ga0496106_0001864 3300048909 Bacteria 15779
830 Ga0496107_0211521 3300048910 Bacteria 1442
831 Ga0496108_0021655 3300048911 Bacteria 5284
832 Ga0496109_0042225 3300048912 Bacteria 4130
833 Ga0496110_0301681 3300048913 Bacteria 1459
834 Ga0496112_0015148 3300048915 Bacteria 7185
835 Ga0496113_0079264 3300048916 Bacteria 2514
836 Ga0496113_0265200 3300048916 Bacteria 1372
837 Ga0496115_0249327 3300048918 Bacteria 1462
838 Ga0496115_0505030 3300048918 Bacteria 971
839 Ga0496117_0000446 3300048920 Bacteria 68559
840 Ga0496117_0008490 3300048920 Bacteria 9748
841 Ga0496117_0036780 3300048920 Bacteria 3658
842 Ga0496117_0044342 3300048920 Bacteria 3223
843 Ga0496117_0070480 3300048920 Bacteria 2348
844 Ga0496118_0000177 3300048921 Bacteria 114183
845 Ga0496118_0004944 3300048921 Bacteria 15450
846 Ga0496118_0043362 3300048921 Bacteria 3537
847 Ga0496118_0076525 3300048921 Bacteria 2379
848 Ga0496118_0099723 3300048921 Bacteria 1967
849 Ga0496119_0017246 3300048922 Bacteria 5441
850 Ga0496120_0000102 3300048923 Bacteria 142902
851 Ga0496121_0055034 3300048924 Bacteria 3319
852 Ga0496121_0063603 3300048924 Bacteria 3013
853 Ga0496121_0065807 3300048924 Bacteria 2946
854 Ga0496122_0000158 3300048925 Bacteria 159352
855 Ga0496122_0000487 3300048925 Bacteria 82253
856 Ga0496122_0006129 3300048925 Bacteria 13994
857 Ga0496122_0025404 3300048925 Bacteria 5144
858 Ga0496122_0088252 3300048925 Bacteria 2126
859 Ga0496123_0000120 3300048926 Bacteria 159406
860 Ga0496123_0000151 3300048926 Bacteria 141062
861 Ga0496123_0000296 3300048926 Bacteria 97428
862 Ga0496123_0032847 3300048926 Bacteria 3747
863 Ga0496123_0074909 3300048926 Bacteria 2092
864 Ga0496124_0001894 3300048927 Bacteria 28749
865 Ga0496124_0097064 3300048927 Bacteria 2393
866 Ga0496125_0136041 3300048928 Bacteria 1719
867 Ga0496126_0037693 3300048929 Bacteria 4508
868 Ga0496126_0144798 3300048929 Bacteria 2042
869 Ga0496126_0295312 3300048929 Bacteria 1339
870 Ga0496126_0296237 3300048929 Bacteria 1336
871 Ga0495678_000099 3300049459 Bacteria 106223
872 Ga0495682_0008463 3300049460 Bacteria 4051
873 Ga0495682_0010599 3300049460 Bacteria 3563
874 Ga0501031_0033304 3300049568 Bacteria 3360
875 Ga0501032_0013770 3300049569 Bacteria 5739
876 Ga0501032_0043293 3300049569 Bacteria 3050
877 Ga0501033_0000324 3300049570 Bacteria 45439
878 Ga0501033_0015186 3300049570 Bacteria 5844
879 Ga0501033_0019531 3300049570 Bacteria 5123
880 Ga0501033_0105324 3300049570 Bacteria 2056
881 Ga0501034_0002776 3300049571 Bacteria 20531
882 Ga0501034_0005361 3300049571 Bacteria 14039
883 Ga0501034_0021375 3300049571 Bacteria 6597
884 Ga0501034_0048739 3300049571 Bacteria 4275
885 Ga0501034_0242138 3300049571 Bacteria 1750
886 Ga0501034_0384902 3300049571 Bacteria 1327
887 Ga0501036_0004120 3300049572 Bacteria 11698
888 Ga0501036_0060031 3300049572 Bacteria 3221
889 Ga0501036_0067456 3300049572 Bacteria 3027
890 Ga0501036_0132295 3300049572 Bacteria 2105
891 Ga0501036_0152823 3300049572 Bacteria 1947
892 Ga0501036_0191382 3300049572 Bacteria 1721
893 Ga0501036_0348525 3300049572 Bacteria 1236
894 Ga0501037_0000499 3300049573 Bacteria 31684
895 Ga0501037_0007006 3300049573 Bacteria 8231
896 Ga0501037_0009963 3300049573 Bacteria 6969
897 Ga0501037_0076353 3300049573 Bacteria 2432
898 Ga0501037_0255125 3300049573 Bacteria 1226
899 Ga0501038_0003249 3300049574 Bacteria 15157
900 Ga0501038_0003315 3300049574 Bacteria 15016
901 Ga0501038_0187986 3300049574 Bacteria 1663
902 Ga0501038_0291379 3300049574 Bacteria 1283
903 Ga0501039_0018424 3300049575 Bacteria 5358
904 Ga0501039_0033038 3300049575 Bacteria 3991
905 Ga0501039_0143181 3300049575 Bacteria 1878
906 Ga0501039_0248540 3300049575 Bacteria 1399
907 Ga0501040_0145074 3300049576 Bacteria 1673
908 Ga0501041_0113511 3300049577 Bacteria 1682
909 Ga0501042_0158072 3300049578 Bacteria 1635
910 Ga0501042_0543193 3300049578 Bacteria 844
911 Ga0501043_0007141 3300049579 Bacteria 8886
912 Ga0501043_0045881 3300049579 Bacteria 3436
913 Ga0501043_0215980 3300049579 Bacteria 1485
914 Ga0501046_0003027 3300049580 Bacteria 15530
915 Ga0501046_0014037 3300049580 Bacteria 6765
916 Ga0501046_0113853 3300049580 Bacteria 2064
917 Ga0501046_0184279 3300049580 Bacteria 1559
918 Ga0501046_0442008 3300049580 Bacteria 936
919 Ga0501047_0001523 3300049581 Bacteria 22634
920 Ga0501047_0019332 3300049581 Bacteria 6535
921 Ga0501047_0072956 3300049581 Bacteria 3304
922 Ga0501047_0120904 3300049581 Bacteria 2501
923 Ga0501047_0152962 3300049581 Bacteria 2182
924 Ga0501047_0198195 3300049581 Bacteria 1869
925 Ga0501047_0252344 3300049581 Bacteria 1612
926 Ga0501048_0008263 3300049582 Bacteria 7874
927 Ga0501048_0110392 3300049582 Bacteria 1942
928 Ga0501067_0000619 3300049583 Bacteria 19144
929 Ga0501067_0034617 3300049583 Bacteria 2803
930 Ga0501068_0078802 3300049584 Bacteria 2019
931 Ga0501069_0012755 3300049585 Bacteria 4473
932 Ga0501069_0050775 3300049585 Bacteria 2306
933 Ga0501069_0064299 3300049585 Bacteria 2050
934 Ga0501069_0065715 3300049585 Bacteria 2028
935 Ga0501069_0106378 3300049585 Bacteria 1595
936 Ga0501070_0003167 3300049586 Bacteria 14312
937 Ga0501070_0038613 3300049586 Bacteria 3984
938 Ga0501070_0044700 3300049586 Bacteria 3683
939 Ga0501070_0086050 3300049586 Bacteria 2602
940 Ga0501070_0143052 3300049586 Bacteria 1974
941 Ga0501070_0330286 3300049586 Bacteria 1239
942 Ga0501070_0504069 3300049586 Bacteria 972
943 Ga0501071_0008965 3300049587 Bacteria 6636
944 Ga0501072_0030064 3300049588 Bacteria 4246
945 Ga0501073_0001312 3300049589 Bacteria 18293
946 Ga0501073_0002117 3300049589 Bacteria 14877
947 Ga0501073_0006715 3300049589 Bacteria 8566
948 Ga0501073_0139117 3300049589 Bacteria 1682
949 Ga0501073_0294392 3300049589 Bacteria 1120
950 Ga0501073_0309049 3300049589 Bacteria 1090
951 Ga0501074_0019787 3300049590 Bacteria 4889
952 Ga0501074_0037584 3300049590 Bacteria 3509
953 Ga0501074_0065373 3300049590 Bacteria 2618
954 Ga0501074_0160531 3300049590 Bacteria 1605
955 Ga0501074_0181615 3300049590 Bacteria 1501
956 Ga0501075_0301460 3300049591 Bacteria 1221
957 Ga0501076_0799392 3300049592 Bacteria 778
958 Ga0501077_0229963 3300049593 Bacteria 1179
959 Ga0501257_027282 3300049686 Bacteria 1366
960 Ga0501257_077332 3300049686 Bacteria 855
961 Ga0501079_0034838 3300049741 Bacteria 3873
962 Ga0501079_0051130 3300049741 Bacteria 3190
963 Ga0501079_0165261 3300049741 Bacteria 1726
964 Ga0501079_0533878 3300049741 Bacteria 922
965 Ga0501080_0000739 3300049742 Bacteria 26414
966 Ga0501080_0001727 3300049742 Bacteria 18680
967 Ga0501080_0013993 3300049742 Bacteria 7384
968 Ga0501080_0015445 3300049742 Bacteria 7039
969 Ga0501080_0035297 3300049742 Bacteria 4667
970 Ga0501080_0060091 3300049742 Bacteria 3537
971 Ga0501080_0100031 3300049742 Bacteria 2690
972 Ga0501080_0224665 3300049742 Bacteria 1717
973 Ga0501080_0537872 3300049742 Bacteria 1041
974 Ga0501080_1013980 3300049742 Bacteria 719
975 Ga0501083_0007418 3300049744 Bacteria 7778
976 Ga0501083_0040020 3300049744 Bacteria 3182
977 Ga0501083_0143256 3300049744 Bacteria 1565
978 Ga0501035_0017155 3300049822 Bacteria 6672
979 Ga0501035_0037489 3300049822 Bacteria 4390
980 Ga0501035_0078260 3300049822 Bacteria 2921
981 Ga0501035_0189958 3300049822 Bacteria 1766
982 Ga0501035_0326996 3300049822 Bacteria 1287
983 Ga0501044_0006294 3300049823 Bacteria 13122
984 Ga0501044_0015031 3300049823 Bacteria 8344
985 Ga0501044_0024216 3300049823 Bacteria 6449
986 Ga0501044_0088409 3300049823 Bacteria 3127
987 Ga0501044_0092312 3300049823 Bacteria 3053
988 Ga0501044_0176063 3300049823 Bacteria 2108
989 Ga0501044_0622550 3300049823 Bacteria 971
990 nmdc:mga0qj67_91052_c1 3300050509 Bacteria 2451
991 nmdc:mga08y16_11439_c1 3300050511 Bacteria 9324
992 nmdc:mga08y16_1174852_c1 3300050511 Bacteria 739
993 nmdc:mga08y16_196714_c1 3300050511 Bacteria 2089
994 nmdc:mga0a205_22852_c1 3300050515 Bacteria 5928
995 Ga0495601_0027161 3300053077 Bacteria 3538
996 Ga0500610_0003430 3300053079 Bacteria 6086
997 Ga0500643_000118 3300053087 Bacteria 82138
998 Ga0500643_005173 3300053087 Bacteria 5690
999 Ga0500583_0061072 3300053092 Bacteria 1779
1000 Ga0500651_0000301 3300053093 Bacteria 28575
1001 Ga0500651_0020652 3300053093 Bacteria 4101
1002 Ga0500651_0102806 3300053093 Bacteria 1750
1003 Ga0500651_0117828 3300053093 Bacteria 1615
1004 Ga0500555_000715 3300053103 Bacteria 12482
1005 Ga0500597_000335 3300053120 Bacteria 9709
1006 Ga0500614_037085 3300053123 Bacteria 1222
1007 Ga0500658_0220297 3300053134 Bacteria 870
1008 Ga0500568_0000952 3300053139 Bacteria 19915
1009 Ga0500633_0003369 3300053160 Bacteria 3476
1010 Ga0501084_0086233 3300054114 Bacteria 2636
1011 Ga0501084_0131217 3300054114 Bacteria 2109
1012 Ga0501084_0149041 3300054114 Bacteria 1971
1013 Ga0500661_021664 3300055283 Bacteria 1140
1014 Ga0501082_0012969 3300060353 Bacteria 7164
1015 Ga0501082_0104835 3300060353 Bacteria 2446
1016 Ga0501082_0208114 3300060353 Bacteria 1702
1017 Ga0501082_0215244 3300060353 Bacteria 1671
1018 Ga0501082_0301485 3300060353 Bacteria 1395
1019 Ga0466962_0010495 3300061719 Bacteria 4454

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0040972 Ga0316574_0040972_2294_2818 174
2 3300041441 Ga0451787_375813 Ga0451787_375813_511_1035 174
3 3300036712 Ga0316584_0358700 Ga0316584_0358700_221_844 185
4 3300031727 Ga0316576_10014556 Ga0316576_100145564 187
5 3300031728 Ga0316578_10108756 Ga0316578_101087563 187
6 3300036712 Ga0316584_0133854 Ga0316584_0133854_1234_1797 187
7 3300025913 Ga0207695_10069938 Ga0207695_100699382 188
8 3300009551 Ga0105238_10092552 Ga0105238_100925522 195
9 3300013296 Ga0157374_10223638 Ga0157374_102236382 195
10 3300031251 Ga0265327_10001299 Ga0265327_1000129913 196
11 3300031691 Ga0316579_10074782 Ga0316579_100747823 196
12 3300032168 Ga0316593_10016512 Ga0316593_100165123 196
13 3300048904 Ga0496101_0152250 Ga0496101_0152250_219_812 197
14 3300048920 Ga0496117_0044342 Ga0496117_0044342_1598_2239 197
15 3300048921 Ga0496118_0000177 Ga0496118_0000177_10513_11154 197
16 3300026118 Ga0207675_100327665 Ga0207675_1003276652 199
17 3300041459 Ga0451800_1239448 Ga0451800_1239448_304_906 199
18 3300041458 Ga0451798_0587288 Ga0451798_0587288_113_718 201
19 3300005335 Ga0070666_10154259 Ga0070666_101542592 204
20 3300013102 Ga0157371_10300654 Ga0157371_103006542 204
21 3300013306 Ga0163162_10195409 Ga0163162_101954092 204
22 3300014325 Ga0163163_10000714 Ga0163163_1000071411 204
23 3300014325 Ga0163163_10047685 Ga0163163_100476854 204
24 3300025903 Ga0207680_10001037 Ga0207680_1000103712 204
25 3300025903 Ga0207680_10199425 Ga0207680_101994252 204
26 3300025911 Ga0207654_10000418 Ga0207654_1000041821 204
27 3300046663 Ga0495635_0065355 Ga0495635_0065355_627_1253 204
28 3300049571 Ga0501034_0242138 Ga0501034_0242138_237_854 204
29 3300049572 Ga0501036_0152823 Ga0501036_0152823_633_1250 204
30 3300049579 Ga0501043_0215980 Ga0501043_0215980_477_1094 204
31 3300049581 Ga0501047_0072956 Ga0501047_0072956_1986_2603 204
32 3300049585 Ga0501069_0106378 Ga0501069_0106378_470_1087 204
33 3300049590 Ga0501074_0037584 Ga0501074_0037584_228_845 204
34 3300049742 Ga0501080_0100031 Ga0501080_0100031_1177_1794 204
35 3300049742 Ga0501080_1013980 Ga0501080_1013980_39_656 204
36 3300060353 Ga0501082_0208114 Ga0501082_0208114_594_1211 204
37 3300005337 Ga0070682_100113715 Ga0070682_1001137153 205
38 3300005455 Ga0070663_100055331 Ga0070663_1000553311 205
39 3300005456 Ga0070678_100408866 Ga0070678_1004088662 205
40 3300005539 Ga0068853_100062215 Ga0068853_1000622155 205
41 3300005539 Ga0068853_100321467 Ga0068853_1003214673 205
42 3300005614 Ga0068856_100040580 Ga0068856_1000405803 205
43 3300005616 Ga0068852_100167428 Ga0068852_1001674281 205
44 3300005841 Ga0068863_100432497 Ga0068863_1004324972 205
45 3300006358 Ga0068871_100039070 Ga0068871_1000390703 205
46 3300006358 Ga0068871_100196340 Ga0068871_1001963403 205
47 3300009093 Ga0105240_10554704 Ga0105240_105547041 205
48 3300009093 Ga0105240_10573559 Ga0105240_105735592 205
49 3300009098 Ga0105245_10363834 Ga0105245_103638342 205
50 3300009177 Ga0105248_10296624 Ga0105248_102966241 205
51 3300009545 Ga0105237_10195837 Ga0105237_101958373 205
52 3300009551 Ga0105238_10086971 Ga0105238_100869713 205
53 3300009551 Ga0105238_10326225 Ga0105238_103262252 205
54 3300013297 Ga0157378_10221819 Ga0157378_102218192 205
55 3300013308 Ga0157375_11043307 Ga0157375_110433071 205
56 3300014969 Ga0157376_10164688 Ga0157376_101646881 205
57 3300025914 Ga0207671_10114039 Ga0207671_101140393 205
58 3300025924 Ga0207694_10005276 Ga0207694_100052764 205
59 3300025941 Ga0207711_10135621 Ga0207711_101356212 205
60 3300026041 Ga0207639_10391885 Ga0207639_103918853 205
61 3300026078 Ga0207702_10002671 Ga0207702_1000267115 205
62 3300026088 Ga0207641_10401933 Ga0207641_104019332 205
63 3300026121 Ga0207683_10568027 Ga0207683_105680271 205
64 3300026142 Ga0207698_10043839 Ga0207698_100438392 205
65 3300028379 Ga0268266_10262737 Ga0268266_102627372 205
66 3300031730 Ga0307516_10035322 Ga0307516_100353224 205
67 3300042876 Ga0451577_0000543 Ga0451577_0000543_54064_54681 205
68 3300044712 Ga0453684_0000533 Ga0453684_0000533_3554_4171 205
69 3300045051 Ga0451576_0102593 Ga0451576_0102593_2330_2947 205
70 3300048918 Ga0496115_0505030 Ga0496115_0505030_173_790 205
71 3300048929 Ga0496126_0295312 Ga0496126_0295312_673_1290 205
72 3300049569 Ga0501032_0043293 Ga0501032_0043293_397_1014 205
73 3300049570 Ga0501033_0015186 Ga0501033_0015186_1445_2062 205
74 3300049571 Ga0501034_0002776 Ga0501034_0002776_11237_11857 205
75 3300049572 Ga0501036_0132295 Ga0501036_0132295_922_1539 205
76 3300049572 Ga0501036_0348525 Ga0501036_0348525_517_1137 205
77 3300049573 Ga0501037_0076353 Ga0501037_0076353_409_1026 205
78 3300049573 Ga0501037_0255125 Ga0501037_0255125_117_734 205
79 3300049574 Ga0501038_0187986 Ga0501038_0187986_649_1266 205
80 3300049575 Ga0501039_0018424 Ga0501039_0018424_1632_2249 205
81 3300049576 Ga0501040_0145074 Ga0501040_0145074_988_1605 205
82 3300049579 Ga0501043_0045881 Ga0501043_0045881_158_778 205
83 3300049580 Ga0501046_0184279 Ga0501046_0184279_271_888 205
84 3300049580 Ga0501046_0442008 Ga0501046_0442008_147_767 205
85 3300049581 Ga0501047_0001523 Ga0501047_0001523_11059_11679 205
86 3300049582 Ga0501048_0008263 Ga0501048_0008263_6998_7615 205
87 3300049583 Ga0501067_0000619 Ga0501067_0000619_11433_12053 205
88 3300049584 Ga0501068_0078802 Ga0501068_0078802_1123_1740 205
89 3300049585 Ga0501069_0012755 Ga0501069_0012755_750_1367 205
90 3300049585 Ga0501069_0050775 Ga0501069_0050775_269_889 205
91 3300049586 Ga0501070_0003167 Ga0501070_0003167_12327_12947 205
92 3300049586 Ga0501070_0044700 Ga0501070_0044700_1661_2278 205
93 3300049587 Ga0501071_0008965 Ga0501071_0008965_327_944 205
94 3300049588 Ga0501072_0030064 Ga0501072_0030064_2642_3259 205
95 3300049589 Ga0501073_0001312 Ga0501073_0001312_9343_9963 205
96 3300049589 Ga0501073_0309049 Ga0501073_0309049_397_1014 205
97 3300049590 Ga0501074_0019787 Ga0501074_0019787_1251_1871 205
98 3300049590 Ga0501074_0181615 Ga0501074_0181615_373_990 205
99 3300049741 Ga0501079_0034838 Ga0501079_0034838_1142_1759 205
100 3300049741 Ga0501079_0533878 Ga0501079_0533878_77_694 205
101 3300049742 Ga0501080_0001727 Ga0501080_0001727_4279_4899 205
102 3300049742 Ga0501080_0537872 Ga0501080_0537872_395_1012 205
103 3300049744 Ga0501083_0007418 Ga0501083_0007418_2167_2787 205
104 3300049744 Ga0501083_0040020 Ga0501083_0040020_1883_2500 205
105 3300049822 Ga0501035_0078260 Ga0501035_0078260_76_693 205
106 3300049823 Ga0501044_0006294 Ga0501044_0006294_1398_2018 205
107 3300049823 Ga0501044_0024216 Ga0501044_0024216_4643_5260 205
108 3300053139 Ga0500568_0000952 Ga0500568_0000952_7794_8411 205
109 3300054114 Ga0501084_0086233 Ga0501084_0086233_1049_1666 205
110 3300060353 Ga0501082_0104835 Ga0501082_0104835_931_1548 205
111 3300060353 Ga0501082_0301485 Ga0501082_0301485_77_694 205
112 iso_pu_bacteria 2537561836 2538834623 205
113 iso_pu_bacteria 2734482264 2735833353 205
114 iso_pu_bacteria 2734482264 2735837799 205
115 iso_pu_bacteria 2738543009 2739228393 205
116 iso_pu_bacteria 2939611941 2939614636 205
117 3300004799 Ga0058863_11775536 Ga0058863_117755362 206
118 3300005327 Ga0070658_10129147 Ga0070658_101291472 206
119 3300005327 Ga0070658_10316884 Ga0070658_103168841 206
120 3300005331 Ga0070670_100003232 Ga0070670_10000323210 206
121 3300005331 Ga0070670_100184825 Ga0070670_1001848253 206
122 3300005335 Ga0070666_10021006 Ga0070666_100210065 206
123 3300005336 Ga0070680_100188167 Ga0070680_1001881672 206
124 3300005338 Ga0068868_100307562 Ga0068868_1003075622 206
125 3300005344 Ga0070661_100026423 Ga0070661_1000264235 206
126 3300005344 Ga0070661_100158823 Ga0070661_1001588232 206
127 3300005344 Ga0070661_100521705 Ga0070661_1005217051 206
128 3300005364 Ga0070673_100027257 Ga0070673_1000272573 206
129 3300005367 Ga0070667_100000005 Ga0070667_100000005101 206
130 3300005367 Ga0070667_100062337 Ga0070667_1000623372 206
131 3300005367 Ga0070667_100097600 Ga0070667_1000976002 206
132 3300005367 Ga0070667_100138220 Ga0070667_1001382202 206
133 3300005439 Ga0070711_100069150 Ga0070711_1000691502 206
134 3300005455 Ga0070663_100004878 Ga0070663_1000048782 206
135 3300005455 Ga0070663_100009056 Ga0070663_1000090561 206
136 3300005455 Ga0070663_100024628 Ga0070663_1000246284 206
137 3300005455 Ga0070663_100335658 Ga0070663_1003356582 206
138 3300005457 Ga0070662_100008490 Ga0070662_1000084902 206
139 3300005458 Ga0070681_10042418 Ga0070681_100424182 206
140 3300005466 Ga0070685_10003480 Ga0070685_100034805 206
141 3300005530 Ga0070679_100055197 Ga0070679_1000551975 206
142 3300005530 Ga0070679_100221925 Ga0070679_1002219252 206
143 3300005539 Ga0068853_100003367 Ga0068853_1000033672 206
144 3300005539 Ga0068853_100020363 Ga0068853_1000203632 206
145 3300005539 Ga0068853_100039275 Ga0068853_1000392754 206
146 3300005539 Ga0068853_100145952 Ga0068853_1001459523 206
147 3300005539 Ga0068853_100547944 Ga0068853_1005479442 206
148 3300005547 Ga0070693_100005909 Ga0070693_1000059092 206
149 3300005548 Ga0070665_100000062 Ga0070665_100000062102 206
150 3300005548 Ga0070665_100001482 Ga0070665_1000014822 206
151 3300005563 Ga0068855_100212061 Ga0068855_1002120612 206
152 3300005564 Ga0070664_100524934 Ga0070664_1005249342 206
153 3300005577 Ga0068857_100241676 Ga0068857_1002416762 206
154 3300005577 Ga0068857_100282547 Ga0068857_1002825473 206
155 3300005614 Ga0068856_100169761 Ga0068856_1001697613 206
156 3300005616 Ga0068852_100005452 Ga0068852_1000054529 206
157 3300005616 Ga0068852_100136432 Ga0068852_1001364322 206
158 3300005616 Ga0068852_100277398 Ga0068852_1002773982 206
159 3300005834 Ga0068851_10047128 Ga0068851_100471284 206
160 3300005841 Ga0068863_100335364 Ga0068863_1003353642 206
161 3300005842 Ga0068858_100001325 Ga0068858_10000132517 206
162 3300005842 Ga0068858_100233568 Ga0068858_1002335682 206
163 3300005844 Ga0068862_100400602 Ga0068862_1004006021 206
164 3300005937 Ga0081455_10045286 Ga0081455_100452863 206
165 3300006237 Ga0097621_100101376 Ga0097621_1001013764 206
166 3300006358 Ga0068871_100064954 Ga0068871_1000649542 206
167 3300006881 Ga0068865_100201766 Ga0068865_1002017662 206
168 3300009011 Ga0105251_10127723 Ga0105251_101277232 206
169 3300009093 Ga0105240_10001278 Ga0105240_100012789 206
170 3300009093 Ga0105240_10439147 Ga0105240_104391472 206
171 3300009098 Ga0105245_10773967 Ga0105245_107739672 206
172 3300009174 Ga0105241_10096475 Ga0105241_100964754 206
173 3300009177 Ga0105248_10002061 Ga0105248_1000206123 206
174 3300009177 Ga0105248_10129409 Ga0105248_101294092 206
175 3300009177 Ga0105248_10251166 Ga0105248_102511663 206
176 3300009545 Ga0105237_10004780 Ga0105237_1000478020 206
177 3300009545 Ga0105237_11012795 Ga0105237_110127952 206
178 3300009551 Ga0105238_10032728 Ga0105238_100327282 206
179 3300009551 Ga0105238_10055319 Ga0105238_100553195 206
180 3300009553 Ga0105249_10002473 Ga0105249_1000247320 206
181 3300009553 Ga0105249_10025839 Ga0105249_100258396 206
182 3300010375 Ga0105239_10106229 Ga0105239_101062291 206
183 3300010375 Ga0105239_10125127 Ga0105239_101251272 206
184 3300010375 Ga0105239_10221435 Ga0105239_102214353 206
185 3300010375 Ga0105239_10325273 Ga0105239_103252732 206
186 3300011119 Ga0105246_10729468 Ga0105246_107294682 206
187 3300013100 Ga0157373_10155666 Ga0157373_101556662 206
188 3300013102 Ga0157371_10645570 Ga0157371_106455701 206
189 3300013104 Ga0157370_10222091 Ga0157370_102220912 206
190 3300013104 Ga0157370_10453721 Ga0157370_104537212 206
191 3300013105 Ga0157369_10164205 Ga0157369_101642054 206
192 3300013105 Ga0157369_10406855 Ga0157369_104068552 206
193 3300013296 Ga0157374_10052356 Ga0157374_100523565 206
194 3300013307 Ga0157372_10189198 Ga0157372_101891983 206
195 3300013307 Ga0157372_10193754 Ga0157372_101937545 206
196 3300013308 Ga0157375_11096410 Ga0157375_110964102 206
197 3300014325 Ga0163163_10593421 Ga0163163_105934211 206
198 3300014969 Ga0157376_10134518 Ga0157376_101345182 206
199 3300020070 Ga0206356_10153146 Ga0206356_101531462 206
200 3300020081 Ga0206354_10250691 Ga0206354_102506912 206
201 3300025303 Ga0209051_1013016 Ga0209051_10130164 206
202 3300025321 Ga0207656_10001827 Ga0207656_100018275 206
203 3300025321 Ga0207656_10062648 Ga0207656_100626482 206
204 3300025903 Ga0207680_10003078 Ga0207680_1000307810 206
205 3300025909 Ga0207705_10110203 Ga0207705_101102032 206
206 3300025911 Ga0207654_10129466 Ga0207654_101294662 206
207 3300025912 Ga0207707_10143369 Ga0207707_101433692 206
208 3300025913 Ga0207695_10000033 Ga0207695_10000033362 206
209 3300025913 Ga0207695_10005921 Ga0207695_100059212 206
210 3300025913 Ga0207695_10034290 Ga0207695_100342903 206
211 3300025913 Ga0207695_10446241 Ga0207695_104462412 206
212 3300025914 Ga0207671_10004488 Ga0207671_100044885 206
213 3300025914 Ga0207671_10013246 Ga0207671_100132465 206
214 3300025914 Ga0207671_10034031 Ga0207671_100340312 206
215 3300025917 Ga0207660_10251721 Ga0207660_102517212 206
216 3300025920 Ga0207649_10009882 Ga0207649_100098824 206
217 3300025920 Ga0207649_10041331 Ga0207649_100413315 206
218 3300025921 Ga0207652_10059229 Ga0207652_100592295 206
219 3300025924 Ga0207694_10002668 Ga0207694_100026688 206
220 3300025924 Ga0207694_10003738 Ga0207694_100037386 206
221 3300025925 Ga0207650_10009991 Ga0207650_100099915 206
222 3300025933 Ga0207706_10052916 Ga0207706_100529165 206
223 3300025938 Ga0207704_10088448 Ga0207704_100884483 206
224 3300025941 Ga0207711_10000470 Ga0207711_100004703 206
225 3300025941 Ga0207711_10162642 Ga0207711_101626422 206
226 3300025949 Ga0207667_10120945 Ga0207667_101209452 206
227 3300025949 Ga0207667_11111797 Ga0207667_111117971 206
228 3300025961 Ga0207712_10000165 Ga0207712_1000016529 206
229 3300025961 Ga0207712_10000771 Ga0207712_1000077112 206
230 3300025986 Ga0207658_10000006 Ga0207658_10000006271 206
231 3300025986 Ga0207658_10016117 Ga0207658_100161172 206
232 3300025986 Ga0207658_10129629 Ga0207658_101296293 206
233 3300026023 Ga0207677_10060979 Ga0207677_100609794 206
234 3300026035 Ga0207703_10000553 Ga0207703_100005537 206
235 3300026041 Ga0207639_10000217 Ga0207639_1000021720 206
236 3300026041 Ga0207639_10004497 Ga0207639_100044975 206
237 3300026041 Ga0207639_10124736 Ga0207639_101247362 206
238 3300026041 Ga0207639_10143638 Ga0207639_101436382 206
239 3300026067 Ga0207678_10001340 Ga0207678_100013409 206
240 3300026067 Ga0207678_10005262 Ga0207678_1000526213 206
241 3300026067 Ga0207678_10073285 Ga0207678_100732852 206
242 3300026067 Ga0207678_10401985 Ga0207678_104019852 206
243 3300026078 Ga0207702_10060529 Ga0207702_100605295 206
244 3300026088 Ga0207641_10905676 Ga0207641_109056762 206
245 3300026116 Ga0207674_10127511 Ga0207674_101275111 206
246 3300026142 Ga0207698_10138025 Ga0207698_101380253 206
247 3300026142 Ga0207698_10210449 Ga0207698_102104492 206
248 3300026142 Ga0207698_10223943 Ga0207698_102239432 206
249 3300028379 Ga0268266_10000001 Ga0268266_100000011780 206
250 3300028379 Ga0268266_10000006 Ga0268266_100000061156 206
251 3300031665 Ga0316575_10188527 Ga0316575_101885271 206
252 3300031691 Ga0316579_10006748 Ga0316579_100067485 206
253 3300031728 Ga0316578_10167457 Ga0316578_101674572 206
254 3300031733 Ga0316577_10149675 Ga0316577_101496751 206
255 3300035398 Ga0316574_0003830 Ga0316574_0003830_2701_3321 206
256 3300035398 Ga0316574_0384521 Ga0316574_0384521_138_758 206
257 3300036647 Ga0316582_0003307 Ga0316582_0003307_3481_4101 206
258 3300036647 Ga0316582_0003479 Ga0316582_0003479_6353_6973 206
259 3300036647 Ga0316582_0021067 Ga0316582_0021067_2963_3583 206
260 3300036712 Ga0316584_0001131 Ga0316584_0001131_13391_14011 206
261 3300036712 Ga0316584_0071174 Ga0316584_0071174_1738_2358 206
262 3300036712 Ga0316584_0104210 Ga0316584_0104210_1011_1631 206
263 3300036712 Ga0316584_0548402 Ga0316584_0548402_58_678 206
264 3300037418 Ga0395900_0005906 Ga0395900_0005906_1631_2302 206
265 3300037588 Ga0316581_0000030 Ga0316581_0000030_13468_14088 206
266 3300037588 Ga0316581_0039133 Ga0316581_0039133_709_1329 206
267 3300039450 Ga0436363_1278302 Ga0436363_1278302_258_881 206
268 3300041441 Ga0451787_424847 Ga0451787_424847_349_969 206
269 3300041452 Ga0451793_0203707 Ga0451793_0203707_332_952 206
270 3300041453 Ga0451797_0696143 Ga0451797_0696143_951_1571 206
271 3300041460 Ga0451802_0653047 Ga0451802_0653047_245_865 206
272 3300041486 Ga0451807_0052036 Ga0451807_0052036_729_1349 206
273 3300041486 Ga0451807_1727819 Ga0451807_1727819_174_794 206
274 3300041494 Ga0451837_0211328 Ga0451837_0211328_437_1057 206
275 3300041494 Ga0451837_1594622 Ga0451837_1594622_41_661 206
276 3300041509 Ga0451843_0832695 Ga0451843_0832695_735_1355 206
277 3300045976 Ga0466967_0215672 Ga0466967_0215672_757_1377 206
278 3300047472 Ga0495686_0008876 Ga0495686_0008876_914_1534 206
279 3300048910 Ga0496107_0211521 Ga0496107_0211521_494_1114 206
280 3300048916 Ga0496113_0265200 Ga0496113_0265200_201_821 206
281 3300048920 Ga0496117_0036780 Ga0496117_0036780_564_1184 206
282 3300048920 Ga0496117_0070480 Ga0496117_0070480_1015_1653 206
283 3300048921 Ga0496118_0076525 Ga0496118_0076525_956_1594 206
284 3300048924 Ga0496121_0055034 Ga0496121_0055034_1108_1728 206
285 3300048925 Ga0496122_0000487 Ga0496122_0000487_3137_3757 206
286 3300048926 Ga0496123_0000296 Ga0496123_0000296_62385_63005 206
287 3300048928 Ga0496125_0136041 Ga0496125_0136041_464_1084 206
288 3300048929 Ga0496126_0296237 Ga0496126_0296237_380_1000 206
289 3300049568 Ga0501031_0033304 Ga0501031_0033304_1518_2138 206
290 3300049569 Ga0501032_0013770 Ga0501032_0013770_234_854 206
291 3300049570 Ga0501033_0019531 Ga0501033_0019531_1084_1704 206
292 3300049571 Ga0501034_0048739 Ga0501034_0048739_233_853 206
293 3300049572 Ga0501036_0060031 Ga0501036_0060031_896_1516 206
294 3300049573 Ga0501037_0000499 Ga0501037_0000499_28697_29317 206
295 3300049574 Ga0501038_0003315 Ga0501038_0003315_13609_14229 206
296 3300049578 Ga0501042_0158072 Ga0501042_0158072_54_674 206
297 3300049578 Ga0501042_0543193 Ga0501042_0543193_211_831 206
298 3300049579 Ga0501043_0007141 Ga0501043_0007141_2368_2988 206
299 3300049580 Ga0501046_0003027 Ga0501046_0003027_1074_1694 206
300 3300049581 Ga0501047_0019332 Ga0501047_0019332_2368_2988 206
301 3300049581 Ga0501047_0152962 Ga0501047_0152962_1300_1920 206
302 3300049582 Ga0501048_0110392 Ga0501048_0110392_251_871 206
303 3300049583 Ga0501067_0034617 Ga0501067_0034617_410_1030 206
304 3300049586 Ga0501070_0038613 Ga0501070_0038613_1979_2599 206
305 3300049589 Ga0501073_0002117 Ga0501073_0002117_3225_3845 206
306 3300049590 Ga0501074_0065373 Ga0501074_0065373_516_1136 206
307 3300049742 Ga0501080_0013993 Ga0501080_0013993_1709_2329 206
308 3300049742 Ga0501080_0035297 Ga0501080_0035297_95_715 206
309 3300049822 Ga0501035_0017155 Ga0501035_0017155_3924_4544 206
310 3300049822 Ga0501035_0189958 Ga0501035_0189958_278_898 206
311 3300049823 Ga0501044_0015031 Ga0501044_0015031_5171_5791 206
312 3300049823 Ga0501044_0176063 Ga0501044_0176063_625_1245 206
313 3300049823 Ga0501044_0622550 Ga0501044_0622550_277_906 206
314 3300053087 Ga0500643_005173 Ga0500643_005173_970_1590 206
315 3300053093 Ga0500651_0102806 Ga0500651_0102806_247_867 206
316 3300053120 Ga0500597_000335 Ga0500597_000335_602_1222 206
317 3300055283 Ga0500661_021664 Ga0500661_021664_80_715 206
318 iso_pu_bacteria 2643221579 2643908888 206
319 iso_pu_bacteria 2643221581 2643915428 206
320 iso_pu_bacteria 2747842501 2748015618 206
321 iso_pu_bacteria 2923516293 2923519023 206
322 3300005334 Ga0068869_100143932 Ga0068869_1001439322 207
323 3300005334 Ga0068869_100357235 Ga0068869_1003572352 207
324 3300005340 Ga0070689_100239447 Ga0070689_1002394472 207
325 3300005345 Ga0070692_10091172 Ga0070692_100911721 207
326 3300005364 Ga0070673_100182693 Ga0070673_1001826933 207
327 3300005441 Ga0070700_100102054 Ga0070700_1001020543 207
328 3300005444 Ga0070694_100075030 Ga0070694_1000750303 207
329 3300005444 Ga0070694_100116435 Ga0070694_1001164353 207
330 3300005456 Ga0070678_100117199 Ga0070678_1001171993 207
331 3300005457 Ga0070662_100493055 Ga0070662_1004930551 207
332 3300005543 Ga0070672_100278654 Ga0070672_1002786542 207
333 3300005543 Ga0070672_100396620 Ga0070672_1003966202 207
334 3300005549 Ga0070704_100343010 Ga0070704_1003430102 207
335 3300005617 Ga0068859_100169678 Ga0068859_1001696782 207
336 3300005618 Ga0068864_100225814 Ga0068864_1002258142 207
337 3300005719 Ga0068861_100036281 Ga0068861_1000362812 207
338 3300005719 Ga0068861_100068799 Ga0068861_1000687992 207
339 3300005841 Ga0068863_100189952 Ga0068863_1001899523 207
340 3300005844 Ga0068862_100289079 Ga0068862_1002890793 207
341 3300006237 Ga0097621_100118942 Ga0097621_1001189422 207
342 3300006237 Ga0097621_100520190 Ga0097621_1005201901 207
343 3300006844 Ga0075428_100003215 Ga0075428_10000321515 207
344 3300006846 Ga0075430_100013050 Ga0075430_1000130508 207
345 3300006852 Ga0075433_10031019 Ga0075433_100310192 207
346 3300006881 Ga0068865_100116570 Ga0068865_1001165702 207
347 3300006931 Ga0097620_100169686 Ga0097620_1001696862 207
348 3300009093 Ga0105240_10061336 Ga0105240_100613363 207
349 3300009093 Ga0105240_10405029 Ga0105240_104050292 207
350 3300009094 Ga0111539_10018132 Ga0111539_100181323 207
351 3300009094 Ga0111539_11223966 Ga0111539_112239661 207
352 3300009094 Ga0111539_11339585 Ga0111539_113395851 207
353 3300009551 Ga0105238_10024550 Ga0105238_100245503 207
354 3300009553 Ga0105249_10101054 Ga0105249_101010542 207
355 3300010375 Ga0105239_10018289 Ga0105239_100182899 207
356 3300013105 Ga0157369_10000032 Ga0157369_1000003259 207
357 3300013307 Ga0157372_10007958 Ga0157372_1000795815 207
358 3300014326 Ga0157380_10130820 Ga0157380_101308202 207
359 3300014968 Ga0157379_10052017 Ga0157379_100520172 207
360 3300014969 Ga0157376_10456447 Ga0157376_104564472 207
361 3300025903 Ga0207680_10109953 Ga0207680_101099533 207
362 3300025907 Ga0207645_10105181 Ga0207645_101051812 207
363 3300025913 Ga0207695_10007552 Ga0207695_1000755212 207
364 3300025914 Ga0207671_10003137 Ga0207671_100031373 207
365 3300025917 Ga0207660_10413363 Ga0207660_104133631 207
366 3300025919 Ga0207657_10188169 Ga0207657_101881692 207
367 3300025923 Ga0207681_10706039 Ga0207681_107060391 207
368 3300025924 Ga0207694_10006609 Ga0207694_100066095 207
369 3300025931 Ga0207644_10005307 Ga0207644_100053074 207
370 3300025940 Ga0207691_10238619 Ga0207691_102386192 207
371 3300025940 Ga0207691_10388861 Ga0207691_103888612 207
372 3300025942 Ga0207689_10054480 Ga0207689_100544802 207
373 3300025961 Ga0207712_10057473 Ga0207712_100574732 207
374 3300026075 Ga0207708_10015570 Ga0207708_100155702 207
375 3300026118 Ga0207675_100008268 Ga0207675_1000082688 207
376 3300026118 Ga0207675_100050463 Ga0207675_1000504635 207
377 3300026121 Ga0207683_10191731 Ga0207683_101917312 207
378 3300027695 Ga0209966_1029318 Ga0209966_10293182 207
379 3300027907 Ga0207428_10015745 Ga0207428_100157453 207
380 3300028381 Ga0268264_10540004 Ga0268264_105400042 207
381 3300031911 Ga0307412_10289834 Ga0307412_102898342 207
382 3300035398 Ga0316574_0005837 Ga0316574_0005837_156_779 207
383 3300035398 Ga0316574_0006179 Ga0316574_0006179_3098_3721 207
384 3300035398 Ga0316574_0057540 Ga0316574_0057540_1695_2318 207
385 3300042876 Ga0451577_0256247 Ga0451577_0256247_636_1259 207
386 3300044656 Ga0466969_0155589 Ga0466969_0155589_77_700 207
387 3300045051 Ga0451576_0027440 Ga0451576_0027440_2467_3090 207
388 3300046499 Ga0495594_0361525 Ga0495594_0361525_67_690 207
389 3300046664 Ga0495659_0131686 Ga0495659_0131686_73_696 207
390 3300049572 Ga0501036_0067456 Ga0501036_0067456_1977_2600 207
391 3300049575 Ga0501039_0143181 Ga0501039_0143181_1036_1659 207
392 3300049577 Ga0501041_0113511 Ga0501041_0113511_300_923 207
393 3300049586 Ga0501070_0504069 Ga0501070_0504069_51_677 207
394 3300049591 Ga0501075_0301460 Ga0501075_0301460_312_935 207
395 3300050509 nmdc:mga0qj67_91052_c1 nmdc:mga0qj67_91052_c1_1348_1971 207
396 3300050511 nmdc:mga08y16_11439_c1 nmdc:mga08y16_11439_c1_2796_3419 207
397 3300050511 nmdc:mga08y16_1174852_c1 nmdc:mga08y16_1174852_c1_37_660 207
398 3300050511 nmdc:mga08y16_196714_c1 nmdc:mga08y16_196714_c1_1448_2071 207
399 3300050515 nmdc:mga0a205_22852_c1 nmdc:mga0a205_22852_c1_2950_3573 207
400 3300005330 Ga0070690_100012274 Ga0070690_1000122742 208
401 3300005331 Ga0070670_100066426 Ga0070670_1000664262 208
402 3300005334 Ga0068869_100146300 Ga0068869_1001463002 208
403 3300005338 Ga0068868_100003997 Ga0068868_1000039973 208
404 3300005339 Ga0070660_100860189 Ga0070660_1008601891 208
405 3300005364 Ga0070673_100028362 Ga0070673_1000283622 208
406 3300005367 Ga0070667_100079369 Ga0070667_1000793692 208
407 3300005434 Ga0070709_10003340 Ga0070709_100033408 208
408 3300005439 Ga0070711_100360920 Ga0070711_1003609202 208
409 3300005466 Ga0070685_10025507 Ga0070685_100255073 208
410 3300005543 Ga0070672_100328539 Ga0070672_1003285392 208
411 3300005544 Ga0070686_100293412 Ga0070686_1002934121 208
412 3300005548 Ga0070665_100022022 Ga0070665_1000220224 208
413 3300005564 Ga0070664_100004667 Ga0070664_1000046672 208
414 3300005615 Ga0070702_100072672 Ga0070702_1000726722 208
415 3300005617 Ga0068859_100008663 Ga0068859_1000086638 208
416 3300005618 Ga0068864_100005830 Ga0068864_1000058306 208
417 3300005719 Ga0068861_100756616 Ga0068861_1007566161 208
418 3300005841 Ga0068863_100035993 Ga0068863_1000359933 208
419 3300005842 Ga0068858_100014128 Ga0068858_1000141283 208
420 3300005843 Ga0068860_100019554 Ga0068860_1000195542 208
421 3300006237 Ga0097621_100009176 Ga0097621_1000091762 208
422 3300006358 Ga0068871_100005841 Ga0068871_1000058413 208
423 3300006871 Ga0075434_100738905 Ga0075434_1007389052 208
424 3300006931 Ga0097620_100008663 Ga0097620_1000086638 208
425 3300007265 Ga0099794_10081435 Ga0099794_100814352 208
426 3300007788 Ga0099795_10000064 Ga0099795_100000649 208
427 3300007788 Ga0099795_10050150 Ga0099795_100501502 208
428 3300007788 Ga0099795_10078744 Ga0099795_100787441 208
429 3300009093 Ga0105240_10163453 Ga0105240_101634533 208
430 3300009098 Ga0105245_10003531 Ga0105245_1000353111 208
431 3300009101 Ga0105247_10021024 Ga0105247_100210242 208
432 3300009148 Ga0105243_11067241 Ga0105243_110672412 208
433 3300009176 Ga0105242_10359063 Ga0105242_103590632 208
434 3300009177 Ga0105248_10010033 Ga0105248_100100332 208
435 3300009545 Ga0105237_10442532 Ga0105237_104425322 208
436 3300009551 Ga0105238_10367898 Ga0105238_103678982 208
437 3300009553 Ga0105249_10216145 Ga0105249_102161452 208
438 3300010159 Ga0099796_10000064 Ga0099796_1000006411 208
439 3300011119 Ga0105246_10020552 Ga0105246_100205522 208
440 3300013296 Ga0157374_10002676 Ga0157374_100026767 208
441 3300013297 Ga0157378_10375160 Ga0157378_103751603 208
442 3300013306 Ga0163162_10007195 Ga0163162_100071953 208
443 3300013308 Ga0157375_10049038 Ga0157375_100490383 208
444 3300014325 Ga0163163_10015604 Ga0163163_100156043 208
445 3300014326 Ga0157380_11087087 Ga0157380_110870871 208
446 3300014745 Ga0157377_10125033 Ga0157377_101250332 208
447 3300014968 Ga0157379_10452806 Ga0157379_104528061 208
448 3300014969 Ga0157376_10070476 Ga0157376_100704762 208
449 3300025913 Ga0207695_10184901 Ga0207695_101849012 208
450 3300025919 Ga0207657_10527203 Ga0207657_105272032 208
451 3300025925 Ga0207650_10040606 Ga0207650_100406063 208
452 3300025927 Ga0207687_10018293 Ga0207687_100182933 208
453 3300025933 Ga0207706_10059192 Ga0207706_100591923 208
454 3300025940 Ga0207691_10480311 Ga0207691_104803112 208
455 3300025941 Ga0207711_10007410 Ga0207711_100074105 208
456 3300025942 Ga0207689_10100713 Ga0207689_101007132 208
457 3300025945 Ga0207679_10215560 Ga0207679_102155602 208
458 3300026023 Ga0207677_10218081 Ga0207677_102180812 208
459 3300026035 Ga0207703_10028956 Ga0207703_100289562 208
460 3300026041 Ga0207639_10502556 Ga0207639_105025562 208
461 3300026067 Ga0207678_10259792 Ga0207678_102597922 208
462 3300026088 Ga0207641_10016935 Ga0207641_100169352 208
463 3300026088 Ga0207641_10615933 Ga0207641_106159332 208
464 3300026089 Ga0207648_10048941 Ga0207648_100489411 208
465 3300026095 Ga0207676_10031766 Ga0207676_100317662 208
466 3300026118 Ga0207675_100545995 Ga0207675_1005459952 208
467 3300027512 Ga0209179_1000062 Ga0209179_10000622 208
468 3300028379 Ga0268266_10043867 Ga0268266_100438673 208
469 3300028381 Ga0268264_10100170 Ga0268264_101001702 208
470 3300031733 Ga0316577_10020308 Ga0316577_100203084 208
471 3300035117 Ga0373953_0063289 Ga0373953_0063289_583_1209 208
472 3300035172 Ga0373955_0028400 Ga0373955_0028400_1433_2059 208
473 3300035398 Ga0316574_0060045 Ga0316574_0060045_260_886 208
474 3300035410 Ga0373924_0018094 Ga0373924_0018094_492_1118 208
475 3300035724 Ga0373933_0271513 Ga0373933_0271513_390_1016 208
476 3300036401 Ga0373937_0036733 Ga0373937_0036733_2143_2769 208
477 3300036401 Ga0373937_0102030 Ga0373937_0102030_58_684 208
478 3300036712 Ga0316584_0141162 Ga0316584_0141162_24_650 208
479 3300045049 Ga0466959_0070150 Ga0466959_0070150_208_834 208
480 3300045051 Ga0451576_0042101 Ga0451576_0042101_3564_4190 208
481 3300046678 Ga0495599_0438045 Ga0495599_0438045_133_759 208
482 3300048903 Ga0496100_0283629 Ga0496100_0283629_182_808 208
483 3300048904 Ga0496101_0261736 Ga0496101_0261736_550_1176 208
484 3300048907 Ga0496104_0062004 Ga0496104_0062004_2101_2727 208
485 3300048911 Ga0496108_0021655 Ga0496108_0021655_3327_3953 208
486 3300048912 Ga0496109_0042225 Ga0496109_0042225_839_1465 208
487 3300048913 Ga0496110_0301681 Ga0496110_0301681_755_1381 208
488 3300048915 Ga0496112_0015148 Ga0496112_0015148_6024_6650 208
489 3300048916 Ga0496113_0079264 Ga0496113_0079264_1514_2140 208
490 3300049585 Ga0501069_0065715 Ga0501069_0065715_914_1540 208
491 3300053077 Ga0495601_0027161 Ga0495601_0027161_2029_2655 208
492 3300005327 Ga0070658_10183396 Ga0070658_101833962 209
493 3300005329 Ga0070683_100589297 Ga0070683_1005892971 209
494 3300005330 Ga0070690_100291850 Ga0070690_1002918502 209
495 3300005334 Ga0068869_100104729 Ga0068869_1001047294 209
496 3300005335 Ga0070666_10273246 Ga0070666_102732461 209
497 3300005336 Ga0070680_100035599 Ga0070680_1000355995 209
498 3300005337 Ga0070682_100001003 Ga0070682_10000100310 209
499 3300005337 Ga0070682_100013088 Ga0070682_1000130884 209
500 3300005337 Ga0070682_100184641 Ga0070682_1001846412 209
501 3300005338 Ga0068868_100200423 Ga0068868_1002004233 209
502 3300005340 Ga0070689_100253351 Ga0070689_1002533511 209
503 3300005341 Ga0070691_10100303 Ga0070691_101003033 209
504 3300005344 Ga0070661_100142059 Ga0070661_1001420594 209
505 3300005345 Ga0070692_10002864 Ga0070692_100028642 209
506 3300005345 Ga0070692_10159184 Ga0070692_101591842 209
507 3300005354 Ga0070675_100125898 Ga0070675_1001258981 209
508 3300005355 Ga0070671_100289817 Ga0070671_1002898172 209
509 3300005356 Ga0070674_100099394 Ga0070674_1000993944 209
510 3300005365 Ga0070688_100362286 Ga0070688_1003622862 209
511 3300005366 Ga0070659_100003413 Ga0070659_1000034138 209
512 3300005367 Ga0070667_100152010 Ga0070667_1001520104 209
513 3300005367 Ga0070667_100168594 Ga0070667_1001685942 209
514 3300005435 Ga0070714_100000034 Ga0070714_100000034130 209
515 3300005444 Ga0070694_100604327 Ga0070694_1006043271 209
516 3300005455 Ga0070663_100228774 Ga0070663_1002287742 209
517 3300005458 Ga0070681_10002489 Ga0070681_1000248914 209
518 3300005458 Ga0070681_10037443 Ga0070681_100374436 209
519 3300005458 Ga0070681_10047300 Ga0070681_100473007 209
520 3300005459 Ga0068867_100032358 Ga0068867_1000323582 209
521 3300005530 Ga0070679_100033446 Ga0070679_1000334462 209
522 3300005530 Ga0070679_100178635 Ga0070679_1001786353 209
523 3300005530 Ga0070679_100328945 Ga0070679_1003289452 209
524 3300005539 Ga0068853_100001206 Ga0068853_10000120611 209
525 3300005539 Ga0068853_100046651 Ga0068853_1000466516 209
526 3300005539 Ga0068853_100131158 Ga0068853_1001311584 209
527 3300005539 Ga0068853_100206934 Ga0068853_1002069343 209
528 3300005539 Ga0068853_100274007 Ga0068853_1002740071 209
529 3300005546 Ga0070696_100002465 Ga0070696_10000246514 209
530 3300005546 Ga0070696_100003766 Ga0070696_10000376610 209
531 3300005563 Ga0068855_100013534 Ga0068855_1000135347 209
532 3300005563 Ga0068855_100022716 Ga0068855_10002271611 209
533 3300005563 Ga0068855_100374393 Ga0068855_1003743932 209
534 3300005563 Ga0068855_100753137 Ga0068855_1007531372 209
535 3300005577 Ga0068857_100059380 Ga0068857_1000593805 209
536 3300006881 Ga0068865_100059895 Ga0068865_1000598952 209
537 3300009098 Ga0105245_10757196 Ga0105245_107571962 209
538 3300009101 Ga0105247_10014315 Ga0105247_100143157 209
539 3300009174 Ga0105241_10067168 Ga0105241_100671684 209
540 3300009174 Ga0105241_10564590 Ga0105241_105645902 209
541 3300009551 Ga0105238_10014138 Ga0105238_1001413811 209
542 3300009551 Ga0105238_10268181 Ga0105238_102681812 209
543 3300010375 Ga0105239_10144450 Ga0105239_101444504 209
544 3300013100 Ga0157373_10072564 Ga0157373_100725642 209
545 3300013102 Ga0157371_10005748 Ga0157371_100057482 209
546 3300013105 Ga0157369_10252566 Ga0157369_102525661 209
547 3300013306 Ga0163162_10000015 Ga0163162_10000015143 209
548 3300013306 Ga0163162_10179018 Ga0163162_101790182 209
549 3300013306 Ga0163162_10603941 Ga0163162_106039412 209
550 3300013306 Ga0163162_10722167 Ga0163162_107221672 209
551 3300013307 Ga0157372_10007227 Ga0157372_1000722714 209
552 3300013307 Ga0157372_10531026 Ga0157372_105310262 209
553 3300013308 Ga0157375_11094181 Ga0157375_110941812 209
554 3300014497 Ga0182008_10012022 Ga0182008_100120227 209
555 3300014497 Ga0182008_10044098 Ga0182008_100440984 209
556 3300015261 Ga0182006_1000072 Ga0182006_100007265 209
557 3300015262 Ga0182007_10014466 Ga0182007_100144664 209
558 3300015265 Ga0182005_1008905 Ga0182005_10089052 209
559 3300017792 Ga0163161_10003999 Ga0163161_1000399911 209
560 3300025302 Ga0207426_1008053 Ga0207426_10080534 209
561 3300025903 Ga0207680_10226315 Ga0207680_102263152 209
562 3300025904 Ga0207647_10008817 Ga0207647_100088176 209
563 3300025909 Ga0207705_10156265 Ga0207705_101562652 209
564 3300025912 Ga0207707_10000933 Ga0207707_1000093316 209
565 3300025914 Ga0207671_10076557 Ga0207671_100765574 209
566 3300025917 Ga0207660_10012771 Ga0207660_100127717 209
567 3300025919 Ga0207657_10329127 Ga0207657_103291272 209
568 3300025920 Ga0207649_10370334 Ga0207649_103703342 209
569 3300025921 Ga0207652_10002665 Ga0207652_1000266516 209
570 3300025921 Ga0207652_10252094 Ga0207652_102520942 209
571 3300025921 Ga0207652_10596818 Ga0207652_105968182 209
572 3300025924 Ga0207694_10013765 Ga0207694_100137651 209
573 3300025925 Ga0207650_10153251 Ga0207650_101532514 209
574 3300025926 Ga0207659_10204061 Ga0207659_102040613 209
575 3300025929 Ga0207664_10000021 Ga0207664_1000002193 209
576 3300025932 Ga0207690_10000734 Ga0207690_1000073424 209
577 3300025932 Ga0207690_10005653 Ga0207690_100056538 209
578 3300025933 Ga0207706_10035735 Ga0207706_100357356 209
579 3300025934 Ga0207686_10009012 Ga0207686_100090126 209
580 3300025936 Ga0207670_10490945 Ga0207670_104909452 209
581 3300025937 Ga0207669_10406243 Ga0207669_104062432 209
582 3300025942 Ga0207689_10128956 Ga0207689_101289564 209
583 3300025949 Ga0207667_10136837 Ga0207667_101368374 209
584 3300026023 Ga0207677_10415334 Ga0207677_104153342 209
585 3300026041 Ga0207639_10023741 Ga0207639_100237412 209
586 3300026041 Ga0207639_10070097 Ga0207639_100700972 209
587 3300026041 Ga0207639_10187967 Ga0207639_101879672 209
588 3300026041 Ga0207639_10294512 Ga0207639_102945121 209
589 3300026067 Ga0207678_10060058 Ga0207678_100600585 209
590 3300026089 Ga0207648_10122708 Ga0207648_101227083 209
591 3300026095 Ga0207676_10120531 Ga0207676_101205313 209
592 3300026116 Ga0207674_10009055 Ga0207674_1000905512 209
593 3300028379 Ga0268266_10099202 Ga0268266_100992022 209
594 3300028379 Ga0268266_10284648 Ga0268266_102846481 209
595 3300028381 Ga0268264_10001065 Ga0268264_1000106513 209
596 3300028381 Ga0268264_10370134 Ga0268264_103701342 209
597 3300031691 Ga0316579_10148270 Ga0316579_101482702 209
598 3300031727 Ga0316576_10111114 Ga0316576_101111142 209
599 3300031728 Ga0316578_10020751 Ga0316578_100207512 209
600 3300031728 Ga0316578_10048071 Ga0316578_100480715 209
601 3300031728 Ga0316578_10107553 Ga0316578_101075531 209
602 3300031728 Ga0316578_10123309 Ga0316578_101233093 209
603 3300031730 Ga0307516_10038403 Ga0307516_100384032 209
604 3300031733 Ga0316577_10108346 Ga0316577_101083462 209
605 3300031824 Ga0307413_10089612 Ga0307413_100896124 209
606 3300032004 Ga0307414_10260042 Ga0307414_102600422 209
607 3300032133 Ga0316583_10003904 Ga0316583_100039044 209
608 3300032133 Ga0316583_10038033 Ga0316583_100380332 209
609 3300032168 Ga0316593_10030131 Ga0316593_100301312 209
610 3300033527 Ga0316586_1014900 Ga0316586_10149002 209
611 3300035398 Ga0316574_0004019 Ga0316574_0004019_1117_1749 209
612 3300035398 Ga0316574_0005371 Ga0316574_0005371_748_1380 209
613 3300035398 Ga0316574_0066076 Ga0316574_0066076_476_1117 209
614 3300036647 Ga0316582_0062775 Ga0316582_0062775_185_817 209
615 3300036712 Ga0316584_0002666 Ga0316584_0002666_457_1089 209
616 3300036712 Ga0316584_0034789 Ga0316584_0034789_2871_3503 209
617 3300036712 Ga0316584_0042038 Ga0316584_0042038_664_1296 209
618 3300037418 Ga0395900_0000590 Ga0395900_0000590_45764_46459 209
619 3300037466 Ga0395898_0313103 Ga0395898_0313103_664_1359 209
620 3300037588 Ga0316581_0060041 Ga0316581_0060041_221_853 209
621 3300038443 Ga0395901_0625910 Ga0395901_0625910_13_666 209
622 3300039437 Ga0436365_0481947 Ga0436365_0481947_792_1427 209
623 3300041443 Ga0451789_1305691 Ga0451789_1305691_141_773 209
624 3300041452 Ga0451793_0331580 Ga0451793_0331580_345_977 209
625 3300041456 Ga0451795_0402747 Ga0451795_0402747_377_1006 209
626 3300041460 Ga0451802_0842713 Ga0451802_0842713_76_708 209
627 3300041486 Ga0451807_1276735 Ga0451807_1276735_658_1290 209
628 3300041512 Ga0451853_0542427 Ga0451853_0542427_591_1220 209
629 3300042000 Ga0439437_001897 Ga0439437_001897_924_1574 209
630 3300042184 Ga0450908_000100 Ga0450908_000100_4522_5151 209
631 3300044658 Ga0466972_0004200 Ga0466972_0004200_2358_2987 209
632 3300044683 Ga0466965_0018370 Ga0466965_0018370_864_1514 209
633 3300044693 Ga0466961_0000944 Ga0466961_0000944_5619_6269 209
634 3300044694 Ga0466963_0049646 Ga0466963_0049646_108_758 209
635 3300044719 Ga0466971_0003453 Ga0466971_0003453_3795_4445 209
636 3300044842 Ga0466957_0109288 Ga0466957_0109288_227_877 209
637 3300045049 Ga0466959_0004692 Ga0466959_0004692_5339_5989 209
638 3300045836 Ga0466958_0024993 Ga0466958_0024993_2004_2654 209
639 3300046452 Ga0495617_007162 Ga0495617_007162_438_1067 209
640 3300046452 Ga0495617_009741 Ga0495617_009741_2339_2968 209
641 3300046460 Ga0495638_0000146 Ga0495638_0000146_445_1074 209
642 3300046460 Ga0495638_0083807 Ga0495638_0083807_1010_1639 209
643 3300046471 Ga0495650_0005392 Ga0495650_0005392_222_851 209
644 3300046471 Ga0495650_0070421 Ga0495650_0070421_674_1303 209
645 3300046474 Ga0495605_0053908 Ga0495605_0053908_521_1150 209
646 3300046491 Ga0495584_0000823 Ga0495584_0000823_15357_15986 209
647 3300046491 Ga0495584_0188245 Ga0495584_0188245_360_989 209
648 3300046492 Ga0495585_0005197 Ga0495585_0005197_7550_8179 209
649 3300046492 Ga0495585_0306575 Ga0495585_0306575_75_704 209
650 3300046501 Ga0495607_0000122 Ga0495607_0000122_49702_50331 209
651 3300046501 Ga0495607_0000837 Ga0495607_0000837_10746_11396 209
652 3300046506 Ga0495583_0073334 Ga0495583_0073334_407_1036 209
653 3300046507 Ga0495606_0032598 Ga0495606_0032598_2838_3467 209
654 3300046507 Ga0495606_0036205 Ga0495606_0036205_769_1398 209
655 3300046507 Ga0495606_0037699 Ga0495606_0037699_2511_3140 209
656 3300046512 Ga0495610_0027392 Ga0495610_0027392_1835_2464 209
657 3300046513 Ga0495616_0000565 Ga0495616_0000565_24966_25595 209
658 3300046515 Ga0495620_0003610 Ga0495620_0003610_1291_1920 209
659 3300046515 Ga0495620_0034989 Ga0495620_0034989_225_854 209
660 3300046518 Ga0495631_0000808 Ga0495631_0000808_11853_12482 209
661 3300046519 Ga0495632_0009510 Ga0495632_0009510_4151_4780 209
662 3300046524 Ga0495648_0002534 Ga0495648_0002534_13950_14579 209
663 3300046524 Ga0495648_0084069 Ga0495648_0084069_430_1059 209
664 3300046538 Ga0495609_0003075 Ga0495609_0003075_5591_6220 209
665 3300046557 Ga0495622_0111740 Ga0495622_0111740_207_836 209
666 3300046616 Ga0495668_0003466 Ga0495668_0003466_1455_2084 209
667 3300046648 Ga0495611_0000001 Ga0495611_0000001_2033473_2034102 209
668 3300046648 Ga0495611_0000952 Ga0495611_0000952_2702_3331 209
669 3300046660 Ga0495625_0000022 Ga0495625_0000022_222697_223326 209
670 3300046660 Ga0495625_0086013 Ga0495625_0086013_100_729 209
671 3300046665 Ga0495661_0006772 Ga0495661_0006772_6001_6630 209
672 3300046691 Ga0495670_0012505 Ga0495670_0012505_453_1082 209
673 3300046691 Ga0495670_0280257 Ga0495670_0280257_167_796 209
674 3300046692 Ga0495671_0002998 Ga0495671_0002998_9327_9956 209
675 3300046794 Ga0495589_0000137 Ga0495589_0000137_33418_34047 209
676 3300046810 Ga0495660_0003625 Ga0495660_0003625_8432_9061 209
677 3300046810 Ga0495660_0028700 Ga0495660_0028700_48_677 209
678 3300047323 Ga0495683_0001586 Ga0495683_0001586_2737_3366 209
679 3300047446 Ga0495679_000004 Ga0495679_000004_144223_144852 209
680 3300047469 Ga0495673_0000202 Ga0495673_0000202_24317_24946 209
681 3300047469 Ga0495673_0020879 Ga0495673_0020879_347_976 209
682 3300047469 Ga0495673_0021499 Ga0495673_0021499_47_676 209
683 3300047472 Ga0495686_0031480 Ga0495686_0031480_2558_3187 209
684 3300047472 Ga0495686_0224267 Ga0495686_0224267_361_990 209
685 3300047472 Ga0495686_0356009 Ga0495686_0356009_140_769 209
686 3300047472 Ga0495686_0356015 Ga0495686_0356015_26_655 209
687 3300048903 Ga0496100_0089591 Ga0496100_0089591_559_1188 209
688 3300048904 Ga0496101_0002136 Ga0496101_0002136_10172_10801 209
689 3300048905 Ga0496102_0263654 Ga0496102_0263654_326_955 209
690 3300048909 Ga0496106_0001864 Ga0496106_0001864_2354_2983 209
691 3300048924 Ga0496121_0063603 Ga0496121_0063603_75_704 209
692 3300048924 Ga0496121_0065807 Ga0496121_0065807_75_704 209
693 3300048926 Ga0496123_0032847 Ga0496123_0032847_921_1550 209
694 3300048927 Ga0496124_0097064 Ga0496124_0097064_500_1150 209
695 3300049459 Ga0495678_000099 Ga0495678_000099_74511_75140 209
696 3300049460 Ga0495682_0008463 Ga0495682_0008463_2300_2929 209
697 3300049460 Ga0495682_0010599 Ga0495682_0010599_43_672 209
698 3300049570 Ga0501033_0105324 Ga0501033_0105324_836_1489 209
699 3300049571 Ga0501034_0005361 Ga0501034_0005361_9290_9943 209
700 3300049571 Ga0501034_0021375 Ga0501034_0021375_882_1511 209
701 3300049572 Ga0501036_0191382 Ga0501036_0191382_278_931 209
702 3300049573 Ga0501037_0009963 Ga0501037_0009963_893_1546 209
703 3300049586 Ga0501070_0086050 Ga0501070_0086050_597_1250 209
704 3300049686 Ga0501257_027282 Ga0501257_027282_553_1182 209
705 3300049686 Ga0501257_077332 Ga0501257_077332_47_679 209
706 3300049822 Ga0501035_0326996 Ga0501035_0326996_542_1195 209
707 3300049823 Ga0501044_0092312 Ga0501044_0092312_1185_1838 209
708 3300053079 Ga0500610_0003430 Ga0500610_0003430_4795_5424 209
709 3300053087 Ga0500643_000118 Ga0500643_000118_55634_56263 209
710 3300053092 Ga0500583_0061072 Ga0500583_0061072_190_819 209
711 3300053093 Ga0500651_0000301 Ga0500651_0000301_8045_8686 209
712 3300053093 Ga0500651_0117828 Ga0500651_0117828_272_901 209
713 3300053103 Ga0500555_000715 Ga0500555_000715_206_835 209
714 3300053160 Ga0500633_0003369 Ga0500633_0003369_2202_2831 209
715 3300061719 Ga0466962_0010495 Ga0466962_0010495_1668_2318 209
716 3300001991 JGI24743J22301_10044081 JGI24743J22301_100440812 210
717 3300003781 Ga0055536_1005660 Ga0055536_10056605 210
718 3300003794 Ga0055531_10024585 Ga0055531_100245852 210
719 3300005337 Ga0070682_100437538 Ga0070682_1004375382 210
720 3300005344 Ga0070661_100027894 Ga0070661_1000278942 210
721 3300005539 Ga0068853_100004939 Ga0068853_1000049399 210
722 3300005548 Ga0070665_100181726 Ga0070665_1001817263 210
723 3300005563 Ga0068855_100059017 Ga0068855_1000590174 210
724 3300005563 Ga0068855_100187908 Ga0068855_1001879082 210
725 3300005564 Ga0070664_100083939 Ga0070664_1000839394 210
726 3300005577 Ga0068857_100120536 Ga0068857_1001205362 210
727 3300005578 Ga0068854_100049360 Ga0068854_1000493602 210
728 3300005614 Ga0068856_100007871 Ga0068856_1000078717 210
729 3300005614 Ga0068856_100117830 Ga0068856_1001178302 210
730 3300005617 Ga0068859_100344807 Ga0068859_1003448072 210
731 3300005618 Ga0068864_100006173 Ga0068864_1000061737 210
732 3300005834 Ga0068851_10068612 Ga0068851_100686122 210
733 3300005841 Ga0068863_100045714 Ga0068863_1000457146 210
734 3300005842 Ga0068858_100042643 Ga0068858_1000426435 210
735 3300005843 Ga0068860_100119696 Ga0068860_1001196962 210
736 3300006237 Ga0097621_100339840 Ga0097621_1003398402 210
737 3300006358 Ga0068871_100297362 Ga0068871_1002973623 210
738 3300006931 Ga0097620_100344832 Ga0097620_1003448322 210
739 3300009011 Ga0105251_10002861 Ga0105251_100028614 210
740 3300009093 Ga0105240_10122181 Ga0105240_101221815 210
741 3300009174 Ga0105241_10016408 Ga0105241_100164082 210
742 3300009545 Ga0105237_10025841 Ga0105237_100258415 210
743 3300009551 Ga0105238_10167385 Ga0105238_101673853 210
744 3300010375 Ga0105239_10067815 Ga0105239_100678155 210
745 3300013104 Ga0157370_10060548 Ga0157370_100605486 210
746 3300013105 Ga0157369_10020635 Ga0157369_100206355 210
747 3300013307 Ga0157372_10004512 Ga0157372_100045125 210
748 3300025292 Ga0209676_1000034 Ga0209676_100003439 210
749 3300025298 Ga0209050_1064702 Ga0209050_10647021 210
750 3300025304 Ga0209257_1000302 Ga0209257_100030292 210
751 3300025304 Ga0209257_1000585 Ga0209257_100058549 210
752 3300025321 Ga0207656_10096211 Ga0207656_100962112 210
753 3300025904 Ga0207647_10004843 Ga0207647_100048432 210
754 3300025911 Ga0207654_10410006 Ga0207654_104100062 210
755 3300025913 Ga0207695_10000536 Ga0207695_100005365 210
756 3300025914 Ga0207671_10065136 Ga0207671_100651362 210
757 3300025917 Ga0207660_10308039 Ga0207660_103080392 210
758 3300025919 Ga0207657_10001316 Ga0207657_1000131614 210
759 3300025920 Ga0207649_10014164 Ga0207649_100141644 210
760 3300025920 Ga0207649_10200821 Ga0207649_102008213 210
761 3300025921 Ga0207652_10320833 Ga0207652_103208332 210
762 3300025924 Ga0207694_10128108 Ga0207694_101281082 210
763 3300025927 Ga0207687_10353911 Ga0207687_103539112 210
764 3300025932 Ga0207690_10069040 Ga0207690_100690402 210
765 3300025933 Ga0207706_10145804 Ga0207706_101458042 210
766 3300025938 Ga0207704_10057192 Ga0207704_100571922 210
767 3300025942 Ga0207689_10031609 Ga0207689_100316093 210
768 3300025944 Ga0207661_10229204 Ga0207661_102292042 210
769 3300025945 Ga0207679_10183613 Ga0207679_101836132 210
770 3300025949 Ga0207667_10002731 Ga0207667_1000273120 210
771 3300025949 Ga0207667_10027065 Ga0207667_100270655 210
772 3300025986 Ga0207658_10043114 Ga0207658_100431142 210
773 3300026041 Ga0207639_10189556 Ga0207639_101895562 210
774 3300026041 Ga0207639_10273645 Ga0207639_102736452 210
775 3300026067 Ga0207678_10226119 Ga0207678_102261192 210
776 3300026078 Ga0207702_10911004 Ga0207702_109110042 210
777 3300026116 Ga0207674_10003941 Ga0207674_100039415 210
778 3300026142 Ga0207698_10004066 Ga0207698_100040667 210
779 3300026142 Ga0207698_10182890 Ga0207698_101828902 210
780 3300028379 Ga0268266_10068858 Ga0268266_100688584 210
781 3300028381 Ga0268264_10072417 Ga0268264_100724175 210
782 3300028794 Ga0307515_10144069 Ga0307515_101440691 210
783 3300032004 Ga0307414_10002380 Ga0307414_100023802 210
784 3300041443 Ga0451789_0324187 Ga0451789_0324187_851_1483 210
785 3300041451 Ga0451791_0734992 Ga0451791_0734992_3301_3933 210
786 3300041451 Ga0451791_0977198 Ga0451791_0977198_132_764 210
787 3300041451 Ga0451791_1698871 Ga0451791_1698871_323_955 210
788 3300041452 Ga0451793_1036736 Ga0451793_1036736_786_1418 210
789 3300041452 Ga0451793_1912156 Ga0451793_1912156_391_1023 210
790 3300041456 Ga0451795_0613894 Ga0451795_0613894_1372_2004 210
791 3300041456 Ga0451795_1282306 Ga0451795_1282306_972_1604 210
792 3300041459 Ga0451800_0416075 Ga0451800_0416075_3123_3755 210
793 3300041460 Ga0451802_1409802 Ga0451802_1409802_244_876 210
794 3300041460 Ga0451802_1663798 Ga0451802_1663798_110_742 210
795 3300041462 Ga0451806_051010 Ga0451806_051010_1563_2195 210
796 3300041463 Ga0451804_0778980 Ga0451804_0778980_1227_1859 210
797 3300041486 Ga0451807_2045398 Ga0451807_2045398_1338_1970 210
798 3300041496 Ga0451839_1349525 Ga0451839_1349525_177_809 210
799 3300041509 Ga0451843_0541203 Ga0451843_0541203_613_1245 210
800 3300041509 Ga0451843_1620786 Ga0451843_1620786_396_1028 210
801 3300041512 Ga0451853_0536472 Ga0451853_0536472_117_749 210
802 3300041999 Ga0439433_0018730 Ga0439433_0018730_30_662 210
803 3300042007 Ga0439449_0063355 Ga0439449_0063355_83_715 210
804 3300042435 Ga0439434_0134681 Ga0439434_0134681_155_787 210
805 3300044684 Ga0466966_0000529 Ga0466966_0000529_7270_7902 210
806 3300046460 Ga0495638_0135010 Ga0495638_0135010_364_996 210
807 3300046525 Ga0495663_0007180 Ga0495663_0007180_2078_2710 210
808 3300046660 Ga0495625_0387271 Ga0495625_0387271_27_689 210
809 3300046692 Ga0495671_0016012 Ga0495671_0016012_2422_3054 210
810 3300048920 Ga0496117_0000446 Ga0496117_0000446_8101_8733 210
811 3300048921 Ga0496118_0099723 Ga0496118_0099723_113_745 210
812 3300048922 Ga0496119_0017246 Ga0496119_0017246_4296_4928 210
813 3300048923 Ga0496120_0000102 Ga0496120_0000102_101250_101882 210
814 3300048925 Ga0496122_0000158 Ga0496122_0000158_115191_115823 210
815 3300048925 Ga0496122_0006129 Ga0496122_0006129_12804_13436 210
816 3300048925 Ga0496122_0025404 Ga0496122_0025404_3793_4425 210
817 3300048925 Ga0496122_0088252 Ga0496122_0088252_931_1563 210
818 3300048926 Ga0496123_0000120 Ga0496123_0000120_43530_44162 210
819 3300048926 Ga0496123_0000151 Ga0496123_0000151_139865_140497 210
820 3300048926 Ga0496123_0074909 Ga0496123_0074909_1049_1681 210
821 3300048927 Ga0496124_0001894 Ga0496124_0001894_5630_6262 210
822 3300049570 Ga0501033_0000324 Ga0501033_0000324_19155_19859 210
823 3300049571 Ga0501034_0384902 Ga0501034_0384902_336_998 210
824 3300049572 Ga0501036_0004120 Ga0501036_0004120_10209_10913 210
825 3300049573 Ga0501037_0007006 Ga0501037_0007006_1317_2021 210
826 3300049574 Ga0501038_0003249 Ga0501038_0003249_1871_2575 210
827 3300049575 Ga0501039_0033038 Ga0501039_0033038_1653_2357 210
828 3300049580 Ga0501046_0113853 Ga0501046_0113853_592_1239 210
829 3300049581 Ga0501047_0198195 Ga0501047_0198195_922_1626 210
830 3300049581 Ga0501047_0252344 Ga0501047_0252344_859_1506 210
831 3300049585 Ga0501069_0064299 Ga0501069_0064299_935_1639 210
832 3300049586 Ga0501070_0143052 Ga0501070_0143052_568_1272 210
833 3300049586 Ga0501070_0330286 Ga0501070_0330286_477_1124 210
834 3300049589 Ga0501073_0006715 Ga0501073_0006715_5888_6592 210
835 3300049589 Ga0501073_0139117 Ga0501073_0139117_540_1202 210
836 3300049590 Ga0501074_0160531 Ga0501074_0160531_512_1216 210
837 3300049592 Ga0501076_0799392 Ga0501076_0799392_16_720 210
838 3300049593 Ga0501077_0229963 Ga0501077_0229963_484_1146 210
839 3300049742 Ga0501080_0000739 Ga0501080_0000739_11689_12336 210
840 3300049742 Ga0501080_0015445 Ga0501080_0015445_3400_4104 210
841 3300049822 Ga0501035_0037489 Ga0501035_0037489_704_1408 210
842 3300049823 Ga0501044_0088409 Ga0501044_0088409_847_1551 210
843 3300053134 Ga0500658_0220297 Ga0500658_0220297_92_724 210
844 3300054114 Ga0501084_0131217 Ga0501084_0131217_577_1281 210
845 3300060353 Ga0501082_0215244 Ga0501082_0215244_755_1402 210
846 3300005331 Ga0070670_100026260 Ga0070670_1000262602 211
847 3300005335 Ga0070666_10214078 Ga0070666_102140782 211
848 3300005338 Ga0068868_100062603 Ga0068868_1000626032 211
849 3300005344 Ga0070661_100053518 Ga0070661_1000535184 211
850 3300005344 Ga0070661_100194320 Ga0070661_1001943202 211
851 3300005355 Ga0070671_100108553 Ga0070671_1001085533 211
852 3300005367 Ga0070667_100080731 Ga0070667_1000807314 211
853 3300005455 Ga0070663_100194361 Ga0070663_1001943612 211
854 3300005535 Ga0070684_100071094 Ga0070684_1000710944 211
855 3300005539 Ga0068853_100080405 Ga0068853_1000804055 211
856 3300005563 Ga0068855_100109324 Ga0068855_1001093244 211
857 3300005563 Ga0068855_100398516 Ga0068855_1003985162 211
858 3300005564 Ga0070664_100176940 Ga0070664_1001769402 211
859 3300005614 Ga0068856_100082877 Ga0068856_1000828772 211
860 3300005616 Ga0068852_100042880 Ga0068852_1000428803 211
861 3300005618 Ga0068864_100046404 Ga0068864_1000464046 211
862 3300005834 Ga0068851_10090317 Ga0068851_100903172 211
863 3300005841 Ga0068863_100109182 Ga0068863_1001091824 211
864 3300005842 Ga0068858_100064412 Ga0068858_1000644124 211
865 3300005983 Ga0081540_1004799 Ga0081540_10047997 211
866 3300006237 Ga0097621_100242261 Ga0097621_1002422612 211
867 3300006358 Ga0068871_100150903 Ga0068871_1001509032 211
868 3300006881 Ga0068865_100024619 Ga0068865_1000246194 211
869 3300009176 Ga0105242_10130728 Ga0105242_101307283 211
870 3300025903 Ga0207680_10048120 Ga0207680_100481204 211
871 3300025920 Ga0207649_10388196 Ga0207649_103881962 211
872 3300025925 Ga0207650_10090521 Ga0207650_100905214 211
873 3300025925 Ga0207650_10228861 Ga0207650_102288612 211
874 3300025931 Ga0207644_10050387 Ga0207644_100503872 211
875 3300025938 Ga0207704_10009199 Ga0207704_100091998 211
876 3300025941 Ga0207711_10261887 Ga0207711_102618872 211
877 3300025942 Ga0207689_10378563 Ga0207689_103785632 211
878 3300025945 Ga0207679_10180849 Ga0207679_101808492 211
879 3300025949 Ga0207667_10689581 Ga0207667_106895811 211
880 3300025960 Ga0207651_10129993 Ga0207651_101299932 211
881 3300025986 Ga0207658_10485345 Ga0207658_104853452 211
882 3300026023 Ga0207677_10415658 Ga0207677_104156582 211
883 3300026041 Ga0207639_10088687 Ga0207639_100886874 211
884 3300026078 Ga0207702_10128052 Ga0207702_101280522 211
885 3300026088 Ga0207641_10201191 Ga0207641_102011913 211
886 3300026095 Ga0207676_10051657 Ga0207676_100516572 211
887 3300026116 Ga0207674_10189246 Ga0207674_101892462 211
888 3300026142 Ga0207698_10507817 Ga0207698_105078171 211
889 3300035692 Ga0373935_0105935 Ga0373935_0105935_491_1138 211
890 3300036401 Ga0373937_0020829 Ga0373937_0020829_21_668 211
891 3300037068 Ga0373925_0231289 Ga0373925_0231289_647_1294 211
892 3300042005 Ga0439448_0071872 Ga0439448_0071872_103_768 211
893 3300045051 Ga0451576_0329324 Ga0451576_0329324_531_1205 211
894 3300046459 Ga0495629_0360024 Ga0495629_0360024_177_824 211
895 3300046472 Ga0495580_0145739 Ga0495580_0145739_163_810 211
896 3300046473 Ga0495582_0015290 Ga0495582_0015290_826_1473 211
897 3300046535 Ga0495586_0148323 Ga0495586_0148323_454_1101 211
898 3300046681 Ga0495647_0133369 Ga0495647_0133369_378_1025 211
899 3300046683 Ga0495658_0014949 Ga0495658_0014949_434_1081 211
900 3300047317 Ga0495604_0229304 Ga0495604_0229304_115_762 211
901 3300048918 Ga0496115_0249327 Ga0496115_0249327_141_809 211
902 3300049574 Ga0501038_0291379 Ga0501038_0291379_507_1172 211
903 3300049575 Ga0501039_0248540 Ga0501039_0248540_403_1053 211
904 3300049580 Ga0501046_0014037 Ga0501046_0014037_20_685 211
905 3300049581 Ga0501047_0120904 Ga0501047_0120904_480_1145 211
906 3300049589 Ga0501073_0294392 Ga0501073_0294392_142_804 211
907 3300049741 Ga0501079_0051130 Ga0501079_0051130_722_1387 211
908 3300049741 Ga0501079_0165261 Ga0501079_0165261_752_1414 211
909 3300049742 Ga0501080_0060091 Ga0501080_0060091_797_1462 211
910 3300049742 Ga0501080_0224665 Ga0501080_0224665_375_1037 211
911 3300049744 Ga0501083_0143256 Ga0501083_0143256_142_807 211
912 3300053123 Ga0500614_037085 Ga0500614_037085_410_1057 211
913 3300054114 Ga0501084_0149041 Ga0501084_0149041_1201_1866 211
914 3300060353 Ga0501082_0012969 Ga0501082_0012969_286_951 211
915 3300005347 Ga0070668_100206196 Ga0070668_1002061961 212
916 3300005367 Ga0070667_100128838 Ga0070667_1001288382 212
917 3300005548 Ga0070665_100210823 Ga0070665_1002108232 212
918 3300005563 Ga0068855_100430770 Ga0068855_1004307702 212
919 3300005617 Ga0068859_100000265 Ga0068859_10000026513 212
920 3300005834 Ga0068851_10011387 Ga0068851_100113872 212
921 3300005841 Ga0068863_100167612 Ga0068863_1001676123 212
922 3300005842 Ga0068858_100124970 Ga0068858_1001249704 212
923 3300005843 Ga0068860_100048149 Ga0068860_1000481492 212
924 3300005844 Ga0068862_100000447 Ga0068862_1000004475 212
925 3300006931 Ga0097620_100000265 Ga0097620_10000026513 212
926 3300009101 Ga0105247_10176893 Ga0105247_101768932 212
927 3300009545 Ga0105237_10030200 Ga0105237_100302008 212
928 3300009553 Ga0105249_10417158 Ga0105249_104171583 212
929 3300010375 Ga0105239_10010293 Ga0105239_100102932 212
930 3300025321 Ga0207656_10026626 Ga0207656_100266262 212
931 3300025986 Ga0207658_10048019 Ga0207658_100480195 212
932 3300026035 Ga0207703_10134529 Ga0207703_101345293 212
933 3300026088 Ga0207641_10291447 Ga0207641_102914472 212
934 3300028379 Ga0268266_10362936 Ga0268266_103629362 212
935 3300028380 Ga0268265_10000608 Ga0268265_1000060829 212
936 3300028381 Ga0268264_10026185 Ga0268264_100261854 212
937 3300009176 Ga0105242_10004235 Ga0105242_100042353 213
938 3300013306 Ga0163162_10080190 Ga0163162_100801902 213
939 3300013308 Ga0157375_10000102 Ga0157375_1000010265 213
940 3300014969 Ga0157376_10001668 Ga0157376_1000166815 213
941 3300041503 Ga0451847_0708482 Ga0451847_0708482_257_928 213
942 3300048907 Ga0496104_0000022 Ga0496104_0000022_178861_179517 213
943 3300048908 Ga0496105_0000012 Ga0496105_0000012_159387_160043 213
944 3300005355 Ga0070671_100116529 Ga0070671_1001165294 214
945 3300005458 Ga0070681_10000344 Ga0070681_100003447 214
946 3300005539 Ga0068853_100043183 Ga0068853_1000431835 214
947 3300013100 Ga0157373_10077267 Ga0157373_100772672 214
948 3300013307 Ga0157372_10960657 Ga0157372_109606571 214
949 3300013308 Ga0157375_10001413 Ga0157375_100014132 214
950 3300025903 Ga0207680_10221044 Ga0207680_102210442 214
951 3300025912 Ga0207707_10000128 Ga0207707_1000012837 214
952 3300025931 Ga0207644_10105070 Ga0207644_101050702 214
953 3300025933 Ga0207706_10119408 Ga0207706_101194082 214
954 3300025941 Ga0207711_10187333 Ga0207711_101873332 214
955 3300041498 Ga0451841_0486514 Ga0451841_0486514_186_902 214
956 3300044694 Ga0466963_0181154 Ga0466963_0181154_555_1214 214
957 3300005548 Ga0070665_100252158 Ga0070665_1002521583 215
958 3300005578 Ga0068854_100153046 Ga0068854_1001530462 215
959 3300013104 Ga0157370_10007947 Ga0157370_100079472 215
960 3300024225 Ga0224572_1041748 Ga0224572_10417482 215
961 3300025924 Ga0207694_10138376 Ga0207694_101383762 215
962 3300025981 Ga0207640_10108250 Ga0207640_101082502 215
963 3300026078 Ga0207702_10306825 Ga0207702_103068252 215
964 3300028379 Ga0268266_10019047 Ga0268266_100190472 215
965 3300053093 Ga0500651_0020652 Ga0500651_0020652_765_1469 215
966 iso_pu_bacteria 2643221562 2643829853 215
967 iso_pu_bacteria 2818991457 2819659776 215
968 iso_pu_bacteria 2852684882 2852685396 215
969 iso_pu_bacteria 2919130084 2919131511 215
970 iso_pu_bacteria 2929195423 2929198070 215
971 iso_pu_bacteria 8021622325 8021624413 215
972 iso_pu_bacteria 8021626552 8021628093 215
973 iso_pu_bacteria 8021648035 8021651015 215
974 3300005328 Ga0070676_10027579 Ga0070676_100275791 216
975 3300005334 Ga0068869_100177272 Ga0068869_1001772721 216
976 3300005338 Ga0068868_100125813 Ga0068868_1001258132 216
977 3300005347 Ga0070668_100045299 Ga0070668_1000452992 216
978 3300005353 Ga0070669_100090318 Ga0070669_1000903182 216
979 3300005354 Ga0070675_100024532 Ga0070675_1000245325 216
980 3300005455 Ga0070663_100172682 Ga0070663_1001726822 216
981 3300005455 Ga0070663_100741370 Ga0070663_1007413701 216
982 3300005456 Ga0070678_100020450 Ga0070678_1000204505 216
983 3300005543 Ga0070672_100006538 Ga0070672_1000065382 216
984 3300005548 Ga0070665_100005179 Ga0070665_1000051799 216
985 3300005563 Ga0068855_100009974 Ga0068855_1000099743 216
986 3300005616 Ga0068852_100652465 Ga0068852_1006524652 216
987 3300005840 Ga0068870_10074338 Ga0068870_100743382 216
988 3300005841 Ga0068863_100016749 Ga0068863_1000167492 216
989 3300005843 Ga0068860_100707764 Ga0068860_1007077642 216
990 3300009545 Ga0105237_10305845 Ga0105237_103058452 216
991 3300009551 Ga0105238_10924708 Ga0105238_109247082 216
992 3300009553 Ga0105249_10365161 Ga0105249_103651612 216
993 3300010375 Ga0105239_10023801 Ga0105239_100238012 216
994 3300025903 Ga0207680_10246437 Ga0207680_102464372 216
995 3300025907 Ga0207645_10020277 Ga0207645_100202772 216
996 3300025908 Ga0207643_10006508 Ga0207643_100065083 216
997 3300025914 Ga0207671_10017813 Ga0207671_1001781311 216
998 3300025923 Ga0207681_10085431 Ga0207681_100854313 216
999 3300025924 Ga0207694_10663357 Ga0207694_106633571 216
1000 3300025926 Ga0207659_10089319 Ga0207659_100893194 216
1001 3300025940 Ga0207691_10032756 Ga0207691_100327562 216
1002 3300025942 Ga0207689_10086585 Ga0207689_100865853 216
1003 3300025949 Ga0207667_10295027 Ga0207667_102950271 216
1004 3300025961 Ga0207712_10469630 Ga0207712_104696301 216
1005 3300025972 Ga0207668_10027253 Ga0207668_100272533 216
1006 3300026023 Ga0207677_10201183 Ga0207677_102011832 216
1007 3300026041 Ga0207639_10000643 Ga0207639_1000064322 216
1008 3300026067 Ga0207678_10179595 Ga0207678_101795952 216
1009 3300026067 Ga0207678_10806208 Ga0207678_108062082 216
1010 3300026088 Ga0207641_10015458 Ga0207641_100154582 216
1011 3300026121 Ga0207683_10045586 Ga0207683_100455862 216
1012 3300026142 Ga0207698_10400302 Ga0207698_104003022 216
1013 3300028379 Ga0268266_10004292 Ga0268266_100042923 216
1014 3300028379 Ga0268266_10135762 Ga0268266_101357622 216
1015 3300028381 Ga0268264_10603014 Ga0268264_106030141 216
1016 3300031616 Ga0307508_10290933 Ga0307508_102909332 216
1017 3300045049 Ga0466959_0125006 Ga0466959_0125006_979_1683 216
1018 3300048920 Ga0496117_0008490 Ga0496117_0008490_8604_9287 216
1019 3300048921 Ga0496118_0004944 Ga0496118_0004944_2843_3526 216
1020 iso_pu_bacteria 2718218334 2721026655 216
1021 3300032137 Ga0316585_10002747 Ga0316585_100027475 217
1022 3300005834 Ga0068851_10067424 Ga0068851_100674242 218
1023 3300026067 Ga0207678_10201565 Ga0207678_102015652 218
1024 2162886007 SwRhRL2b_contig_136925 SwRhRL2b_0185.00007400 219
1025 3300005289 Ga0065704_10074187 Ga0065704_100741875 219
1026 3300005289 Ga0065704_10074217 Ga0065704_100742179 219
1027 3300005331 Ga0070670_100021104 Ga0070670_1000211046 219
1028 3300015265 Ga0182005_1002561 Ga0182005_10025613 219
1029 3300025735 Ga0207713_1000890 Ga0207713_10008906 219
1030 3300025925 Ga0207650_10002390 Ga0207650_100023903 219
1031 3300027312 Ga0209371_1000016 Ga0209371_100001649 219
1032 3300030500 Ga0268256_1000015 Ga0268256_1000015521 219
1033 3300041452 Ga0451793_1074463 Ga0451793_1074463_121_834 219
1034 3300041453 Ga0451797_0907429 Ga0451797_0907429_353_1012 219
1035 3300048921 Ga0496118_0043362 Ga0496118_0043362_113_772 219
1036 3300048929 Ga0496126_0037693 Ga0496126_0037693_533_1192 219
1037 3300048929 Ga0496126_0144798 Ga0496126_0144798_211_906 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

52

232

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9835 39 215
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9621 39 215
7naf-assembly1.cif.gz_w state e2 nucleolar 60s ribosomal biogenesis intermediate - spb1-mtd local model 0.9587 27 219
8i9v-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 0.9571 27 219
7o9k-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu 0.9553 38 216
ID Description Score Start End Superfamily
1ej0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9835 39 215 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9653 38 217 3.40.50.150
1ej0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9621 39 215 3.40.50.150
af_Q5RJT2_23_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9557 38 219 3.40.50.150
af_F4JTD2_19_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9545 37 219 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2S5M0A2-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9905 24 216 GO:0008650
AF-A0A3C1XVZ4-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9897 84 219 GO:0008650
AF-Q87F66-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9869 14 217 GO:0005737
GO:0008650
AF-A0A3E1K5Q8-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9854 20 215 GO:0005737
GO:0008650
AF-A0A3C0T5G8-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9844 126 214 GO:0008650

Feature Viewer

pLDDT pTM Quality
90.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map