F488741

General Info

Members Datasets Scaffolds Average Seq Length
1037 468 2074 352

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10005792|Ga0265325_100057925
Length 394
Sequence MALEDRPRDHQTAMSGVANPPDCAALTAARSARSLRRVNATPQPQDVVPVTDRHRFDEAALARYLARHLEGYRGPLTVQQFAGGQSNPTFFLTEGGRSLVLRKKPPGELLPSAHAVDREFRVMRALGTTDFPVPRTHLLCEDAAVIGQIFYVMDWVPGRILRDPLLAGMQPAERRAIYDAMNAAMAQLHTIDPFAIGLGDFGKPGNYFARQTARWIKQYEASQTEEIESFNRLIEWLPKSIPPGDETRIAHGDFRLENMVLHPTEPRVLAVLDWELSTLGHPLADLGYNVMGYFMPPGQPGRLAGADLEALGIPSVDDYVAAYCRRTGRARVDDLEFYVVFALFRSAAIMQGIAMRAKIGTASAANAELVGKYARTIADTAWEIVQRPPSEGRE

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
232 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
233 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
240 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
243 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
321 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
330 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
366 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
369 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
393 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
394 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
397 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
398 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
399 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
400 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
406 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
413 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
414 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
415 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
416 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
417 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
418 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
419 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
420 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
421 2643221651 Afipia sp. Root123D2 Isolate Unclassified
422 2643221734 Bosea sp. Root670 Isolate Unclassified
423 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
424 2738541297 Duganella sp. GV083 Isolate Unclassified
425 2738541357 Duganella sp. GV053 Isolate Unclassified
426 2738543003 Duganella sp. GV066 Isolate Unclassified
427 2738543024 Aminobacter sp. AP02 Isolate Unclassified
428 2738543026 Duganella sp. GV089 Isolate Unclassified
429 2738543029 Duganella sp. GV039 Isolate Unclassified
430 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
431 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
432 2821131069 Duganella sp. 1224 Isolate Unclassified
433 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
434 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
435 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
436 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
437 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
438 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
439 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
440 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
441 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
442 2857558681 Duganella sp. R-74565 Isolate Unclassified
443 2857564685 Duganella sp. R-74599 Isolate Unclassified
444 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
445 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
446 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
447 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
448 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
449 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
450 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
451 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
452 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
453 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
454 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
455 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
456 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
457 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
458 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
459 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
460 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
461 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
462 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
463 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
464 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
465 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
466 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
467 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
468 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0.1
Isolates 5.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 7.23
Nodule 2.22
Rhizoplane 2.03
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10005792 3300031241 Bacteria 7577
2 JGI24736J21556_1002424 3300001904 Bacteria 3295
3 JGI24741J21665_1000034 3300001915 Bacteria 32794
4 JGI24740J21852_10000403 3300001979 Bacteria 18606
5 JGI24739J22299_10000059 3300001989 Bacteria 31070
6 JGI24737J22298_10000084 3300001990 Bacteria 27475
7 JGI24735J21928_10000109 3300002067 Bacteria 29714
8 JGI25154J39366_1001838 3300002738 Bacteria 6537
9 JGI25151J46595_10000030 3300003187 Bacteria 202084
10 JGI25406J46586_10005781 3300003203 Bacteria 5722
11 JGI25406J46586_10030970 3300003203 Bacteria 2007
12 Ga0055526_1000013 3300003771 Bacteria 233580
13 Ga0055526_1000019 3300003771 Bacteria 189698
14 Ga0055526_1000368 3300003771 Bacteria 36399
15 Ga0055526_1000502 3300003771 Bacteria 31206
16 Ga0055526_1001266 3300003771 Bacteria 18132
17 Ga0055537_1000159 3300003773 Bacteria 50407
18 Ga0055524_1000069 3300003775 Bacteria 128956
19 Ga0055524_1000469 3300003775 Bacteria 32369
20 Ga0055524_1009528 3300003775 Bacteria 3940
21 Ga0055534_1000045 3300003784 Bacteria 98659
22 Ga0055528_1000323 3300003790 Bacteria 40144
23 Ga0055530_10000160 3300003791 Bacteria 61095
24 Ga0055530_10000630 3300003791 Bacteria 30400
25 Ga0055540_1000173 3300003792 Bacteria 63434
26 Ga0055531_10005811 3300003794 Bacteria 7140
27 Ga0055543_1006928 3300004625 Bacteria 2677
28 Ga0065165_1000243 3300005262 Bacteria 93455
29 Ga0065707_10119488 3300005295 Bacteria 2158
30 Ga0070658_10049172 3300005327 Bacteria 3415
31 Ga0070676_10002512 3300005328 Bacteria 9416
32 Ga0070676_10002638 3300005328 Bacteria 9234
33 Ga0070676_10120668 3300005328 Bacteria 1645
34 Ga0070690_100164033 3300005330 Bacteria 1525
35 Ga0070670_100000052 3300005331 Bacteria 129346
36 Ga0070677_10000311 3300005333 Bacteria 16974
37 Ga0070666_10007951 3300005335 Bacteria 6556
38 Ga0070666_10009376 3300005335 Bacteria 6100
39 Ga0070666_10012511 3300005335 Bacteria 5357
40 Ga0070666_10027544 3300005335 Bacteria 3723
41 Ga0070682_100017170 3300005337 Bacteria 4216
42 Ga0068868_100003668 3300005338 Bacteria 10719
43 Ga0068868_100201892 3300005338 Bacteria 1658
44 Ga0070661_100004880 3300005344 Bacteria 9235
45 Ga0070668_100002357 3300005347 Bacteria 13887
46 Ga0070668_100049834 3300005347 Bacteria 3222
47 Ga0070669_100006210 3300005353 Bacteria 8626
48 Ga0070675_100063964 3300005354 Bacteria 3041
49 Ga0070671_100000043 3300005355 Bacteria 89426
50 Ga0070671_100021300 3300005355 Bacteria 5295
51 Ga0070671_100230895 3300005355 Bacteria 1570
52 Ga0070674_100007399 3300005356 Bacteria 6476
53 Ga0070667_100000021 3300005367 Bacteria 205662
54 Ga0070667_100005451 3300005367 Bacteria 10627
55 Ga0070667_100162598 3300005367 Bacteria 1967
56 Ga0070714_100125240 3300005435 Bacteria 2290
57 Ga0070711_100176618 3300005439 Bacteria 1632
58 Ga0070705_100093787 3300005440 Bacteria 1878
59 Ga0070663_100005315 3300005455 Bacteria 7641
60 Ga0070678_100003476 3300005456 Bacteria 8779
61 Ga0070662_100002384 3300005457 Bacteria 11544
62 Ga0070681_10000746 3300005458 Bacteria 27005
63 Ga0068867_100008363 3300005459 Bacteria 7301
64 Ga0068867_100029996 3300005459 Bacteria 3922
65 Ga0070685_10000002 3300005466 Bacteria 295205
66 Ga0070685_10020498 3300005466 Bacteria 3577
67 Ga0070706_100108730 3300005467 Bacteria 2580
68 Ga0070706_100309292 3300005467 Bacteria 1474
69 Ga0070707_100425834 3300005468 Bacteria 1288
70 Ga0070698_100066406 3300005471 Bacteria 3631
71 Ga0070698_100104724 3300005471 Bacteria 2799
72 Ga0070679_100007841 3300005530 Bacteria 10010
73 Ga0068853_100002265 3300005539 Bacteria 14368
74 Ga0068853_100035764 3300005539 Bacteria 4220
75 Ga0068853_100043248 3300005539 Bacteria 3854
76 Ga0068853_100076250 3300005539 Bacteria 2927
77 Ga0070672_100013917 3300005543 Bacteria 5692
78 Ga0070672_100064851 3300005543 Bacteria 2887
79 Ga0070696_100061739 3300005546 Bacteria 2622
80 Ga0070693_100004068 3300005547 Bacteria 6885
81 Ga0070665_100002758 3300005548 Bacteria 19041
82 Ga0070665_100012190 3300005548 Bacteria 8668
83 Ga0070665_100074772 3300005548 Bacteria 3394
84 Ga0070704_100345089 3300005549 Bacteria 1255
85 Ga0068855_100001912 3300005563 Bacteria 25837
86 Ga0068855_100078234 3300005563 Bacteria 3837
87 Ga0070664_100027829 3300005564 Bacteria 4700
88 Ga0070664_100185300 3300005564 Bacteria 1852
89 Ga0068857_100004902 3300005577 Bacteria 11356
90 Ga0068857_100270444 3300005577 Bacteria 1562
91 Ga0068854_100002245 3300005578 Bacteria 11892
92 Ga0068854_100197870 3300005578 Bacteria 1578
93 Ga0068856_100002241 3300005614 Bacteria 19964
94 Ga0068852_100002292 3300005616 Bacteria 13161
95 Ga0068859_100011410 3300005617 Bacteria 8933
96 Ga0068859_100152228 3300005617 Bacteria 2388
97 Ga0068859_100215222 3300005617 Bacteria 2008
98 Ga0068864_100000219 3300005618 Bacteria 51801
99 Ga0068864_100170677 3300005618 Bacteria 1983
100 Ga0068861_100022703 3300005719 Bacteria 4524
101 Ga0068861_100047335 3300005719 Bacteria 3246
102 Ga0068861_100126034 3300005719 Bacteria 2072
103 Ga0068851_10002958 3300005834 Bacteria 7511
104 Ga0068851_10094263 3300005834 Bacteria 1580
105 Ga0068863_100008937 3300005841 Bacteria 9782
106 Ga0068863_100039472 3300005841 Bacteria 4491
107 Ga0068863_100066373 3300005841 Bacteria 3413
108 Ga0068863_100093670 3300005841 Bacteria 2851
109 Ga0068858_100056739 3300005842 Bacteria 3619
110 Ga0068858_100402127 3300005842 Bacteria 1316
111 Ga0068860_100000015 3300005843 Bacteria 313639
112 Ga0068860_100001564 3300005843 Bacteria 24652
113 Ga0068860_100051949 3300005843 Bacteria 3899
114 Ga0068860_100133889 3300005843 Bacteria 2380
115 Ga0068860_100146437 3300005843 Bacteria 2273
116 Ga0068862_100001673 3300005844 Bacteria 20087
117 Ga0068862_100006372 3300005844 Bacteria 9813
118 Ga0068862_100088433 3300005844 Bacteria 2695
119 Ga0068862_100120093 3300005844 Bacteria 2316
120 Ga0081455_10000391 3300005937 Bacteria 57931
121 Ga0081540_1003425 3300005983 Bacteria 12542
122 Ga0081539_10000203 3300005985 Bacteria 138096
123 Ga0081539_10000316 3300005985 Bacteria 107841
124 Ga0075368_10052603 3300006042 Bacteria 1620
125 Ga0075363_100000506 3300006048 Bacteria 12473
126 Ga0075363_100053469 3300006048 Bacteria 2158
127 Ga0075363_100057444 3300006048 Bacteria 2088
128 Ga0075362_10013292 3300006177 Bacteria 3293
129 Ga0075367_10048860 3300006178 Bacteria 2493
130 Ga0075369_10019359 3300006186 Bacteria 2779
131 Ga0075366_10120826 3300006195 Bacteria 1579
132 Ga0097621_100028254 3300006237 Bacteria 4421
133 Ga0075370_10025155 3300006353 Bacteria 3291
134 Ga0075428_100169101 3300006844 Bacteria 2371
135 Ga0075431_100032041 3300006847 Bacteria 5417
136 Ga0075431_100033531 3300006847 Bacteria 5291
137 Ga0075431_100138743 3300006847 Bacteria 2506
138 Ga0075429_100058235 3300006880 Bacteria 3364
139 Ga0068865_100041090 3300006881 Bacteria 3146
140 Ga0097620_100011410 3300006931 Bacteria 8933
141 Ga0097620_100152237 3300006931 Bacteria 2388
142 Ga0097620_100215225 3300006931 Bacteria 2008
143 Ga0079104_1000294 3300006946 Bacteria 63150
144 Ga0075435_100147607 3300007076 Bacteria 1976
145 Ga0099794_10000703 3300007265 Bacteria 11248
146 Ga0099794_10023616 3300007265 Bacteria 2815
147 Ga0099795_10002134 3300007788 Bacteria 4559
148 Ga0099795_10038661 3300007788 Bacteria 1685
149 Ga0105244_10004592 3300009036 Bacteria 9453
150 Ga0105240_10009713 3300009093 Bacteria 13584
151 Ga0105240_10017325 3300009093 Bacteria 9712
152 Ga0105240_10021363 3300009093 Bacteria 8610
153 Ga0105240_10080085 3300009093 Bacteria 4018
154 Ga0111539_10130613 3300009094 Bacteria 2941
155 Ga0111539_10150922 3300009094 Bacteria 2720
156 Ga0111539_10226551 3300009094 Bacteria 2177
157 Ga0105245_10001099 3300009098 Bacteria 24505
158 Ga0105247_10026286 3300009101 Bacteria 3514
159 Ga0114129_10000523 3300009147 Bacteria 46856
160 Ga0105243_10000293 3300009148 Bacteria 55165
161 Ga0105241_10014586 3300009174 Bacteria 5754
162 Ga0105248_10000851 3300009177 Bacteria 34362
163 Ga0105248_10022168 3300009177 Bacteria 7041
164 Ga0105248_10096218 3300009177 Bacteria 3335
165 Ga0105248_10123808 3300009177 Bacteria 2916
166 Ga0105237_10053764 3300009545 Bacteria 4038
167 Ga0105237_10196031 3300009545 Bacteria 2020
168 Ga0105237_10235451 3300009545 Bacteria 1832
169 Ga0105238_10000493 3300009551 Bacteria 41482
170 Ga0105238_10006619 3300009551 Bacteria 11548
171 Ga0105249_10018235 3300009553 Bacteria 6238
172 Ga0105249_10031571 3300009553 Bacteria 4791
173 Ga0105249_10070334 3300009553 Bacteria 3230
174 Ga0105249_10306810 3300009553 Bacteria 1594
175 Ga0099796_10000651 3300010159 Bacteria 6047
176 Ga0105239_10055846 3300010375 Bacteria 4332
177 Ga0157373_10044194 3300013100 Bacteria 3181
178 Ga0157371_10004600 3300013102 Bacteria 11980
179 Ga0157370_10124958 3300013104 Bacteria 2402
180 Ga0157369_10026347 3300013105 Bacteria 6450
181 Ga0171462_1013 3300013250 Bacteria 202864
182 Ga0157378_10009277 3300013297 Bacteria 8571
183 Ga0157378_10175857 3300013297 Bacteria 2011
184 Ga0163162_10234112 3300013306 Bacteria 1968
185 Ga0157372_10072967 3300013307 Bacteria 3868
186 Ga0157375_10005737 3300013308 Bacteria 10800
187 Ga0157375_10051189 3300013308 Bacteria 4055
188 Ga0157375_10404997 3300013308 Bacteria 1531
189 Ga0163163_10004461 3300014325 Bacteria 11936
190 Ga0182008_10124288 3300014497 Bacteria 1283
191 Ga0157379_10157466 3300014968 Bacteria 2049
192 Ga0157379_10297689 3300014968 Bacteria 1470
193 Ga0157379_10409934 3300014968 Bacteria 1247
194 Ga0157376_10132038 3300014969 Bacteria 2230
195 Ga0157376_10270986 3300014969 Bacteria 1595
196 Ga0183361_10003 3300016635 Bacteria 577277
197 Ga0163161_10037715 3300017792 Bacteria 3465
198 Ga0213872_10000019 3300021361 Bacteria 172803
199 Ga0213872_10001794 3300021361 Bacteria 13382
200 Ga0213872_10003169 3300021361 Bacteria 9226
201 Ga0213874_10024099 3300021377 Bacteria 1703
202 Ga0213874_10038923 3300021377 Bacteria 1414
203 Ga0213876_10000611 3300021384 Bacteria 26400
204 Ga0213875_10001414 3300021388 Bacteria 15605
205 Ga0213875_10003941 3300021388 Bacteria 8290
206 Ga0213875_10007514 3300021388 Bacteria 5619
207 Ga0209437_103668 3300025233 Bacteria 2750
208 Ga0209646_1000007 3300025246 Bacteria 670994
209 Ga0209565_1000003 3300025263 Bacteria 1099648
210 Ga0209673_1000003 3300025273 Bacteria 980859
211 Ga0209675_1000003 3300025291 Bacteria 1003982
212 Ga0209675_1000909 3300025291 Bacteria 18906
213 Ga0209675_1016544 3300025291 Bacteria 2142
214 Ga0209676_1000267 3300025292 Bacteria 109237
215 Ga0209025_1000063 3300025294 Bacteria 303962
216 Ga0209564_1000002 3300025295 Bacteria 1636803
217 Ga0209564_1000007 3300025295 Bacteria 1028582
218 Ga0209564_1000012 3300025295 Bacteria 792078
219 Ga0209564_1000043 3300025295 Bacteria 388153
220 Ga0209564_1000052 3300025295 Bacteria 356578
221 Ga0209050_1000915 3300025298 Bacteria 38980
222 Ga0209050_1000916 3300025298 Bacteria 38869
223 Ga0209050_1010784 3300025298 Bacteria 4448
224 Ga0209256_1000036 3300025299 Bacteria 386664
225 Ga0209256_1000172 3300025299 Bacteria 129025
226 Ga0209256_1000697 3300025299 Bacteria 44617
227 Ga0209051_1000230 3300025303 Bacteria 94027
228 Ga0209051_1000379 3300025303 Bacteria 63486
229 Ga0209257_1000141 3300025304 Bacteria 201130
230 Ga0209257_1000676 3300025304 Bacteria 53204
231 Ga0209257_1028785 3300025304 Bacteria 1823
232 Ga0207656_10010386 3300025321 Bacteria 3487
233 Ga0207656_10066613 3300025321 Bacteria 1592
234 Ga0207682_10000061 3300025893 Bacteria 46850
235 Ga0207642_10116554 3300025899 Bacteria 1370
236 Ga0207710_10150175 3300025900 Bacteria 1130
237 Ga0207680_10000489 3300025903 Bacteria 18801
238 Ga0207680_10031077 3300025903 Bacteria 3021
239 Ga0207680_10107901 3300025903 Bacteria 1800
240 Ga0207647_10000817 3300025904 Bacteria 24192
241 Ga0207645_10003267 3300025907 Bacteria 12380
242 Ga0207645_10036693 3300025907 Bacteria 3147
243 Ga0207643_10015602 3300025908 Bacteria 4136
244 Ga0207705_10072679 3300025909 Bacteria 2495
245 Ga0207684_10068853 3300025910 Bacteria 3008
246 Ga0207684_10263923 3300025910 Bacteria 1486
247 Ga0207695_10037969 3300025913 Bacteria 5192
248 Ga0207695_10067720 3300025913 Bacteria 3661
249 Ga0207695_10068557 3300025913 Bacteria 3634
250 Ga0207662_10081503 3300025918 Bacteria 1975
251 Ga0207649_10020345 3300025920 Bacteria 3805
252 Ga0207681_10007036 3300025923 Bacteria 6905
253 Ga0207681_10075811 3300025923 Bacteria 2360
254 Ga0207694_10000397 3300025924 Bacteria 40466
255 Ga0207694_10063477 3300025924 Bacteria 2877
256 Ga0207650_10000002 3300025925 Bacteria 1439222
257 Ga0207650_10060737 3300025925 Bacteria 2821
258 Ga0207659_10146894 3300025926 Bacteria 1837
259 Ga0207659_10163884 3300025926 Bacteria 1748
260 Ga0207687_10002035 3300025927 Bacteria 13862
261 Ga0207644_10000372 3300025931 Bacteria 29326
262 Ga0207644_10005509 3300025931 Bacteria 8244
263 Ga0207644_10039648 3300025931 Bacteria 3325
264 Ga0207644_10089089 3300025931 Bacteria 2296
265 Ga0207706_10000744 3300025933 Bacteria 33884
266 Ga0207706_10009544 3300025933 Bacteria 8910
267 Ga0207706_10042045 3300025933 Bacteria 4050
268 Ga0207706_10231483 3300025933 Bacteria 1617
269 Ga0207706_10279438 3300025933 Bacteria 1456
270 Ga0207709_10000076 3300025935 Bacteria 173292
271 Ga0207704_10052278 3300025938 Bacteria 2476
272 Ga0207691_10000016 3300025940 Bacteria 141024
273 Ga0207691_10024116 3300025940 Bacteria 5721
274 Ga0207711_10002050 3300025941 Bacteria 18223
275 Ga0207711_10003955 3300025941 Bacteria 12744
276 Ga0207689_10105939 3300025942 Bacteria 2310
277 Ga0207679_10088532 3300025945 Bacteria 2387
278 Ga0207679_10137793 3300025945 Bacteria 1968
279 Ga0207667_10051563 3300025949 Bacteria 4337
280 Ga0207667_10098298 3300025949 Bacteria 3020
281 Ga0207651_10029503 3300025960 Bacteria 3476
282 Ga0207712_10019361 3300025961 Bacteria 4444
283 Ga0207712_10026403 3300025961 Bacteria 3869
284 Ga0207668_10010412 3300025972 Bacteria 5617
285 Ga0207668_10049405 3300025972 Bacteria 2891
286 Ga0207640_10065584 3300025981 Bacteria 2423
287 Ga0207658_10000001 3300025986 Bacteria 1439333
288 Ga0207658_10001061 3300025986 Bacteria 22224
289 Ga0207658_10005073 3300025986 Bacteria 9059
290 Ga0207658_10025287 3300025986 Bacteria 4157
291 Ga0207658_10130949 3300025986 Bacteria 2015
292 Ga0207658_10361965 3300025986 Bacteria 1266
293 Ga0207703_10067840 3300026035 Bacteria 2937
294 Ga0207703_10092071 3300026035 Bacteria 2551
295 Ga0207639_10000632 3300026041 Bacteria 24237
296 Ga0207639_10037373 3300026041 Bacteria 3606
297 Ga0207639_10061248 3300026041 Bacteria 2905
298 Ga0207639_10062057 3300026041 Bacteria 2889
299 Ga0207678_10000914 3300026067 Bacteria 27005
300 Ga0207678_10013650 3300026067 Bacteria 7134
301 Ga0207702_10001373 3300026078 Bacteria 24259
302 Ga0207702_10020598 3300026078 Bacteria 5459
303 Ga0207641_10008740 3300026088 Bacteria 8367
304 Ga0207641_10050012 3300026088 Bacteria 3535
305 Ga0207641_10224594 3300026088 Bacteria 1743
306 Ga0207648_10004401 3300026089 Bacteria 14473
307 Ga0207648_10005187 3300026089 Bacteria 13193
308 Ga0207676_10000001 3300026095 Bacteria 1439222
309 Ga0207676_10014847 3300026095 Bacteria 5611
310 Ga0207676_10181994 3300026095 Bacteria 1841
311 Ga0207676_10208096 3300026095 Bacteria 1733
312 Ga0207676_10395469 3300026095 Bacteria 1290
313 Ga0207674_10001538 3300026116 Bacteria 29722
314 Ga0207674_10021564 3300026116 Bacteria 6935
315 Ga0207675_100039056 3300026118 Bacteria 4430
316 Ga0207675_100056394 3300026118 Bacteria 3664
317 Ga0207675_100160883 3300026118 Bacteria 2141
318 Ga0207683_10000322 3300026121 Bacteria 43758
319 Ga0207683_10175467 3300026121 Bacteria 1942
320 Ga0209281_1000423 3300027111 Bacteria 63126
321 Ga0209179_1000828 3300027512 Bacteria 3412
322 Ga0268266_10007343 3300028379 Bacteria 9955
323 Ga0268266_10009218 3300028379 Bacteria 8707
324 Ga0268266_10013731 3300028379 Bacteria 6975
325 Ga0268266_10023392 3300028379 Bacteria 5262
326 Ga0268266_10121103 3300028379 Bacteria 2329
327 Ga0268265_10083838 3300028380 Bacteria 2525
328 Ga0268265_10084293 3300028380 Bacteria 2519
329 Ga0268265_10356246 3300028380 Bacteria 1338
330 Ga0268264_10000002 3300028381 Bacteria 1153045
331 Ga0268264_10000004 3300028381 Bacteria 1116842
332 Ga0268264_10000014 3300028381 Bacteria 509962
333 Ga0268264_10009680 3300028381 Bacteria 7983
334 Ga0268264_10042701 3300028381 Bacteria 3754
335 Ga0307515_10000006 3300028794 Bacteria 725810
336 Ga0307515_10063025 3300028794 Bacteria 5221
337 Ga0307511_10000025 3300030521 Bacteria 112344
338 Ga0316177_1212761 3300030731 Bacteria 3251
339 Ga0265340_10144815 3300031247 Bacteria 1085
340 Ga0265339_10010596 3300031249 Bacteria 5720
341 Ga0265327_10001131 3300031251 Bacteria 36638
342 Ga0265327_10008872 3300031251 Bacteria 7389
343 Ga0265327_10010715 3300031251 Bacteria 6405
344 Ga0307408_100060395 3300031548 Bacteria 2763
345 Ga0307408_100075499 3300031548 Bacteria 2504
346 Ga0265313_10040486 3300031595 Bacteria 2303
347 Ga0265314_10029756 3300031711 Bacteria 4055
348 Ga0316576_10124408 3300031727 Bacteria 1937
349 Ga0316576_10267391 3300031727 Unclassified 1282
350 Ga0316578_10053225 3300031728 Bacteria 2371
351 Ga0307516_10046623 3300031730 Bacteria 4275
352 Ga0307405_10033113 3300031731 Bacteria 3061
353 Ga0307405_10140183 3300031731 Bacteria 1684
354 Ga0316577_10019978 3300031733 Bacteria 3710
355 Ga0307413_10110899 3300031824 Bacteria 1836
356 Ga0307518_10222053 3300031838 Bacteria 1232
357 Ga0307410_10137388 3300031852 Bacteria 1803
358 Ga0307410_10173092 3300031852 Bacteria 1628
359 Ga0307406_10012195 3300031901 Bacteria 4896
360 Ga0307406_10091859 3300031901 Bacteria 2046
361 Ga0307407_10005506 3300031903 Bacteria 5503
362 Ga0307412_10024218 3300031911 Bacteria 3745
363 Ga0307412_10168454 3300031911 Bacteria 1635
364 Ga0307409_100005750 3300031995 Bacteria 7188
365 Ga0307414_10026730 3300032004 Bacteria 3719
366 Ga0307414_10094848 3300032004 Bacteria 2228
367 Ga0307415_100273674 3300032126 Bacteria 1384
368 Ga0307507_10035925 3300033179 Bacteria 5077
369 Ga0307510_10001839 3300033180 Bacteria 23770
370 Ga0307510_10039902 3300033180 Bacteria 5163
371 Ga0307510_10202941 3300033180 Bacteria 1515
372 Ga0373926_0014404 3300035083 Bacteria 2688
373 Ga0373923_0009335 3300035111 Bacteria 3537
374 Ga0373936_0017021 3300035113 Bacteria 2795
375 Ga0373936_0068214 3300035113 Bacteria 1462
376 Ga0373945_0026017 3300035116 Bacteria 2036
377 Ga0373943_0003641 3300035170 Bacteria 7005
378 Ga0373946_0002251 3300035171 Bacteria 6811
379 Ga0373946_0007659 3300035171 Bacteria 3955
380 Ga0373955_0040066 3300035172 Bacteria 2503
381 Ga0373924_0039566 3300035410 Bacteria 1927
382 Ga0373931_0016354 3300035691 Bacteria 3651
383 Ga0373935_0004899 3300035692 Bacteria 7870
384 Ga0373935_0019897 3300035692 Bacteria 4097
385 Ga0373935_0056067 3300035692 Bacteria 2511
386 Ga0373927_0002255 3300035695 Bacteria 14135
387 Ga0373927_0002256 3300035695 Bacteria 14126
388 Ga0373947_0001432 3300035725 Bacteria 14679
389 Ga0373947_0204067 3300035725 Bacteria 1294
390 Ga0316584_0016657 3300036712 Bacteria 5272
391 Ga0373925_0000104 3300037068 Bacteria 91673
392 Ga0373925_0000976 3300037068 Bacteria 26036
393 Ga0373925_0075408 3300037068 Bacteria 2555
394 Ga0395899_0000361 3300037312 Bacteria 55292
395 Ga0395899_0013123 3300037312 Bacteria 6337
396 Ga0395899_0262044 3300037312 Unclassified 1182
397 Ga0395900_0000046 3300037418 Bacteria 230114
398 Ga0395900_0000237 3300037418 Bacteria 86507
399 Ga0395900_0064772 3300037418 Bacteria 3755
400 Ga0395900_0166403 3300037418 Bacteria 2247
401 Ga0395900_0190827 3300037418 Bacteria 2078
402 Ga0395900_0296593 3300037418 Bacteria 1604
403 Ga0395905_0000498 3300037471 Bacteria 53933
404 Ga0395905_0087405 3300037471 Bacteria 2922
405 Ga0395905_0124786 3300037471 Bacteria 2421
406 Ga0395905_0167522 3300037471 Bacteria 2064
407 Ga0395905_0173861 3300037471 Bacteria 2022
408 Ga0395905_0187495 3300037471 Bacteria 1941
409 Ga0395905_0315121 3300037471 Bacteria 1453
410 Ga0436364_0473640 3300037853 Bacteria 15605
411 Ga0436364_0563933 3300037853 Bacteria 17439
412 Ga0436364_0786035 3300037853 Bacteria 3970
413 Ga0436364_0804800 3300037853 Bacteria 21862
414 Ga0395901_0000028 3300038443 Bacteria 242653
415 Ga0395901_0100110 3300038443 Bacteria 3040
416 Ga0395901_0452827 3300038443 Bacteria 1312
417 Ga0400483_068090 3300039062 Bacteria 1885
418 Ga0436365_1595143 3300039437 Bacteria 26401
419 Ga0436360_0787362 3300039438 Bacteria 1673
420 Ga0436361_0075382 3300039447 Bacteria 4523
421 Ga0436361_0330198 3300039447 Bacteria 18763
422 Ga0436361_0352948 3300039447 Bacteria 62639
423 Ga0436361_0635819 3300039447 Bacteria 1362
424 Ga0436361_1127083 3300039447 Bacteria 3115
425 Ga0436363_0240244 3300039450 Bacteria 4335
426 Ga0436363_1348059 3300039450 Bacteria 4809
427 Ga0439441_005803 3300042001 Bacteria 1933
428 Ga0439449_0054328 3300042007 Bacteria 1480
429 Ga0450904_000658 3300042139 Bacteria 6256
430 Ga0451577_0001960 3300042876 Bacteria 25893
431 Ga0451577_0034963 3300042876 Bacteria 4528
432 Ga0451577_0040418 3300042876 Bacteria 4187
433 Ga0453683_0262854 3300044673 Bacteria 1101
434 Ga0466965_0112314 3300044683 Bacteria 1401
435 Ga0466966_0002584 3300044684 Bacteria 11864
436 Ga0451576_0000025 3300045051 Bacteria 427980
437 Ga0495617_000060 3300046452 Bacteria 97123
438 Ga0495617_000072 3300046452 Bacteria 80951
439 Ga0495617_018523 3300046452 Bacteria 2354
440 Ga0495627_000272 3300046453 Bacteria 52368
441 Ga0495627_000489 3300046453 Bacteria 33226
442 Ga0495603_0069937 3300046455 Bacteria 2064
443 Ga0495603_0125092 3300046455 Bacteria 1498
444 Ga0495590_0000005 3300046457 Bacteria 384276
445 Ga0495590_0000008 3300046457 Bacteria 330520
446 Ga0495590_0000424 3300046457 Bacteria 21300
447 Ga0495590_0000562 3300046457 Bacteria 17639
448 Ga0495590_0010969 3300046457 Bacteria 3396
449 Ga0495591_000051 3300046458 Bacteria 137457
450 Ga0495629_0000365 3300046459 Bacteria 38312
451 Ga0495629_0027120 3300046459 Bacteria 4069
452 Ga0495629_0055488 3300046459 Bacteria 2770
453 Ga0495629_0067560 3300046459 Bacteria 2494
454 Ga0495638_0000027 3300046460 Bacteria 337569
455 Ga0495638_0001965 3300046460 Bacteria 17609
456 Ga0495638_0003652 3300046460 Bacteria 12000
457 Ga0495641_0045723 3300046461 Bacteria 2015
458 Ga0495653_0000880 3300046463 Bacteria 23178
459 Ga0495653_0008489 3300046463 Bacteria 8422
460 Ga0495653_0009298 3300046463 Bacteria 8041
461 Ga0495653_0015205 3300046463 Bacteria 6273
462 Ga0495653_0136800 3300046463 Bacteria 1727
463 Ga0495653_0189182 3300046463 Bacteria 1406
464 Ga0495650_0000044 3300046471 Bacteria 355139
465 Ga0495650_0000185 3300046471 Bacteria 136913
466 Ga0495650_0000323 3300046471 Bacteria 85563
467 Ga0495650_0002258 3300046471 Bacteria 16098
468 Ga0495650_0003969 3300046471 Bacteria 10397
469 Ga0495650_0005067 3300046471 Bacteria 8716
470 Ga0495650_0055439 3300046471 Bacteria 1613
471 Ga0495580_0003410 3300046472 Bacteria 13548
472 Ga0495580_0006376 3300046472 Bacteria 9624
473 Ga0495582_0090689 3300046473 Bacteria 1704
474 Ga0495605_0000049 3300046474 Bacteria 166669
475 Ga0495605_0017778 3300046474 Bacteria 3822
476 Ga0495605_0019852 3300046474 Bacteria 3580
477 Ga0495639_0006411 3300046475 Bacteria 5062
478 Ga0495662_0067417 3300046476 Bacteria 1732
479 Ga0495664_0002204 3300046477 Bacteria 10434
480 Ga0495664_0028490 3300046477 Bacteria 3261
481 Ga0495584_0000001 3300046491 Bacteria 649329
482 Ga0495584_0000024 3300046491 Bacteria 117259
483 Ga0495584_0001263 3300046491 Bacteria 15400
484 Ga0495584_0003873 3300046491 Bacteria 8108
485 Ga0495584_0009495 3300046491 Bacteria 5009
486 Ga0495585_0000040 3300046492 Bacteria 130615
487 Ga0495585_0002248 3300046492 Bacteria 13971
488 Ga0495585_0002439 3300046492 Bacteria 13331
489 Ga0495585_0036912 3300046492 Bacteria 2753
490 Ga0495585_0039002 3300046492 Bacteria 2672
491 Ga0495585_0059017 3300046492 Bacteria 2115
492 Ga0495585_0122419 3300046492 Bacteria 1375
493 Ga0495594_0046635 3300046499 Bacteria 2380
494 Ga0495594_0097782 3300046499 Bacteria 1649
495 Ga0495596_0000714 3300046500 Bacteria 20519
496 Ga0495596_0001374 3300046500 Bacteria 13962
497 Ga0495596_0008634 3300046500 Bacteria 4523
498 Ga0495596_0010135 3300046500 Bacteria 4118
499 Ga0495596_0010676 3300046500 Bacteria 3991
500 Ga0495596_0012118 3300046500 Bacteria 3700
501 Ga0495596_0037335 3300046500 Bacteria 1921
502 Ga0495607_0000473 3300046501 Bacteria 40325
503 Ga0495607_0000984 3300046501 Bacteria 26388
504 Ga0495607_0003885 3300046501 Bacteria 11256
505 Ga0495607_0031534 3300046501 Bacteria 3244
506 Ga0495607_0055116 3300046501 Bacteria 2288
507 Ga0495607_0064406 3300046501 Bacteria 2070
508 Ga0495583_0000055 3300046506 Bacteria 201245
509 Ga0495583_0000100 3300046506 Bacteria 145745
510 Ga0495583_0000117 3300046506 Bacteria 135061
511 Ga0495583_0000314 3300046506 Bacteria 76522
512 Ga0495583_0000792 3300046506 Bacteria 39204
513 Ga0495583_0001305 3300046506 Bacteria 25935
514 Ga0495583_0003790 3300046506 Bacteria 11230
515 Ga0495583_0036350 3300046506 Bacteria 2344
516 Ga0495583_0038279 3300046506 Bacteria 2266
517 Ga0495583_0039360 3300046506 Bacteria 2228
518 Ga0495606_0000053 3300046507 Bacteria 200818
519 Ga0495606_0000059 3300046507 Bacteria 186886
520 Ga0495606_0004757 3300046507 Bacteria 13358
521 Ga0495606_0008214 3300046507 Bacteria 9125
522 Ga0495606_0013949 3300046507 Bacteria 6305
523 Ga0495606_0019668 3300046507 Bacteria 5011
524 Ga0495606_0044306 3300046507 Bacteria 2960
525 Ga0495606_0075230 3300046507 Bacteria 2113
526 Ga0495606_0117201 3300046507 Bacteria 1598
527 Ga0495606_0125542 3300046507 Bacteria 1531
528 Ga0495610_0000008 3300046512 Bacteria 622732
529 Ga0495610_0000556 3300046512 Bacteria 37327
530 Ga0495610_0000771 3300046512 Bacteria 30226
531 Ga0495610_0002195 3300046512 Bacteria 16525
532 Ga0495610_0007885 3300046512 Bacteria 6996
533 Ga0495610_0022630 3300046512 Bacteria 3433
534 Ga0495610_0039922 3300046512 Bacteria 2370
535 Ga0495616_0000035 3300046513 Bacteria 128636
536 Ga0495616_0000080 3300046513 Bacteria 81238
537 Ga0495616_0003689 3300046513 Bacteria 9782
538 Ga0495616_0011085 3300046513 Bacteria 5180
539 Ga0495616_0011853 3300046513 Bacteria 4969
540 Ga0495616_0023409 3300046513 Bacteria 3322
541 Ga0495616_0035134 3300046513 Bacteria 2596
542 Ga0495618_0080682 3300046514 Bacteria 2076
543 Ga0495620_0000351 3300046515 Bacteria 31904
544 Ga0495628_0003503 3300046516 Bacteria 14044
545 Ga0495628_0028044 3300046516 Bacteria 4579
546 Ga0495630_0002597 3300046517 Bacteria 12524
547 Ga0495630_0074389 3300046517 Bacteria 2558
548 Ga0495630_0084314 3300046517 Bacteria 2399
549 Ga0495631_0003168 3300046518 Bacteria 9050
550 Ga0495631_0008273 3300046518 Bacteria 5244
551 Ga0495631_0011965 3300046518 Bacteria 4254
552 Ga0495631_0018765 3300046518 Bacteria 3252
553 Ga0495631_0019353 3300046518 Bacteria 3193
554 Ga0495631_0026730 3300046518 Bacteria 2646
555 Ga0495631_0026941 3300046518 Bacteria 2634
556 Ga0495631_0036889 3300046518 Bacteria 2180
557 Ga0495632_0000044 3300046519 Bacteria 141051
558 Ga0495632_0000066 3300046519 Bacteria 115170
559 Ga0495632_0000285 3300046519 Bacteria 49299
560 Ga0495632_0011220 3300046519 Bacteria 5243
561 Ga0495632_0095856 3300046519 Bacteria 1401
562 Ga0495637_0000009 3300046520 Bacteria 402028
563 Ga0495637_0000189 3300046520 Bacteria 48390
564 Ga0495637_0007240 3300046520 Bacteria 5518
565 Ga0495637_0009788 3300046520 Bacteria 4664
566 Ga0495643_0000022 3300046522 Bacteria 289691
567 Ga0495643_0000094 3300046522 Bacteria 150795
568 Ga0495643_0026589 3300046522 Bacteria 3263
569 Ga0495643_0056149 3300046522 Bacteria 2103
570 Ga0495643_0065384 3300046522 Bacteria 1920
571 Ga0495644_0006445 3300046523 Bacteria 4547
572 Ga0495644_0007635 3300046523 Bacteria 4169
573 Ga0495644_0010658 3300046523 Bacteria 3540
574 Ga0495644_0011124 3300046523 Bacteria 3468
575 Ga0495648_0000411 3300046524 Bacteria 47243
576 Ga0495648_0001558 3300046524 Bacteria 22405
577 Ga0495648_0005347 3300046524 Bacteria 10699
578 Ga0495648_0019087 3300046524 Bacteria 4834
579 Ga0495648_0021267 3300046524 Bacteria 4498
580 Ga0495648_0025112 3300046524 Bacteria 4039
581 Ga0495648_0032359 3300046524 Bacteria 3433
582 Ga0495648_0045189 3300046524 Bacteria 2742
583 Ga0495648_0063905 3300046524 Bacteria 2170
584 Ga0495663_0004172 3300046525 Bacteria 4083
585 Ga0495663_0022815 3300046525 Bacteria 1810
586 Ga0495663_0035034 3300046525 Bacteria 1506
587 Ga0495666_0004909 3300046526 Bacteria 6765
588 Ga0495666_0007197 3300046526 Bacteria 5586
589 Ga0495666_0017775 3300046526 Bacteria 3541
590 Ga0495642_0000012 3300046528 Bacteria 127229
591 Ga0495642_0002273 3300046528 Bacteria 7846
592 Ga0495642_0014066 3300046528 Bacteria 3101
593 Ga0495642_0016372 3300046528 Bacteria 2889
594 Ga0495642_0018803 3300046528 Bacteria 2705
595 Ga0495642_0109106 3300046528 Bacteria 1182
596 Ga0495652_0018714 3300046529 Bacteria 6173
597 Ga0495652_0020109 3300046529 Bacteria 5937
598 Ga0495652_0030202 3300046529 Bacteria 4755
599 Ga0495654_0000002 3300046530 Bacteria 1021205
600 Ga0495654_0011218 3300046530 Bacteria 4860
601 Ga0495654_0061171 3300046530 Bacteria 1809
602 Ga0495665_0000097 3300046531 Bacteria 40415
603 Ga0495665_0015244 3300046531 Bacteria 4141
604 Ga0495665_0065446 3300046531 Bacteria 1919
605 Ga0495665_0125272 3300046531 Bacteria 1345
606 Ga0495665_0146228 3300046531 Bacteria 1234
607 Ga0495640_0002599 3300046533 Bacteria 14518
608 Ga0495640_0064218 3300046533 Bacteria 2483
609 Ga0495586_0003981 3300046535 Bacteria 7924
610 Ga0495587_0016570 3300046536 Bacteria 4584
611 Ga0495587_0026273 3300046536 Bacteria 3551
612 Ga0495609_0000177 3300046538 Bacteria 64469
613 Ga0495609_0000981 3300046538 Bacteria 20439
614 Ga0495609_0001757 3300046538 Bacteria 13913
615 Ga0495609_0008006 3300046538 Bacteria 5218
616 Ga0495609_0021747 3300046538 Bacteria 2959
617 Ga0495609_0079108 3300046538 Bacteria 1438
618 Ga0495597_0000009 3300046542 Bacteria 227319
619 Ga0495597_0000055 3300046542 Bacteria 95175
620 Ga0495597_0000672 3300046542 Bacteria 27772
621 Ga0495597_0005908 3300046542 Bacteria 6392
622 Ga0495597_0011159 3300046542 Bacteria 4361
623 Ga0495597_0015727 3300046542 Bacteria 3580
624 Ga0495597_0016538 3300046542 Bacteria 3482
625 Ga0495645_0002089 3300046543 Bacteria 13565
626 Ga0495645_0019718 3300046543 Bacteria 4857
627 Ga0495645_0039510 3300046543 Bacteria 3441
628 Ga0495622_0000009 3300046557 Bacteria 224622
629 Ga0495622_0000128 3300046557 Bacteria 65352
630 Ga0495633_0000050 3300046558 Bacteria 155466
631 Ga0495633_0012260 3300046558 Bacteria 4570
632 Ga0495633_0030058 3300046558 Bacteria 2640
633 Ga0495633_0057903 3300046558 Bacteria 1819
634 Ga0495633_0073416 3300046558 Bacteria 1594
635 Ga0495667_0103145 3300046559 Bacteria 1845
636 Ga0495656_0014920 3300046615 Bacteria 2922
637 Ga0495668_0000006 3300046616 Bacteria 553404
638 Ga0495668_0000027 3300046616 Bacteria 297194
639 Ga0495668_0000350 3300046616 Bacteria 61356
640 Ga0495668_0000353 3300046616 Bacteria 61110
641 Ga0495668_0001625 3300046616 Bacteria 20999
642 Ga0495668_0007466 3300046616 Bacteria 6986
643 Ga0495668_0023465 3300046616 Bacteria 3517
644 Ga0495668_0063250 3300046616 Bacteria 2038
645 Ga0495668_0082766 3300046616 Bacteria 1760
646 Ga0495668_0105224 3300046616 Bacteria 1543
647 Ga0495634_0014394 3300046642 Bacteria 5706
648 Ga0495634_0079051 3300046642 Bacteria 2154
649 Ga0495611_0000311 3300046648 Bacteria 32985
650 Ga0495611_0007917 3300046648 Bacteria 4511
651 Ga0495611_0027492 3300046648 Bacteria 2486
652 Ga0495611_0039772 3300046648 Bacteria 2094
653 Ga0495611_0041086 3300046648 Bacteria 2062
654 Ga0495625_0003531 3300046660 Bacteria 15480
655 Ga0495625_0005763 3300046660 Bacteria 11200
656 Ga0495625_0014914 3300046660 Bacteria 6180
657 Ga0495625_0039909 3300046660 Bacteria 3426
658 Ga0495625_0149651 3300046660 Bacteria 1570
659 Ga0495625_0238049 3300046660 Bacteria 1186
660 Ga0495659_0009489 3300046664 Bacteria 3107
661 Ga0495661_0000531 3300046665 Bacteria 39271
662 Ga0495661_0033987 3300046665 Bacteria 3212
663 Ga0495661_0036495 3300046665 Bacteria 3077
664 Ga0495661_0051487 3300046665 Bacteria 2486
665 Ga0495661_0065344 3300046665 Bacteria 2144
666 Ga0495661_0075402 3300046665 Bacteria 1960
667 Ga0495661_0086346 3300046665 Bacteria 1796
668 Ga0495661_0181877 3300046665 Bacteria 1113
669 Ga0495588_0029914 3300046674 Bacteria 2734
670 Ga0495588_0062678 3300046674 Bacteria 1927
671 Ga0495588_0091777 3300046674 Bacteria 1591
672 Ga0495599_0066007 3300046678 Bacteria 2261
673 Ga0495623_0003969 3300046679 Bacteria 9738
674 Ga0495646_0006689 3300046680 Bacteria 7309
675 Ga0495647_0021282 3300046681 Bacteria 2334
676 Ga0495647_0064955 3300046681 Bacteria 1448
677 Ga0495669_0000017 3300046684 Bacteria 131447
678 Ga0495669_0005081 3300046684 Bacteria 5474
679 Ga0495669_0017390 3300046684 Bacteria 3086
680 Ga0495669_0024204 3300046684 Bacteria 2645
681 Ga0495669_0076352 3300046684 Bacteria 1533
682 Ga0495613_0038721 3300046689 Bacteria 3534
683 Ga0495613_0086690 3300046689 Bacteria 2270
684 Ga0495624_0000316 3300046690 Bacteria 38401
685 Ga0495624_0004924 3300046690 Bacteria 9682
686 Ga0495624_0015579 3300046690 Bacteria 5130
687 Ga0495624_0054496 3300046690 Bacteria 2521
688 Ga0495670_0008894 3300046691 Bacteria 4939
689 Ga0495670_0020761 3300046691 Bacteria 3239
690 Ga0495670_0023483 3300046691 Bacteria 3043
691 Ga0495670_0025810 3300046691 Bacteria 2907
692 Ga0495671_0000002 3300046692 Bacteria 1136189
693 Ga0495671_0000469 3300046692 Bacteria 31566
694 Ga0495671_0013575 3300046692 Bacteria 4404
695 Ga0495649_0000546 3300046694 Bacteria 31916
696 Ga0495649_0020472 3300046694 Bacteria 3711
697 Ga0495649_0024363 3300046694 Bacteria 3375
698 Ga0495649_0026329 3300046694 Bacteria 3235
699 Ga0495649_0075244 3300046694 Bacteria 1808
700 Ga0495589_0000102 3300046794 Bacteria 82380
701 Ga0495589_0001114 3300046794 Bacteria 16022
702 Ga0495589_0016132 3300046794 Bacteria 3838
703 Ga0495589_0080051 3300046794 Bacteria 1589
704 Ga0495589_0080682 3300046794 Bacteria 1583
705 Ga0495589_0100900 3300046794 Bacteria 1396
706 Ga0495660_0003891 3300046810 Bacteria 9128
707 Ga0495660_0019284 3300046810 Bacteria 3916
708 Ga0495660_0020441 3300046810 Bacteria 3795
709 Ga0495660_0043022 3300046810 Bacteria 2493
710 Ga0495660_0070542 3300046810 Bacteria 1854
711 Ga0495581_0002330 3300047315 Bacteria 10701
712 Ga0495581_0006456 3300047315 Bacteria 6805
713 Ga0495581_0027224 3300047315 Bacteria 3315
714 Ga0495604_0012826 3300047317 Bacteria 6674
715 Ga0495604_0062580 3300047317 Bacteria 2842
716 Ga0495604_0090387 3300047317 Bacteria 2274
717 Ga0495636_0037515 3300047318 Bacteria 2001
718 Ga0495636_0112751 3300047318 Bacteria 1197
719 Ga0495674_0000923 3300047319 Bacteria 28086
720 Ga0495674_0003405 3300047319 Bacteria 15455
721 Ga0495674_0007608 3300047319 Bacteria 10351
722 Ga0495674_0012637 3300047319 Bacteria 7956
723 Ga0495674_0163125 3300047319 Bacteria 1863
724 Ga0495674_0193456 3300047319 Bacteria 1689
725 Ga0495672_0000131 3300047320 Bacteria 111562
726 Ga0495672_0000290 3300047320 Bacteria 69104
727 Ga0495672_0000738 3300047320 Bacteria 35882
728 Ga0495672_0001642 3300047320 Bacteria 21746
729 Ga0495672_0025534 3300047320 Bacteria 3778
730 Ga0495672_0087181 3300047320 Bacteria 1724
731 Ga0495676_0044397 3300047321 Bacteria 3628
732 Ga0495676_0135153 3300047321 Bacteria 1774
733 Ga0495680_0001842 3300047322 Bacteria 22357
734 Ga0495680_0006432 3300047322 Bacteria 10918
735 Ga0495680_0035667 3300047322 Bacteria 4004
736 Ga0495683_0000160 3300047323 Bacteria 65995
737 Ga0495683_0071165 3300047323 Bacteria 1707
738 Ga0495683_0104951 3300047323 Bacteria 1355
739 Ga0495687_000034 3300047443 Bacteria 257321
740 Ga0495687_000048 3300047443 Bacteria 205967
741 Ga0495687_000550 3300047443 Bacteria 44560
742 Ga0495687_001509 3300047443 Bacteria 21213
743 Ga0495687_005005 3300047443 Bacteria 8659
744 Ga0495675_0004046 3300047444 Bacteria 8887
745 Ga0495677_0000085 3300047445 Bacteria 48240
746 Ga0495677_0004620 3300047445 Bacteria 5255
747 Ga0495677_0005820 3300047445 Bacteria 4665
748 Ga0495677_0024761 3300047445 Bacteria 2177
749 Ga0495677_0035575 3300047445 Bacteria 1817
750 Ga0495677_0036393 3300047445 Bacteria 1798
751 Ga0495677_0057661 3300047445 Bacteria 1436
752 Ga0495677_0067032 3300047445 Bacteria 1335
753 Ga0495679_011256 3300047446 Bacteria 3465
754 Ga0495679_024963 3300047446 Bacteria 2005
755 Ga0495685_002522 3300047447 Bacteria 5746
756 Ga0495685_012896 3300047447 Bacteria 2833
757 Ga0495685_046097 3300047447 Bacteria 1483
758 Ga0495685_048914 3300047447 Bacteria 1437
759 Ga0495673_0000005 3300047469 Bacteria 943364
760 Ga0495673_0000059 3300047469 Bacteria 233234
761 Ga0495673_0000067 3300047469 Bacteria 219908
762 Ga0495673_0011100 3300047469 Bacteria 4866
763 Ga0495681_0000269 3300047470 Bacteria 41587
764 Ga0495681_0002027 3300047470 Bacteria 14779
765 Ga0495681_0073047 3300047470 Bacteria 1549
766 Ga0495684_0003539 3300047471 Bacteria 12218
767 Ga0495684_0018009 3300047471 Bacteria 5442
768 Ga0495684_0033143 3300047471 Bacteria 3964
769 Ga0495686_0000135 3300047472 Bacteria 148920
770 Ga0495686_0012055 3300047472 Bacteria 6073
771 Ga0495686_0020942 3300047472 Bacteria 4354
772 Ga0495686_0026380 3300047472 Bacteria 3801
773 Ga0495593_0000787 3300047673 Bacteria 18362
774 Ga0495593_0003596 3300047673 Bacteria 9258
775 Ga0495593_0006297 3300047673 Bacteria 6965
776 Ga0495593_0006547 3300047673 Bacteria 6819
777 Ga0495593_0008040 3300047673 Bacteria 6137
778 Ga0495602_0019299 3300048088 Bacteria 6774
779 Ga0495602_0049914 3300048088 Bacteria 3743
780 Ga0495614_0000655 3300048089 Bacteria 14492
781 Ga0495615_0000090 3300048090 Bacteria 26651
782 Ga0495626_0000015 3300048091 Bacteria 232238
783 Ga0495626_0002439 3300048091 Bacteria 12912
784 Ga0495626_0005763 3300048091 Bacteria 7145
785 Ga0495626_0012922 3300048091 Bacteria 4357
786 Ga0495626_0023280 3300048091 Bacteria 3052
787 Ga0495626_0052382 3300048091 Bacteria 1881
788 Ga0495626_0055004 3300048091 Bacteria 1826
789 Ga0495626_0114231 3300048091 Bacteria 1166
790 Ga0496100_0171307 3300048903 Bacteria 1563
791 Ga0496101_0062832 3300048904 Bacteria 2701
792 Ga0496102_0000101 3300048905 Bacteria 123198
793 Ga0496102_0000437 3300048905 Bacteria 47555
794 Ga0496102_0076585 3300048905 Bacteria 3077
795 Ga0496102_0106931 3300048905 Bacteria 2604
796 Ga0496103_0013818 3300048906 Bacteria 4793
797 Ga0496103_0033628 3300048906 Bacteria 3132
798 Ga0496103_0035675 3300048906 Bacteria 3045
799 Ga0496104_0013762 3300048907 Bacteria 7297
800 Ga0496105_0039366 3300048908 Bacteria 3896
801 Ga0496107_0094146 3300048910 Bacteria 2192
802 Ga0496109_0015097 3300048912 Bacteria 6723
803 Ga0496110_0000001 3300048913 Bacteria 232652
804 Ga0496110_0042658 3300048913 Bacteria 3960
805 Ga0496110_0193506 3300048913 Bacteria 1847
806 Ga0496110_0337279 3300048913 Bacteria 1373
807 Ga0496112_0021563 3300048915 Bacteria 6128
808 Ga0496113_0000447 3300048916 Bacteria 20018
809 Ga0496114_0016647 3300048917 Bacteria 5929
810 Ga0496114_0047896 3300048917 Bacteria 3555
811 Ga0496119_0042509 3300048922 Bacteria 2880
812 Ga0496120_0001365 3300048923 Bacteria 29928
813 Ga0496120_0021525 3300048923 Bacteria 4075
814 Ga0496121_0070897 3300048924 Bacteria 2804
815 Ga0496121_0137174 3300048924 Bacteria 1821
816 Ga0496121_0139723 3300048924 Bacteria 1799
817 Ga0496121_0194771 3300048924 Bacteria 1450
818 Ga0496122_0001169 3300048925 Bacteria 44889
819 Ga0496122_0004108 3300048925 Bacteria 18427
820 Ga0496122_0050551 3300048925 Bacteria 3169
821 Ga0496123_0001064 3300048926 Bacteria 41497
822 Ga0496123_0004336 3300048926 Bacteria 15028
823 Ga0496123_0007104 3300048926 Bacteria 10637
824 Ga0496123_0147219 3300048926 Bacteria 1277
825 Ga0496124_0005968 3300048927 Bacteria 13453
826 Ga0496124_0007668 3300048927 Bacteria 11416
827 Ga0496124_0026267 3300048927 Bacteria 5255
828 Ga0496124_0041894 3300048927 Bacteria 3947
829 Ga0496124_0085686 3300048927 Bacteria 2581
830 Ga0496124_0286204 3300048927 Bacteria 1199
831 Ga0496125_0011546 3300048928 Bacteria 8824
832 Ga0496125_0189281 3300048928 Bacteria 1361
833 Ga0496126_0002152 3300048929 Bacteria 27443
834 Ga0496126_0024193 3300048929 Bacteria 5866
835 Ga0496126_0042436 3300048929 Bacteria 4201
836 Ga0496126_0088348 3300048929 Bacteria 2730
837 Ga0496126_0097812 3300048929 Bacteria 2572
838 Ga0496126_0102895 3300048929 Bacteria 2496
839 Ga0496126_0206076 3300048929 Bacteria 1658
840 Ga0496126_0365375 3300048929 Bacteria 1178
841 Ga0495678_000071 3300049459 Bacteria 128709
842 Ga0495678_000092 3300049459 Bacteria 114501
843 Ga0495678_000100 3300049459 Bacteria 106118
844 Ga0495678_000562 3300049459 Bacteria 35639
845 Ga0495678_000574 3300049459 Bacteria 34979
846 Ga0495678_001283 3300049459 Bacteria 20328
847 Ga0495678_009839 3300049459 Bacteria 4694
848 Ga0495678_029020 3300049459 Bacteria 2327
849 Ga0495682_0000066 3300049460 Bacteria 97829
850 Ga0495682_0006833 3300049460 Bacteria 4594
851 Ga0495682_0015804 3300049460 Bacteria 2858
852 Ga0501033_0012115 3300049570 Bacteria 6583
853 Ga0501033_0025514 3300049570 Bacteria 4453
854 Ga0501033_0141149 3300049570 Bacteria 1741
855 Ga0501036_0001539 3300049572 Bacteria 17819
856 Ga0501036_0017070 3300049572 Bacteria 6068
857 Ga0501036_0019669 3300049572 Bacteria 5669
858 Ga0501036_0051445 3300049572 Bacteria 3488
859 Ga0501036_0097595 3300049572 Bacteria 2484
860 Ga0501038_0000983 3300049574 Bacteria 25585
861 Ga0501038_0001449 3300049574 Bacteria 21794
862 Ga0501038_0117021 3300049574 Bacteria 2202
863 Ga0501039_0000223 3300049575 Bacteria 41655
864 Ga0501039_0027408 3300049575 Bacteria 4381
865 Ga0501040_0000073 3300049576 Bacteria 48338
866 Ga0501040_0087357 3300049576 Bacteria 2165
867 Ga0501040_0106558 3300049576 Bacteria 1958
868 Ga0501041_0008206 3300049577 Bacteria 6147
869 Ga0501041_0009275 3300049577 Bacteria 5794
870 Ga0501041_0065199 3300049577 Bacteria 2231
871 Ga0501042_0000169 3300049578 Bacteria 30114
872 Ga0501042_0008157 3300049578 Bacteria 6899
873 Ga0501042_0065113 3300049578 Bacteria 2605
874 Ga0501043_0000053 3300049579 Bacteria 106085
875 Ga0501043_0099436 3300049579 Bacteria 2287
876 Ga0501043_0279726 3300049579 Bacteria 1279
877 Ga0501046_0000018 3300049580 Bacteria 220589
878 Ga0501046_0037357 3300049580 Bacteria 3903
879 Ga0501046_0038066 3300049580 Bacteria 3862
880 Ga0501046_0161851 3300049580 Bacteria 1683
881 Ga0501047_0000020 3300049581 Bacteria 259377
882 Ga0501047_0053445 3300049581 Bacteria 3906
883 Ga0501047_0142759 3300049581 Bacteria 2272
884 Ga0501048_0000167 3300049582 Bacteria 41216
885 Ga0501048_0005219 3300049582 Bacteria 9892
886 Ga0501048_0010984 3300049582 Bacteria 6756
887 Ga0501067_0065581 3300049583 Bacteria 2010
888 Ga0501068_0016008 3300049584 Bacteria 4319
889 Ga0501068_0216222 3300049584 Bacteria 1218
890 Ga0501069_0132329 3300049585 Bacteria 1428
891 Ga0501069_0169818 3300049585 Bacteria 1258
892 Ga0501070_0006281 3300049586 Bacteria 10112
893 Ga0501070_0056453 3300049586 Bacteria 3255
894 Ga0501070_0090867 3300049586 Bacteria 2527
895 Ga0501070_0247151 3300049586 Bacteria 1460
896 Ga0501071_0000160 3300049587 Bacteria 28746
897 Ga0501071_0059970 3300049587 Bacteria 2754
898 Ga0501072_0000890 3300049588 Bacteria 21918
899 Ga0501072_0000995 3300049588 Bacteria 20951
900 Ga0501073_0084056 3300049589 Bacteria 2215
901 Ga0501073_0216064 3300049589 Bacteria 1325
902 Ga0501074_0006489 3300049590 Bacteria 8449
903 Ga0501074_0032276 3300049590 Bacteria 3793
904 Ga0501074_0062972 3300049590 Bacteria 2672
905 Ga0501074_0117684 3300049590 Bacteria 1901
906 Ga0501075_0000005 3300049591 Bacteria 112003
907 Ga0501075_0000068 3300049591 Bacteria 45392
908 Ga0501076_0000014 3300049592 Bacteria 97509
909 Ga0501076_0000024 3300049592 Bacteria 78719
910 Ga0501076_0014841 3300049592 Bacteria 5876
911 Ga0501076_0204564 3300049592 Bacteria 1612
912 Ga0501077_0000248 3300049593 Bacteria 31988
913 Ga0501077_0016102 3300049593 Bacteria 4711
914 Ga0501077_0037286 3300049593 Bacteria 3097
915 Ga0501077_0044770 3300049593 Bacteria 2811
916 Ga0501079_0000025 3300049741 Bacteria 62163
917 Ga0501079_0014104 3300049741 Bacteria 6091
918 Ga0501080_0001721 3300049742 Bacteria 18697
919 Ga0501080_0021361 3300049742 Bacteria 5992
920 Ga0501080_0083312 3300049742 Bacteria 2971
921 Ga0501080_0121170 3300049742 Bacteria 2424
922 Ga0501080_0413242 3300049742 Bacteria 1213
923 Ga0501080_0448196 3300049742 Bacteria 1157
924 Ga0501081_0000007 3300049743 Bacteria 73600
925 Ga0501081_0013224 3300049743 Bacteria 5427
926 Ga0501081_0022564 3300049743 Bacteria 4213
927 Ga0501081_0105267 3300049743 Bacteria 1998
928 Ga0501081_0138769 3300049743 Bacteria 1741
929 Ga0501083_0008644 3300049744 Bacteria 7187
930 Ga0501035_0013335 3300049822 Bacteria 7584
931 Ga0501035_0105238 3300049822 Bacteria 2474
932 Ga0501035_0118312 3300049822 Bacteria 2318
933 Ga0501044_0001029 3300049823 Bacteria 33592
934 Ga0501044_0099539 3300049823 Bacteria 2926
935 Ga0501044_0255709 3300049823 Bacteria 1691
936 Ga0501045_0000003 3300049824 Bacteria 88725
937 Ga0501045_0002602 3300049824 Bacteria 12303
938 Ga0501045_0024218 3300049824 Bacteria 4356
939 Ga0501045_0030962 3300049824 Bacteria 3874
940 Ga0501045_0229092 3300049824 Bacteria 1383
941 nmdc:mga03n38_96369_c1 3300050490 Bacteria 1419
942 nmdc:mga00v17_44215_c1 3300050491 Bacteria 2686
943 nmdc:mga0k408_43237_c1 3300050493 Bacteria 2596
944 nmdc:mga06z11_144218_c1 3300050494 Bacteria 1348
945 nmdc:mga06z11_64616_c1 3300050494 Bacteria 1919
946 nmdc:mga04h51_10581_c1 3300050495 Bacteria 2538
947 nmdc:mga07m45_24707_c2 3300050496 Bacteria 1749
948 nmdc:mga05p37_652_c1 3300050507 Bacteria 38364
949 nmdc:mga0qj67_134453_c1 3300050509 Bacteria 2003
950 nmdc:mga06r32_38689_c1 3300050510 Bacteria 4521
951 nmdc:mga08y16_283407_c1 3300050511 Bacteria 1709
952 nmdc:mga08x19_57524_c1 3300050514 Bacteria 2513
953 nmdc:mga0sz30_43295_c1 3300050516 Bacteria 1895
954 Ga0495601_0001429 3300053077 Bacteria 13150
955 Ga0500643_043954 3300053087 Bacteria 1301
956 Ga0500583_0003224 3300053092 Bacteria 5086
957 Ga0500651_0083462 3300053093 Bacteria 1977
958 Ga0500650_0000016 3300053098 Bacteria 70975
959 Ga0500555_000125 3300053103 Bacteria 36635
960 Ga0500556_0008611 3300053104 Bacteria 2947
961 Ga0500595_044607 3300053119 Bacteria 1404
962 Ga0500618_000187 3300053125 Bacteria 50730
963 Ga0500658_0016231 3300053134 Bacteria 2773
964 Ga0500568_0031391 3300053139 Bacteria 2193
965 Ga0500588_0003016 3300053146 Unclassified 3510
966 Ga0500604_0009644 3300053151 Bacteria 2574
967 Ga0500616_0000085 3300053153 Bacteria 193192
968 Ga0500616_0046502 3300053153 Bacteria 2307
969 Ga0500645_001226 3300053730 Bacteria 13522
970 Ga0500645_007461 3300053730 Bacteria 3805
971 Ga0501084_0002287 3300054114 Bacteria 15381
972 Ga0501084_0008211 3300054114 Bacteria 8613
973 Ga0501084_0033507 3300054114 Bacteria 4297
974 Ga0587090_005911 3300059510 Bacteria 1554
975 Ga0501082_0000062 3300060353 Bacteria 77313
976 Ga0501082_0023279 3300060353 Bacteria 5343
977 Ga0501082_0154630 3300060353 Bacteria 1993
978 Ga0530510_0000062 3300061734 Bacteria 52768
979 Ga0530510_0000201 3300061734 Bacteria 36954
980 Ga0530510_0093688 3300061734 Bacteria 2193
981 Ga0530510_0217878 3300061734 Bacteria 1418
982 2509141272 2508501127 Bacteria 7037543
983 2513556885 2513237082 Bacteria 8640282
984 2513564892 2513237083 Bacteria 8410967
985 2514590420 2513237351 Bacteria 6968952
986 2525556280 2524614729 Bacteria 3091755
987 2563064119 2562617112 Bacteria 10918404
988 2597815495 2597489875 Bacteria 7010078
989 2630649510 2627854209 Bacteria 3093011
990 2644287921 2643221651 Bacteria 4798932
991 2644737527 2643221734 Bacteria 5365412
992 2713472393 2711768613 Bacteria 11048459
993 2738827981 2738541297 Bacteria 6549566
994 2739151777 2738541357 Bacteria 6549408
995 2739194202 2738543003 Bacteria 6549560
996 2739305704 2738543024 Bacteria 5603683
997 2739320173 2738543026 Bacteria 6549408
998 2739338919 2738543029 Bacteria 6549249
999 2778126350 2775507255 Bacteria 3945731
1000 2819553216 2818991438 Bacteria 5793701
1001 2821132733 2821131069 Bacteria 6108407
1002 2824618536 2824617872 Bacteria 8814715
1003 2824627249 2824626560 Bacteria 8813858
1004 2824635535 2824635225 Bacteria 8785348
1005 2824644371 2824644064 Bacteria 8743947
1006 2824716812 2824714736 Bacteria 8717648
1007 2824725500 2824723954 Bacteria 8758240
1008 2841735434 2841734538 Bacteria 6784580
1009 2852683884 2852680915 Bacteria 4100189
1010 2856347601 2856342000 Bacteria 7176905
1011 2857562065 2857558681 Bacteria 6617694
1012 2857566802 2857564685 Bacteria 6290584
1013 2869168956 2869162929 Bacteria 6399702
1014 2871479687 2871474448 Bacteria 6806570
1015 2878796705 2878788777 Bacteria 6567085
1016 2881414782 2881412998 Bacteria 6492157
1017 2883294893 2883291878 Bacteria 5894118
1018 2885315522 2885312484 Bacteria 6415165
1019 2888349398 2888343758 Bacteria 6611049
1020 2894023462 2894023352 Bacteria 5167372
1021 2900642227 2900634093 Bacteria 10263517
1022 2904549692 2904541872 Bacteria 8915136
1023 2917702878 2917699015 Bacteria 7043791
1024 2921650169 2921643360 Bacteria 11448031
1025 2924755239 2924754689 Bacteria 6774424
1026 2929168461 2929160207 Bacteria 9075316
1027 2937842251 2937836603 Bacteria 6811263
1028 2938021679 2938014810 Bacteria 6700592
1029 2958075570 2958071322 Bacteria 6815895
1030 2970531017 2970524798 Bacteria 6840927
1031 2970543282 2970540015 Bacteria 6977556
1032 2984567235 2984564862 Bacteria 4339992
1033 2996312385 2996310559 Bacteria 6357320
1034 8003960762 8003955200 Bacteria 8601927
1035 8004639505 8004633249 Bacteria 6723080
1036 8055228882 8055225921 Bacteria 3341787
1037 8055623814 8055617313 Bacteria 7548464
1038 Ga0265325_10005792
1039 JGI24736J21556_1002424
1040 JGI24741J21665_1000034
1041 JGI24740J21852_10000403
1042 JGI24739J22299_10000059
1043 JGI24737J22298_10000084
1044 JGI24735J21928_10000109
1045 JGI25154J39366_1001838
1046 JGI25151J46595_10000030
1047 JGI25406J46586_10005781
1048 JGI25406J46586_10030970
1049 Ga0055526_1000013
1050 Ga0055526_1000019
1051 Ga0055526_1000368
1052 Ga0055526_1000502
1053 Ga0055526_1001266
1054 Ga0055537_1000159
1055 Ga0055524_1000069
1056 Ga0055524_1000469
1057 Ga0055524_1009528
1058 Ga0055534_1000045
1059 Ga0055528_1000323
1060 Ga0055530_10000160
1061 Ga0055530_10000630
1062 Ga0055540_1000173
1063 Ga0055531_10005811
1064 Ga0055543_1006928
1065 Ga0065165_1000243
1066 Ga0065707_10119488
1067 Ga0070658_10049172
1068 Ga0070676_10002512
1069 Ga0070676_10002638
1070 Ga0070676_10120668
1071 Ga0070690_100164033
1072 Ga0070670_100000052
1073 Ga0070677_10000311
1074 Ga0070666_10007951
1075 Ga0070666_10009376
1076 Ga0070666_10012511
1077 Ga0070666_10027544
1078 Ga0070682_100017170
1079 Ga0068868_100003668
1080 Ga0068868_100201892
1081 Ga0070661_100004880
1082 Ga0070668_100002357
1083 Ga0070668_100049834
1084 Ga0070669_100006210
1085 Ga0070675_100063964
1086 Ga0070671_100000043
1087 Ga0070671_100021300
1088 Ga0070671_100230895
1089 Ga0070674_100007399
1090 Ga0070667_100000021
1091 Ga0070667_100005451
1092 Ga0070667_100162598
1093 Ga0070714_100125240
1094 Ga0070711_100176618
1095 Ga0070705_100093787
1096 Ga0070663_100005315
1097 Ga0070678_100003476
1098 Ga0070662_100002384
1099 Ga0070681_10000746
1100 Ga0068867_100008363
1101 Ga0068867_100029996
1102 Ga0070685_10000002
1103 Ga0070685_10020498
1104 Ga0070706_100108730
1105 Ga0070706_100309292
1106 Ga0070707_100425834
1107 Ga0070698_100066406
1108 Ga0070698_100104724
1109 Ga0070679_100007841
1110 Ga0068853_100002265
1111 Ga0068853_100035764
1112 Ga0068853_100043248
1113 Ga0068853_100076250
1114 Ga0070672_100013917
1115 Ga0070672_100064851
1116 Ga0070696_100061739
1117 Ga0070693_100004068
1118 Ga0070665_100002758
1119 Ga0070665_100012190
1120 Ga0070665_100074772
1121 Ga0070704_100345089
1122 Ga0068855_100001912
1123 Ga0068855_100078234
1124 Ga0070664_100027829
1125 Ga0070664_100185300
1126 Ga0068857_100004902
1127 Ga0068857_100270444
1128 Ga0068854_100002245
1129 Ga0068854_100197870
1130 Ga0068856_100002241
1131 Ga0068852_100002292
1132 Ga0068859_100011410
1133 Ga0068859_100152228
1134 Ga0068859_100215222
1135 Ga0068864_100000219
1136 Ga0068864_100170677
1137 Ga0068861_100022703
1138 Ga0068861_100047335
1139 Ga0068861_100126034
1140 Ga0068851_10002958
1141 Ga0068851_10094263
1142 Ga0068863_100008937
1143 Ga0068863_100039472
1144 Ga0068863_100066373
1145 Ga0068863_100093670
1146 Ga0068858_100056739
1147 Ga0068858_100402127
1148 Ga0068860_100000015
1149 Ga0068860_100001564
1150 Ga0068860_100051949
1151 Ga0068860_100133889
1152 Ga0068860_100146437
1153 Ga0068862_100001673
1154 Ga0068862_100006372
1155 Ga0068862_100088433
1156 Ga0068862_100120093
1157 Ga0081455_10000391
1158 Ga0081540_1003425
1159 Ga0081539_10000203
1160 Ga0081539_10000316
1161 Ga0075368_10052603
1162 Ga0075363_100000506
1163 Ga0075363_100053469
1164 Ga0075363_100057444
1165 Ga0075362_10013292
1166 Ga0075367_10048860
1167 Ga0075369_10019359
1168 Ga0075366_10120826
1169 Ga0097621_100028254
1170 Ga0075370_10025155
1171 Ga0075428_100169101
1172 Ga0075431_100032041
1173 Ga0075431_100033531
1174 Ga0075431_100138743
1175 Ga0075429_100058235
1176 Ga0068865_100041090
1177 Ga0097620_100011410
1178 Ga0097620_100152237
1179 Ga0097620_100215225
1180 Ga0079104_1000294
1181 Ga0075435_100147607
1182 Ga0099794_10000703
1183 Ga0099794_10023616
1184 Ga0099795_10002134
1185 Ga0099795_10038661
1186 Ga0105244_10004592
1187 Ga0105240_10009713
1188 Ga0105240_10017325
1189 Ga0105240_10021363
1190 Ga0105240_10080085
1191 Ga0111539_10130613
1192 Ga0111539_10150922
1193 Ga0111539_10226551
1194 Ga0105245_10001099
1195 Ga0105247_10026286
1196 Ga0114129_10000523
1197 Ga0105243_10000293
1198 Ga0105241_10014586
1199 Ga0105248_10000851
1200 Ga0105248_10022168
1201 Ga0105248_10096218
1202 Ga0105248_10123808
1203 Ga0105237_10053764
1204 Ga0105237_10196031
1205 Ga0105237_10235451
1206 Ga0105238_10000493
1207 Ga0105238_10006619
1208 Ga0105249_10018235
1209 Ga0105249_10031571
1210 Ga0105249_10070334
1211 Ga0105249_10306810
1212 Ga0099796_10000651
1213 Ga0105239_10055846
1214 Ga0157373_10044194
1215 Ga0157371_10004600
1216 Ga0157370_10124958
1217 Ga0157369_10026347
1218 Ga0171462_1013
1219 Ga0157378_10009277
1220 Ga0157378_10175857
1221 Ga0163162_10234112
1222 Ga0157372_10072967
1223 Ga0157375_10005737
1224 Ga0157375_10051189
1225 Ga0157375_10404997
1226 Ga0163163_10004461
1227 Ga0182008_10124288
1228 Ga0157379_10157466
1229 Ga0157379_10297689
1230 Ga0157379_10409934
1231 Ga0157376_10132038
1232 Ga0157376_10270986
1233 Ga0183361_10003
1234 Ga0163161_10037715
1235 Ga0213872_10000019
1236 Ga0213872_10001794
1237 Ga0213872_10003169
1238 Ga0213874_10024099
1239 Ga0213874_10038923
1240 Ga0213876_10000611
1241 Ga0213875_10001414
1242 Ga0213875_10003941
1243 Ga0213875_10007514
1244 Ga0209437_103668
1245 Ga0209646_1000007
1246 Ga0209565_1000003
1247 Ga0209673_1000003
1248 Ga0209675_1000003
1249 Ga0209675_1000909
1250 Ga0209675_1016544
1251 Ga0209676_1000267
1252 Ga0209025_1000063
1253 Ga0209564_1000002
1254 Ga0209564_1000007
1255 Ga0209564_1000012
1256 Ga0209564_1000043
1257 Ga0209564_1000052
1258 Ga0209050_1000915
1259 Ga0209050_1000916
1260 Ga0209050_1010784
1261 Ga0209256_1000036
1262 Ga0209256_1000172
1263 Ga0209256_1000697
1264 Ga0209051_1000230
1265 Ga0209051_1000379
1266 Ga0209257_1000141
1267 Ga0209257_1000676
1268 Ga0209257_1028785
1269 Ga0207656_10010386
1270 Ga0207656_10066613
1271 Ga0207682_10000061
1272 Ga0207642_10116554
1273 Ga0207710_10150175
1274 Ga0207680_10000489
1275 Ga0207680_10031077
1276 Ga0207680_10107901
1277 Ga0207647_10000817
1278 Ga0207645_10003267
1279 Ga0207645_10036693
1280 Ga0207643_10015602
1281 Ga0207705_10072679
1282 Ga0207684_10068853
1283 Ga0207684_10263923
1284 Ga0207695_10037969
1285 Ga0207695_10067720
1286 Ga0207695_10068557
1287 Ga0207662_10081503
1288 Ga0207649_10020345
1289 Ga0207681_10007036
1290 Ga0207681_10075811
1291 Ga0207694_10000397
1292 Ga0207694_10063477
1293 Ga0207650_10000002
1294 Ga0207650_10060737
1295 Ga0207659_10146894
1296 Ga0207659_10163884
1297 Ga0207687_10002035
1298 Ga0207644_10000372
1299 Ga0207644_10005509
1300 Ga0207644_10039648
1301 Ga0207644_10089089
1302 Ga0207706_10000744
1303 Ga0207706_10009544
1304 Ga0207706_10042045
1305 Ga0207706_10231483
1306 Ga0207706_10279438
1307 Ga0207709_10000076
1308 Ga0207704_10052278
1309 Ga0207691_10000016
1310 Ga0207691_10024116
1311 Ga0207711_10002050
1312 Ga0207711_10003955
1313 Ga0207689_10105939
1314 Ga0207679_10088532
1315 Ga0207679_10137793
1316 Ga0207667_10051563
1317 Ga0207667_10098298
1318 Ga0207651_10029503
1319 Ga0207712_10019361
1320 Ga0207712_10026403
1321 Ga0207668_10010412
1322 Ga0207668_10049405
1323 Ga0207640_10065584
1324 Ga0207658_10000001
1325 Ga0207658_10001061
1326 Ga0207658_10005073
1327 Ga0207658_10025287
1328 Ga0207658_10130949
1329 Ga0207658_10361965
1330 Ga0207703_10067840
1331 Ga0207703_10092071
1332 Ga0207639_10000632
1333 Ga0207639_10037373
1334 Ga0207639_10061248
1335 Ga0207639_10062057
1336 Ga0207678_10000914
1337 Ga0207678_10013650
1338 Ga0207702_10001373
1339 Ga0207702_10020598
1340 Ga0207641_10008740
1341 Ga0207641_10050012
1342 Ga0207641_10224594
1343 Ga0207648_10004401
1344 Ga0207648_10005187
1345 Ga0207676_10000001
1346 Ga0207676_10014847
1347 Ga0207676_10181994
1348 Ga0207676_10208096
1349 Ga0207676_10395469
1350 Ga0207674_10001538
1351 Ga0207674_10021564
1352 Ga0207675_100039056
1353 Ga0207675_100056394
1354 Ga0207675_100160883
1355 Ga0207683_10000322
1356 Ga0207683_10175467
1357 Ga0209281_1000423
1358 Ga0209179_1000828
1359 Ga0268266_10007343
1360 Ga0268266_10009218
1361 Ga0268266_10013731
1362 Ga0268266_10023392
1363 Ga0268266_10121103
1364 Ga0268265_10083838
1365 Ga0268265_10084293
1366 Ga0268265_10356246
1367 Ga0268264_10000002
1368 Ga0268264_10000004
1369 Ga0268264_10000014
1370 Ga0268264_10009680
1371 Ga0268264_10042701
1372 Ga0307515_10000006
1373 Ga0307515_10063025
1374 Ga0307511_10000025
1375 Ga0316177_1212761
1376 Ga0265340_10144815
1377 Ga0265339_10010596
1378 Ga0265327_10001131
1379 Ga0265327_10008872
1380 Ga0265327_10010715
1381 Ga0307408_100060395
1382 Ga0307408_100075499
1383 Ga0265313_10040486
1384 Ga0265314_10029756
1385 Ga0316576_10124408
1386 Ga0316576_10267391
1387 Ga0316578_10053225
1388 Ga0307516_10046623
1389 Ga0307405_10033113
1390 Ga0307405_10140183
1391 Ga0316577_10019978
1392 Ga0307413_10110899
1393 Ga0307518_10222053
1394 Ga0307410_10137388
1395 Ga0307410_10173092
1396 Ga0307406_10012195
1397 Ga0307406_10091859
1398 Ga0307407_10005506
1399 Ga0307412_10024218
1400 Ga0307412_10168454
1401 Ga0307409_100005750
1402 Ga0307414_10026730
1403 Ga0307414_10094848
1404 Ga0307415_100273674
1405 Ga0307507_10035925
1406 Ga0307510_10001839
1407 Ga0307510_10039902
1408 Ga0307510_10202941
1409 Ga0373926_0014404
1410 Ga0373923_0009335
1411 Ga0373936_0017021
1412 Ga0373936_0068214
1413 Ga0373945_0026017
1414 Ga0373943_0003641
1415 Ga0373946_0002251
1416 Ga0373946_0007659
1417 Ga0373955_0040066
1418 Ga0373924_0039566
1419 Ga0373931_0016354
1420 Ga0373935_0004899
1421 Ga0373935_0019897
1422 Ga0373935_0056067
1423 Ga0373927_0002255
1424 Ga0373927_0002256
1425 Ga0373947_0001432
1426 Ga0373947_0204067
1427 Ga0316584_0016657
1428 Ga0373925_0000104
1429 Ga0373925_0000976
1430 Ga0373925_0075408
1431 Ga0395899_0000361
1432 Ga0395899_0013123
1433 Ga0395899_0262044
1434 Ga0395900_0000046
1435 Ga0395900_0000237
1436 Ga0395900_0064772
1437 Ga0395900_0166403
1438 Ga0395900_0190827
1439 Ga0395900_0296593
1440 Ga0395905_0000498
1441 Ga0395905_0087405
1442 Ga0395905_0124786
1443 Ga0395905_0167522
1444 Ga0395905_0173861
1445 Ga0395905_0187495
1446 Ga0395905_0315121
1447 Ga0436364_0473640
1448 Ga0436364_0563933
1449 Ga0436364_0786035
1450 Ga0436364_0804800
1451 Ga0395901_0000028
1452 Ga0395901_0100110
1453 Ga0395901_0452827
1454 Ga0400483_068090
1455 Ga0436365_1595143
1456 Ga0436360_0787362
1457 Ga0436361_0075382
1458 Ga0436361_0330198
1459 Ga0436361_0352948
1460 Ga0436361_0635819
1461 Ga0436361_1127083
1462 Ga0436363_0240244
1463 Ga0436363_1348059
1464 Ga0439441_005803
1465 Ga0439449_0054328
1466 Ga0450904_000658
1467 Ga0451577_0001960
1468 Ga0451577_0034963
1469 Ga0451577_0040418
1470 Ga0453683_0262854
1471 Ga0466965_0112314
1472 Ga0466966_0002584
1473 Ga0451576_0000025
1474 Ga0495617_000060
1475 Ga0495617_000072
1476 Ga0495617_018523
1477 Ga0495627_000272
1478 Ga0495627_000489
1479 Ga0495603_0069937
1480 Ga0495603_0125092
1481 Ga0495590_0000005
1482 Ga0495590_0000008
1483 Ga0495590_0000424
1484 Ga0495590_0000562
1485 Ga0495590_0010969
1486 Ga0495591_000051
1487 Ga0495629_0000365
1488 Ga0495629_0027120
1489 Ga0495629_0055488
1490 Ga0495629_0067560
1491 Ga0495638_0000027
1492 Ga0495638_0001965
1493 Ga0495638_0003652
1494 Ga0495641_0045723
1495 Ga0495653_0000880
1496 Ga0495653_0008489
1497 Ga0495653_0009298
1498 Ga0495653_0015205
1499 Ga0495653_0136800
1500 Ga0495653_0189182
1501 Ga0495650_0000044
1502 Ga0495650_0000185
1503 Ga0495650_0000323
1504 Ga0495650_0002258
1505 Ga0495650_0003969
1506 Ga0495650_0005067
1507 Ga0495650_0055439
1508 Ga0495580_0003410
1509 Ga0495580_0006376
1510 Ga0495582_0090689
1511 Ga0495605_0000049
1512 Ga0495605_0017778
1513 Ga0495605_0019852
1514 Ga0495639_0006411
1515 Ga0495662_0067417
1516 Ga0495664_0002204
1517 Ga0495664_0028490
1518 Ga0495584_0000001
1519 Ga0495584_0000024
1520 Ga0495584_0001263
1521 Ga0495584_0003873
1522 Ga0495584_0009495
1523 Ga0495585_0000040
1524 Ga0495585_0002248
1525 Ga0495585_0002439
1526 Ga0495585_0036912
1527 Ga0495585_0039002
1528 Ga0495585_0059017
1529 Ga0495585_0122419
1530 Ga0495594_0046635
1531 Ga0495594_0097782
1532 Ga0495596_0000714
1533 Ga0495596_0001374
1534 Ga0495596_0008634
1535 Ga0495596_0010135
1536 Ga0495596_0010676
1537 Ga0495596_0012118
1538 Ga0495596_0037335
1539 Ga0495607_0000473
1540 Ga0495607_0000984
1541 Ga0495607_0003885
1542 Ga0495607_0031534
1543 Ga0495607_0055116
1544 Ga0495607_0064406
1545 Ga0495583_0000055
1546 Ga0495583_0000100
1547 Ga0495583_0000117
1548 Ga0495583_0000314
1549 Ga0495583_0000792
1550 Ga0495583_0001305
1551 Ga0495583_0003790
1552 Ga0495583_0036350
1553 Ga0495583_0038279
1554 Ga0495583_0039360
1555 Ga0495606_0000053
1556 Ga0495606_0000059
1557 Ga0495606_0004757
1558 Ga0495606_0008214
1559 Ga0495606_0013949
1560 Ga0495606_0019668
1561 Ga0495606_0044306
1562 Ga0495606_0075230
1563 Ga0495606_0117201
1564 Ga0495606_0125542
1565 Ga0495610_0000008
1566 Ga0495610_0000556
1567 Ga0495610_0000771
1568 Ga0495610_0002195
1569 Ga0495610_0007885
1570 Ga0495610_0022630
1571 Ga0495610_0039922
1572 Ga0495616_0000035
1573 Ga0495616_0000080
1574 Ga0495616_0003689
1575 Ga0495616_0011085
1576 Ga0495616_0011853
1577 Ga0495616_0023409
1578 Ga0495616_0035134
1579 Ga0495618_0080682
1580 Ga0495620_0000351
1581 Ga0495628_0003503
1582 Ga0495628_0028044
1583 Ga0495630_0002597
1584 Ga0495630_0074389
1585 Ga0495630_0084314
1586 Ga0495631_0003168
1587 Ga0495631_0008273
1588 Ga0495631_0011965
1589 Ga0495631_0018765
1590 Ga0495631_0019353
1591 Ga0495631_0026730
1592 Ga0495631_0026941
1593 Ga0495631_0036889
1594 Ga0495632_0000044
1595 Ga0495632_0000066
1596 Ga0495632_0000285
1597 Ga0495632_0011220
1598 Ga0495632_0095856
1599 Ga0495637_0000009
1600 Ga0495637_0000189
1601 Ga0495637_0007240
1602 Ga0495637_0009788
1603 Ga0495643_0000022
1604 Ga0495643_0000094
1605 Ga0495643_0026589
1606 Ga0495643_0056149
1607 Ga0495643_0065384
1608 Ga0495644_0006445
1609 Ga0495644_0007635
1610 Ga0495644_0010658
1611 Ga0495644_0011124
1612 Ga0495648_0000411
1613 Ga0495648_0001558
1614 Ga0495648_0005347
1615 Ga0495648_0019087
1616 Ga0495648_0021267
1617 Ga0495648_0025112
1618 Ga0495648_0032359
1619 Ga0495648_0045189
1620 Ga0495648_0063905
1621 Ga0495663_0004172
1622 Ga0495663_0022815
1623 Ga0495663_0035034
1624 Ga0495666_0004909
1625 Ga0495666_0007197
1626 Ga0495666_0017775
1627 Ga0495642_0000012
1628 Ga0495642_0002273
1629 Ga0495642_0014066
1630 Ga0495642_0016372
1631 Ga0495642_0018803
1632 Ga0495642_0109106
1633 Ga0495652_0018714
1634 Ga0495652_0020109
1635 Ga0495652_0030202
1636 Ga0495654_0000002
1637 Ga0495654_0011218
1638 Ga0495654_0061171
1639 Ga0495665_0000097
1640 Ga0495665_0015244
1641 Ga0495665_0065446
1642 Ga0495665_0125272
1643 Ga0495665_0146228
1644 Ga0495640_0002599
1645 Ga0495640_0064218
1646 Ga0495586_0003981
1647 Ga0495587_0016570
1648 Ga0495587_0026273
1649 Ga0495609_0000177
1650 Ga0495609_0000981
1651 Ga0495609_0001757
1652 Ga0495609_0008006
1653 Ga0495609_0021747
1654 Ga0495609_0079108
1655 Ga0495597_0000009
1656 Ga0495597_0000055
1657 Ga0495597_0000672
1658 Ga0495597_0005908
1659 Ga0495597_0011159
1660 Ga0495597_0015727
1661 Ga0495597_0016538
1662 Ga0495645_0002089
1663 Ga0495645_0019718
1664 Ga0495645_0039510
1665 Ga0495622_0000009
1666 Ga0495622_0000128
1667 Ga0495633_0000050
1668 Ga0495633_0012260
1669 Ga0495633_0030058
1670 Ga0495633_0057903
1671 Ga0495633_0073416
1672 Ga0495667_0103145
1673 Ga0495656_0014920
1674 Ga0495668_0000006
1675 Ga0495668_0000027
1676 Ga0495668_0000350
1677 Ga0495668_0000353
1678 Ga0495668_0001625
1679 Ga0495668_0007466
1680 Ga0495668_0023465
1681 Ga0495668_0063250
1682 Ga0495668_0082766
1683 Ga0495668_0105224
1684 Ga0495634_0014394
1685 Ga0495634_0079051
1686 Ga0495611_0000311
1687 Ga0495611_0007917
1688 Ga0495611_0027492
1689 Ga0495611_0039772
1690 Ga0495611_0041086
1691 Ga0495625_0003531
1692 Ga0495625_0005763
1693 Ga0495625_0014914
1694 Ga0495625_0039909
1695 Ga0495625_0149651
1696 Ga0495625_0238049
1697 Ga0495659_0009489
1698 Ga0495661_0000531
1699 Ga0495661_0033987
1700 Ga0495661_0036495
1701 Ga0495661_0051487
1702 Ga0495661_0065344
1703 Ga0495661_0075402
1704 Ga0495661_0086346
1705 Ga0495661_0181877
1706 Ga0495588_0029914
1707 Ga0495588_0062678
1708 Ga0495588_0091777
1709 Ga0495599_0066007
1710 Ga0495623_0003969
1711 Ga0495646_0006689
1712 Ga0495647_0021282
1713 Ga0495647_0064955
1714 Ga0495669_0000017
1715 Ga0495669_0005081
1716 Ga0495669_0017390
1717 Ga0495669_0024204
1718 Ga0495669_0076352
1719 Ga0495613_0038721
1720 Ga0495613_0086690
1721 Ga0495624_0000316
1722 Ga0495624_0004924
1723 Ga0495624_0015579
1724 Ga0495624_0054496
1725 Ga0495670_0008894
1726 Ga0495670_0020761
1727 Ga0495670_0023483
1728 Ga0495670_0025810
1729 Ga0495671_0000002
1730 Ga0495671_0000469
1731 Ga0495671_0013575
1732 Ga0495649_0000546
1733 Ga0495649_0020472
1734 Ga0495649_0024363
1735 Ga0495649_0026329
1736 Ga0495649_0075244
1737 Ga0495589_0000102
1738 Ga0495589_0001114
1739 Ga0495589_0016132
1740 Ga0495589_0080051
1741 Ga0495589_0080682
1742 Ga0495589_0100900
1743 Ga0495660_0003891
1744 Ga0495660_0019284
1745 Ga0495660_0020441
1746 Ga0495660_0043022
1747 Ga0495660_0070542
1748 Ga0495581_0002330
1749 Ga0495581_0006456
1750 Ga0495581_0027224
1751 Ga0495604_0012826
1752 Ga0495604_0062580
1753 Ga0495604_0090387
1754 Ga0495636_0037515
1755 Ga0495636_0112751
1756 Ga0495674_0000923
1757 Ga0495674_0003405
1758 Ga0495674_0007608
1759 Ga0495674_0012637
1760 Ga0495674_0163125
1761 Ga0495674_0193456
1762 Ga0495672_0000131
1763 Ga0495672_0000290
1764 Ga0495672_0000738
1765 Ga0495672_0001642
1766 Ga0495672_0025534
1767 Ga0495672_0087181
1768 Ga0495676_0044397
1769 Ga0495676_0135153
1770 Ga0495680_0001842
1771 Ga0495680_0006432
1772 Ga0495680_0035667
1773 Ga0495683_0000160
1774 Ga0495683_0071165
1775 Ga0495683_0104951
1776 Ga0495687_000034
1777 Ga0495687_000048
1778 Ga0495687_000550
1779 Ga0495687_001509
1780 Ga0495687_005005
1781 Ga0495675_0004046
1782 Ga0495677_0000085
1783 Ga0495677_0004620
1784 Ga0495677_0005820
1785 Ga0495677_0024761
1786 Ga0495677_0035575
1787 Ga0495677_0036393
1788 Ga0495677_0057661
1789 Ga0495677_0067032
1790 Ga0495679_011256
1791 Ga0495679_024963
1792 Ga0495685_002522
1793 Ga0495685_012896
1794 Ga0495685_046097
1795 Ga0495685_048914
1796 Ga0495673_0000005
1797 Ga0495673_0000059
1798 Ga0495673_0000067
1799 Ga0495673_0011100
1800 Ga0495681_0000269
1801 Ga0495681_0002027
1802 Ga0495681_0073047
1803 Ga0495684_0003539
1804 Ga0495684_0018009
1805 Ga0495684_0033143
1806 Ga0495686_0000135
1807 Ga0495686_0012055
1808 Ga0495686_0020942
1809 Ga0495686_0026380
1810 Ga0495593_0000787
1811 Ga0495593_0003596
1812 Ga0495593_0006297
1813 Ga0495593_0006547
1814 Ga0495593_0008040
1815 Ga0495602_0019299
1816 Ga0495602_0049914
1817 Ga0495614_0000655
1818 Ga0495615_0000090
1819 Ga0495626_0000015
1820 Ga0495626_0002439
1821 Ga0495626_0005763
1822 Ga0495626_0012922
1823 Ga0495626_0023280
1824 Ga0495626_0052382
1825 Ga0495626_0055004
1826 Ga0495626_0114231
1827 Ga0496100_0171307
1828 Ga0496101_0062832
1829 Ga0496102_0000101
1830 Ga0496102_0000437
1831 Ga0496102_0076585
1832 Ga0496102_0106931
1833 Ga0496103_0013818
1834 Ga0496103_0033628
1835 Ga0496103_0035675
1836 Ga0496104_0013762
1837 Ga0496105_0039366
1838 Ga0496107_0094146
1839 Ga0496109_0015097
1840 Ga0496110_0000001
1841 Ga0496110_0042658
1842 Ga0496110_0193506
1843 Ga0496110_0337279
1844 Ga0496112_0021563
1845 Ga0496113_0000447
1846 Ga0496114_0016647
1847 Ga0496114_0047896
1848 Ga0496119_0042509
1849 Ga0496120_0001365
1850 Ga0496120_0021525
1851 Ga0496121_0070897
1852 Ga0496121_0137174
1853 Ga0496121_0139723
1854 Ga0496121_0194771
1855 Ga0496122_0001169
1856 Ga0496122_0004108
1857 Ga0496122_0050551
1858 Ga0496123_0001064
1859 Ga0496123_0004336
1860 Ga0496123_0007104
1861 Ga0496123_0147219
1862 Ga0496124_0005968
1863 Ga0496124_0007668
1864 Ga0496124_0026267
1865 Ga0496124_0041894
1866 Ga0496124_0085686
1867 Ga0496124_0286204
1868 Ga0496125_0011546
1869 Ga0496125_0189281
1870 Ga0496126_0002152
1871 Ga0496126_0024193
1872 Ga0496126_0042436
1873 Ga0496126_0088348
1874 Ga0496126_0097812
1875 Ga0496126_0102895
1876 Ga0496126_0206076
1877 Ga0496126_0365375
1878 Ga0495678_000071
1879 Ga0495678_000092
1880 Ga0495678_000100
1881 Ga0495678_000562
1882 Ga0495678_000574
1883 Ga0495678_001283
1884 Ga0495678_009839
1885 Ga0495678_029020
1886 Ga0495682_0000066
1887 Ga0495682_0006833
1888 Ga0495682_0015804
1889 Ga0501033_0012115
1890 Ga0501033_0025514
1891 Ga0501033_0141149
1892 Ga0501036_0001539
1893 Ga0501036_0017070
1894 Ga0501036_0019669
1895 Ga0501036_0051445
1896 Ga0501036_0097595
1897 Ga0501038_0000983
1898 Ga0501038_0001449
1899 Ga0501038_0117021
1900 Ga0501039_0000223
1901 Ga0501039_0027408
1902 Ga0501040_0000073
1903 Ga0501040_0087357
1904 Ga0501040_0106558
1905 Ga0501041_0008206
1906 Ga0501041_0009275
1907 Ga0501041_0065199
1908 Ga0501042_0000169
1909 Ga0501042_0008157
1910 Ga0501042_0065113
1911 Ga0501043_0000053
1912 Ga0501043_0099436
1913 Ga0501043_0279726
1914 Ga0501046_0000018
1915 Ga0501046_0037357
1916 Ga0501046_0038066
1917 Ga0501046_0161851
1918 Ga0501047_0000020
1919 Ga0501047_0053445
1920 Ga0501047_0142759
1921 Ga0501048_0000167
1922 Ga0501048_0005219
1923 Ga0501048_0010984
1924 Ga0501067_0065581
1925 Ga0501068_0016008
1926 Ga0501068_0216222
1927 Ga0501069_0132329
1928 Ga0501069_0169818
1929 Ga0501070_0006281
1930 Ga0501070_0056453
1931 Ga0501070_0090867
1932 Ga0501070_0247151
1933 Ga0501071_0000160
1934 Ga0501071_0059970
1935 Ga0501072_0000890
1936 Ga0501072_0000995
1937 Ga0501073_0084056
1938 Ga0501073_0216064
1939 Ga0501074_0006489
1940 Ga0501074_0032276
1941 Ga0501074_0062972
1942 Ga0501074_0117684
1943 Ga0501075_0000005
1944 Ga0501075_0000068
1945 Ga0501076_0000014
1946 Ga0501076_0000024
1947 Ga0501076_0014841
1948 Ga0501076_0204564
1949 Ga0501077_0000248
1950 Ga0501077_0016102
1951 Ga0501077_0037286
1952 Ga0501077_0044770
1953 Ga0501079_0000025
1954 Ga0501079_0014104
1955 Ga0501080_0001721
1956 Ga0501080_0021361
1957 Ga0501080_0083312
1958 Ga0501080_0121170
1959 Ga0501080_0413242
1960 Ga0501080_0448196
1961 Ga0501081_0000007
1962 Ga0501081_0013224
1963 Ga0501081_0022564
1964 Ga0501081_0105267
1965 Ga0501081_0138769
1966 Ga0501083_0008644
1967 Ga0501035_0013335
1968 Ga0501035_0105238
1969 Ga0501035_0118312
1970 Ga0501044_0001029
1971 Ga0501044_0099539
1972 Ga0501044_0255709
1973 Ga0501045_0000003
1974 Ga0501045_0002602
1975 Ga0501045_0024218
1976 Ga0501045_0030962
1977 Ga0501045_0229092
1978 nmdc:mga03n38_96369_c1
1979 nmdc:mga00v17_44215_c1
1980 nmdc:mga0k408_43237_c1
1981 nmdc:mga06z11_144218_c1
1982 nmdc:mga06z11_64616_c1
1983 nmdc:mga04h51_10581_c1
1984 nmdc:mga07m45_24707_c2
1985 nmdc:mga05p37_652_c1
1986 nmdc:mga0qj67_134453_c1
1987 nmdc:mga06r32_38689_c1
1988 nmdc:mga08y16_283407_c1
1989 nmdc:mga08x19_57524_c1
1990 nmdc:mga0sz30_43295_c1
1991 Ga0495601_0001429
1992 Ga0500643_043954
1993 Ga0500583_0003224
1994 Ga0500651_0083462
1995 Ga0500650_0000016
1996 Ga0500555_000125
1997 Ga0500556_0008611
1998 Ga0500595_044607
1999 Ga0500618_000187
2000 Ga0500658_0016231
2001 Ga0500568_0031391
2002 Ga0500588_0003016
2003 Ga0500604_0009644
2004 Ga0500616_0000085
2005 Ga0500616_0046502
2006 Ga0500645_001226
2007 Ga0500645_007461
2008 Ga0501084_0002287
2009 Ga0501084_0008211
2010 Ga0501084_0033507
2011 Ga0587090_005911
2012 Ga0501082_0000062
2013 Ga0501082_0023279
2014 Ga0501082_0154630
2015 Ga0530510_0000062
2016 Ga0530510_0000201
2017 Ga0530510_0093688
2018 Ga0530510_0217878
2019 2509141272
2020 2513556885
2021 2513564892
2022 2514590420
2023 2525556280
2024 2563064119
2025 2597815495
2026 2630649510
2027 2644287921
2028 2644737527
2029 2713472393
2030 2738827981
2031 2739151777
2032 2739194202
2033 2739305704
2034 2739320173
2035 2739338919
2036 2778126350
2037 2819553216
2038 2821132733
2039 2824618536
2040 2824627249
2041 2824635535
2042 2824644371
2043 2824716812
2044 2824725500
2045 2841735434
2046 2852683884
2047 2856347601
2048 2857562065
2049 2857566802
2050 2869168956
2051 2871479687
2052 2878796705
2053 2881414782
2054 2883294893
2055 2885315522
2056 2888349398
2057 2894023462
2058 2900642227
2059 2904549692
2060 2917702878
2061 2921650169
2062 2924755239
2063 2929168461
2064 2937842251
2065 2938021679
2066 2958075570
2067 2970531017
2068 2970543282
2069 2984567235
2070 2996312385
2071 8003960762
2072 8004639505
2073 8055228882
2074 8055623814

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

77

335

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9302 4 335
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9167 4 335
3att-assembly1.cif.gz_A crystal structure of rv3168 with atp 0.7529 6 329
2ppq-assembly1.cif.gz_A-2 crystal structure of the homoserine kinase from agrobacterium tumefaciens 0.7447 2 336
4dfb-assembly2.cif.gz_B "crystal structure of aminoglycoside phosphotransferase aph(2"")-id/aph(2"")-iva in complex with kanamycin" 0.744 23 322
ID Description Score Start End Superfamily
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9508 106 335 3.90.1200.10
af_O01590_328_568_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9431 105 338 3.90.1200.10
3dxpA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9402 105 335 3.90.1200.10
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9351 106 335 3.90.1200.10
af_Q8RWZ3_128_373_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9251 106 333 3.90.1200.10
ID Description Score Start End GO Terms
AF-A0A3B9AZX6-F1-model_v4 deleted 0.981 86 336
AF-A0A6L4A8W3-F1-model_v4 deleted 0.977 74 338
AF-A0A3N2QIF4-F1-model_v4 deleted 0.9754 1 339
AF-H0TE96-F1-model_v4 Putative aminoglycoside phosphotransferase 0.9753 4 338 GO:0016740
AF-A0A358J1J6-F1-model_v4 Phosphotransferase family protein 0.9737 142 340 GO:0016740

Map