F488741
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1037 | 468 | 2074 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10005792|Ga0265325_100057925 |
| Length | 394 |
| Sequence | MALEDRPRDHQTAMSGVANPPDCAALTAARSARSLRRVNATPQPQDVVPVTDRHRFDEAALARYLARHLEGYRGPLTVQQFAGGQSNPTFFLTEGGRSLVLRKKPPGELLPSAHAVDREFRVMRALGTTDFPVPRTHLLCEDAAVIGQIFYVMDWVPGRILRDPLLAGMQPAERRAIYDAMNAAMAQLHTIDPFAIGLGDFGKPGNYFARQTARWIKQYEASQTEEIESFNRLIEWLPKSIPPGDETRIAHGDFRLENMVLHPTEPRVLAVLDWELSTLGHPLADLGYNVMGYFMPPGQPGRLAGADLEALGIPSVDDYVAAYCRRTGRARVDDLEFYVVFALFRSAAIMQGIAMRAKIGTASAANAELVGKYARTIADTAWEIVQRPPSEGRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 192 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 232 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 233 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 347 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 394 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 396 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 399 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 406 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 413 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 414 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 415 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 416 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 417 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 418 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 419 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 420 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 421 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 422 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 423 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 424 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 425 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 426 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 427 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 428 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 429 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 430 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 431 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 432 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 433 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 434 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 435 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 436 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 437 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 438 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 439 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 440 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 441 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 442 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 443 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 444 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 445 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 446 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 447 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 448 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 449 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 450 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 451 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 452 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 453 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 454 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 455 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 456 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 457 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 458 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 459 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 460 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 461 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 462 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 463 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 464 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 465 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 466 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 467 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 468 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.5 |
| Metatranscriptomes | 0.1 |
| Isolates | 5.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 7.23 |
| Nodule | 2.22 |
| Rhizoplane | 2.03 |
| Rhizosphere | 80.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265325_10005792 | 3300031241 | Bacteria | 7577 |
| 2 | JGI24736J21556_1002424 | 3300001904 | Bacteria | 3295 |
| 3 | JGI24741J21665_1000034 | 3300001915 | Bacteria | 32794 |
| 4 | JGI24740J21852_10000403 | 3300001979 | Bacteria | 18606 |
| 5 | JGI24739J22299_10000059 | 3300001989 | Bacteria | 31070 |
| 6 | JGI24737J22298_10000084 | 3300001990 | Bacteria | 27475 |
| 7 | JGI24735J21928_10000109 | 3300002067 | Bacteria | 29714 |
| 8 | JGI25154J39366_1001838 | 3300002738 | Bacteria | 6537 |
| 9 | JGI25151J46595_10000030 | 3300003187 | Bacteria | 202084 |
| 10 | JGI25406J46586_10005781 | 3300003203 | Bacteria | 5722 |
| 11 | JGI25406J46586_10030970 | 3300003203 | Bacteria | 2007 |
| 12 | Ga0055526_1000013 | 3300003771 | Bacteria | 233580 |
| 13 | Ga0055526_1000019 | 3300003771 | Bacteria | 189698 |
| 14 | Ga0055526_1000368 | 3300003771 | Bacteria | 36399 |
| 15 | Ga0055526_1000502 | 3300003771 | Bacteria | 31206 |
| 16 | Ga0055526_1001266 | 3300003771 | Bacteria | 18132 |
| 17 | Ga0055537_1000159 | 3300003773 | Bacteria | 50407 |
| 18 | Ga0055524_1000069 | 3300003775 | Bacteria | 128956 |
| 19 | Ga0055524_1000469 | 3300003775 | Bacteria | 32369 |
| 20 | Ga0055524_1009528 | 3300003775 | Bacteria | 3940 |
| 21 | Ga0055534_1000045 | 3300003784 | Bacteria | 98659 |
| 22 | Ga0055528_1000323 | 3300003790 | Bacteria | 40144 |
| 23 | Ga0055530_10000160 | 3300003791 | Bacteria | 61095 |
| 24 | Ga0055530_10000630 | 3300003791 | Bacteria | 30400 |
| 25 | Ga0055540_1000173 | 3300003792 | Bacteria | 63434 |
| 26 | Ga0055531_10005811 | 3300003794 | Bacteria | 7140 |
| 27 | Ga0055543_1006928 | 3300004625 | Bacteria | 2677 |
| 28 | Ga0065165_1000243 | 3300005262 | Bacteria | 93455 |
| 29 | Ga0065707_10119488 | 3300005295 | Bacteria | 2158 |
| 30 | Ga0070658_10049172 | 3300005327 | Bacteria | 3415 |
| 31 | Ga0070676_10002512 | 3300005328 | Bacteria | 9416 |
| 32 | Ga0070676_10002638 | 3300005328 | Bacteria | 9234 |
| 33 | Ga0070676_10120668 | 3300005328 | Bacteria | 1645 |
| 34 | Ga0070690_100164033 | 3300005330 | Bacteria | 1525 |
| 35 | Ga0070670_100000052 | 3300005331 | Bacteria | 129346 |
| 36 | Ga0070677_10000311 | 3300005333 | Bacteria | 16974 |
| 37 | Ga0070666_10007951 | 3300005335 | Bacteria | 6556 |
| 38 | Ga0070666_10009376 | 3300005335 | Bacteria | 6100 |
| 39 | Ga0070666_10012511 | 3300005335 | Bacteria | 5357 |
| 40 | Ga0070666_10027544 | 3300005335 | Bacteria | 3723 |
| 41 | Ga0070682_100017170 | 3300005337 | Bacteria | 4216 |
| 42 | Ga0068868_100003668 | 3300005338 | Bacteria | 10719 |
| 43 | Ga0068868_100201892 | 3300005338 | Bacteria | 1658 |
| 44 | Ga0070661_100004880 | 3300005344 | Bacteria | 9235 |
| 45 | Ga0070668_100002357 | 3300005347 | Bacteria | 13887 |
| 46 | Ga0070668_100049834 | 3300005347 | Bacteria | 3222 |
| 47 | Ga0070669_100006210 | 3300005353 | Bacteria | 8626 |
| 48 | Ga0070675_100063964 | 3300005354 | Bacteria | 3041 |
| 49 | Ga0070671_100000043 | 3300005355 | Bacteria | 89426 |
| 50 | Ga0070671_100021300 | 3300005355 | Bacteria | 5295 |
| 51 | Ga0070671_100230895 | 3300005355 | Bacteria | 1570 |
| 52 | Ga0070674_100007399 | 3300005356 | Bacteria | 6476 |
| 53 | Ga0070667_100000021 | 3300005367 | Bacteria | 205662 |
| 54 | Ga0070667_100005451 | 3300005367 | Bacteria | 10627 |
| 55 | Ga0070667_100162598 | 3300005367 | Bacteria | 1967 |
| 56 | Ga0070714_100125240 | 3300005435 | Bacteria | 2290 |
| 57 | Ga0070711_100176618 | 3300005439 | Bacteria | 1632 |
| 58 | Ga0070705_100093787 | 3300005440 | Bacteria | 1878 |
| 59 | Ga0070663_100005315 | 3300005455 | Bacteria | 7641 |
| 60 | Ga0070678_100003476 | 3300005456 | Bacteria | 8779 |
| 61 | Ga0070662_100002384 | 3300005457 | Bacteria | 11544 |
| 62 | Ga0070681_10000746 | 3300005458 | Bacteria | 27005 |
| 63 | Ga0068867_100008363 | 3300005459 | Bacteria | 7301 |
| 64 | Ga0068867_100029996 | 3300005459 | Bacteria | 3922 |
| 65 | Ga0070685_10000002 | 3300005466 | Bacteria | 295205 |
| 66 | Ga0070685_10020498 | 3300005466 | Bacteria | 3577 |
| 67 | Ga0070706_100108730 | 3300005467 | Bacteria | 2580 |
| 68 | Ga0070706_100309292 | 3300005467 | Bacteria | 1474 |
| 69 | Ga0070707_100425834 | 3300005468 | Bacteria | 1288 |
| 70 | Ga0070698_100066406 | 3300005471 | Bacteria | 3631 |
| 71 | Ga0070698_100104724 | 3300005471 | Bacteria | 2799 |
| 72 | Ga0070679_100007841 | 3300005530 | Bacteria | 10010 |
| 73 | Ga0068853_100002265 | 3300005539 | Bacteria | 14368 |
| 74 | Ga0068853_100035764 | 3300005539 | Bacteria | 4220 |
| 75 | Ga0068853_100043248 | 3300005539 | Bacteria | 3854 |
| 76 | Ga0068853_100076250 | 3300005539 | Bacteria | 2927 |
| 77 | Ga0070672_100013917 | 3300005543 | Bacteria | 5692 |
| 78 | Ga0070672_100064851 | 3300005543 | Bacteria | 2887 |
| 79 | Ga0070696_100061739 | 3300005546 | Bacteria | 2622 |
| 80 | Ga0070693_100004068 | 3300005547 | Bacteria | 6885 |
| 81 | Ga0070665_100002758 | 3300005548 | Bacteria | 19041 |
| 82 | Ga0070665_100012190 | 3300005548 | Bacteria | 8668 |
| 83 | Ga0070665_100074772 | 3300005548 | Bacteria | 3394 |
| 84 | Ga0070704_100345089 | 3300005549 | Bacteria | 1255 |
| 85 | Ga0068855_100001912 | 3300005563 | Bacteria | 25837 |
| 86 | Ga0068855_100078234 | 3300005563 | Bacteria | 3837 |
| 87 | Ga0070664_100027829 | 3300005564 | Bacteria | 4700 |
| 88 | Ga0070664_100185300 | 3300005564 | Bacteria | 1852 |
| 89 | Ga0068857_100004902 | 3300005577 | Bacteria | 11356 |
| 90 | Ga0068857_100270444 | 3300005577 | Bacteria | 1562 |
| 91 | Ga0068854_100002245 | 3300005578 | Bacteria | 11892 |
| 92 | Ga0068854_100197870 | 3300005578 | Bacteria | 1578 |
| 93 | Ga0068856_100002241 | 3300005614 | Bacteria | 19964 |
| 94 | Ga0068852_100002292 | 3300005616 | Bacteria | 13161 |
| 95 | Ga0068859_100011410 | 3300005617 | Bacteria | 8933 |
| 96 | Ga0068859_100152228 | 3300005617 | Bacteria | 2388 |
| 97 | Ga0068859_100215222 | 3300005617 | Bacteria | 2008 |
| 98 | Ga0068864_100000219 | 3300005618 | Bacteria | 51801 |
| 99 | Ga0068864_100170677 | 3300005618 | Bacteria | 1983 |
| 100 | Ga0068861_100022703 | 3300005719 | Bacteria | 4524 |
| 101 | Ga0068861_100047335 | 3300005719 | Bacteria | 3246 |
| 102 | Ga0068861_100126034 | 3300005719 | Bacteria | 2072 |
| 103 | Ga0068851_10002958 | 3300005834 | Bacteria | 7511 |
| 104 | Ga0068851_10094263 | 3300005834 | Bacteria | 1580 |
| 105 | Ga0068863_100008937 | 3300005841 | Bacteria | 9782 |
| 106 | Ga0068863_100039472 | 3300005841 | Bacteria | 4491 |
| 107 | Ga0068863_100066373 | 3300005841 | Bacteria | 3413 |
| 108 | Ga0068863_100093670 | 3300005841 | Bacteria | 2851 |
| 109 | Ga0068858_100056739 | 3300005842 | Bacteria | 3619 |
| 110 | Ga0068858_100402127 | 3300005842 | Bacteria | 1316 |
| 111 | Ga0068860_100000015 | 3300005843 | Bacteria | 313639 |
| 112 | Ga0068860_100001564 | 3300005843 | Bacteria | 24652 |
| 113 | Ga0068860_100051949 | 3300005843 | Bacteria | 3899 |
| 114 | Ga0068860_100133889 | 3300005843 | Bacteria | 2380 |
| 115 | Ga0068860_100146437 | 3300005843 | Bacteria | 2273 |
| 116 | Ga0068862_100001673 | 3300005844 | Bacteria | 20087 |
| 117 | Ga0068862_100006372 | 3300005844 | Bacteria | 9813 |
| 118 | Ga0068862_100088433 | 3300005844 | Bacteria | 2695 |
| 119 | Ga0068862_100120093 | 3300005844 | Bacteria | 2316 |
| 120 | Ga0081455_10000391 | 3300005937 | Bacteria | 57931 |
| 121 | Ga0081540_1003425 | 3300005983 | Bacteria | 12542 |
| 122 | Ga0081539_10000203 | 3300005985 | Bacteria | 138096 |
| 123 | Ga0081539_10000316 | 3300005985 | Bacteria | 107841 |
| 124 | Ga0075368_10052603 | 3300006042 | Bacteria | 1620 |
| 125 | Ga0075363_100000506 | 3300006048 | Bacteria | 12473 |
| 126 | Ga0075363_100053469 | 3300006048 | Bacteria | 2158 |
| 127 | Ga0075363_100057444 | 3300006048 | Bacteria | 2088 |
| 128 | Ga0075362_10013292 | 3300006177 | Bacteria | 3293 |
| 129 | Ga0075367_10048860 | 3300006178 | Bacteria | 2493 |
| 130 | Ga0075369_10019359 | 3300006186 | Bacteria | 2779 |
| 131 | Ga0075366_10120826 | 3300006195 | Bacteria | 1579 |
| 132 | Ga0097621_100028254 | 3300006237 | Bacteria | 4421 |
| 133 | Ga0075370_10025155 | 3300006353 | Bacteria | 3291 |
| 134 | Ga0075428_100169101 | 3300006844 | Bacteria | 2371 |
| 135 | Ga0075431_100032041 | 3300006847 | Bacteria | 5417 |
| 136 | Ga0075431_100033531 | 3300006847 | Bacteria | 5291 |
| 137 | Ga0075431_100138743 | 3300006847 | Bacteria | 2506 |
| 138 | Ga0075429_100058235 | 3300006880 | Bacteria | 3364 |
| 139 | Ga0068865_100041090 | 3300006881 | Bacteria | 3146 |
| 140 | Ga0097620_100011410 | 3300006931 | Bacteria | 8933 |
| 141 | Ga0097620_100152237 | 3300006931 | Bacteria | 2388 |
| 142 | Ga0097620_100215225 | 3300006931 | Bacteria | 2008 |
| 143 | Ga0079104_1000294 | 3300006946 | Bacteria | 63150 |
| 144 | Ga0075435_100147607 | 3300007076 | Bacteria | 1976 |
| 145 | Ga0099794_10000703 | 3300007265 | Bacteria | 11248 |
| 146 | Ga0099794_10023616 | 3300007265 | Bacteria | 2815 |
| 147 | Ga0099795_10002134 | 3300007788 | Bacteria | 4559 |
| 148 | Ga0099795_10038661 | 3300007788 | Bacteria | 1685 |
| 149 | Ga0105244_10004592 | 3300009036 | Bacteria | 9453 |
| 150 | Ga0105240_10009713 | 3300009093 | Bacteria | 13584 |
| 151 | Ga0105240_10017325 | 3300009093 | Bacteria | 9712 |
| 152 | Ga0105240_10021363 | 3300009093 | Bacteria | 8610 |
| 153 | Ga0105240_10080085 | 3300009093 | Bacteria | 4018 |
| 154 | Ga0111539_10130613 | 3300009094 | Bacteria | 2941 |
| 155 | Ga0111539_10150922 | 3300009094 | Bacteria | 2720 |
| 156 | Ga0111539_10226551 | 3300009094 | Bacteria | 2177 |
| 157 | Ga0105245_10001099 | 3300009098 | Bacteria | 24505 |
| 158 | Ga0105247_10026286 | 3300009101 | Bacteria | 3514 |
| 159 | Ga0114129_10000523 | 3300009147 | Bacteria | 46856 |
| 160 | Ga0105243_10000293 | 3300009148 | Bacteria | 55165 |
| 161 | Ga0105241_10014586 | 3300009174 | Bacteria | 5754 |
| 162 | Ga0105248_10000851 | 3300009177 | Bacteria | 34362 |
| 163 | Ga0105248_10022168 | 3300009177 | Bacteria | 7041 |
| 164 | Ga0105248_10096218 | 3300009177 | Bacteria | 3335 |
| 165 | Ga0105248_10123808 | 3300009177 | Bacteria | 2916 |
| 166 | Ga0105237_10053764 | 3300009545 | Bacteria | 4038 |
| 167 | Ga0105237_10196031 | 3300009545 | Bacteria | 2020 |
| 168 | Ga0105237_10235451 | 3300009545 | Bacteria | 1832 |
| 169 | Ga0105238_10000493 | 3300009551 | Bacteria | 41482 |
| 170 | Ga0105238_10006619 | 3300009551 | Bacteria | 11548 |
| 171 | Ga0105249_10018235 | 3300009553 | Bacteria | 6238 |
| 172 | Ga0105249_10031571 | 3300009553 | Bacteria | 4791 |
| 173 | Ga0105249_10070334 | 3300009553 | Bacteria | 3230 |
| 174 | Ga0105249_10306810 | 3300009553 | Bacteria | 1594 |
| 175 | Ga0099796_10000651 | 3300010159 | Bacteria | 6047 |
| 176 | Ga0105239_10055846 | 3300010375 | Bacteria | 4332 |
| 177 | Ga0157373_10044194 | 3300013100 | Bacteria | 3181 |
| 178 | Ga0157371_10004600 | 3300013102 | Bacteria | 11980 |
| 179 | Ga0157370_10124958 | 3300013104 | Bacteria | 2402 |
| 180 | Ga0157369_10026347 | 3300013105 | Bacteria | 6450 |
| 181 | Ga0171462_1013 | 3300013250 | Bacteria | 202864 |
| 182 | Ga0157378_10009277 | 3300013297 | Bacteria | 8571 |
| 183 | Ga0157378_10175857 | 3300013297 | Bacteria | 2011 |
| 184 | Ga0163162_10234112 | 3300013306 | Bacteria | 1968 |
| 185 | Ga0157372_10072967 | 3300013307 | Bacteria | 3868 |
| 186 | Ga0157375_10005737 | 3300013308 | Bacteria | 10800 |
| 187 | Ga0157375_10051189 | 3300013308 | Bacteria | 4055 |
| 188 | Ga0157375_10404997 | 3300013308 | Bacteria | 1531 |
| 189 | Ga0163163_10004461 | 3300014325 | Bacteria | 11936 |
| 190 | Ga0182008_10124288 | 3300014497 | Bacteria | 1283 |
| 191 | Ga0157379_10157466 | 3300014968 | Bacteria | 2049 |
| 192 | Ga0157379_10297689 | 3300014968 | Bacteria | 1470 |
| 193 | Ga0157379_10409934 | 3300014968 | Bacteria | 1247 |
| 194 | Ga0157376_10132038 | 3300014969 | Bacteria | 2230 |
| 195 | Ga0157376_10270986 | 3300014969 | Bacteria | 1595 |
| 196 | Ga0183361_10003 | 3300016635 | Bacteria | 577277 |
| 197 | Ga0163161_10037715 | 3300017792 | Bacteria | 3465 |
| 198 | Ga0213872_10000019 | 3300021361 | Bacteria | 172803 |
| 199 | Ga0213872_10001794 | 3300021361 | Bacteria | 13382 |
| 200 | Ga0213872_10003169 | 3300021361 | Bacteria | 9226 |
| 201 | Ga0213874_10024099 | 3300021377 | Bacteria | 1703 |
| 202 | Ga0213874_10038923 | 3300021377 | Bacteria | 1414 |
| 203 | Ga0213876_10000611 | 3300021384 | Bacteria | 26400 |
| 204 | Ga0213875_10001414 | 3300021388 | Bacteria | 15605 |
| 205 | Ga0213875_10003941 | 3300021388 | Bacteria | 8290 |
| 206 | Ga0213875_10007514 | 3300021388 | Bacteria | 5619 |
| 207 | Ga0209437_103668 | 3300025233 | Bacteria | 2750 |
| 208 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 209 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 210 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 211 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 212 | Ga0209675_1000909 | 3300025291 | Bacteria | 18906 |
| 213 | Ga0209675_1016544 | 3300025291 | Bacteria | 2142 |
| 214 | Ga0209676_1000267 | 3300025292 | Bacteria | 109237 |
| 215 | Ga0209025_1000063 | 3300025294 | Bacteria | 303962 |
| 216 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 217 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 218 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 219 | Ga0209564_1000043 | 3300025295 | Bacteria | 388153 |
| 220 | Ga0209564_1000052 | 3300025295 | Bacteria | 356578 |
| 221 | Ga0209050_1000915 | 3300025298 | Bacteria | 38980 |
| 222 | Ga0209050_1000916 | 3300025298 | Bacteria | 38869 |
| 223 | Ga0209050_1010784 | 3300025298 | Bacteria | 4448 |
| 224 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 225 | Ga0209256_1000172 | 3300025299 | Bacteria | 129025 |
| 226 | Ga0209256_1000697 | 3300025299 | Bacteria | 44617 |
| 227 | Ga0209051_1000230 | 3300025303 | Bacteria | 94027 |
| 228 | Ga0209051_1000379 | 3300025303 | Bacteria | 63486 |
| 229 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 230 | Ga0209257_1000676 | 3300025304 | Bacteria | 53204 |
| 231 | Ga0209257_1028785 | 3300025304 | Bacteria | 1823 |
| 232 | Ga0207656_10010386 | 3300025321 | Bacteria | 3487 |
| 233 | Ga0207656_10066613 | 3300025321 | Bacteria | 1592 |
| 234 | Ga0207682_10000061 | 3300025893 | Bacteria | 46850 |
| 235 | Ga0207642_10116554 | 3300025899 | Bacteria | 1370 |
| 236 | Ga0207710_10150175 | 3300025900 | Bacteria | 1130 |
| 237 | Ga0207680_10000489 | 3300025903 | Bacteria | 18801 |
| 238 | Ga0207680_10031077 | 3300025903 | Bacteria | 3021 |
| 239 | Ga0207680_10107901 | 3300025903 | Bacteria | 1800 |
| 240 | Ga0207647_10000817 | 3300025904 | Bacteria | 24192 |
| 241 | Ga0207645_10003267 | 3300025907 | Bacteria | 12380 |
| 242 | Ga0207645_10036693 | 3300025907 | Bacteria | 3147 |
| 243 | Ga0207643_10015602 | 3300025908 | Bacteria | 4136 |
| 244 | Ga0207705_10072679 | 3300025909 | Bacteria | 2495 |
| 245 | Ga0207684_10068853 | 3300025910 | Bacteria | 3008 |
| 246 | Ga0207684_10263923 | 3300025910 | Bacteria | 1486 |
| 247 | Ga0207695_10037969 | 3300025913 | Bacteria | 5192 |
| 248 | Ga0207695_10067720 | 3300025913 | Bacteria | 3661 |
| 249 | Ga0207695_10068557 | 3300025913 | Bacteria | 3634 |
| 250 | Ga0207662_10081503 | 3300025918 | Bacteria | 1975 |
| 251 | Ga0207649_10020345 | 3300025920 | Bacteria | 3805 |
| 252 | Ga0207681_10007036 | 3300025923 | Bacteria | 6905 |
| 253 | Ga0207681_10075811 | 3300025923 | Bacteria | 2360 |
| 254 | Ga0207694_10000397 | 3300025924 | Bacteria | 40466 |
| 255 | Ga0207694_10063477 | 3300025924 | Bacteria | 2877 |
| 256 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 257 | Ga0207650_10060737 | 3300025925 | Bacteria | 2821 |
| 258 | Ga0207659_10146894 | 3300025926 | Bacteria | 1837 |
| 259 | Ga0207659_10163884 | 3300025926 | Bacteria | 1748 |
| 260 | Ga0207687_10002035 | 3300025927 | Bacteria | 13862 |
| 261 | Ga0207644_10000372 | 3300025931 | Bacteria | 29326 |
| 262 | Ga0207644_10005509 | 3300025931 | Bacteria | 8244 |
| 263 | Ga0207644_10039648 | 3300025931 | Bacteria | 3325 |
| 264 | Ga0207644_10089089 | 3300025931 | Bacteria | 2296 |
| 265 | Ga0207706_10000744 | 3300025933 | Bacteria | 33884 |
| 266 | Ga0207706_10009544 | 3300025933 | Bacteria | 8910 |
| 267 | Ga0207706_10042045 | 3300025933 | Bacteria | 4050 |
| 268 | Ga0207706_10231483 | 3300025933 | Bacteria | 1617 |
| 269 | Ga0207706_10279438 | 3300025933 | Bacteria | 1456 |
| 270 | Ga0207709_10000076 | 3300025935 | Bacteria | 173292 |
| 271 | Ga0207704_10052278 | 3300025938 | Bacteria | 2476 |
| 272 | Ga0207691_10000016 | 3300025940 | Bacteria | 141024 |
| 273 | Ga0207691_10024116 | 3300025940 | Bacteria | 5721 |
| 274 | Ga0207711_10002050 | 3300025941 | Bacteria | 18223 |
| 275 | Ga0207711_10003955 | 3300025941 | Bacteria | 12744 |
| 276 | Ga0207689_10105939 | 3300025942 | Bacteria | 2310 |
| 277 | Ga0207679_10088532 | 3300025945 | Bacteria | 2387 |
| 278 | Ga0207679_10137793 | 3300025945 | Bacteria | 1968 |
| 279 | Ga0207667_10051563 | 3300025949 | Bacteria | 4337 |
| 280 | Ga0207667_10098298 | 3300025949 | Bacteria | 3020 |
| 281 | Ga0207651_10029503 | 3300025960 | Bacteria | 3476 |
| 282 | Ga0207712_10019361 | 3300025961 | Bacteria | 4444 |
| 283 | Ga0207712_10026403 | 3300025961 | Bacteria | 3869 |
| 284 | Ga0207668_10010412 | 3300025972 | Bacteria | 5617 |
| 285 | Ga0207668_10049405 | 3300025972 | Bacteria | 2891 |
| 286 | Ga0207640_10065584 | 3300025981 | Bacteria | 2423 |
| 287 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 288 | Ga0207658_10001061 | 3300025986 | Bacteria | 22224 |
| 289 | Ga0207658_10005073 | 3300025986 | Bacteria | 9059 |
| 290 | Ga0207658_10025287 | 3300025986 | Bacteria | 4157 |
| 291 | Ga0207658_10130949 | 3300025986 | Bacteria | 2015 |
| 292 | Ga0207658_10361965 | 3300025986 | Bacteria | 1266 |
| 293 | Ga0207703_10067840 | 3300026035 | Bacteria | 2937 |
| 294 | Ga0207703_10092071 | 3300026035 | Bacteria | 2551 |
| 295 | Ga0207639_10000632 | 3300026041 | Bacteria | 24237 |
| 296 | Ga0207639_10037373 | 3300026041 | Bacteria | 3606 |
| 297 | Ga0207639_10061248 | 3300026041 | Bacteria | 2905 |
| 298 | Ga0207639_10062057 | 3300026041 | Bacteria | 2889 |
| 299 | Ga0207678_10000914 | 3300026067 | Bacteria | 27005 |
| 300 | Ga0207678_10013650 | 3300026067 | Bacteria | 7134 |
| 301 | Ga0207702_10001373 | 3300026078 | Bacteria | 24259 |
| 302 | Ga0207702_10020598 | 3300026078 | Bacteria | 5459 |
| 303 | Ga0207641_10008740 | 3300026088 | Bacteria | 8367 |
| 304 | Ga0207641_10050012 | 3300026088 | Bacteria | 3535 |
| 305 | Ga0207641_10224594 | 3300026088 | Bacteria | 1743 |
| 306 | Ga0207648_10004401 | 3300026089 | Bacteria | 14473 |
| 307 | Ga0207648_10005187 | 3300026089 | Bacteria | 13193 |
| 308 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 309 | Ga0207676_10014847 | 3300026095 | Bacteria | 5611 |
| 310 | Ga0207676_10181994 | 3300026095 | Bacteria | 1841 |
| 311 | Ga0207676_10208096 | 3300026095 | Bacteria | 1733 |
| 312 | Ga0207676_10395469 | 3300026095 | Bacteria | 1290 |
| 313 | Ga0207674_10001538 | 3300026116 | Bacteria | 29722 |
| 314 | Ga0207674_10021564 | 3300026116 | Bacteria | 6935 |
| 315 | Ga0207675_100039056 | 3300026118 | Bacteria | 4430 |
| 316 | Ga0207675_100056394 | 3300026118 | Bacteria | 3664 |
| 317 | Ga0207675_100160883 | 3300026118 | Bacteria | 2141 |
| 318 | Ga0207683_10000322 | 3300026121 | Bacteria | 43758 |
| 319 | Ga0207683_10175467 | 3300026121 | Bacteria | 1942 |
| 320 | Ga0209281_1000423 | 3300027111 | Bacteria | 63126 |
| 321 | Ga0209179_1000828 | 3300027512 | Bacteria | 3412 |
| 322 | Ga0268266_10007343 | 3300028379 | Bacteria | 9955 |
| 323 | Ga0268266_10009218 | 3300028379 | Bacteria | 8707 |
| 324 | Ga0268266_10013731 | 3300028379 | Bacteria | 6975 |
| 325 | Ga0268266_10023392 | 3300028379 | Bacteria | 5262 |
| 326 | Ga0268266_10121103 | 3300028379 | Bacteria | 2329 |
| 327 | Ga0268265_10083838 | 3300028380 | Bacteria | 2525 |
| 328 | Ga0268265_10084293 | 3300028380 | Bacteria | 2519 |
| 329 | Ga0268265_10356246 | 3300028380 | Bacteria | 1338 |
| 330 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 331 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 332 | Ga0268264_10000014 | 3300028381 | Bacteria | 509962 |
| 333 | Ga0268264_10009680 | 3300028381 | Bacteria | 7983 |
| 334 | Ga0268264_10042701 | 3300028381 | Bacteria | 3754 |
| 335 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 336 | Ga0307515_10063025 | 3300028794 | Bacteria | 5221 |
| 337 | Ga0307511_10000025 | 3300030521 | Bacteria | 112344 |
| 338 | Ga0316177_1212761 | 3300030731 | Bacteria | 3251 |
| 339 | Ga0265340_10144815 | 3300031247 | Bacteria | 1085 |
| 340 | Ga0265339_10010596 | 3300031249 | Bacteria | 5720 |
| 341 | Ga0265327_10001131 | 3300031251 | Bacteria | 36638 |
| 342 | Ga0265327_10008872 | 3300031251 | Bacteria | 7389 |
| 343 | Ga0265327_10010715 | 3300031251 | Bacteria | 6405 |
| 344 | Ga0307408_100060395 | 3300031548 | Bacteria | 2763 |
| 345 | Ga0307408_100075499 | 3300031548 | Bacteria | 2504 |
| 346 | Ga0265313_10040486 | 3300031595 | Bacteria | 2303 |
| 347 | Ga0265314_10029756 | 3300031711 | Bacteria | 4055 |
| 348 | Ga0316576_10124408 | 3300031727 | Bacteria | 1937 |
| 349 | Ga0316576_10267391 | 3300031727 | Unclassified | 1282 |
| 350 | Ga0316578_10053225 | 3300031728 | Bacteria | 2371 |
| 351 | Ga0307516_10046623 | 3300031730 | Bacteria | 4275 |
| 352 | Ga0307405_10033113 | 3300031731 | Bacteria | 3061 |
| 353 | Ga0307405_10140183 | 3300031731 | Bacteria | 1684 |
| 354 | Ga0316577_10019978 | 3300031733 | Bacteria | 3710 |
| 355 | Ga0307413_10110899 | 3300031824 | Bacteria | 1836 |
| 356 | Ga0307518_10222053 | 3300031838 | Bacteria | 1232 |
| 357 | Ga0307410_10137388 | 3300031852 | Bacteria | 1803 |
| 358 | Ga0307410_10173092 | 3300031852 | Bacteria | 1628 |
| 359 | Ga0307406_10012195 | 3300031901 | Bacteria | 4896 |
| 360 | Ga0307406_10091859 | 3300031901 | Bacteria | 2046 |
| 361 | Ga0307407_10005506 | 3300031903 | Bacteria | 5503 |
| 362 | Ga0307412_10024218 | 3300031911 | Bacteria | 3745 |
| 363 | Ga0307412_10168454 | 3300031911 | Bacteria | 1635 |
| 364 | Ga0307409_100005750 | 3300031995 | Bacteria | 7188 |
| 365 | Ga0307414_10026730 | 3300032004 | Bacteria | 3719 |
| 366 | Ga0307414_10094848 | 3300032004 | Bacteria | 2228 |
| 367 | Ga0307415_100273674 | 3300032126 | Bacteria | 1384 |
| 368 | Ga0307507_10035925 | 3300033179 | Bacteria | 5077 |
| 369 | Ga0307510_10001839 | 3300033180 | Bacteria | 23770 |
| 370 | Ga0307510_10039902 | 3300033180 | Bacteria | 5163 |
| 371 | Ga0307510_10202941 | 3300033180 | Bacteria | 1515 |
| 372 | Ga0373926_0014404 | 3300035083 | Bacteria | 2688 |
| 373 | Ga0373923_0009335 | 3300035111 | Bacteria | 3537 |
| 374 | Ga0373936_0017021 | 3300035113 | Bacteria | 2795 |
| 375 | Ga0373936_0068214 | 3300035113 | Bacteria | 1462 |
| 376 | Ga0373945_0026017 | 3300035116 | Bacteria | 2036 |
| 377 | Ga0373943_0003641 | 3300035170 | Bacteria | 7005 |
| 378 | Ga0373946_0002251 | 3300035171 | Bacteria | 6811 |
| 379 | Ga0373946_0007659 | 3300035171 | Bacteria | 3955 |
| 380 | Ga0373955_0040066 | 3300035172 | Bacteria | 2503 |
| 381 | Ga0373924_0039566 | 3300035410 | Bacteria | 1927 |
| 382 | Ga0373931_0016354 | 3300035691 | Bacteria | 3651 |
| 383 | Ga0373935_0004899 | 3300035692 | Bacteria | 7870 |
| 384 | Ga0373935_0019897 | 3300035692 | Bacteria | 4097 |
| 385 | Ga0373935_0056067 | 3300035692 | Bacteria | 2511 |
| 386 | Ga0373927_0002255 | 3300035695 | Bacteria | 14135 |
| 387 | Ga0373927_0002256 | 3300035695 | Bacteria | 14126 |
| 388 | Ga0373947_0001432 | 3300035725 | Bacteria | 14679 |
| 389 | Ga0373947_0204067 | 3300035725 | Bacteria | 1294 |
| 390 | Ga0316584_0016657 | 3300036712 | Bacteria | 5272 |
| 391 | Ga0373925_0000104 | 3300037068 | Bacteria | 91673 |
| 392 | Ga0373925_0000976 | 3300037068 | Bacteria | 26036 |
| 393 | Ga0373925_0075408 | 3300037068 | Bacteria | 2555 |
| 394 | Ga0395899_0000361 | 3300037312 | Bacteria | 55292 |
| 395 | Ga0395899_0013123 | 3300037312 | Bacteria | 6337 |
| 396 | Ga0395899_0262044 | 3300037312 | Unclassified | 1182 |
| 397 | Ga0395900_0000046 | 3300037418 | Bacteria | 230114 |
| 398 | Ga0395900_0000237 | 3300037418 | Bacteria | 86507 |
| 399 | Ga0395900_0064772 | 3300037418 | Bacteria | 3755 |
| 400 | Ga0395900_0166403 | 3300037418 | Bacteria | 2247 |
| 401 | Ga0395900_0190827 | 3300037418 | Bacteria | 2078 |
| 402 | Ga0395900_0296593 | 3300037418 | Bacteria | 1604 |
| 403 | Ga0395905_0000498 | 3300037471 | Bacteria | 53933 |
| 404 | Ga0395905_0087405 | 3300037471 | Bacteria | 2922 |
| 405 | Ga0395905_0124786 | 3300037471 | Bacteria | 2421 |
| 406 | Ga0395905_0167522 | 3300037471 | Bacteria | 2064 |
| 407 | Ga0395905_0173861 | 3300037471 | Bacteria | 2022 |
| 408 | Ga0395905_0187495 | 3300037471 | Bacteria | 1941 |
| 409 | Ga0395905_0315121 | 3300037471 | Bacteria | 1453 |
| 410 | Ga0436364_0473640 | 3300037853 | Bacteria | 15605 |
| 411 | Ga0436364_0563933 | 3300037853 | Bacteria | 17439 |
| 412 | Ga0436364_0786035 | 3300037853 | Bacteria | 3970 |
| 413 | Ga0436364_0804800 | 3300037853 | Bacteria | 21862 |
| 414 | Ga0395901_0000028 | 3300038443 | Bacteria | 242653 |
| 415 | Ga0395901_0100110 | 3300038443 | Bacteria | 3040 |
| 416 | Ga0395901_0452827 | 3300038443 | Bacteria | 1312 |
| 417 | Ga0400483_068090 | 3300039062 | Bacteria | 1885 |
| 418 | Ga0436365_1595143 | 3300039437 | Bacteria | 26401 |
| 419 | Ga0436360_0787362 | 3300039438 | Bacteria | 1673 |
| 420 | Ga0436361_0075382 | 3300039447 | Bacteria | 4523 |
| 421 | Ga0436361_0330198 | 3300039447 | Bacteria | 18763 |
| 422 | Ga0436361_0352948 | 3300039447 | Bacteria | 62639 |
| 423 | Ga0436361_0635819 | 3300039447 | Bacteria | 1362 |
| 424 | Ga0436361_1127083 | 3300039447 | Bacteria | 3115 |
| 425 | Ga0436363_0240244 | 3300039450 | Bacteria | 4335 |
| 426 | Ga0436363_1348059 | 3300039450 | Bacteria | 4809 |
| 427 | Ga0439441_005803 | 3300042001 | Bacteria | 1933 |
| 428 | Ga0439449_0054328 | 3300042007 | Bacteria | 1480 |
| 429 | Ga0450904_000658 | 3300042139 | Bacteria | 6256 |
| 430 | Ga0451577_0001960 | 3300042876 | Bacteria | 25893 |
| 431 | Ga0451577_0034963 | 3300042876 | Bacteria | 4528 |
| 432 | Ga0451577_0040418 | 3300042876 | Bacteria | 4187 |
| 433 | Ga0453683_0262854 | 3300044673 | Bacteria | 1101 |
| 434 | Ga0466965_0112314 | 3300044683 | Bacteria | 1401 |
| 435 | Ga0466966_0002584 | 3300044684 | Bacteria | 11864 |
| 436 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 437 | Ga0495617_000060 | 3300046452 | Bacteria | 97123 |
| 438 | Ga0495617_000072 | 3300046452 | Bacteria | 80951 |
| 439 | Ga0495617_018523 | 3300046452 | Bacteria | 2354 |
| 440 | Ga0495627_000272 | 3300046453 | Bacteria | 52368 |
| 441 | Ga0495627_000489 | 3300046453 | Bacteria | 33226 |
| 442 | Ga0495603_0069937 | 3300046455 | Bacteria | 2064 |
| 443 | Ga0495603_0125092 | 3300046455 | Bacteria | 1498 |
| 444 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 445 | Ga0495590_0000008 | 3300046457 | Bacteria | 330520 |
| 446 | Ga0495590_0000424 | 3300046457 | Bacteria | 21300 |
| 447 | Ga0495590_0000562 | 3300046457 | Bacteria | 17639 |
| 448 | Ga0495590_0010969 | 3300046457 | Bacteria | 3396 |
| 449 | Ga0495591_000051 | 3300046458 | Bacteria | 137457 |
| 450 | Ga0495629_0000365 | 3300046459 | Bacteria | 38312 |
| 451 | Ga0495629_0027120 | 3300046459 | Bacteria | 4069 |
| 452 | Ga0495629_0055488 | 3300046459 | Bacteria | 2770 |
| 453 | Ga0495629_0067560 | 3300046459 | Bacteria | 2494 |
| 454 | Ga0495638_0000027 | 3300046460 | Bacteria | 337569 |
| 455 | Ga0495638_0001965 | 3300046460 | Bacteria | 17609 |
| 456 | Ga0495638_0003652 | 3300046460 | Bacteria | 12000 |
| 457 | Ga0495641_0045723 | 3300046461 | Bacteria | 2015 |
| 458 | Ga0495653_0000880 | 3300046463 | Bacteria | 23178 |
| 459 | Ga0495653_0008489 | 3300046463 | Bacteria | 8422 |
| 460 | Ga0495653_0009298 | 3300046463 | Bacteria | 8041 |
| 461 | Ga0495653_0015205 | 3300046463 | Bacteria | 6273 |
| 462 | Ga0495653_0136800 | 3300046463 | Bacteria | 1727 |
| 463 | Ga0495653_0189182 | 3300046463 | Bacteria | 1406 |
| 464 | Ga0495650_0000044 | 3300046471 | Bacteria | 355139 |
| 465 | Ga0495650_0000185 | 3300046471 | Bacteria | 136913 |
| 466 | Ga0495650_0000323 | 3300046471 | Bacteria | 85563 |
| 467 | Ga0495650_0002258 | 3300046471 | Bacteria | 16098 |
| 468 | Ga0495650_0003969 | 3300046471 | Bacteria | 10397 |
| 469 | Ga0495650_0005067 | 3300046471 | Bacteria | 8716 |
| 470 | Ga0495650_0055439 | 3300046471 | Bacteria | 1613 |
| 471 | Ga0495580_0003410 | 3300046472 | Bacteria | 13548 |
| 472 | Ga0495580_0006376 | 3300046472 | Bacteria | 9624 |
| 473 | Ga0495582_0090689 | 3300046473 | Bacteria | 1704 |
| 474 | Ga0495605_0000049 | 3300046474 | Bacteria | 166669 |
| 475 | Ga0495605_0017778 | 3300046474 | Bacteria | 3822 |
| 476 | Ga0495605_0019852 | 3300046474 | Bacteria | 3580 |
| 477 | Ga0495639_0006411 | 3300046475 | Bacteria | 5062 |
| 478 | Ga0495662_0067417 | 3300046476 | Bacteria | 1732 |
| 479 | Ga0495664_0002204 | 3300046477 | Bacteria | 10434 |
| 480 | Ga0495664_0028490 | 3300046477 | Bacteria | 3261 |
| 481 | Ga0495584_0000001 | 3300046491 | Bacteria | 649329 |
| 482 | Ga0495584_0000024 | 3300046491 | Bacteria | 117259 |
| 483 | Ga0495584_0001263 | 3300046491 | Bacteria | 15400 |
| 484 | Ga0495584_0003873 | 3300046491 | Bacteria | 8108 |
| 485 | Ga0495584_0009495 | 3300046491 | Bacteria | 5009 |
| 486 | Ga0495585_0000040 | 3300046492 | Bacteria | 130615 |
| 487 | Ga0495585_0002248 | 3300046492 | Bacteria | 13971 |
| 488 | Ga0495585_0002439 | 3300046492 | Bacteria | 13331 |
| 489 | Ga0495585_0036912 | 3300046492 | Bacteria | 2753 |
| 490 | Ga0495585_0039002 | 3300046492 | Bacteria | 2672 |
| 491 | Ga0495585_0059017 | 3300046492 | Bacteria | 2115 |
| 492 | Ga0495585_0122419 | 3300046492 | Bacteria | 1375 |
| 493 | Ga0495594_0046635 | 3300046499 | Bacteria | 2380 |
| 494 | Ga0495594_0097782 | 3300046499 | Bacteria | 1649 |
| 495 | Ga0495596_0000714 | 3300046500 | Bacteria | 20519 |
| 496 | Ga0495596_0001374 | 3300046500 | Bacteria | 13962 |
| 497 | Ga0495596_0008634 | 3300046500 | Bacteria | 4523 |
| 498 | Ga0495596_0010135 | 3300046500 | Bacteria | 4118 |
| 499 | Ga0495596_0010676 | 3300046500 | Bacteria | 3991 |
| 500 | Ga0495596_0012118 | 3300046500 | Bacteria | 3700 |
| 501 | Ga0495596_0037335 | 3300046500 | Bacteria | 1921 |
| 502 | Ga0495607_0000473 | 3300046501 | Bacteria | 40325 |
| 503 | Ga0495607_0000984 | 3300046501 | Bacteria | 26388 |
| 504 | Ga0495607_0003885 | 3300046501 | Bacteria | 11256 |
| 505 | Ga0495607_0031534 | 3300046501 | Bacteria | 3244 |
| 506 | Ga0495607_0055116 | 3300046501 | Bacteria | 2288 |
| 507 | Ga0495607_0064406 | 3300046501 | Bacteria | 2070 |
| 508 | Ga0495583_0000055 | 3300046506 | Bacteria | 201245 |
| 509 | Ga0495583_0000100 | 3300046506 | Bacteria | 145745 |
| 510 | Ga0495583_0000117 | 3300046506 | Bacteria | 135061 |
| 511 | Ga0495583_0000314 | 3300046506 | Bacteria | 76522 |
| 512 | Ga0495583_0000792 | 3300046506 | Bacteria | 39204 |
| 513 | Ga0495583_0001305 | 3300046506 | Bacteria | 25935 |
| 514 | Ga0495583_0003790 | 3300046506 | Bacteria | 11230 |
| 515 | Ga0495583_0036350 | 3300046506 | Bacteria | 2344 |
| 516 | Ga0495583_0038279 | 3300046506 | Bacteria | 2266 |
| 517 | Ga0495583_0039360 | 3300046506 | Bacteria | 2228 |
| 518 | Ga0495606_0000053 | 3300046507 | Bacteria | 200818 |
| 519 | Ga0495606_0000059 | 3300046507 | Bacteria | 186886 |
| 520 | Ga0495606_0004757 | 3300046507 | Bacteria | 13358 |
| 521 | Ga0495606_0008214 | 3300046507 | Bacteria | 9125 |
| 522 | Ga0495606_0013949 | 3300046507 | Bacteria | 6305 |
| 523 | Ga0495606_0019668 | 3300046507 | Bacteria | 5011 |
| 524 | Ga0495606_0044306 | 3300046507 | Bacteria | 2960 |
| 525 | Ga0495606_0075230 | 3300046507 | Bacteria | 2113 |
| 526 | Ga0495606_0117201 | 3300046507 | Bacteria | 1598 |
| 527 | Ga0495606_0125542 | 3300046507 | Bacteria | 1531 |
| 528 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 529 | Ga0495610_0000556 | 3300046512 | Bacteria | 37327 |
| 530 | Ga0495610_0000771 | 3300046512 | Bacteria | 30226 |
| 531 | Ga0495610_0002195 | 3300046512 | Bacteria | 16525 |
| 532 | Ga0495610_0007885 | 3300046512 | Bacteria | 6996 |
| 533 | Ga0495610_0022630 | 3300046512 | Bacteria | 3433 |
| 534 | Ga0495610_0039922 | 3300046512 | Bacteria | 2370 |
| 535 | Ga0495616_0000035 | 3300046513 | Bacteria | 128636 |
| 536 | Ga0495616_0000080 | 3300046513 | Bacteria | 81238 |
| 537 | Ga0495616_0003689 | 3300046513 | Bacteria | 9782 |
| 538 | Ga0495616_0011085 | 3300046513 | Bacteria | 5180 |
| 539 | Ga0495616_0011853 | 3300046513 | Bacteria | 4969 |
| 540 | Ga0495616_0023409 | 3300046513 | Bacteria | 3322 |
| 541 | Ga0495616_0035134 | 3300046513 | Bacteria | 2596 |
| 542 | Ga0495618_0080682 | 3300046514 | Bacteria | 2076 |
| 543 | Ga0495620_0000351 | 3300046515 | Bacteria | 31904 |
| 544 | Ga0495628_0003503 | 3300046516 | Bacteria | 14044 |
| 545 | Ga0495628_0028044 | 3300046516 | Bacteria | 4579 |
| 546 | Ga0495630_0002597 | 3300046517 | Bacteria | 12524 |
| 547 | Ga0495630_0074389 | 3300046517 | Bacteria | 2558 |
| 548 | Ga0495630_0084314 | 3300046517 | Bacteria | 2399 |
| 549 | Ga0495631_0003168 | 3300046518 | Bacteria | 9050 |
| 550 | Ga0495631_0008273 | 3300046518 | Bacteria | 5244 |
| 551 | Ga0495631_0011965 | 3300046518 | Bacteria | 4254 |
| 552 | Ga0495631_0018765 | 3300046518 | Bacteria | 3252 |
| 553 | Ga0495631_0019353 | 3300046518 | Bacteria | 3193 |
| 554 | Ga0495631_0026730 | 3300046518 | Bacteria | 2646 |
| 555 | Ga0495631_0026941 | 3300046518 | Bacteria | 2634 |
| 556 | Ga0495631_0036889 | 3300046518 | Bacteria | 2180 |
| 557 | Ga0495632_0000044 | 3300046519 | Bacteria | 141051 |
| 558 | Ga0495632_0000066 | 3300046519 | Bacteria | 115170 |
| 559 | Ga0495632_0000285 | 3300046519 | Bacteria | 49299 |
| 560 | Ga0495632_0011220 | 3300046519 | Bacteria | 5243 |
| 561 | Ga0495632_0095856 | 3300046519 | Bacteria | 1401 |
| 562 | Ga0495637_0000009 | 3300046520 | Bacteria | 402028 |
| 563 | Ga0495637_0000189 | 3300046520 | Bacteria | 48390 |
| 564 | Ga0495637_0007240 | 3300046520 | Bacteria | 5518 |
| 565 | Ga0495637_0009788 | 3300046520 | Bacteria | 4664 |
| 566 | Ga0495643_0000022 | 3300046522 | Bacteria | 289691 |
| 567 | Ga0495643_0000094 | 3300046522 | Bacteria | 150795 |
| 568 | Ga0495643_0026589 | 3300046522 | Bacteria | 3263 |
| 569 | Ga0495643_0056149 | 3300046522 | Bacteria | 2103 |
| 570 | Ga0495643_0065384 | 3300046522 | Bacteria | 1920 |
| 571 | Ga0495644_0006445 | 3300046523 | Bacteria | 4547 |
| 572 | Ga0495644_0007635 | 3300046523 | Bacteria | 4169 |
| 573 | Ga0495644_0010658 | 3300046523 | Bacteria | 3540 |
| 574 | Ga0495644_0011124 | 3300046523 | Bacteria | 3468 |
| 575 | Ga0495648_0000411 | 3300046524 | Bacteria | 47243 |
| 576 | Ga0495648_0001558 | 3300046524 | Bacteria | 22405 |
| 577 | Ga0495648_0005347 | 3300046524 | Bacteria | 10699 |
| 578 | Ga0495648_0019087 | 3300046524 | Bacteria | 4834 |
| 579 | Ga0495648_0021267 | 3300046524 | Bacteria | 4498 |
| 580 | Ga0495648_0025112 | 3300046524 | Bacteria | 4039 |
| 581 | Ga0495648_0032359 | 3300046524 | Bacteria | 3433 |
| 582 | Ga0495648_0045189 | 3300046524 | Bacteria | 2742 |
| 583 | Ga0495648_0063905 | 3300046524 | Bacteria | 2170 |
| 584 | Ga0495663_0004172 | 3300046525 | Bacteria | 4083 |
| 585 | Ga0495663_0022815 | 3300046525 | Bacteria | 1810 |
| 586 | Ga0495663_0035034 | 3300046525 | Bacteria | 1506 |
| 587 | Ga0495666_0004909 | 3300046526 | Bacteria | 6765 |
| 588 | Ga0495666_0007197 | 3300046526 | Bacteria | 5586 |
| 589 | Ga0495666_0017775 | 3300046526 | Bacteria | 3541 |
| 590 | Ga0495642_0000012 | 3300046528 | Bacteria | 127229 |
| 591 | Ga0495642_0002273 | 3300046528 | Bacteria | 7846 |
| 592 | Ga0495642_0014066 | 3300046528 | Bacteria | 3101 |
| 593 | Ga0495642_0016372 | 3300046528 | Bacteria | 2889 |
| 594 | Ga0495642_0018803 | 3300046528 | Bacteria | 2705 |
| 595 | Ga0495642_0109106 | 3300046528 | Bacteria | 1182 |
| 596 | Ga0495652_0018714 | 3300046529 | Bacteria | 6173 |
| 597 | Ga0495652_0020109 | 3300046529 | Bacteria | 5937 |
| 598 | Ga0495652_0030202 | 3300046529 | Bacteria | 4755 |
| 599 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 600 | Ga0495654_0011218 | 3300046530 | Bacteria | 4860 |
| 601 | Ga0495654_0061171 | 3300046530 | Bacteria | 1809 |
| 602 | Ga0495665_0000097 | 3300046531 | Bacteria | 40415 |
| 603 | Ga0495665_0015244 | 3300046531 | Bacteria | 4141 |
| 604 | Ga0495665_0065446 | 3300046531 | Bacteria | 1919 |
| 605 | Ga0495665_0125272 | 3300046531 | Bacteria | 1345 |
| 606 | Ga0495665_0146228 | 3300046531 | Bacteria | 1234 |
| 607 | Ga0495640_0002599 | 3300046533 | Bacteria | 14518 |
| 608 | Ga0495640_0064218 | 3300046533 | Bacteria | 2483 |
| 609 | Ga0495586_0003981 | 3300046535 | Bacteria | 7924 |
| 610 | Ga0495587_0016570 | 3300046536 | Bacteria | 4584 |
| 611 | Ga0495587_0026273 | 3300046536 | Bacteria | 3551 |
| 612 | Ga0495609_0000177 | 3300046538 | Bacteria | 64469 |
| 613 | Ga0495609_0000981 | 3300046538 | Bacteria | 20439 |
| 614 | Ga0495609_0001757 | 3300046538 | Bacteria | 13913 |
| 615 | Ga0495609_0008006 | 3300046538 | Bacteria | 5218 |
| 616 | Ga0495609_0021747 | 3300046538 | Bacteria | 2959 |
| 617 | Ga0495609_0079108 | 3300046538 | Bacteria | 1438 |
| 618 | Ga0495597_0000009 | 3300046542 | Bacteria | 227319 |
| 619 | Ga0495597_0000055 | 3300046542 | Bacteria | 95175 |
| 620 | Ga0495597_0000672 | 3300046542 | Bacteria | 27772 |
| 621 | Ga0495597_0005908 | 3300046542 | Bacteria | 6392 |
| 622 | Ga0495597_0011159 | 3300046542 | Bacteria | 4361 |
| 623 | Ga0495597_0015727 | 3300046542 | Bacteria | 3580 |
| 624 | Ga0495597_0016538 | 3300046542 | Bacteria | 3482 |
| 625 | Ga0495645_0002089 | 3300046543 | Bacteria | 13565 |
| 626 | Ga0495645_0019718 | 3300046543 | Bacteria | 4857 |
| 627 | Ga0495645_0039510 | 3300046543 | Bacteria | 3441 |
| 628 | Ga0495622_0000009 | 3300046557 | Bacteria | 224622 |
| 629 | Ga0495622_0000128 | 3300046557 | Bacteria | 65352 |
| 630 | Ga0495633_0000050 | 3300046558 | Bacteria | 155466 |
| 631 | Ga0495633_0012260 | 3300046558 | Bacteria | 4570 |
| 632 | Ga0495633_0030058 | 3300046558 | Bacteria | 2640 |
| 633 | Ga0495633_0057903 | 3300046558 | Bacteria | 1819 |
| 634 | Ga0495633_0073416 | 3300046558 | Bacteria | 1594 |
| 635 | Ga0495667_0103145 | 3300046559 | Bacteria | 1845 |
| 636 | Ga0495656_0014920 | 3300046615 | Bacteria | 2922 |
| 637 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 638 | Ga0495668_0000027 | 3300046616 | Bacteria | 297194 |
| 639 | Ga0495668_0000350 | 3300046616 | Bacteria | 61356 |
| 640 | Ga0495668_0000353 | 3300046616 | Bacteria | 61110 |
| 641 | Ga0495668_0001625 | 3300046616 | Bacteria | 20999 |
| 642 | Ga0495668_0007466 | 3300046616 | Bacteria | 6986 |
| 643 | Ga0495668_0023465 | 3300046616 | Bacteria | 3517 |
| 644 | Ga0495668_0063250 | 3300046616 | Bacteria | 2038 |
| 645 | Ga0495668_0082766 | 3300046616 | Bacteria | 1760 |
| 646 | Ga0495668_0105224 | 3300046616 | Bacteria | 1543 |
| 647 | Ga0495634_0014394 | 3300046642 | Bacteria | 5706 |
| 648 | Ga0495634_0079051 | 3300046642 | Bacteria | 2154 |
| 649 | Ga0495611_0000311 | 3300046648 | Bacteria | 32985 |
| 650 | Ga0495611_0007917 | 3300046648 | Bacteria | 4511 |
| 651 | Ga0495611_0027492 | 3300046648 | Bacteria | 2486 |
| 652 | Ga0495611_0039772 | 3300046648 | Bacteria | 2094 |
| 653 | Ga0495611_0041086 | 3300046648 | Bacteria | 2062 |
| 654 | Ga0495625_0003531 | 3300046660 | Bacteria | 15480 |
| 655 | Ga0495625_0005763 | 3300046660 | Bacteria | 11200 |
| 656 | Ga0495625_0014914 | 3300046660 | Bacteria | 6180 |
| 657 | Ga0495625_0039909 | 3300046660 | Bacteria | 3426 |
| 658 | Ga0495625_0149651 | 3300046660 | Bacteria | 1570 |
| 659 | Ga0495625_0238049 | 3300046660 | Bacteria | 1186 |
| 660 | Ga0495659_0009489 | 3300046664 | Bacteria | 3107 |
| 661 | Ga0495661_0000531 | 3300046665 | Bacteria | 39271 |
| 662 | Ga0495661_0033987 | 3300046665 | Bacteria | 3212 |
| 663 | Ga0495661_0036495 | 3300046665 | Bacteria | 3077 |
| 664 | Ga0495661_0051487 | 3300046665 | Bacteria | 2486 |
| 665 | Ga0495661_0065344 | 3300046665 | Bacteria | 2144 |
| 666 | Ga0495661_0075402 | 3300046665 | Bacteria | 1960 |
| 667 | Ga0495661_0086346 | 3300046665 | Bacteria | 1796 |
| 668 | Ga0495661_0181877 | 3300046665 | Bacteria | 1113 |
| 669 | Ga0495588_0029914 | 3300046674 | Bacteria | 2734 |
| 670 | Ga0495588_0062678 | 3300046674 | Bacteria | 1927 |
| 671 | Ga0495588_0091777 | 3300046674 | Bacteria | 1591 |
| 672 | Ga0495599_0066007 | 3300046678 | Bacteria | 2261 |
| 673 | Ga0495623_0003969 | 3300046679 | Bacteria | 9738 |
| 674 | Ga0495646_0006689 | 3300046680 | Bacteria | 7309 |
| 675 | Ga0495647_0021282 | 3300046681 | Bacteria | 2334 |
| 676 | Ga0495647_0064955 | 3300046681 | Bacteria | 1448 |
| 677 | Ga0495669_0000017 | 3300046684 | Bacteria | 131447 |
| 678 | Ga0495669_0005081 | 3300046684 | Bacteria | 5474 |
| 679 | Ga0495669_0017390 | 3300046684 | Bacteria | 3086 |
| 680 | Ga0495669_0024204 | 3300046684 | Bacteria | 2645 |
| 681 | Ga0495669_0076352 | 3300046684 | Bacteria | 1533 |
| 682 | Ga0495613_0038721 | 3300046689 | Bacteria | 3534 |
| 683 | Ga0495613_0086690 | 3300046689 | Bacteria | 2270 |
| 684 | Ga0495624_0000316 | 3300046690 | Bacteria | 38401 |
| 685 | Ga0495624_0004924 | 3300046690 | Bacteria | 9682 |
| 686 | Ga0495624_0015579 | 3300046690 | Bacteria | 5130 |
| 687 | Ga0495624_0054496 | 3300046690 | Bacteria | 2521 |
| 688 | Ga0495670_0008894 | 3300046691 | Bacteria | 4939 |
| 689 | Ga0495670_0020761 | 3300046691 | Bacteria | 3239 |
| 690 | Ga0495670_0023483 | 3300046691 | Bacteria | 3043 |
| 691 | Ga0495670_0025810 | 3300046691 | Bacteria | 2907 |
| 692 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 693 | Ga0495671_0000469 | 3300046692 | Bacteria | 31566 |
| 694 | Ga0495671_0013575 | 3300046692 | Bacteria | 4404 |
| 695 | Ga0495649_0000546 | 3300046694 | Bacteria | 31916 |
| 696 | Ga0495649_0020472 | 3300046694 | Bacteria | 3711 |
| 697 | Ga0495649_0024363 | 3300046694 | Bacteria | 3375 |
| 698 | Ga0495649_0026329 | 3300046694 | Bacteria | 3235 |
| 699 | Ga0495649_0075244 | 3300046694 | Bacteria | 1808 |
| 700 | Ga0495589_0000102 | 3300046794 | Bacteria | 82380 |
| 701 | Ga0495589_0001114 | 3300046794 | Bacteria | 16022 |
| 702 | Ga0495589_0016132 | 3300046794 | Bacteria | 3838 |
| 703 | Ga0495589_0080051 | 3300046794 | Bacteria | 1589 |
| 704 | Ga0495589_0080682 | 3300046794 | Bacteria | 1583 |
| 705 | Ga0495589_0100900 | 3300046794 | Bacteria | 1396 |
| 706 | Ga0495660_0003891 | 3300046810 | Bacteria | 9128 |
| 707 | Ga0495660_0019284 | 3300046810 | Bacteria | 3916 |
| 708 | Ga0495660_0020441 | 3300046810 | Bacteria | 3795 |
| 709 | Ga0495660_0043022 | 3300046810 | Bacteria | 2493 |
| 710 | Ga0495660_0070542 | 3300046810 | Bacteria | 1854 |
| 711 | Ga0495581_0002330 | 3300047315 | Bacteria | 10701 |
| 712 | Ga0495581_0006456 | 3300047315 | Bacteria | 6805 |
| 713 | Ga0495581_0027224 | 3300047315 | Bacteria | 3315 |
| 714 | Ga0495604_0012826 | 3300047317 | Bacteria | 6674 |
| 715 | Ga0495604_0062580 | 3300047317 | Bacteria | 2842 |
| 716 | Ga0495604_0090387 | 3300047317 | Bacteria | 2274 |
| 717 | Ga0495636_0037515 | 3300047318 | Bacteria | 2001 |
| 718 | Ga0495636_0112751 | 3300047318 | Bacteria | 1197 |
| 719 | Ga0495674_0000923 | 3300047319 | Bacteria | 28086 |
| 720 | Ga0495674_0003405 | 3300047319 | Bacteria | 15455 |
| 721 | Ga0495674_0007608 | 3300047319 | Bacteria | 10351 |
| 722 | Ga0495674_0012637 | 3300047319 | Bacteria | 7956 |
| 723 | Ga0495674_0163125 | 3300047319 | Bacteria | 1863 |
| 724 | Ga0495674_0193456 | 3300047319 | Bacteria | 1689 |
| 725 | Ga0495672_0000131 | 3300047320 | Bacteria | 111562 |
| 726 | Ga0495672_0000290 | 3300047320 | Bacteria | 69104 |
| 727 | Ga0495672_0000738 | 3300047320 | Bacteria | 35882 |
| 728 | Ga0495672_0001642 | 3300047320 | Bacteria | 21746 |
| 729 | Ga0495672_0025534 | 3300047320 | Bacteria | 3778 |
| 730 | Ga0495672_0087181 | 3300047320 | Bacteria | 1724 |
| 731 | Ga0495676_0044397 | 3300047321 | Bacteria | 3628 |
| 732 | Ga0495676_0135153 | 3300047321 | Bacteria | 1774 |
| 733 | Ga0495680_0001842 | 3300047322 | Bacteria | 22357 |
| 734 | Ga0495680_0006432 | 3300047322 | Bacteria | 10918 |
| 735 | Ga0495680_0035667 | 3300047322 | Bacteria | 4004 |
| 736 | Ga0495683_0000160 | 3300047323 | Bacteria | 65995 |
| 737 | Ga0495683_0071165 | 3300047323 | Bacteria | 1707 |
| 738 | Ga0495683_0104951 | 3300047323 | Bacteria | 1355 |
| 739 | Ga0495687_000034 | 3300047443 | Bacteria | 257321 |
| 740 | Ga0495687_000048 | 3300047443 | Bacteria | 205967 |
| 741 | Ga0495687_000550 | 3300047443 | Bacteria | 44560 |
| 742 | Ga0495687_001509 | 3300047443 | Bacteria | 21213 |
| 743 | Ga0495687_005005 | 3300047443 | Bacteria | 8659 |
| 744 | Ga0495675_0004046 | 3300047444 | Bacteria | 8887 |
| 745 | Ga0495677_0000085 | 3300047445 | Bacteria | 48240 |
| 746 | Ga0495677_0004620 | 3300047445 | Bacteria | 5255 |
| 747 | Ga0495677_0005820 | 3300047445 | Bacteria | 4665 |
| 748 | Ga0495677_0024761 | 3300047445 | Bacteria | 2177 |
| 749 | Ga0495677_0035575 | 3300047445 | Bacteria | 1817 |
| 750 | Ga0495677_0036393 | 3300047445 | Bacteria | 1798 |
| 751 | Ga0495677_0057661 | 3300047445 | Bacteria | 1436 |
| 752 | Ga0495677_0067032 | 3300047445 | Bacteria | 1335 |
| 753 | Ga0495679_011256 | 3300047446 | Bacteria | 3465 |
| 754 | Ga0495679_024963 | 3300047446 | Bacteria | 2005 |
| 755 | Ga0495685_002522 | 3300047447 | Bacteria | 5746 |
| 756 | Ga0495685_012896 | 3300047447 | Bacteria | 2833 |
| 757 | Ga0495685_046097 | 3300047447 | Bacteria | 1483 |
| 758 | Ga0495685_048914 | 3300047447 | Bacteria | 1437 |
| 759 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 760 | Ga0495673_0000059 | 3300047469 | Bacteria | 233234 |
| 761 | Ga0495673_0000067 | 3300047469 | Bacteria | 219908 |
| 762 | Ga0495673_0011100 | 3300047469 | Bacteria | 4866 |
| 763 | Ga0495681_0000269 | 3300047470 | Bacteria | 41587 |
| 764 | Ga0495681_0002027 | 3300047470 | Bacteria | 14779 |
| 765 | Ga0495681_0073047 | 3300047470 | Bacteria | 1549 |
| 766 | Ga0495684_0003539 | 3300047471 | Bacteria | 12218 |
| 767 | Ga0495684_0018009 | 3300047471 | Bacteria | 5442 |
| 768 | Ga0495684_0033143 | 3300047471 | Bacteria | 3964 |
| 769 | Ga0495686_0000135 | 3300047472 | Bacteria | 148920 |
| 770 | Ga0495686_0012055 | 3300047472 | Bacteria | 6073 |
| 771 | Ga0495686_0020942 | 3300047472 | Bacteria | 4354 |
| 772 | Ga0495686_0026380 | 3300047472 | Bacteria | 3801 |
| 773 | Ga0495593_0000787 | 3300047673 | Bacteria | 18362 |
| 774 | Ga0495593_0003596 | 3300047673 | Bacteria | 9258 |
| 775 | Ga0495593_0006297 | 3300047673 | Bacteria | 6965 |
| 776 | Ga0495593_0006547 | 3300047673 | Bacteria | 6819 |
| 777 | Ga0495593_0008040 | 3300047673 | Bacteria | 6137 |
| 778 | Ga0495602_0019299 | 3300048088 | Bacteria | 6774 |
| 779 | Ga0495602_0049914 | 3300048088 | Bacteria | 3743 |
| 780 | Ga0495614_0000655 | 3300048089 | Bacteria | 14492 |
| 781 | Ga0495615_0000090 | 3300048090 | Bacteria | 26651 |
| 782 | Ga0495626_0000015 | 3300048091 | Bacteria | 232238 |
| 783 | Ga0495626_0002439 | 3300048091 | Bacteria | 12912 |
| 784 | Ga0495626_0005763 | 3300048091 | Bacteria | 7145 |
| 785 | Ga0495626_0012922 | 3300048091 | Bacteria | 4357 |
| 786 | Ga0495626_0023280 | 3300048091 | Bacteria | 3052 |
| 787 | Ga0495626_0052382 | 3300048091 | Bacteria | 1881 |
| 788 | Ga0495626_0055004 | 3300048091 | Bacteria | 1826 |
| 789 | Ga0495626_0114231 | 3300048091 | Bacteria | 1166 |
| 790 | Ga0496100_0171307 | 3300048903 | Bacteria | 1563 |
| 791 | Ga0496101_0062832 | 3300048904 | Bacteria | 2701 |
| 792 | Ga0496102_0000101 | 3300048905 | Bacteria | 123198 |
| 793 | Ga0496102_0000437 | 3300048905 | Bacteria | 47555 |
| 794 | Ga0496102_0076585 | 3300048905 | Bacteria | 3077 |
| 795 | Ga0496102_0106931 | 3300048905 | Bacteria | 2604 |
| 796 | Ga0496103_0013818 | 3300048906 | Bacteria | 4793 |
| 797 | Ga0496103_0033628 | 3300048906 | Bacteria | 3132 |
| 798 | Ga0496103_0035675 | 3300048906 | Bacteria | 3045 |
| 799 | Ga0496104_0013762 | 3300048907 | Bacteria | 7297 |
| 800 | Ga0496105_0039366 | 3300048908 | Bacteria | 3896 |
| 801 | Ga0496107_0094146 | 3300048910 | Bacteria | 2192 |
| 802 | Ga0496109_0015097 | 3300048912 | Bacteria | 6723 |
| 803 | Ga0496110_0000001 | 3300048913 | Bacteria | 232652 |
| 804 | Ga0496110_0042658 | 3300048913 | Bacteria | 3960 |
| 805 | Ga0496110_0193506 | 3300048913 | Bacteria | 1847 |
| 806 | Ga0496110_0337279 | 3300048913 | Bacteria | 1373 |
| 807 | Ga0496112_0021563 | 3300048915 | Bacteria | 6128 |
| 808 | Ga0496113_0000447 | 3300048916 | Bacteria | 20018 |
| 809 | Ga0496114_0016647 | 3300048917 | Bacteria | 5929 |
| 810 | Ga0496114_0047896 | 3300048917 | Bacteria | 3555 |
| 811 | Ga0496119_0042509 | 3300048922 | Bacteria | 2880 |
| 812 | Ga0496120_0001365 | 3300048923 | Bacteria | 29928 |
| 813 | Ga0496120_0021525 | 3300048923 | Bacteria | 4075 |
| 814 | Ga0496121_0070897 | 3300048924 | Bacteria | 2804 |
| 815 | Ga0496121_0137174 | 3300048924 | Bacteria | 1821 |
| 816 | Ga0496121_0139723 | 3300048924 | Bacteria | 1799 |
| 817 | Ga0496121_0194771 | 3300048924 | Bacteria | 1450 |
| 818 | Ga0496122_0001169 | 3300048925 | Bacteria | 44889 |
| 819 | Ga0496122_0004108 | 3300048925 | Bacteria | 18427 |
| 820 | Ga0496122_0050551 | 3300048925 | Bacteria | 3169 |
| 821 | Ga0496123_0001064 | 3300048926 | Bacteria | 41497 |
| 822 | Ga0496123_0004336 | 3300048926 | Bacteria | 15028 |
| 823 | Ga0496123_0007104 | 3300048926 | Bacteria | 10637 |
| 824 | Ga0496123_0147219 | 3300048926 | Bacteria | 1277 |
| 825 | Ga0496124_0005968 | 3300048927 | Bacteria | 13453 |
| 826 | Ga0496124_0007668 | 3300048927 | Bacteria | 11416 |
| 827 | Ga0496124_0026267 | 3300048927 | Bacteria | 5255 |
| 828 | Ga0496124_0041894 | 3300048927 | Bacteria | 3947 |
| 829 | Ga0496124_0085686 | 3300048927 | Bacteria | 2581 |
| 830 | Ga0496124_0286204 | 3300048927 | Bacteria | 1199 |
| 831 | Ga0496125_0011546 | 3300048928 | Bacteria | 8824 |
| 832 | Ga0496125_0189281 | 3300048928 | Bacteria | 1361 |
| 833 | Ga0496126_0002152 | 3300048929 | Bacteria | 27443 |
| 834 | Ga0496126_0024193 | 3300048929 | Bacteria | 5866 |
| 835 | Ga0496126_0042436 | 3300048929 | Bacteria | 4201 |
| 836 | Ga0496126_0088348 | 3300048929 | Bacteria | 2730 |
| 837 | Ga0496126_0097812 | 3300048929 | Bacteria | 2572 |
| 838 | Ga0496126_0102895 | 3300048929 | Bacteria | 2496 |
| 839 | Ga0496126_0206076 | 3300048929 | Bacteria | 1658 |
| 840 | Ga0496126_0365375 | 3300048929 | Bacteria | 1178 |
| 841 | Ga0495678_000071 | 3300049459 | Bacteria | 128709 |
| 842 | Ga0495678_000092 | 3300049459 | Bacteria | 114501 |
| 843 | Ga0495678_000100 | 3300049459 | Bacteria | 106118 |
| 844 | Ga0495678_000562 | 3300049459 | Bacteria | 35639 |
| 845 | Ga0495678_000574 | 3300049459 | Bacteria | 34979 |
| 846 | Ga0495678_001283 | 3300049459 | Bacteria | 20328 |
| 847 | Ga0495678_009839 | 3300049459 | Bacteria | 4694 |
| 848 | Ga0495678_029020 | 3300049459 | Bacteria | 2327 |
| 849 | Ga0495682_0000066 | 3300049460 | Bacteria | 97829 |
| 850 | Ga0495682_0006833 | 3300049460 | Bacteria | 4594 |
| 851 | Ga0495682_0015804 | 3300049460 | Bacteria | 2858 |
| 852 | Ga0501033_0012115 | 3300049570 | Bacteria | 6583 |
| 853 | Ga0501033_0025514 | 3300049570 | Bacteria | 4453 |
| 854 | Ga0501033_0141149 | 3300049570 | Bacteria | 1741 |
| 855 | Ga0501036_0001539 | 3300049572 | Bacteria | 17819 |
| 856 | Ga0501036_0017070 | 3300049572 | Bacteria | 6068 |
| 857 | Ga0501036_0019669 | 3300049572 | Bacteria | 5669 |
| 858 | Ga0501036_0051445 | 3300049572 | Bacteria | 3488 |
| 859 | Ga0501036_0097595 | 3300049572 | Bacteria | 2484 |
| 860 | Ga0501038_0000983 | 3300049574 | Bacteria | 25585 |
| 861 | Ga0501038_0001449 | 3300049574 | Bacteria | 21794 |
| 862 | Ga0501038_0117021 | 3300049574 | Bacteria | 2202 |
| 863 | Ga0501039_0000223 | 3300049575 | Bacteria | 41655 |
| 864 | Ga0501039_0027408 | 3300049575 | Bacteria | 4381 |
| 865 | Ga0501040_0000073 | 3300049576 | Bacteria | 48338 |
| 866 | Ga0501040_0087357 | 3300049576 | Bacteria | 2165 |
| 867 | Ga0501040_0106558 | 3300049576 | Bacteria | 1958 |
| 868 | Ga0501041_0008206 | 3300049577 | Bacteria | 6147 |
| 869 | Ga0501041_0009275 | 3300049577 | Bacteria | 5794 |
| 870 | Ga0501041_0065199 | 3300049577 | Bacteria | 2231 |
| 871 | Ga0501042_0000169 | 3300049578 | Bacteria | 30114 |
| 872 | Ga0501042_0008157 | 3300049578 | Bacteria | 6899 |
| 873 | Ga0501042_0065113 | 3300049578 | Bacteria | 2605 |
| 874 | Ga0501043_0000053 | 3300049579 | Bacteria | 106085 |
| 875 | Ga0501043_0099436 | 3300049579 | Bacteria | 2287 |
| 876 | Ga0501043_0279726 | 3300049579 | Bacteria | 1279 |
| 877 | Ga0501046_0000018 | 3300049580 | Bacteria | 220589 |
| 878 | Ga0501046_0037357 | 3300049580 | Bacteria | 3903 |
| 879 | Ga0501046_0038066 | 3300049580 | Bacteria | 3862 |
| 880 | Ga0501046_0161851 | 3300049580 | Bacteria | 1683 |
| 881 | Ga0501047_0000020 | 3300049581 | Bacteria | 259377 |
| 882 | Ga0501047_0053445 | 3300049581 | Bacteria | 3906 |
| 883 | Ga0501047_0142759 | 3300049581 | Bacteria | 2272 |
| 884 | Ga0501048_0000167 | 3300049582 | Bacteria | 41216 |
| 885 | Ga0501048_0005219 | 3300049582 | Bacteria | 9892 |
| 886 | Ga0501048_0010984 | 3300049582 | Bacteria | 6756 |
| 887 | Ga0501067_0065581 | 3300049583 | Bacteria | 2010 |
| 888 | Ga0501068_0016008 | 3300049584 | Bacteria | 4319 |
| 889 | Ga0501068_0216222 | 3300049584 | Bacteria | 1218 |
| 890 | Ga0501069_0132329 | 3300049585 | Bacteria | 1428 |
| 891 | Ga0501069_0169818 | 3300049585 | Bacteria | 1258 |
| 892 | Ga0501070_0006281 | 3300049586 | Bacteria | 10112 |
| 893 | Ga0501070_0056453 | 3300049586 | Bacteria | 3255 |
| 894 | Ga0501070_0090867 | 3300049586 | Bacteria | 2527 |
| 895 | Ga0501070_0247151 | 3300049586 | Bacteria | 1460 |
| 896 | Ga0501071_0000160 | 3300049587 | Bacteria | 28746 |
| 897 | Ga0501071_0059970 | 3300049587 | Bacteria | 2754 |
| 898 | Ga0501072_0000890 | 3300049588 | Bacteria | 21918 |
| 899 | Ga0501072_0000995 | 3300049588 | Bacteria | 20951 |
| 900 | Ga0501073_0084056 | 3300049589 | Bacteria | 2215 |
| 901 | Ga0501073_0216064 | 3300049589 | Bacteria | 1325 |
| 902 | Ga0501074_0006489 | 3300049590 | Bacteria | 8449 |
| 903 | Ga0501074_0032276 | 3300049590 | Bacteria | 3793 |
| 904 | Ga0501074_0062972 | 3300049590 | Bacteria | 2672 |
| 905 | Ga0501074_0117684 | 3300049590 | Bacteria | 1901 |
| 906 | Ga0501075_0000005 | 3300049591 | Bacteria | 112003 |
| 907 | Ga0501075_0000068 | 3300049591 | Bacteria | 45392 |
| 908 | Ga0501076_0000014 | 3300049592 | Bacteria | 97509 |
| 909 | Ga0501076_0000024 | 3300049592 | Bacteria | 78719 |
| 910 | Ga0501076_0014841 | 3300049592 | Bacteria | 5876 |
| 911 | Ga0501076_0204564 | 3300049592 | Bacteria | 1612 |
| 912 | Ga0501077_0000248 | 3300049593 | Bacteria | 31988 |
| 913 | Ga0501077_0016102 | 3300049593 | Bacteria | 4711 |
| 914 | Ga0501077_0037286 | 3300049593 | Bacteria | 3097 |
| 915 | Ga0501077_0044770 | 3300049593 | Bacteria | 2811 |
| 916 | Ga0501079_0000025 | 3300049741 | Bacteria | 62163 |
| 917 | Ga0501079_0014104 | 3300049741 | Bacteria | 6091 |
| 918 | Ga0501080_0001721 | 3300049742 | Bacteria | 18697 |
| 919 | Ga0501080_0021361 | 3300049742 | Bacteria | 5992 |
| 920 | Ga0501080_0083312 | 3300049742 | Bacteria | 2971 |
| 921 | Ga0501080_0121170 | 3300049742 | Bacteria | 2424 |
| 922 | Ga0501080_0413242 | 3300049742 | Bacteria | 1213 |
| 923 | Ga0501080_0448196 | 3300049742 | Bacteria | 1157 |
| 924 | Ga0501081_0000007 | 3300049743 | Bacteria | 73600 |
| 925 | Ga0501081_0013224 | 3300049743 | Bacteria | 5427 |
| 926 | Ga0501081_0022564 | 3300049743 | Bacteria | 4213 |
| 927 | Ga0501081_0105267 | 3300049743 | Bacteria | 1998 |
| 928 | Ga0501081_0138769 | 3300049743 | Bacteria | 1741 |
| 929 | Ga0501083_0008644 | 3300049744 | Bacteria | 7187 |
| 930 | Ga0501035_0013335 | 3300049822 | Bacteria | 7584 |
| 931 | Ga0501035_0105238 | 3300049822 | Bacteria | 2474 |
| 932 | Ga0501035_0118312 | 3300049822 | Bacteria | 2318 |
| 933 | Ga0501044_0001029 | 3300049823 | Bacteria | 33592 |
| 934 | Ga0501044_0099539 | 3300049823 | Bacteria | 2926 |
| 935 | Ga0501044_0255709 | 3300049823 | Bacteria | 1691 |
| 936 | Ga0501045_0000003 | 3300049824 | Bacteria | 88725 |
| 937 | Ga0501045_0002602 | 3300049824 | Bacteria | 12303 |
| 938 | Ga0501045_0024218 | 3300049824 | Bacteria | 4356 |
| 939 | Ga0501045_0030962 | 3300049824 | Bacteria | 3874 |
| 940 | Ga0501045_0229092 | 3300049824 | Bacteria | 1383 |
| 941 | nmdc:mga03n38_96369_c1 | 3300050490 | Bacteria | 1419 |
| 942 | nmdc:mga00v17_44215_c1 | 3300050491 | Bacteria | 2686 |
| 943 | nmdc:mga0k408_43237_c1 | 3300050493 | Bacteria | 2596 |
| 944 | nmdc:mga06z11_144218_c1 | 3300050494 | Bacteria | 1348 |
| 945 | nmdc:mga06z11_64616_c1 | 3300050494 | Bacteria | 1919 |
| 946 | nmdc:mga04h51_10581_c1 | 3300050495 | Bacteria | 2538 |
| 947 | nmdc:mga07m45_24707_c2 | 3300050496 | Bacteria | 1749 |
| 948 | nmdc:mga05p37_652_c1 | 3300050507 | Bacteria | 38364 |
| 949 | nmdc:mga0qj67_134453_c1 | 3300050509 | Bacteria | 2003 |
| 950 | nmdc:mga06r32_38689_c1 | 3300050510 | Bacteria | 4521 |
| 951 | nmdc:mga08y16_283407_c1 | 3300050511 | Bacteria | 1709 |
| 952 | nmdc:mga08x19_57524_c1 | 3300050514 | Bacteria | 2513 |
| 953 | nmdc:mga0sz30_43295_c1 | 3300050516 | Bacteria | 1895 |
| 954 | Ga0495601_0001429 | 3300053077 | Bacteria | 13150 |
| 955 | Ga0500643_043954 | 3300053087 | Bacteria | 1301 |
| 956 | Ga0500583_0003224 | 3300053092 | Bacteria | 5086 |
| 957 | Ga0500651_0083462 | 3300053093 | Bacteria | 1977 |
| 958 | Ga0500650_0000016 | 3300053098 | Bacteria | 70975 |
| 959 | Ga0500555_000125 | 3300053103 | Bacteria | 36635 |
| 960 | Ga0500556_0008611 | 3300053104 | Bacteria | 2947 |
| 961 | Ga0500595_044607 | 3300053119 | Bacteria | 1404 |
| 962 | Ga0500618_000187 | 3300053125 | Bacteria | 50730 |
| 963 | Ga0500658_0016231 | 3300053134 | Bacteria | 2773 |
| 964 | Ga0500568_0031391 | 3300053139 | Bacteria | 2193 |
| 965 | Ga0500588_0003016 | 3300053146 | Unclassified | 3510 |
| 966 | Ga0500604_0009644 | 3300053151 | Bacteria | 2574 |
| 967 | Ga0500616_0000085 | 3300053153 | Bacteria | 193192 |
| 968 | Ga0500616_0046502 | 3300053153 | Bacteria | 2307 |
| 969 | Ga0500645_001226 | 3300053730 | Bacteria | 13522 |
| 970 | Ga0500645_007461 | 3300053730 | Bacteria | 3805 |
| 971 | Ga0501084_0002287 | 3300054114 | Bacteria | 15381 |
| 972 | Ga0501084_0008211 | 3300054114 | Bacteria | 8613 |
| 973 | Ga0501084_0033507 | 3300054114 | Bacteria | 4297 |
| 974 | Ga0587090_005911 | 3300059510 | Bacteria | 1554 |
| 975 | Ga0501082_0000062 | 3300060353 | Bacteria | 77313 |
| 976 | Ga0501082_0023279 | 3300060353 | Bacteria | 5343 |
| 977 | Ga0501082_0154630 | 3300060353 | Bacteria | 1993 |
| 978 | Ga0530510_0000062 | 3300061734 | Bacteria | 52768 |
| 979 | Ga0530510_0000201 | 3300061734 | Bacteria | 36954 |
| 980 | Ga0530510_0093688 | 3300061734 | Bacteria | 2193 |
| 981 | Ga0530510_0217878 | 3300061734 | Bacteria | 1418 |
| 982 | 2509141272 | 2508501127 | Bacteria | 7037543 |
| 983 | 2513556885 | 2513237082 | Bacteria | 8640282 |
| 984 | 2513564892 | 2513237083 | Bacteria | 8410967 |
| 985 | 2514590420 | 2513237351 | Bacteria | 6968952 |
| 986 | 2525556280 | 2524614729 | Bacteria | 3091755 |
| 987 | 2563064119 | 2562617112 | Bacteria | 10918404 |
| 988 | 2597815495 | 2597489875 | Bacteria | 7010078 |
| 989 | 2630649510 | 2627854209 | Bacteria | 3093011 |
| 990 | 2644287921 | 2643221651 | Bacteria | 4798932 |
| 991 | 2644737527 | 2643221734 | Bacteria | 5365412 |
| 992 | 2713472393 | 2711768613 | Bacteria | 11048459 |
| 993 | 2738827981 | 2738541297 | Bacteria | 6549566 |
| 994 | 2739151777 | 2738541357 | Bacteria | 6549408 |
| 995 | 2739194202 | 2738543003 | Bacteria | 6549560 |
| 996 | 2739305704 | 2738543024 | Bacteria | 5603683 |
| 997 | 2739320173 | 2738543026 | Bacteria | 6549408 |
| 998 | 2739338919 | 2738543029 | Bacteria | 6549249 |
| 999 | 2778126350 | 2775507255 | Bacteria | 3945731 |
| 1000 | 2819553216 | 2818991438 | Bacteria | 5793701 |
| 1001 | 2821132733 | 2821131069 | Bacteria | 6108407 |
| 1002 | 2824618536 | 2824617872 | Bacteria | 8814715 |
| 1003 | 2824627249 | 2824626560 | Bacteria | 8813858 |
| 1004 | 2824635535 | 2824635225 | Bacteria | 8785348 |
| 1005 | 2824644371 | 2824644064 | Bacteria | 8743947 |
| 1006 | 2824716812 | 2824714736 | Bacteria | 8717648 |
| 1007 | 2824725500 | 2824723954 | Bacteria | 8758240 |
| 1008 | 2841735434 | 2841734538 | Bacteria | 6784580 |
| 1009 | 2852683884 | 2852680915 | Bacteria | 4100189 |
| 1010 | 2856347601 | 2856342000 | Bacteria | 7176905 |
| 1011 | 2857562065 | 2857558681 | Bacteria | 6617694 |
| 1012 | 2857566802 | 2857564685 | Bacteria | 6290584 |
| 1013 | 2869168956 | 2869162929 | Bacteria | 6399702 |
| 1014 | 2871479687 | 2871474448 | Bacteria | 6806570 |
| 1015 | 2878796705 | 2878788777 | Bacteria | 6567085 |
| 1016 | 2881414782 | 2881412998 | Bacteria | 6492157 |
| 1017 | 2883294893 | 2883291878 | Bacteria | 5894118 |
| 1018 | 2885315522 | 2885312484 | Bacteria | 6415165 |
| 1019 | 2888349398 | 2888343758 | Bacteria | 6611049 |
| 1020 | 2894023462 | 2894023352 | Bacteria | 5167372 |
| 1021 | 2900642227 | 2900634093 | Bacteria | 10263517 |
| 1022 | 2904549692 | 2904541872 | Bacteria | 8915136 |
| 1023 | 2917702878 | 2917699015 | Bacteria | 7043791 |
| 1024 | 2921650169 | 2921643360 | Bacteria | 11448031 |
| 1025 | 2924755239 | 2924754689 | Bacteria | 6774424 |
| 1026 | 2929168461 | 2929160207 | Bacteria | 9075316 |
| 1027 | 2937842251 | 2937836603 | Bacteria | 6811263 |
| 1028 | 2938021679 | 2938014810 | Bacteria | 6700592 |
| 1029 | 2958075570 | 2958071322 | Bacteria | 6815895 |
| 1030 | 2970531017 | 2970524798 | Bacteria | 6840927 |
| 1031 | 2970543282 | 2970540015 | Bacteria | 6977556 |
| 1032 | 2984567235 | 2984564862 | Bacteria | 4339992 |
| 1033 | 2996312385 | 2996310559 | Bacteria | 6357320 |
| 1034 | 8003960762 | 8003955200 | Bacteria | 8601927 |
| 1035 | 8004639505 | 8004633249 | Bacteria | 6723080 |
| 1036 | 8055228882 | 8055225921 | Bacteria | 3341787 |
| 1037 | 8055623814 | 8055617313 | Bacteria | 7548464 |
| 1038 | Ga0265325_10005792 | |||
| 1039 | JGI24736J21556_1002424 | |||
| 1040 | JGI24741J21665_1000034 | |||
| 1041 | JGI24740J21852_10000403 | |||
| 1042 | JGI24739J22299_10000059 | |||
| 1043 | JGI24737J22298_10000084 | |||
| 1044 | JGI24735J21928_10000109 | |||
| 1045 | JGI25154J39366_1001838 | |||
| 1046 | JGI25151J46595_10000030 | |||
| 1047 | JGI25406J46586_10005781 | |||
| 1048 | JGI25406J46586_10030970 | |||
| 1049 | Ga0055526_1000013 | |||
| 1050 | Ga0055526_1000019 | |||
| 1051 | Ga0055526_1000368 | |||
| 1052 | Ga0055526_1000502 | |||
| 1053 | Ga0055526_1001266 | |||
| 1054 | Ga0055537_1000159 | |||
| 1055 | Ga0055524_1000069 | |||
| 1056 | Ga0055524_1000469 | |||
| 1057 | Ga0055524_1009528 | |||
| 1058 | Ga0055534_1000045 | |||
| 1059 | Ga0055528_1000323 | |||
| 1060 | Ga0055530_10000160 | |||
| 1061 | Ga0055530_10000630 | |||
| 1062 | Ga0055540_1000173 | |||
| 1063 | Ga0055531_10005811 | |||
| 1064 | Ga0055543_1006928 | |||
| 1065 | Ga0065165_1000243 | |||
| 1066 | Ga0065707_10119488 | |||
| 1067 | Ga0070658_10049172 | |||
| 1068 | Ga0070676_10002512 | |||
| 1069 | Ga0070676_10002638 | |||
| 1070 | Ga0070676_10120668 | |||
| 1071 | Ga0070690_100164033 | |||
| 1072 | Ga0070670_100000052 | |||
| 1073 | Ga0070677_10000311 | |||
| 1074 | Ga0070666_10007951 | |||
| 1075 | Ga0070666_10009376 | |||
| 1076 | Ga0070666_10012511 | |||
| 1077 | Ga0070666_10027544 | |||
| 1078 | Ga0070682_100017170 | |||
| 1079 | Ga0068868_100003668 | |||
| 1080 | Ga0068868_100201892 | |||
| 1081 | Ga0070661_100004880 | |||
| 1082 | Ga0070668_100002357 | |||
| 1083 | Ga0070668_100049834 | |||
| 1084 | Ga0070669_100006210 | |||
| 1085 | Ga0070675_100063964 | |||
| 1086 | Ga0070671_100000043 | |||
| 1087 | Ga0070671_100021300 | |||
| 1088 | Ga0070671_100230895 | |||
| 1089 | Ga0070674_100007399 | |||
| 1090 | Ga0070667_100000021 | |||
| 1091 | Ga0070667_100005451 | |||
| 1092 | Ga0070667_100162598 | |||
| 1093 | Ga0070714_100125240 | |||
| 1094 | Ga0070711_100176618 | |||
| 1095 | Ga0070705_100093787 | |||
| 1096 | Ga0070663_100005315 | |||
| 1097 | Ga0070678_100003476 | |||
| 1098 | Ga0070662_100002384 | |||
| 1099 | Ga0070681_10000746 | |||
| 1100 | Ga0068867_100008363 | |||
| 1101 | Ga0068867_100029996 | |||
| 1102 | Ga0070685_10000002 | |||
| 1103 | Ga0070685_10020498 | |||
| 1104 | Ga0070706_100108730 | |||
| 1105 | Ga0070706_100309292 | |||
| 1106 | Ga0070707_100425834 | |||
| 1107 | Ga0070698_100066406 | |||
| 1108 | Ga0070698_100104724 | |||
| 1109 | Ga0070679_100007841 | |||
| 1110 | Ga0068853_100002265 | |||
| 1111 | Ga0068853_100035764 | |||
| 1112 | Ga0068853_100043248 | |||
| 1113 | Ga0068853_100076250 | |||
| 1114 | Ga0070672_100013917 | |||
| 1115 | Ga0070672_100064851 | |||
| 1116 | Ga0070696_100061739 | |||
| 1117 | Ga0070693_100004068 | |||
| 1118 | Ga0070665_100002758 | |||
| 1119 | Ga0070665_100012190 | |||
| 1120 | Ga0070665_100074772 | |||
| 1121 | Ga0070704_100345089 | |||
| 1122 | Ga0068855_100001912 | |||
| 1123 | Ga0068855_100078234 | |||
| 1124 | Ga0070664_100027829 | |||
| 1125 | Ga0070664_100185300 | |||
| 1126 | Ga0068857_100004902 | |||
| 1127 | Ga0068857_100270444 | |||
| 1128 | Ga0068854_100002245 | |||
| 1129 | Ga0068854_100197870 | |||
| 1130 | Ga0068856_100002241 | |||
| 1131 | Ga0068852_100002292 | |||
| 1132 | Ga0068859_100011410 | |||
| 1133 | Ga0068859_100152228 | |||
| 1134 | Ga0068859_100215222 | |||
| 1135 | Ga0068864_100000219 | |||
| 1136 | Ga0068864_100170677 | |||
| 1137 | Ga0068861_100022703 | |||
| 1138 | Ga0068861_100047335 | |||
| 1139 | Ga0068861_100126034 | |||
| 1140 | Ga0068851_10002958 | |||
| 1141 | Ga0068851_10094263 | |||
| 1142 | Ga0068863_100008937 | |||
| 1143 | Ga0068863_100039472 | |||
| 1144 | Ga0068863_100066373 | |||
| 1145 | Ga0068863_100093670 | |||
| 1146 | Ga0068858_100056739 | |||
| 1147 | Ga0068858_100402127 | |||
| 1148 | Ga0068860_100000015 | |||
| 1149 | Ga0068860_100001564 | |||
| 1150 | Ga0068860_100051949 | |||
| 1151 | Ga0068860_100133889 | |||
| 1152 | Ga0068860_100146437 | |||
| 1153 | Ga0068862_100001673 | |||
| 1154 | Ga0068862_100006372 | |||
| 1155 | Ga0068862_100088433 | |||
| 1156 | Ga0068862_100120093 | |||
| 1157 | Ga0081455_10000391 | |||
| 1158 | Ga0081540_1003425 | |||
| 1159 | Ga0081539_10000203 | |||
| 1160 | Ga0081539_10000316 | |||
| 1161 | Ga0075368_10052603 | |||
| 1162 | Ga0075363_100000506 | |||
| 1163 | Ga0075363_100053469 | |||
| 1164 | Ga0075363_100057444 | |||
| 1165 | Ga0075362_10013292 | |||
| 1166 | Ga0075367_10048860 | |||
| 1167 | Ga0075369_10019359 | |||
| 1168 | Ga0075366_10120826 | |||
| 1169 | Ga0097621_100028254 | |||
| 1170 | Ga0075370_10025155 | |||
| 1171 | Ga0075428_100169101 | |||
| 1172 | Ga0075431_100032041 | |||
| 1173 | Ga0075431_100033531 | |||
| 1174 | Ga0075431_100138743 | |||
| 1175 | Ga0075429_100058235 | |||
| 1176 | Ga0068865_100041090 | |||
| 1177 | Ga0097620_100011410 | |||
| 1178 | Ga0097620_100152237 | |||
| 1179 | Ga0097620_100215225 | |||
| 1180 | Ga0079104_1000294 | |||
| 1181 | Ga0075435_100147607 | |||
| 1182 | Ga0099794_10000703 | |||
| 1183 | Ga0099794_10023616 | |||
| 1184 | Ga0099795_10002134 | |||
| 1185 | Ga0099795_10038661 | |||
| 1186 | Ga0105244_10004592 | |||
| 1187 | Ga0105240_10009713 | |||
| 1188 | Ga0105240_10017325 | |||
| 1189 | Ga0105240_10021363 | |||
| 1190 | Ga0105240_10080085 | |||
| 1191 | Ga0111539_10130613 | |||
| 1192 | Ga0111539_10150922 | |||
| 1193 | Ga0111539_10226551 | |||
| 1194 | Ga0105245_10001099 | |||
| 1195 | Ga0105247_10026286 | |||
| 1196 | Ga0114129_10000523 | |||
| 1197 | Ga0105243_10000293 | |||
| 1198 | Ga0105241_10014586 | |||
| 1199 | Ga0105248_10000851 | |||
| 1200 | Ga0105248_10022168 | |||
| 1201 | Ga0105248_10096218 | |||
| 1202 | Ga0105248_10123808 | |||
| 1203 | Ga0105237_10053764 | |||
| 1204 | Ga0105237_10196031 | |||
| 1205 | Ga0105237_10235451 | |||
| 1206 | Ga0105238_10000493 | |||
| 1207 | Ga0105238_10006619 | |||
| 1208 | Ga0105249_10018235 | |||
| 1209 | Ga0105249_10031571 | |||
| 1210 | Ga0105249_10070334 | |||
| 1211 | Ga0105249_10306810 | |||
| 1212 | Ga0099796_10000651 | |||
| 1213 | Ga0105239_10055846 | |||
| 1214 | Ga0157373_10044194 | |||
| 1215 | Ga0157371_10004600 | |||
| 1216 | Ga0157370_10124958 | |||
| 1217 | Ga0157369_10026347 | |||
| 1218 | Ga0171462_1013 | |||
| 1219 | Ga0157378_10009277 | |||
| 1220 | Ga0157378_10175857 | |||
| 1221 | Ga0163162_10234112 | |||
| 1222 | Ga0157372_10072967 | |||
| 1223 | Ga0157375_10005737 | |||
| 1224 | Ga0157375_10051189 | |||
| 1225 | Ga0157375_10404997 | |||
| 1226 | Ga0163163_10004461 | |||
| 1227 | Ga0182008_10124288 | |||
| 1228 | Ga0157379_10157466 | |||
| 1229 | Ga0157379_10297689 | |||
| 1230 | Ga0157379_10409934 | |||
| 1231 | Ga0157376_10132038 | |||
| 1232 | Ga0157376_10270986 | |||
| 1233 | Ga0183361_10003 | |||
| 1234 | Ga0163161_10037715 | |||
| 1235 | Ga0213872_10000019 | |||
| 1236 | Ga0213872_10001794 | |||
| 1237 | Ga0213872_10003169 | |||
| 1238 | Ga0213874_10024099 | |||
| 1239 | Ga0213874_10038923 | |||
| 1240 | Ga0213876_10000611 | |||
| 1241 | Ga0213875_10001414 | |||
| 1242 | Ga0213875_10003941 | |||
| 1243 | Ga0213875_10007514 | |||
| 1244 | Ga0209437_103668 | |||
| 1245 | Ga0209646_1000007 | |||
| 1246 | Ga0209565_1000003 | |||
| 1247 | Ga0209673_1000003 | |||
| 1248 | Ga0209675_1000003 | |||
| 1249 | Ga0209675_1000909 | |||
| 1250 | Ga0209675_1016544 | |||
| 1251 | Ga0209676_1000267 | |||
| 1252 | Ga0209025_1000063 | |||
| 1253 | Ga0209564_1000002 | |||
| 1254 | Ga0209564_1000007 | |||
| 1255 | Ga0209564_1000012 | |||
| 1256 | Ga0209564_1000043 | |||
| 1257 | Ga0209564_1000052 | |||
| 1258 | Ga0209050_1000915 | |||
| 1259 | Ga0209050_1000916 | |||
| 1260 | Ga0209050_1010784 | |||
| 1261 | Ga0209256_1000036 | |||
| 1262 | Ga0209256_1000172 | |||
| 1263 | Ga0209256_1000697 | |||
| 1264 | Ga0209051_1000230 | |||
| 1265 | Ga0209051_1000379 | |||
| 1266 | Ga0209257_1000141 | |||
| 1267 | Ga0209257_1000676 | |||
| 1268 | Ga0209257_1028785 | |||
| 1269 | Ga0207656_10010386 | |||
| 1270 | Ga0207656_10066613 | |||
| 1271 | Ga0207682_10000061 | |||
| 1272 | Ga0207642_10116554 | |||
| 1273 | Ga0207710_10150175 | |||
| 1274 | Ga0207680_10000489 | |||
| 1275 | Ga0207680_10031077 | |||
| 1276 | Ga0207680_10107901 | |||
| 1277 | Ga0207647_10000817 | |||
| 1278 | Ga0207645_10003267 | |||
| 1279 | Ga0207645_10036693 | |||
| 1280 | Ga0207643_10015602 | |||
| 1281 | Ga0207705_10072679 | |||
| 1282 | Ga0207684_10068853 | |||
| 1283 | Ga0207684_10263923 | |||
| 1284 | Ga0207695_10037969 | |||
| 1285 | Ga0207695_10067720 | |||
| 1286 | Ga0207695_10068557 | |||
| 1287 | Ga0207662_10081503 | |||
| 1288 | Ga0207649_10020345 | |||
| 1289 | Ga0207681_10007036 | |||
| 1290 | Ga0207681_10075811 | |||
| 1291 | Ga0207694_10000397 | |||
| 1292 | Ga0207694_10063477 | |||
| 1293 | Ga0207650_10000002 | |||
| 1294 | Ga0207650_10060737 | |||
| 1295 | Ga0207659_10146894 | |||
| 1296 | Ga0207659_10163884 | |||
| 1297 | Ga0207687_10002035 | |||
| 1298 | Ga0207644_10000372 | |||
| 1299 | Ga0207644_10005509 | |||
| 1300 | Ga0207644_10039648 | |||
| 1301 | Ga0207644_10089089 | |||
| 1302 | Ga0207706_10000744 | |||
| 1303 | Ga0207706_10009544 | |||
| 1304 | Ga0207706_10042045 | |||
| 1305 | Ga0207706_10231483 | |||
| 1306 | Ga0207706_10279438 | |||
| 1307 | Ga0207709_10000076 | |||
| 1308 | Ga0207704_10052278 | |||
| 1309 | Ga0207691_10000016 | |||
| 1310 | Ga0207691_10024116 | |||
| 1311 | Ga0207711_10002050 | |||
| 1312 | Ga0207711_10003955 | |||
| 1313 | Ga0207689_10105939 | |||
| 1314 | Ga0207679_10088532 | |||
| 1315 | Ga0207679_10137793 | |||
| 1316 | Ga0207667_10051563 | |||
| 1317 | Ga0207667_10098298 | |||
| 1318 | Ga0207651_10029503 | |||
| 1319 | Ga0207712_10019361 | |||
| 1320 | Ga0207712_10026403 | |||
| 1321 | Ga0207668_10010412 | |||
| 1322 | Ga0207668_10049405 | |||
| 1323 | Ga0207640_10065584 | |||
| 1324 | Ga0207658_10000001 | |||
| 1325 | Ga0207658_10001061 | |||
| 1326 | Ga0207658_10005073 | |||
| 1327 | Ga0207658_10025287 | |||
| 1328 | Ga0207658_10130949 | |||
| 1329 | Ga0207658_10361965 | |||
| 1330 | Ga0207703_10067840 | |||
| 1331 | Ga0207703_10092071 | |||
| 1332 | Ga0207639_10000632 | |||
| 1333 | Ga0207639_10037373 | |||
| 1334 | Ga0207639_10061248 | |||
| 1335 | Ga0207639_10062057 | |||
| 1336 | Ga0207678_10000914 | |||
| 1337 | Ga0207678_10013650 | |||
| 1338 | Ga0207702_10001373 | |||
| 1339 | Ga0207702_10020598 | |||
| 1340 | Ga0207641_10008740 | |||
| 1341 | Ga0207641_10050012 | |||
| 1342 | Ga0207641_10224594 | |||
| 1343 | Ga0207648_10004401 | |||
| 1344 | Ga0207648_10005187 | |||
| 1345 | Ga0207676_10000001 | |||
| 1346 | Ga0207676_10014847 | |||
| 1347 | Ga0207676_10181994 | |||
| 1348 | Ga0207676_10208096 | |||
| 1349 | Ga0207676_10395469 | |||
| 1350 | Ga0207674_10001538 | |||
| 1351 | Ga0207674_10021564 | |||
| 1352 | Ga0207675_100039056 | |||
| 1353 | Ga0207675_100056394 | |||
| 1354 | Ga0207675_100160883 | |||
| 1355 | Ga0207683_10000322 | |||
| 1356 | Ga0207683_10175467 | |||
| 1357 | Ga0209281_1000423 | |||
| 1358 | Ga0209179_1000828 | |||
| 1359 | Ga0268266_10007343 | |||
| 1360 | Ga0268266_10009218 | |||
| 1361 | Ga0268266_10013731 | |||
| 1362 | Ga0268266_10023392 | |||
| 1363 | Ga0268266_10121103 | |||
| 1364 | Ga0268265_10083838 | |||
| 1365 | Ga0268265_10084293 | |||
| 1366 | Ga0268265_10356246 | |||
| 1367 | Ga0268264_10000002 | |||
| 1368 | Ga0268264_10000004 | |||
| 1369 | Ga0268264_10000014 | |||
| 1370 | Ga0268264_10009680 | |||
| 1371 | Ga0268264_10042701 | |||
| 1372 | Ga0307515_10000006 | |||
| 1373 | Ga0307515_10063025 | |||
| 1374 | Ga0307511_10000025 | |||
| 1375 | Ga0316177_1212761 | |||
| 1376 | Ga0265340_10144815 | |||
| 1377 | Ga0265339_10010596 | |||
| 1378 | Ga0265327_10001131 | |||
| 1379 | Ga0265327_10008872 | |||
| 1380 | Ga0265327_10010715 | |||
| 1381 | Ga0307408_100060395 | |||
| 1382 | Ga0307408_100075499 | |||
| 1383 | Ga0265313_10040486 | |||
| 1384 | Ga0265314_10029756 | |||
| 1385 | Ga0316576_10124408 | |||
| 1386 | Ga0316576_10267391 | |||
| 1387 | Ga0316578_10053225 | |||
| 1388 | Ga0307516_10046623 | |||
| 1389 | Ga0307405_10033113 | |||
| 1390 | Ga0307405_10140183 | |||
| 1391 | Ga0316577_10019978 | |||
| 1392 | Ga0307413_10110899 | |||
| 1393 | Ga0307518_10222053 | |||
| 1394 | Ga0307410_10137388 | |||
| 1395 | Ga0307410_10173092 | |||
| 1396 | Ga0307406_10012195 | |||
| 1397 | Ga0307406_10091859 | |||
| 1398 | Ga0307407_10005506 | |||
| 1399 | Ga0307412_10024218 | |||
| 1400 | Ga0307412_10168454 | |||
| 1401 | Ga0307409_100005750 | |||
| 1402 | Ga0307414_10026730 | |||
| 1403 | Ga0307414_10094848 | |||
| 1404 | Ga0307415_100273674 | |||
| 1405 | Ga0307507_10035925 | |||
| 1406 | Ga0307510_10001839 | |||
| 1407 | Ga0307510_10039902 | |||
| 1408 | Ga0307510_10202941 | |||
| 1409 | Ga0373926_0014404 | |||
| 1410 | Ga0373923_0009335 | |||
| 1411 | Ga0373936_0017021 | |||
| 1412 | Ga0373936_0068214 | |||
| 1413 | Ga0373945_0026017 | |||
| 1414 | Ga0373943_0003641 | |||
| 1415 | Ga0373946_0002251 | |||
| 1416 | Ga0373946_0007659 | |||
| 1417 | Ga0373955_0040066 | |||
| 1418 | Ga0373924_0039566 | |||
| 1419 | Ga0373931_0016354 | |||
| 1420 | Ga0373935_0004899 | |||
| 1421 | Ga0373935_0019897 | |||
| 1422 | Ga0373935_0056067 | |||
| 1423 | Ga0373927_0002255 | |||
| 1424 | Ga0373927_0002256 | |||
| 1425 | Ga0373947_0001432 | |||
| 1426 | Ga0373947_0204067 | |||
| 1427 | Ga0316584_0016657 | |||
| 1428 | Ga0373925_0000104 | |||
| 1429 | Ga0373925_0000976 | |||
| 1430 | Ga0373925_0075408 | |||
| 1431 | Ga0395899_0000361 | |||
| 1432 | Ga0395899_0013123 | |||
| 1433 | Ga0395899_0262044 | |||
| 1434 | Ga0395900_0000046 | |||
| 1435 | Ga0395900_0000237 | |||
| 1436 | Ga0395900_0064772 | |||
| 1437 | Ga0395900_0166403 | |||
| 1438 | Ga0395900_0190827 | |||
| 1439 | Ga0395900_0296593 | |||
| 1440 | Ga0395905_0000498 | |||
| 1441 | Ga0395905_0087405 | |||
| 1442 | Ga0395905_0124786 | |||
| 1443 | Ga0395905_0167522 | |||
| 1444 | Ga0395905_0173861 | |||
| 1445 | Ga0395905_0187495 | |||
| 1446 | Ga0395905_0315121 | |||
| 1447 | Ga0436364_0473640 | |||
| 1448 | Ga0436364_0563933 | |||
| 1449 | Ga0436364_0786035 | |||
| 1450 | Ga0436364_0804800 | |||
| 1451 | Ga0395901_0000028 | |||
| 1452 | Ga0395901_0100110 | |||
| 1453 | Ga0395901_0452827 | |||
| 1454 | Ga0400483_068090 | |||
| 1455 | Ga0436365_1595143 | |||
| 1456 | Ga0436360_0787362 | |||
| 1457 | Ga0436361_0075382 | |||
| 1458 | Ga0436361_0330198 | |||
| 1459 | Ga0436361_0352948 | |||
| 1460 | Ga0436361_0635819 | |||
| 1461 | Ga0436361_1127083 | |||
| 1462 | Ga0436363_0240244 | |||
| 1463 | Ga0436363_1348059 | |||
| 1464 | Ga0439441_005803 | |||
| 1465 | Ga0439449_0054328 | |||
| 1466 | Ga0450904_000658 | |||
| 1467 | Ga0451577_0001960 | |||
| 1468 | Ga0451577_0034963 | |||
| 1469 | Ga0451577_0040418 | |||
| 1470 | Ga0453683_0262854 | |||
| 1471 | Ga0466965_0112314 | |||
| 1472 | Ga0466966_0002584 | |||
| 1473 | Ga0451576_0000025 | |||
| 1474 | Ga0495617_000060 | |||
| 1475 | Ga0495617_000072 | |||
| 1476 | Ga0495617_018523 | |||
| 1477 | Ga0495627_000272 | |||
| 1478 | Ga0495627_000489 | |||
| 1479 | Ga0495603_0069937 | |||
| 1480 | Ga0495603_0125092 | |||
| 1481 | Ga0495590_0000005 | |||
| 1482 | Ga0495590_0000008 | |||
| 1483 | Ga0495590_0000424 | |||
| 1484 | Ga0495590_0000562 | |||
| 1485 | Ga0495590_0010969 | |||
| 1486 | Ga0495591_000051 | |||
| 1487 | Ga0495629_0000365 | |||
| 1488 | Ga0495629_0027120 | |||
| 1489 | Ga0495629_0055488 | |||
| 1490 | Ga0495629_0067560 | |||
| 1491 | Ga0495638_0000027 | |||
| 1492 | Ga0495638_0001965 | |||
| 1493 | Ga0495638_0003652 | |||
| 1494 | Ga0495641_0045723 | |||
| 1495 | Ga0495653_0000880 | |||
| 1496 | Ga0495653_0008489 | |||
| 1497 | Ga0495653_0009298 | |||
| 1498 | Ga0495653_0015205 | |||
| 1499 | Ga0495653_0136800 | |||
| 1500 | Ga0495653_0189182 | |||
| 1501 | Ga0495650_0000044 | |||
| 1502 | Ga0495650_0000185 | |||
| 1503 | Ga0495650_0000323 | |||
| 1504 | Ga0495650_0002258 | |||
| 1505 | Ga0495650_0003969 | |||
| 1506 | Ga0495650_0005067 | |||
| 1507 | Ga0495650_0055439 | |||
| 1508 | Ga0495580_0003410 | |||
| 1509 | Ga0495580_0006376 | |||
| 1510 | Ga0495582_0090689 | |||
| 1511 | Ga0495605_0000049 | |||
| 1512 | Ga0495605_0017778 | |||
| 1513 | Ga0495605_0019852 | |||
| 1514 | Ga0495639_0006411 | |||
| 1515 | Ga0495662_0067417 | |||
| 1516 | Ga0495664_0002204 | |||
| 1517 | Ga0495664_0028490 | |||
| 1518 | Ga0495584_0000001 | |||
| 1519 | Ga0495584_0000024 | |||
| 1520 | Ga0495584_0001263 | |||
| 1521 | Ga0495584_0003873 | |||
| 1522 | Ga0495584_0009495 | |||
| 1523 | Ga0495585_0000040 | |||
| 1524 | Ga0495585_0002248 | |||
| 1525 | Ga0495585_0002439 | |||
| 1526 | Ga0495585_0036912 | |||
| 1527 | Ga0495585_0039002 | |||
| 1528 | Ga0495585_0059017 | |||
| 1529 | Ga0495585_0122419 | |||
| 1530 | Ga0495594_0046635 | |||
| 1531 | Ga0495594_0097782 | |||
| 1532 | Ga0495596_0000714 | |||
| 1533 | Ga0495596_0001374 | |||
| 1534 | Ga0495596_0008634 | |||
| 1535 | Ga0495596_0010135 | |||
| 1536 | Ga0495596_0010676 | |||
| 1537 | Ga0495596_0012118 | |||
| 1538 | Ga0495596_0037335 | |||
| 1539 | Ga0495607_0000473 | |||
| 1540 | Ga0495607_0000984 | |||
| 1541 | Ga0495607_0003885 | |||
| 1542 | Ga0495607_0031534 | |||
| 1543 | Ga0495607_0055116 | |||
| 1544 | Ga0495607_0064406 | |||
| 1545 | Ga0495583_0000055 | |||
| 1546 | Ga0495583_0000100 | |||
| 1547 | Ga0495583_0000117 | |||
| 1548 | Ga0495583_0000314 | |||
| 1549 | Ga0495583_0000792 | |||
| 1550 | Ga0495583_0001305 | |||
| 1551 | Ga0495583_0003790 | |||
| 1552 | Ga0495583_0036350 | |||
| 1553 | Ga0495583_0038279 | |||
| 1554 | Ga0495583_0039360 | |||
| 1555 | Ga0495606_0000053 | |||
| 1556 | Ga0495606_0000059 | |||
| 1557 | Ga0495606_0004757 | |||
| 1558 | Ga0495606_0008214 | |||
| 1559 | Ga0495606_0013949 | |||
| 1560 | Ga0495606_0019668 | |||
| 1561 | Ga0495606_0044306 | |||
| 1562 | Ga0495606_0075230 | |||
| 1563 | Ga0495606_0117201 | |||
| 1564 | Ga0495606_0125542 | |||
| 1565 | Ga0495610_0000008 | |||
| 1566 | Ga0495610_0000556 | |||
| 1567 | Ga0495610_0000771 | |||
| 1568 | Ga0495610_0002195 | |||
| 1569 | Ga0495610_0007885 | |||
| 1570 | Ga0495610_0022630 | |||
| 1571 | Ga0495610_0039922 | |||
| 1572 | Ga0495616_0000035 | |||
| 1573 | Ga0495616_0000080 | |||
| 1574 | Ga0495616_0003689 | |||
| 1575 | Ga0495616_0011085 | |||
| 1576 | Ga0495616_0011853 | |||
| 1577 | Ga0495616_0023409 | |||
| 1578 | Ga0495616_0035134 | |||
| 1579 | Ga0495618_0080682 | |||
| 1580 | Ga0495620_0000351 | |||
| 1581 | Ga0495628_0003503 | |||
| 1582 | Ga0495628_0028044 | |||
| 1583 | Ga0495630_0002597 | |||
| 1584 | Ga0495630_0074389 | |||
| 1585 | Ga0495630_0084314 | |||
| 1586 | Ga0495631_0003168 | |||
| 1587 | Ga0495631_0008273 | |||
| 1588 | Ga0495631_0011965 | |||
| 1589 | Ga0495631_0018765 | |||
| 1590 | Ga0495631_0019353 | |||
| 1591 | Ga0495631_0026730 | |||
| 1592 | Ga0495631_0026941 | |||
| 1593 | Ga0495631_0036889 | |||
| 1594 | Ga0495632_0000044 | |||
| 1595 | Ga0495632_0000066 | |||
| 1596 | Ga0495632_0000285 | |||
| 1597 | Ga0495632_0011220 | |||
| 1598 | Ga0495632_0095856 | |||
| 1599 | Ga0495637_0000009 | |||
| 1600 | Ga0495637_0000189 | |||
| 1601 | Ga0495637_0007240 | |||
| 1602 | Ga0495637_0009788 | |||
| 1603 | Ga0495643_0000022 | |||
| 1604 | Ga0495643_0000094 | |||
| 1605 | Ga0495643_0026589 | |||
| 1606 | Ga0495643_0056149 | |||
| 1607 | Ga0495643_0065384 | |||
| 1608 | Ga0495644_0006445 | |||
| 1609 | Ga0495644_0007635 | |||
| 1610 | Ga0495644_0010658 | |||
| 1611 | Ga0495644_0011124 | |||
| 1612 | Ga0495648_0000411 | |||
| 1613 | Ga0495648_0001558 | |||
| 1614 | Ga0495648_0005347 | |||
| 1615 | Ga0495648_0019087 | |||
| 1616 | Ga0495648_0021267 | |||
| 1617 | Ga0495648_0025112 | |||
| 1618 | Ga0495648_0032359 | |||
| 1619 | Ga0495648_0045189 | |||
| 1620 | Ga0495648_0063905 | |||
| 1621 | Ga0495663_0004172 | |||
| 1622 | Ga0495663_0022815 | |||
| 1623 | Ga0495663_0035034 | |||
| 1624 | Ga0495666_0004909 | |||
| 1625 | Ga0495666_0007197 | |||
| 1626 | Ga0495666_0017775 | |||
| 1627 | Ga0495642_0000012 | |||
| 1628 | Ga0495642_0002273 | |||
| 1629 | Ga0495642_0014066 | |||
| 1630 | Ga0495642_0016372 | |||
| 1631 | Ga0495642_0018803 | |||
| 1632 | Ga0495642_0109106 | |||
| 1633 | Ga0495652_0018714 | |||
| 1634 | Ga0495652_0020109 | |||
| 1635 | Ga0495652_0030202 | |||
| 1636 | Ga0495654_0000002 | |||
| 1637 | Ga0495654_0011218 | |||
| 1638 | Ga0495654_0061171 | |||
| 1639 | Ga0495665_0000097 | |||
| 1640 | Ga0495665_0015244 | |||
| 1641 | Ga0495665_0065446 | |||
| 1642 | Ga0495665_0125272 | |||
| 1643 | Ga0495665_0146228 | |||
| 1644 | Ga0495640_0002599 | |||
| 1645 | Ga0495640_0064218 | |||
| 1646 | Ga0495586_0003981 | |||
| 1647 | Ga0495587_0016570 | |||
| 1648 | Ga0495587_0026273 | |||
| 1649 | Ga0495609_0000177 | |||
| 1650 | Ga0495609_0000981 | |||
| 1651 | Ga0495609_0001757 | |||
| 1652 | Ga0495609_0008006 | |||
| 1653 | Ga0495609_0021747 | |||
| 1654 | Ga0495609_0079108 | |||
| 1655 | Ga0495597_0000009 | |||
| 1656 | Ga0495597_0000055 | |||
| 1657 | Ga0495597_0000672 | |||
| 1658 | Ga0495597_0005908 | |||
| 1659 | Ga0495597_0011159 | |||
| 1660 | Ga0495597_0015727 | |||
| 1661 | Ga0495597_0016538 | |||
| 1662 | Ga0495645_0002089 | |||
| 1663 | Ga0495645_0019718 | |||
| 1664 | Ga0495645_0039510 | |||
| 1665 | Ga0495622_0000009 | |||
| 1666 | Ga0495622_0000128 | |||
| 1667 | Ga0495633_0000050 | |||
| 1668 | Ga0495633_0012260 | |||
| 1669 | Ga0495633_0030058 | |||
| 1670 | Ga0495633_0057903 | |||
| 1671 | Ga0495633_0073416 | |||
| 1672 | Ga0495667_0103145 | |||
| 1673 | Ga0495656_0014920 | |||
| 1674 | Ga0495668_0000006 | |||
| 1675 | Ga0495668_0000027 | |||
| 1676 | Ga0495668_0000350 | |||
| 1677 | Ga0495668_0000353 | |||
| 1678 | Ga0495668_0001625 | |||
| 1679 | Ga0495668_0007466 | |||
| 1680 | Ga0495668_0023465 | |||
| 1681 | Ga0495668_0063250 | |||
| 1682 | Ga0495668_0082766 | |||
| 1683 | Ga0495668_0105224 | |||
| 1684 | Ga0495634_0014394 | |||
| 1685 | Ga0495634_0079051 | |||
| 1686 | Ga0495611_0000311 | |||
| 1687 | Ga0495611_0007917 | |||
| 1688 | Ga0495611_0027492 | |||
| 1689 | Ga0495611_0039772 | |||
| 1690 | Ga0495611_0041086 | |||
| 1691 | Ga0495625_0003531 | |||
| 1692 | Ga0495625_0005763 | |||
| 1693 | Ga0495625_0014914 | |||
| 1694 | Ga0495625_0039909 | |||
| 1695 | Ga0495625_0149651 | |||
| 1696 | Ga0495625_0238049 | |||
| 1697 | Ga0495659_0009489 | |||
| 1698 | Ga0495661_0000531 | |||
| 1699 | Ga0495661_0033987 | |||
| 1700 | Ga0495661_0036495 | |||
| 1701 | Ga0495661_0051487 | |||
| 1702 | Ga0495661_0065344 | |||
| 1703 | Ga0495661_0075402 | |||
| 1704 | Ga0495661_0086346 | |||
| 1705 | Ga0495661_0181877 | |||
| 1706 | Ga0495588_0029914 | |||
| 1707 | Ga0495588_0062678 | |||
| 1708 | Ga0495588_0091777 | |||
| 1709 | Ga0495599_0066007 | |||
| 1710 | Ga0495623_0003969 | |||
| 1711 | Ga0495646_0006689 | |||
| 1712 | Ga0495647_0021282 | |||
| 1713 | Ga0495647_0064955 | |||
| 1714 | Ga0495669_0000017 | |||
| 1715 | Ga0495669_0005081 | |||
| 1716 | Ga0495669_0017390 | |||
| 1717 | Ga0495669_0024204 | |||
| 1718 | Ga0495669_0076352 | |||
| 1719 | Ga0495613_0038721 | |||
| 1720 | Ga0495613_0086690 | |||
| 1721 | Ga0495624_0000316 | |||
| 1722 | Ga0495624_0004924 | |||
| 1723 | Ga0495624_0015579 | |||
| 1724 | Ga0495624_0054496 | |||
| 1725 | Ga0495670_0008894 | |||
| 1726 | Ga0495670_0020761 | |||
| 1727 | Ga0495670_0023483 | |||
| 1728 | Ga0495670_0025810 | |||
| 1729 | Ga0495671_0000002 | |||
| 1730 | Ga0495671_0000469 | |||
| 1731 | Ga0495671_0013575 | |||
| 1732 | Ga0495649_0000546 | |||
| 1733 | Ga0495649_0020472 | |||
| 1734 | Ga0495649_0024363 | |||
| 1735 | Ga0495649_0026329 | |||
| 1736 | Ga0495649_0075244 | |||
| 1737 | Ga0495589_0000102 | |||
| 1738 | Ga0495589_0001114 | |||
| 1739 | Ga0495589_0016132 | |||
| 1740 | Ga0495589_0080051 | |||
| 1741 | Ga0495589_0080682 | |||
| 1742 | Ga0495589_0100900 | |||
| 1743 | Ga0495660_0003891 | |||
| 1744 | Ga0495660_0019284 | |||
| 1745 | Ga0495660_0020441 | |||
| 1746 | Ga0495660_0043022 | |||
| 1747 | Ga0495660_0070542 | |||
| 1748 | Ga0495581_0002330 | |||
| 1749 | Ga0495581_0006456 | |||
| 1750 | Ga0495581_0027224 | |||
| 1751 | Ga0495604_0012826 | |||
| 1752 | Ga0495604_0062580 | |||
| 1753 | Ga0495604_0090387 | |||
| 1754 | Ga0495636_0037515 | |||
| 1755 | Ga0495636_0112751 | |||
| 1756 | Ga0495674_0000923 | |||
| 1757 | Ga0495674_0003405 | |||
| 1758 | Ga0495674_0007608 | |||
| 1759 | Ga0495674_0012637 | |||
| 1760 | Ga0495674_0163125 | |||
| 1761 | Ga0495674_0193456 | |||
| 1762 | Ga0495672_0000131 | |||
| 1763 | Ga0495672_0000290 | |||
| 1764 | Ga0495672_0000738 | |||
| 1765 | Ga0495672_0001642 | |||
| 1766 | Ga0495672_0025534 | |||
| 1767 | Ga0495672_0087181 | |||
| 1768 | Ga0495676_0044397 | |||
| 1769 | Ga0495676_0135153 | |||
| 1770 | Ga0495680_0001842 | |||
| 1771 | Ga0495680_0006432 | |||
| 1772 | Ga0495680_0035667 | |||
| 1773 | Ga0495683_0000160 | |||
| 1774 | Ga0495683_0071165 | |||
| 1775 | Ga0495683_0104951 | |||
| 1776 | Ga0495687_000034 | |||
| 1777 | Ga0495687_000048 | |||
| 1778 | Ga0495687_000550 | |||
| 1779 | Ga0495687_001509 | |||
| 1780 | Ga0495687_005005 | |||
| 1781 | Ga0495675_0004046 | |||
| 1782 | Ga0495677_0000085 | |||
| 1783 | Ga0495677_0004620 | |||
| 1784 | Ga0495677_0005820 | |||
| 1785 | Ga0495677_0024761 | |||
| 1786 | Ga0495677_0035575 | |||
| 1787 | Ga0495677_0036393 | |||
| 1788 | Ga0495677_0057661 | |||
| 1789 | Ga0495677_0067032 | |||
| 1790 | Ga0495679_011256 | |||
| 1791 | Ga0495679_024963 | |||
| 1792 | Ga0495685_002522 | |||
| 1793 | Ga0495685_012896 | |||
| 1794 | Ga0495685_046097 | |||
| 1795 | Ga0495685_048914 | |||
| 1796 | Ga0495673_0000005 | |||
| 1797 | Ga0495673_0000059 | |||
| 1798 | Ga0495673_0000067 | |||
| 1799 | Ga0495673_0011100 | |||
| 1800 | Ga0495681_0000269 | |||
| 1801 | Ga0495681_0002027 | |||
| 1802 | Ga0495681_0073047 | |||
| 1803 | Ga0495684_0003539 | |||
| 1804 | Ga0495684_0018009 | |||
| 1805 | Ga0495684_0033143 | |||
| 1806 | Ga0495686_0000135 | |||
| 1807 | Ga0495686_0012055 | |||
| 1808 | Ga0495686_0020942 | |||
| 1809 | Ga0495686_0026380 | |||
| 1810 | Ga0495593_0000787 | |||
| 1811 | Ga0495593_0003596 | |||
| 1812 | Ga0495593_0006297 | |||
| 1813 | Ga0495593_0006547 | |||
| 1814 | Ga0495593_0008040 | |||
| 1815 | Ga0495602_0019299 | |||
| 1816 | Ga0495602_0049914 | |||
| 1817 | Ga0495614_0000655 | |||
| 1818 | Ga0495615_0000090 | |||
| 1819 | Ga0495626_0000015 | |||
| 1820 | Ga0495626_0002439 | |||
| 1821 | Ga0495626_0005763 | |||
| 1822 | Ga0495626_0012922 | |||
| 1823 | Ga0495626_0023280 | |||
| 1824 | Ga0495626_0052382 | |||
| 1825 | Ga0495626_0055004 | |||
| 1826 | Ga0495626_0114231 | |||
| 1827 | Ga0496100_0171307 | |||
| 1828 | Ga0496101_0062832 | |||
| 1829 | Ga0496102_0000101 | |||
| 1830 | Ga0496102_0000437 | |||
| 1831 | Ga0496102_0076585 | |||
| 1832 | Ga0496102_0106931 | |||
| 1833 | Ga0496103_0013818 | |||
| 1834 | Ga0496103_0033628 | |||
| 1835 | Ga0496103_0035675 | |||
| 1836 | Ga0496104_0013762 | |||
| 1837 | Ga0496105_0039366 | |||
| 1838 | Ga0496107_0094146 | |||
| 1839 | Ga0496109_0015097 | |||
| 1840 | Ga0496110_0000001 | |||
| 1841 | Ga0496110_0042658 | |||
| 1842 | Ga0496110_0193506 | |||
| 1843 | Ga0496110_0337279 | |||
| 1844 | Ga0496112_0021563 | |||
| 1845 | Ga0496113_0000447 | |||
| 1846 | Ga0496114_0016647 | |||
| 1847 | Ga0496114_0047896 | |||
| 1848 | Ga0496119_0042509 | |||
| 1849 | Ga0496120_0001365 | |||
| 1850 | Ga0496120_0021525 | |||
| 1851 | Ga0496121_0070897 | |||
| 1852 | Ga0496121_0137174 | |||
| 1853 | Ga0496121_0139723 | |||
| 1854 | Ga0496121_0194771 | |||
| 1855 | Ga0496122_0001169 | |||
| 1856 | Ga0496122_0004108 | |||
| 1857 | Ga0496122_0050551 | |||
| 1858 | Ga0496123_0001064 | |||
| 1859 | Ga0496123_0004336 | |||
| 1860 | Ga0496123_0007104 | |||
| 1861 | Ga0496123_0147219 | |||
| 1862 | Ga0496124_0005968 | |||
| 1863 | Ga0496124_0007668 | |||
| 1864 | Ga0496124_0026267 | |||
| 1865 | Ga0496124_0041894 | |||
| 1866 | Ga0496124_0085686 | |||
| 1867 | Ga0496124_0286204 | |||
| 1868 | Ga0496125_0011546 | |||
| 1869 | Ga0496125_0189281 | |||
| 1870 | Ga0496126_0002152 | |||
| 1871 | Ga0496126_0024193 | |||
| 1872 | Ga0496126_0042436 | |||
| 1873 | Ga0496126_0088348 | |||
| 1874 | Ga0496126_0097812 | |||
| 1875 | Ga0496126_0102895 | |||
| 1876 | Ga0496126_0206076 | |||
| 1877 | Ga0496126_0365375 | |||
| 1878 | Ga0495678_000071 | |||
| 1879 | Ga0495678_000092 | |||
| 1880 | Ga0495678_000100 | |||
| 1881 | Ga0495678_000562 | |||
| 1882 | Ga0495678_000574 | |||
| 1883 | Ga0495678_001283 | |||
| 1884 | Ga0495678_009839 | |||
| 1885 | Ga0495678_029020 | |||
| 1886 | Ga0495682_0000066 | |||
| 1887 | Ga0495682_0006833 | |||
| 1888 | Ga0495682_0015804 | |||
| 1889 | Ga0501033_0012115 | |||
| 1890 | Ga0501033_0025514 | |||
| 1891 | Ga0501033_0141149 | |||
| 1892 | Ga0501036_0001539 | |||
| 1893 | Ga0501036_0017070 | |||
| 1894 | Ga0501036_0019669 | |||
| 1895 | Ga0501036_0051445 | |||
| 1896 | Ga0501036_0097595 | |||
| 1897 | Ga0501038_0000983 | |||
| 1898 | Ga0501038_0001449 | |||
| 1899 | Ga0501038_0117021 | |||
| 1900 | Ga0501039_0000223 | |||
| 1901 | Ga0501039_0027408 | |||
| 1902 | Ga0501040_0000073 | |||
| 1903 | Ga0501040_0087357 | |||
| 1904 | Ga0501040_0106558 | |||
| 1905 | Ga0501041_0008206 | |||
| 1906 | Ga0501041_0009275 | |||
| 1907 | Ga0501041_0065199 | |||
| 1908 | Ga0501042_0000169 | |||
| 1909 | Ga0501042_0008157 | |||
| 1910 | Ga0501042_0065113 | |||
| 1911 | Ga0501043_0000053 | |||
| 1912 | Ga0501043_0099436 | |||
| 1913 | Ga0501043_0279726 | |||
| 1914 | Ga0501046_0000018 | |||
| 1915 | Ga0501046_0037357 | |||
| 1916 | Ga0501046_0038066 | |||
| 1917 | Ga0501046_0161851 | |||
| 1918 | Ga0501047_0000020 | |||
| 1919 | Ga0501047_0053445 | |||
| 1920 | Ga0501047_0142759 | |||
| 1921 | Ga0501048_0000167 | |||
| 1922 | Ga0501048_0005219 | |||
| 1923 | Ga0501048_0010984 | |||
| 1924 | Ga0501067_0065581 | |||
| 1925 | Ga0501068_0016008 | |||
| 1926 | Ga0501068_0216222 | |||
| 1927 | Ga0501069_0132329 | |||
| 1928 | Ga0501069_0169818 | |||
| 1929 | Ga0501070_0006281 | |||
| 1930 | Ga0501070_0056453 | |||
| 1931 | Ga0501070_0090867 | |||
| 1932 | Ga0501070_0247151 | |||
| 1933 | Ga0501071_0000160 | |||
| 1934 | Ga0501071_0059970 | |||
| 1935 | Ga0501072_0000890 | |||
| 1936 | Ga0501072_0000995 | |||
| 1937 | Ga0501073_0084056 | |||
| 1938 | Ga0501073_0216064 | |||
| 1939 | Ga0501074_0006489 | |||
| 1940 | Ga0501074_0032276 | |||
| 1941 | Ga0501074_0062972 | |||
| 1942 | Ga0501074_0117684 | |||
| 1943 | Ga0501075_0000005 | |||
| 1944 | Ga0501075_0000068 | |||
| 1945 | Ga0501076_0000014 | |||
| 1946 | Ga0501076_0000024 | |||
| 1947 | Ga0501076_0014841 | |||
| 1948 | Ga0501076_0204564 | |||
| 1949 | Ga0501077_0000248 | |||
| 1950 | Ga0501077_0016102 | |||
| 1951 | Ga0501077_0037286 | |||
| 1952 | Ga0501077_0044770 | |||
| 1953 | Ga0501079_0000025 | |||
| 1954 | Ga0501079_0014104 | |||
| 1955 | Ga0501080_0001721 | |||
| 1956 | Ga0501080_0021361 | |||
| 1957 | Ga0501080_0083312 | |||
| 1958 | Ga0501080_0121170 | |||
| 1959 | Ga0501080_0413242 | |||
| 1960 | Ga0501080_0448196 | |||
| 1961 | Ga0501081_0000007 | |||
| 1962 | Ga0501081_0013224 | |||
| 1963 | Ga0501081_0022564 | |||
| 1964 | Ga0501081_0105267 | |||
| 1965 | Ga0501081_0138769 | |||
| 1966 | Ga0501083_0008644 | |||
| 1967 | Ga0501035_0013335 | |||
| 1968 | Ga0501035_0105238 | |||
| 1969 | Ga0501035_0118312 | |||
| 1970 | Ga0501044_0001029 | |||
| 1971 | Ga0501044_0099539 | |||
| 1972 | Ga0501044_0255709 | |||
| 1973 | Ga0501045_0000003 | |||
| 1974 | Ga0501045_0002602 | |||
| 1975 | Ga0501045_0024218 | |||
| 1976 | Ga0501045_0030962 | |||
| 1977 | Ga0501045_0229092 | |||
| 1978 | nmdc:mga03n38_96369_c1 | |||
| 1979 | nmdc:mga00v17_44215_c1 | |||
| 1980 | nmdc:mga0k408_43237_c1 | |||
| 1981 | nmdc:mga06z11_144218_c1 | |||
| 1982 | nmdc:mga06z11_64616_c1 | |||
| 1983 | nmdc:mga04h51_10581_c1 | |||
| 1984 | nmdc:mga07m45_24707_c2 | |||
| 1985 | nmdc:mga05p37_652_c1 | |||
| 1986 | nmdc:mga0qj67_134453_c1 | |||
| 1987 | nmdc:mga06r32_38689_c1 | |||
| 1988 | nmdc:mga08y16_283407_c1 | |||
| 1989 | nmdc:mga08x19_57524_c1 | |||
| 1990 | nmdc:mga0sz30_43295_c1 | |||
| 1991 | Ga0495601_0001429 | |||
| 1992 | Ga0500643_043954 | |||
| 1993 | Ga0500583_0003224 | |||
| 1994 | Ga0500651_0083462 | |||
| 1995 | Ga0500650_0000016 | |||
| 1996 | Ga0500555_000125 | |||
| 1997 | Ga0500556_0008611 | |||
| 1998 | Ga0500595_044607 | |||
| 1999 | Ga0500618_000187 | |||
| 2000 | Ga0500658_0016231 | |||
| 2001 | Ga0500568_0031391 | |||
| 2002 | Ga0500588_0003016 | |||
| 2003 | Ga0500604_0009644 | |||
| 2004 | Ga0500616_0000085 | |||
| 2005 | Ga0500616_0046502 | |||
| 2006 | Ga0500645_001226 | |||
| 2007 | Ga0500645_007461 | |||
| 2008 | Ga0501084_0002287 | |||
| 2009 | Ga0501084_0008211 | |||
| 2010 | Ga0501084_0033507 | |||
| 2011 | Ga0587090_005911 | |||
| 2012 | Ga0501082_0000062 | |||
| 2013 | Ga0501082_0023279 | |||
| 2014 | Ga0501082_0154630 | |||
| 2015 | Ga0530510_0000062 | |||
| 2016 | Ga0530510_0000201 | |||
| 2017 | Ga0530510_0093688 | |||
| 2018 | Ga0530510_0217878 | |||
| 2019 | 2509141272 | |||
| 2020 | 2513556885 | |||
| 2021 | 2513564892 | |||
| 2022 | 2514590420 | |||
| 2023 | 2525556280 | |||
| 2024 | 2563064119 | |||
| 2025 | 2597815495 | |||
| 2026 | 2630649510 | |||
| 2027 | 2644287921 | |||
| 2028 | 2644737527 | |||
| 2029 | 2713472393 | |||
| 2030 | 2738827981 | |||
| 2031 | 2739151777 | |||
| 2032 | 2739194202 | |||
| 2033 | 2739305704 | |||
| 2034 | 2739320173 | |||
| 2035 | 2739338919 | |||
| 2036 | 2778126350 | |||
| 2037 | 2819553216 | |||
| 2038 | 2821132733 | |||
| 2039 | 2824618536 | |||
| 2040 | 2824627249 | |||
| 2041 | 2824635535 | |||
| 2042 | 2824644371 | |||
| 2043 | 2824716812 | |||
| 2044 | 2824725500 | |||
| 2045 | 2841735434 | |||
| 2046 | 2852683884 | |||
| 2047 | 2856347601 | |||
| 2048 | 2857562065 | |||
| 2049 | 2857566802 | |||
| 2050 | 2869168956 | |||
| 2051 | 2871479687 | |||
| 2052 | 2878796705 | |||
| 2053 | 2881414782 | |||
| 2054 | 2883294893 | |||
| 2055 | 2885315522 | |||
| 2056 | 2888349398 | |||
| 2057 | 2894023462 | |||
| 2058 | 2900642227 | |||
| 2059 | 2904549692 | |||
| 2060 | 2917702878 | |||
| 2061 | 2921650169 | |||
| 2062 | 2924755239 | |||
| 2063 | 2929168461 | |||
| 2064 | 2937842251 | |||
| 2065 | 2938021679 | |||
| 2066 | 2958075570 | |||
| 2067 | 2970531017 | |||
| 2068 | 2970543282 | |||
| 2069 | 2984567235 | |||
| 2070 | 2996312385 | |||
| 2071 | 8003960762 | |||
| 2072 | 8004639505 | |||
| 2073 | 8055228882 | |||
| 2074 | 8055623814 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxp-assembly1.cif.gz_A-2 | crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution | 0.9302 | 4 | 335 |
| 3dxp-assembly1.cif.gz_A-2 | crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution | 0.9167 | 4 | 335 |
| 3att-assembly1.cif.gz_A | crystal structure of rv3168 with atp | 0.7529 | 6 | 329 |
| 2ppq-assembly1.cif.gz_A-2 | crystal structure of the homoserine kinase from agrobacterium tumefaciens | 0.7447 | 2 | 336 |
| 4dfb-assembly2.cif.gz_B | "crystal structure of aminoglycoside phosphotransferase aph(2"")-id/aph(2"")-iva in complex with kanamycin" | 0.744 | 23 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8K370_368_600_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.9508 | 106 | 335 | 3.90.1200.10 |
| af_O01590_328_568_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.9431 | 105 | 338 | 3.90.1200.10 |
| 3dxpA02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.9402 | 105 | 335 | 3.90.1200.10 |
| af_Q8K370_368_600_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.9351 | 106 | 335 | 3.90.1200.10 |
| af_Q8RWZ3_128_373_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.9251 | 106 | 333 | 3.90.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9AZX6-F1-model_v4 | deleted | 0.981 | 86 | 336 |
|
| AF-A0A6L4A8W3-F1-model_v4 | deleted | 0.977 | 74 | 338 |
|
| AF-A0A3N2QIF4-F1-model_v4 | deleted | 0.9754 | 1 | 339 |
|
| AF-H0TE96-F1-model_v4 | Putative aminoglycoside phosphotransferase | 0.9753 | 4 | 338 |
GO:0016740
|
| AF-A0A358J1J6-F1-model_v4 | Phosphotransferase family protein | 0.9737 | 142 | 340 |
GO:0016740
|