F488743
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1037 | 288 | 1037 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0007278|Ga0395899_0007278_6637_6969 |
| Length | 110 |
| Sequence | LRRNDRAAKPAIMLIALVDIANLLLSVVTWIIIIQVILSWLFAFNVLNTSSQGVRTVAVAIDRITAPLYRPVRRILPDFGGIDFSPLVILILIQVIKKLLAGVVMQYYGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 219 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 220 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 223 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 261 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 268 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 270 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 274 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 275 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 276 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 277 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 281 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 283 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 284 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 285 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 3.66 |
| Rhizosphere | 95.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1020912 | 3300001904 | Bacteria | 1027 |
| 2 | JGI24741J21665_1008557 | 3300001915 | Bacteria | 1924 |
| 3 | JGI24741J21665_1008594 | 3300001915 | Bacteria | 1919 |
| 4 | JGI24747J21853_1002402 | 3300001978 | Bacteria | 1525 |
| 5 | JGI24747J21853_1011601 | 3300001978 | Bacteria | 893 |
| 6 | JGI24740J21852_10009374 | 3300001979 | Bacteria | 3836 |
| 7 | JGI24740J21852_10047433 | 3300001979 | Bacteria | 1254 |
| 8 | JGI24740J21852_10149131 | 3300001979 | Unclassified | 581 |
| 9 | JGI24739J22299_10077383 | 3300001989 | Bacteria | 1026 |
| 10 | JGI24739J22299_10084372 | 3300001989 | Bacteria | 972 |
| 11 | JGI24737J22298_10007721 | 3300001990 | Bacteria | 3625 |
| 12 | JGI24737J22298_10019478 | 3300001990 | Bacteria | 2170 |
| 13 | JGI24737J22298_10151273 | 3300001990 | Bacteria | 685 |
| 14 | JGI24737J22298_10207947 | 3300001990 | Bacteria | 577 |
| 15 | JGI24743J22301_10002872 | 3300001991 | Bacteria | 2655 |
| 16 | JGI24743J22301_10017326 | 3300001991 | Bacteria | 1351 |
| 17 | JGI24735J21928_10006140 | 3300002067 | Bacteria | 3966 |
| 18 | JGI24735J21928_10101212 | 3300002067 | Bacteria | 827 |
| 19 | JGI24735J21928_10214129 | 3300002067 | Bacteria | 559 |
| 20 | JGI24745J21846_1040230 | 3300002073 | Bacteria | 578 |
| 21 | JGI24738J21930_10046291 | 3300002075 | Bacteria | 885 |
| 22 | JGI24744J21845_10001585 | 3300002077 | Bacteria | 4537 |
| 23 | JGI24744J21845_10077148 | 3300002077 | Bacteria | 609 |
| 24 | JGI24034J26672_10032452 | 3300002239 | Bacteria | 855 |
| 25 | JGI24742J22300_10021446 | 3300002244 | Bacteria | 1103 |
| 26 | JGI24751J29686_10025650 | 3300002459 | Bacteria | 1223 |
| 27 | JGI24751J29686_10083501 | 3300002459 | Bacteria | 662 |
| 28 | JGI25406J46586_10057619 | 3300003203 | Bacteria | 1270 |
| 29 | rootL2_10140508 | 3300003322 | Bacteria | 1453 |
| 30 | Ga0065715_10432613 | 3300005293 | Bacteria | 828 |
| 31 | Ga0065715_11117021 | 3300005293 | Bacteria | 516 |
| 32 | Ga0070658_10066207 | 3300005327 | Bacteria | 2951 |
| 33 | Ga0070658_10075391 | 3300005327 | Bacteria | 2766 |
| 34 | Ga0070658_10085273 | 3300005327 | Bacteria | 2597 |
| 35 | Ga0070658_10163452 | 3300005327 | Bacteria | 1868 |
| 36 | Ga0070658_10165847 | 3300005327 | Bacteria | 1854 |
| 37 | Ga0070658_10272833 | 3300005327 | Bacteria | 1439 |
| 38 | Ga0070658_10426509 | 3300005327 | Bacteria | 1141 |
| 39 | Ga0070658_10592463 | 3300005327 | Bacteria | 961 |
| 40 | Ga0070658_11177287 | 3300005327 | Bacteria | 666 |
| 41 | Ga0070658_11330146 | 3300005327 | Bacteria | 624 |
| 42 | Ga0070676_10015404 | 3300005328 | Bacteria | 4218 |
| 43 | Ga0070676_10016027 | 3300005328 | Bacteria | 4139 |
| 44 | Ga0070676_10110959 | 3300005328 | Bacteria | 1708 |
| 45 | Ga0070676_10461999 | 3300005328 | Bacteria | 895 |
| 46 | Ga0070683_100038899 | 3300005329 | Bacteria | 4363 |
| 47 | Ga0070683_100211431 | 3300005329 | Bacteria | 1843 |
| 48 | Ga0070683_100428494 | 3300005329 | Bacteria | 1262 |
| 49 | Ga0070683_101088629 | 3300005329 | Bacteria | 768 |
| 50 | Ga0070690_100006336 | 3300005330 | Bacteria | 6709 |
| 51 | Ga0070690_100173019 | 3300005330 | Bacteria | 1487 |
| 52 | Ga0070690_100531153 | 3300005330 | Bacteria | 884 |
| 53 | Ga0070690_100536979 | 3300005330 | Bacteria | 880 |
| 54 | Ga0070670_100013225 | 3300005331 | Bacteria | 7070 |
| 55 | Ga0070670_100014982 | 3300005331 | Bacteria | 6654 |
| 56 | Ga0070670_100076532 | 3300005331 | Bacteria | 2875 |
| 57 | Ga0070670_100080502 | 3300005331 | Bacteria | 2799 |
| 58 | Ga0070670_100142924 | 3300005331 | Bacteria | 2069 |
| 59 | Ga0070670_100519148 | 3300005331 | Bacteria | 1060 |
| 60 | Ga0070670_101740013 | 3300005331 | Bacteria | 574 |
| 61 | Ga0070670_101937482 | 3300005331 | Bacteria | 543 |
| 62 | Ga0070677_10011735 | 3300005333 | Bacteria | 3028 |
| 63 | Ga0070677_10017057 | 3300005333 | Bacteria | 2594 |
| 64 | Ga0068869_100086966 | 3300005334 | Bacteria | 2344 |
| 65 | Ga0068869_101720882 | 3300005334 | Bacteria | 560 |
| 66 | Ga0070666_10005953 | 3300005335 | Bacteria | 7486 |
| 67 | Ga0070666_10048049 | 3300005335 | Bacteria | 2866 |
| 68 | Ga0070666_10065966 | 3300005335 | Bacteria | 2456 |
| 69 | Ga0070666_10166582 | 3300005335 | Bacteria | 1542 |
| 70 | Ga0070666_10261028 | 3300005335 | Bacteria | 1228 |
| 71 | Ga0070666_10397347 | 3300005335 | Bacteria | 991 |
| 72 | Ga0070666_10437209 | 3300005335 | Bacteria | 944 |
| 73 | Ga0070666_10949706 | 3300005335 | Bacteria | 637 |
| 74 | Ga0070666_11010986 | 3300005335 | Bacteria | 617 |
| 75 | Ga0070680_100024380 | 3300005336 | Bacteria | 4832 |
| 76 | Ga0070680_101948317 | 3300005336 | Bacteria | 509 |
| 77 | Ga0070680_101964372 | 3300005336 | Bacteria | 507 |
| 78 | Ga0070682_100074295 | 3300005337 | Bacteria | 2183 |
| 79 | Ga0070682_100471395 | 3300005337 | Bacteria | 966 |
| 80 | Ga0068868_100015245 | 3300005338 | Bacteria | 5681 |
| 81 | Ga0068868_100048166 | 3300005338 | Bacteria | 3343 |
| 82 | Ga0068868_100061889 | 3300005338 | Bacteria | 2966 |
| 83 | Ga0068868_100064262 | 3300005338 | Bacteria | 2913 |
| 84 | Ga0068868_100490199 | 3300005338 | Bacteria | 1075 |
| 85 | Ga0068868_100499257 | 3300005338 | Bacteria | 1065 |
| 86 | Ga0068868_101153908 | 3300005338 | Bacteria | 715 |
| 87 | Ga0068868_101436788 | 3300005338 | Bacteria | 644 |
| 88 | Ga0070660_100000156 | 3300005339 | Bacteria | 44192 |
| 89 | Ga0070660_100002966 | 3300005339 | Bacteria | 11674 |
| 90 | Ga0070660_100016614 | 3300005339 | Bacteria | 5346 |
| 91 | Ga0070660_100028293 | 3300005339 | Bacteria | 4192 |
| 92 | Ga0070660_100064071 | 3300005339 | Bacteria | 2859 |
| 93 | Ga0070660_100072385 | 3300005339 | Bacteria | 2693 |
| 94 | Ga0070660_100144401 | 3300005339 | Bacteria | 1911 |
| 95 | Ga0070660_100277699 | 3300005339 | Bacteria | 1370 |
| 96 | Ga0070660_100341182 | 3300005339 | Bacteria | 1233 |
| 97 | Ga0070660_100651836 | 3300005339 | Bacteria | 882 |
| 98 | Ga0070660_101339846 | 3300005339 | Unclassified | 608 |
| 99 | Ga0070660_101795208 | 3300005339 | Bacteria | 522 |
| 100 | Ga0070689_100158173 | 3300005340 | Bacteria | 1830 |
| 101 | Ga0070691_10658536 | 3300005341 | Bacteria | 624 |
| 102 | Ga0070661_100034708 | 3300005344 | Bacteria | 3659 |
| 103 | Ga0070661_100036795 | 3300005344 | Bacteria | 3557 |
| 104 | Ga0070661_100069996 | 3300005344 | Bacteria | 2580 |
| 105 | Ga0070661_100081244 | 3300005344 | Bacteria | 2393 |
| 106 | Ga0070661_100087732 | 3300005344 | Bacteria | 2302 |
| 107 | Ga0070661_100128134 | 3300005344 | Bacteria | 1905 |
| 108 | Ga0070661_100129254 | 3300005344 | Bacteria | 1896 |
| 109 | Ga0070661_100303823 | 3300005344 | Bacteria | 1243 |
| 110 | Ga0070661_100374693 | 3300005344 | Bacteria | 1121 |
| 111 | Ga0070661_100504222 | 3300005344 | Bacteria | 969 |
| 112 | Ga0070692_10278260 | 3300005345 | Bacteria | 1013 |
| 113 | Ga0070692_10411460 | 3300005345 | Bacteria | 856 |
| 114 | Ga0070692_10514304 | 3300005345 | Bacteria | 778 |
| 115 | Ga0070668_100379161 | 3300005347 | Bacteria | 1203 |
| 116 | Ga0070668_100840641 | 3300005347 | Unclassified | 818 |
| 117 | Ga0070668_102037572 | 3300005347 | Bacteria | 529 |
| 118 | Ga0070669_100033518 | 3300005353 | Bacteria | 3715 |
| 119 | Ga0070669_100164872 | 3300005353 | Bacteria | 1724 |
| 120 | Ga0070669_100452609 | 3300005353 | Bacteria | 1058 |
| 121 | Ga0070669_100454631 | 3300005353 | Bacteria | 1056 |
| 122 | Ga0070669_100966435 | 3300005353 | Bacteria | 730 |
| 123 | Ga0070675_100023558 | 3300005354 | Bacteria | 4925 |
| 124 | Ga0070675_100180001 | 3300005354 | Bacteria | 1827 |
| 125 | Ga0070675_100210201 | 3300005354 | Bacteria | 1691 |
| 126 | Ga0070675_100257207 | 3300005354 | Bacteria | 1529 |
| 127 | Ga0070675_100924480 | 3300005354 | Bacteria | 800 |
| 128 | Ga0070671_100000051 | 3300005355 | Bacteria | 79207 |
| 129 | Ga0070671_100006975 | 3300005355 | Bacteria | 9048 |
| 130 | Ga0070671_100033206 | 3300005355 | Bacteria | 4267 |
| 131 | Ga0070671_100059930 | 3300005355 | Bacteria | 3168 |
| 132 | Ga0070671_100143990 | 3300005355 | Bacteria | 2012 |
| 133 | Ga0070671_100235834 | 3300005355 | Bacteria | 1553 |
| 134 | Ga0070671_100259607 | 3300005355 | Bacteria | 1476 |
| 135 | Ga0070671_100306390 | 3300005355 | Bacteria | 1352 |
| 136 | Ga0070671_100420832 | 3300005355 | Bacteria | 1144 |
| 137 | Ga0070671_101540279 | 3300005355 | Bacteria | 589 |
| 138 | Ga0070674_100011997 | 3300005356 | Bacteria | 5306 |
| 139 | Ga0070674_100014729 | 3300005356 | Bacteria | 4866 |
| 140 | Ga0070674_100026956 | 3300005356 | Bacteria | 3760 |
| 141 | Ga0070674_100051171 | 3300005356 | Bacteria | 2846 |
| 142 | Ga0070674_100175509 | 3300005356 | Bacteria | 1637 |
| 143 | Ga0070674_100389875 | 3300005356 | Unclassified | 1135 |
| 144 | Ga0070674_101351730 | 3300005356 | Bacteria | 637 |
| 145 | Ga0070673_100011602 | 3300005364 | Bacteria | 6020 |
| 146 | Ga0070673_100011732 | 3300005364 | Bacteria | 5992 |
| 147 | Ga0070673_100114366 | 3300005364 | Bacteria | 2242 |
| 148 | Ga0070673_100155841 | 3300005364 | Bacteria | 1938 |
| 149 | Ga0070673_100302014 | 3300005364 | Bacteria | 1409 |
| 150 | Ga0070673_100376767 | 3300005364 | Bacteria | 1264 |
| 151 | Ga0070673_100413693 | 3300005364 | Bacteria | 1208 |
| 152 | Ga0070673_100677424 | 3300005364 | Bacteria | 946 |
| 153 | Ga0070673_101754116 | 3300005364 | Bacteria | 588 |
| 154 | Ga0070688_100554371 | 3300005365 | Bacteria | 874 |
| 155 | Ga0070688_101610996 | 3300005365 | Bacteria | 530 |
| 156 | Ga0070659_100003926 | 3300005366 | Bacteria | 10583 |
| 157 | Ga0070659_100061929 | 3300005366 | Bacteria | 2957 |
| 158 | Ga0070659_100066651 | 3300005366 | Bacteria | 2853 |
| 159 | Ga0070659_100083062 | 3300005366 | Bacteria | 2560 |
| 160 | Ga0070659_100083740 | 3300005366 | Bacteria | 2549 |
| 161 | Ga0070659_100098258 | 3300005366 | Bacteria | 2354 |
| 162 | Ga0070659_100199196 | 3300005366 | Bacteria | 1648 |
| 163 | Ga0070659_100482086 | 3300005366 | Bacteria | 1055 |
| 164 | Ga0070659_101002831 | 3300005366 | Bacteria | 733 |
| 165 | Ga0070659_101047034 | 3300005366 | Bacteria | 718 |
| 166 | Ga0070659_101341076 | 3300005366 | Bacteria | 635 |
| 167 | Ga0070659_101394140 | 3300005366 | Bacteria | 623 |
| 168 | Ga0070659_101427693 | 3300005366 | Bacteria | 616 |
| 169 | Ga0070659_101650748 | 3300005366 | Bacteria | 573 |
| 170 | Ga0070667_100001311 | 3300005367 | Bacteria | 22374 |
| 171 | Ga0070667_100025802 | 3300005367 | Bacteria | 4887 |
| 172 | Ga0070667_100065494 | 3300005367 | Bacteria | 3085 |
| 173 | Ga0070667_100104177 | 3300005367 | Bacteria | 2454 |
| 174 | Ga0070667_100569914 | 3300005367 | Bacteria | 1042 |
| 175 | Ga0070667_101376340 | 3300005367 | Bacteria | 662 |
| 176 | Ga0070667_101669081 | 3300005367 | Bacteria | 599 |
| 177 | Ga0070667_101798653 | 3300005367 | Bacteria | 577 |
| 178 | Ga0070709_10081361 | 3300005434 | Bacteria | 2114 |
| 179 | Ga0070709_11415187 | 3300005434 | Unclassified | 563 |
| 180 | Ga0070714_100055739 | 3300005435 | Bacteria | 3379 |
| 181 | Ga0070714_100063691 | 3300005435 | Bacteria | 3171 |
| 182 | Ga0070714_100252100 | 3300005435 | Bacteria | 1632 |
| 183 | Ga0070714_101824868 | 3300005435 | Bacteria | 594 |
| 184 | Ga0070713_100032969 | 3300005436 | Bacteria | 4144 |
| 185 | Ga0070713_100202477 | 3300005436 | Bacteria | 1793 |
| 186 | Ga0070713_100449365 | 3300005436 | Bacteria | 1210 |
| 187 | Ga0070701_10395867 | 3300005438 | Bacteria | 874 |
| 188 | Ga0070711_101876006 | 3300005439 | Bacteria | 526 |
| 189 | Ga0070663_100010764 | 3300005455 | Bacteria | 5711 |
| 190 | Ga0070663_100020658 | 3300005455 | Bacteria | 4363 |
| 191 | Ga0070663_100026400 | 3300005455 | Bacteria | 3934 |
| 192 | Ga0070663_100093271 | 3300005455 | Bacteria | 2234 |
| 193 | Ga0070663_100271906 | 3300005455 | Bacteria | 1347 |
| 194 | Ga0070663_100387113 | 3300005455 | Bacteria | 1140 |
| 195 | Ga0070663_100391081 | 3300005455 | Bacteria | 1134 |
| 196 | Ga0070663_100561215 | 3300005455 | Bacteria | 955 |
| 197 | Ga0070663_101370547 | 3300005455 | Bacteria | 626 |
| 198 | Ga0070663_101402024 | 3300005455 | Bacteria | 619 |
| 199 | Ga0070678_100001121 | 3300005456 | Bacteria | 14070 |
| 200 | Ga0070678_100002490 | 3300005456 | Bacteria | 10099 |
| 201 | Ga0070678_100034382 | 3300005456 | Bacteria | 3529 |
| 202 | Ga0070678_100137937 | 3300005456 | Bacteria | 1948 |
| 203 | Ga0070678_100206575 | 3300005456 | Bacteria | 1624 |
| 204 | Ga0070678_100344490 | 3300005456 | Bacteria | 1279 |
| 205 | Ga0070662_100001195 | 3300005457 | Bacteria | 15948 |
| 206 | Ga0070662_100004959 | 3300005457 | Bacteria | 8456 |
| 207 | Ga0070662_100014122 | 3300005457 | Bacteria | 5327 |
| 208 | Ga0070662_100017911 | 3300005457 | Bacteria | 4782 |
| 209 | Ga0070662_100039331 | 3300005457 | Bacteria | 3363 |
| 210 | Ga0070662_100039339 | 3300005457 | Bacteria | 3363 |
| 211 | Ga0070662_100045906 | 3300005457 | Bacteria | 3137 |
| 212 | Ga0070662_100058911 | 3300005457 | Bacteria | 2796 |
| 213 | Ga0070662_100078053 | 3300005457 | Bacteria | 2459 |
| 214 | Ga0070662_100189587 | 3300005457 | Bacteria | 1625 |
| 215 | Ga0070662_100198471 | 3300005457 | Bacteria | 1591 |
| 216 | Ga0070662_100294846 | 3300005457 | Bacteria | 1316 |
| 217 | Ga0070662_100653742 | 3300005457 | Unclassified | 887 |
| 218 | Ga0070662_101502363 | 3300005457 | Bacteria | 581 |
| 219 | Ga0070681_10058866 | 3300005458 | Bacteria | 3822 |
| 220 | Ga0070681_10288180 | 3300005458 | Bacteria | 1552 |
| 221 | Ga0070681_11016448 | 3300005458 | Bacteria | 749 |
| 222 | Ga0068867_100022766 | 3300005459 | Bacteria | 4482 |
| 223 | Ga0068867_100368578 | 3300005459 | Bacteria | 1203 |
| 224 | Ga0068867_100493649 | 3300005459 | Bacteria | 1051 |
| 225 | Ga0068867_101153741 | 3300005459 | Bacteria | 710 |
| 226 | Ga0068867_101331753 | 3300005459 | Unclassified | 664 |
| 227 | Ga0070685_10129542 | 3300005466 | Bacteria | 1576 |
| 228 | Ga0070679_100009722 | 3300005530 | Bacteria | 9098 |
| 229 | Ga0070679_100019156 | 3300005530 | Bacteria | 6649 |
| 230 | Ga0070679_100174555 | 3300005530 | Bacteria | 2121 |
| 231 | Ga0070679_100372922 | 3300005530 | Unclassified | 1374 |
| 232 | Ga0070679_100754260 | 3300005530 | Bacteria | 916 |
| 233 | Ga0070679_101353121 | 3300005530 | Unclassified | 658 |
| 234 | Ga0070679_101421165 | 3300005530 | Bacteria | 640 |
| 235 | Ga0070684_100068081 | 3300005535 | Bacteria | 3129 |
| 236 | Ga0070684_102115280 | 3300005535 | Bacteria | 531 |
| 237 | Ga0068853_100025405 | 3300005539 | Bacteria | 4969 |
| 238 | Ga0068853_100387060 | 3300005539 | Bacteria | 1307 |
| 239 | Ga0068853_100469235 | 3300005539 | Bacteria | 1185 |
| 240 | Ga0068853_100522702 | 3300005539 | Bacteria | 1122 |
| 241 | Ga0068853_100640747 | 3300005539 | Bacteria | 1011 |
| 242 | Ga0068853_101155853 | 3300005539 | Unclassified | 747 |
| 243 | Ga0068853_101276403 | 3300005539 | Bacteria | 710 |
| 244 | Ga0068853_101483083 | 3300005539 | Bacteria | 657 |
| 245 | Ga0068853_101643763 | 3300005539 | Bacteria | 622 |
| 246 | Ga0070672_100003335 | 3300005543 | Bacteria | 10402 |
| 247 | Ga0070672_100015335 | 3300005543 | Bacteria | 5454 |
| 248 | Ga0070672_100128397 | 3300005543 | Bacteria | 2081 |
| 249 | Ga0070672_100278366 | 3300005543 | Bacteria | 1414 |
| 250 | Ga0070672_100300936 | 3300005543 | Bacteria | 1359 |
| 251 | Ga0070672_100642030 | 3300005543 | Bacteria | 927 |
| 252 | Ga0070672_101265171 | 3300005543 | Bacteria | 658 |
| 253 | Ga0070672_101549882 | 3300005543 | Bacteria | 594 |
| 254 | Ga0070686_100032521 | 3300005544 | Bacteria | 3199 |
| 255 | Ga0070695_100335500 | 3300005545 | Bacteria | 1128 |
| 256 | Ga0070696_100585448 | 3300005546 | Bacteria | 898 |
| 257 | Ga0070693_100425669 | 3300005547 | Bacteria | 926 |
| 258 | Ga0070665_100013547 | 3300005548 | Bacteria | 8203 |
| 259 | Ga0070665_100019750 | 3300005548 | Bacteria | 6763 |
| 260 | Ga0070665_100021059 | 3300005548 | Bacteria | 6556 |
| 261 | Ga0070665_100566968 | 3300005548 | Bacteria | 1148 |
| 262 | Ga0068855_100042906 | 3300005563 | Bacteria | 5359 |
| 263 | Ga0068855_100377383 | 3300005563 | Bacteria | 1557 |
| 264 | Ga0068855_100553106 | 3300005563 | Bacteria | 1245 |
| 265 | Ga0068855_100994134 | 3300005563 | Bacteria | 882 |
| 266 | Ga0070664_100005488 | 3300005564 | Bacteria | 10184 |
| 267 | Ga0070664_100010804 | 3300005564 | Bacteria | 7403 |
| 268 | Ga0070664_100073402 | 3300005564 | Bacteria | 2935 |
| 269 | Ga0070664_100088706 | 3300005564 | Bacteria | 2674 |
| 270 | Ga0070664_100229423 | 3300005564 | Bacteria | 1664 |
| 271 | Ga0070664_100286767 | 3300005564 | Bacteria | 1486 |
| 272 | Ga0070664_100563832 | 3300005564 | Bacteria | 1054 |
| 273 | Ga0070664_100714899 | 3300005564 | Bacteria | 934 |
| 274 | Ga0070664_100734566 | 3300005564 | Unclassified | 921 |
| 275 | Ga0070664_102197857 | 3300005564 | Unclassified | 524 |
| 276 | Ga0068857_100008116 | 3300005577 | Bacteria | 9064 |
| 277 | Ga0068857_100126060 | 3300005577 | Bacteria | 2307 |
| 278 | Ga0068857_100151220 | 3300005577 | Bacteria | 2103 |
| 279 | Ga0068857_100315172 | 3300005577 | Bacteria | 1444 |
| 280 | Ga0068857_100434983 | 3300005577 | Bacteria | 1225 |
| 281 | Ga0068857_102278722 | 3300005577 | Bacteria | 532 |
| 282 | Ga0068854_100020300 | 3300005578 | Bacteria | 4493 |
| 283 | Ga0068854_100047329 | 3300005578 | Bacteria | 3065 |
| 284 | Ga0068854_100074929 | 3300005578 | Bacteria | 2484 |
| 285 | Ga0068854_100111507 | 3300005578 | Bacteria | 2064 |
| 286 | Ga0068854_100165138 | 3300005578 | Bacteria | 1718 |
| 287 | Ga0068854_100271063 | 3300005578 | Bacteria | 1363 |
| 288 | Ga0068854_100275076 | 3300005578 | Bacteria | 1353 |
| 289 | Ga0068854_100566578 | 3300005578 | Bacteria | 965 |
| 290 | Ga0068854_100638705 | 3300005578 | Bacteria | 913 |
| 291 | Ga0068854_100884689 | 3300005578 | Bacteria | 784 |
| 292 | Ga0068854_102151494 | 3300005578 | Bacteria | 516 |
| 293 | Ga0068856_100023762 | 3300005614 | Bacteria | 5961 |
| 294 | Ga0068856_100027363 | 3300005614 | Bacteria | 5563 |
| 295 | Ga0068856_100185923 | 3300005614 | Bacteria | 2091 |
| 296 | Ga0068856_100323893 | 3300005614 | Bacteria | 1558 |
| 297 | Ga0068856_100333314 | 3300005614 | Bacteria | 1535 |
| 298 | Ga0068856_101618028 | 3300005614 | Bacteria | 661 |
| 299 | Ga0068856_102449087 | 3300005614 | Bacteria | 529 |
| 300 | Ga0070702_101482694 | 3300005615 | Bacteria | 557 |
| 301 | Ga0068852_100035258 | 3300005616 | Bacteria | 4171 |
| 302 | Ga0068852_100038835 | 3300005616 | Bacteria | 4004 |
| 303 | Ga0068852_100045745 | 3300005616 | Bacteria | 3725 |
| 304 | Ga0068852_100122683 | 3300005616 | Bacteria | 2382 |
| 305 | Ga0068852_100182868 | 3300005616 | Bacteria | 1972 |
| 306 | Ga0068852_100310680 | 3300005616 | Bacteria | 1528 |
| 307 | Ga0068852_100333219 | 3300005616 | Bacteria | 1477 |
| 308 | Ga0068852_100456244 | 3300005616 | Bacteria | 1266 |
| 309 | Ga0068852_100471672 | 3300005616 | Bacteria | 1246 |
| 310 | Ga0068852_100566468 | 3300005616 | Bacteria | 1138 |
| 311 | Ga0068852_100869340 | 3300005616 | Bacteria | 918 |
| 312 | Ga0068852_101273366 | 3300005616 | Bacteria | 757 |
| 313 | Ga0068859_100067219 | 3300005617 | Bacteria | 3619 |
| 314 | Ga0068859_100186379 | 3300005617 | Bacteria | 2159 |
| 315 | Ga0068859_100279375 | 3300005617 | Bacteria | 1762 |
| 316 | Ga0068859_101433960 | 3300005617 | Bacteria | 762 |
| 317 | Ga0068864_100003198 | 3300005618 | Bacteria | 13529 |
| 318 | Ga0068864_100023399 | 3300005618 | Bacteria | 5187 |
| 319 | Ga0068864_100473741 | 3300005618 | Bacteria | 1201 |
| 320 | Ga0068866_10023764 | 3300005718 | Bacteria | 2855 |
| 321 | Ga0068866_10026409 | 3300005718 | Bacteria | 2742 |
| 322 | Ga0068866_10204017 | 3300005718 | Bacteria | 1183 |
| 323 | Ga0068866_10339675 | 3300005718 | Bacteria | 951 |
| 324 | Ga0068861_100027898 | 3300005719 | Bacteria | 4117 |
| 325 | Ga0068861_100531459 | 3300005719 | Bacteria | 1068 |
| 326 | Ga0068861_100754928 | 3300005719 | Unclassified | 909 |
| 327 | Ga0068861_101503858 | 3300005719 | Unclassified | 661 |
| 328 | Ga0068861_101728555 | 3300005719 | Bacteria | 619 |
| 329 | Ga0068851_10052156 | 3300005834 | Bacteria | 2080 |
| 330 | Ga0068851_10068571 | 3300005834 | Bacteria | 1831 |
| 331 | Ga0068851_10091247 | 3300005834 | Bacteria | 1604 |
| 332 | Ga0068851_10268414 | 3300005834 | Bacteria | 972 |
| 333 | Ga0068870_11141887 | 3300005840 | Bacteria | 562 |
| 334 | Ga0068863_100003336 | 3300005841 | Bacteria | 15863 |
| 335 | Ga0068863_100004174 | 3300005841 | Bacteria | 14263 |
| 336 | Ga0068863_100503547 | 3300005841 | Bacteria | 1193 |
| 337 | Ga0068863_100720481 | 3300005841 | Bacteria | 992 |
| 338 | Ga0068858_100009881 | 3300005842 | Bacteria | 9065 |
| 339 | Ga0068858_100024491 | 3300005842 | Bacteria | 5622 |
| 340 | Ga0068858_100551693 | 3300005842 | Bacteria | 1116 |
| 341 | Ga0068860_100264921 | 3300005843 | Bacteria | 1676 |
| 342 | Ga0068862_100345812 | 3300005844 | Bacteria | 1378 |
| 343 | Ga0068862_100889838 | 3300005844 | Bacteria | 875 |
| 344 | Ga0081455_10112174 | 3300005937 | Bacteria | 2165 |
| 345 | Ga0081539_10021962 | 3300005985 | Bacteria | 4240 |
| 346 | Ga0070717_11321974 | 3300006028 | Bacteria | 655 |
| 347 | Ga0070716_100017029 | 3300006173 | Bacteria | 3761 |
| 348 | Ga0070716_100237612 | 3300006173 | Bacteria | 1234 |
| 349 | Ga0070712_100043513 | 3300006175 | Bacteria | 3091 |
| 350 | Ga0070712_100199713 | 3300006175 | Bacteria | 1570 |
| 351 | Ga0070712_100409844 | 3300006175 | Unclassified | 1121 |
| 352 | Ga0075369_10224746 | 3300006186 | Bacteria | 869 |
| 353 | Ga0075366_10634674 | 3300006195 | Bacteria | 662 |
| 354 | Ga0097621_100036057 | 3300006237 | Bacteria | 3954 |
| 355 | Ga0097621_100200994 | 3300006237 | Bacteria | 1730 |
| 356 | Ga0097621_100874416 | 3300006237 | Bacteria | 836 |
| 357 | Ga0097621_101060345 | 3300006237 | Bacteria | 760 |
| 358 | Ga0075370_10373493 | 3300006353 | Bacteria | 854 |
| 359 | Ga0068871_100200469 | 3300006358 | Bacteria | 1723 |
| 360 | Ga0068871_100460286 | 3300006358 | Bacteria | 1141 |
| 361 | Ga0075434_100306851 | 3300006871 | Bacteria | 1607 |
| 362 | Ga0068865_100072973 | 3300006881 | Bacteria | 2439 |
| 363 | Ga0068865_100615315 | 3300006881 | Bacteria | 920 |
| 364 | Ga0068865_100978046 | 3300006881 | Bacteria | 740 |
| 365 | Ga0068865_101045802 | 3300006881 | Bacteria | 717 |
| 366 | Ga0097620_100067222 | 3300006931 | Bacteria | 3619 |
| 367 | Ga0097620_100186370 | 3300006931 | Bacteria | 2159 |
| 368 | Ga0097620_100279373 | 3300006931 | Bacteria | 1762 |
| 369 | Ga0097620_101433801 | 3300006931 | Bacteria | 762 |
| 370 | Ga0105244_10507981 | 3300009036 | Bacteria | 555 |
| 371 | Ga0105240_11027586 | 3300009093 | Unclassified | 880 |
| 372 | Ga0105240_11248634 | 3300009093 | Unclassified | 785 |
| 373 | Ga0105245_10019606 | 3300009098 | Bacteria | 5925 |
| 374 | Ga0105245_10023282 | 3300009098 | Bacteria | 5437 |
| 375 | Ga0105245_10198795 | 3300009098 | Bacteria | 1924 |
| 376 | Ga0105245_11304672 | 3300009098 | Bacteria | 775 |
| 377 | Ga0105245_11610038 | 3300009098 | Bacteria | 701 |
| 378 | Ga0105245_12384180 | 3300009098 | Bacteria | 583 |
| 379 | Ga0105243_10017247 | 3300009148 | Bacteria | 5460 |
| 380 | Ga0105243_10592442 | 3300009148 | Bacteria | 1066 |
| 381 | Ga0105243_11201855 | 3300009148 | Bacteria | 771 |
| 382 | Ga0105241_10685630 | 3300009174 | Bacteria | 934 |
| 383 | Ga0105241_11342443 | 3300009174 | Unclassified | 682 |
| 384 | Ga0105242_10155550 | 3300009176 | Bacteria | 1997 |
| 385 | Ga0105242_11181354 | 3300009176 | Bacteria | 783 |
| 386 | Ga0105248_10001634 | 3300009177 | Bacteria | 24926 |
| 387 | Ga0105248_10001894 | 3300009177 | Bacteria | 23189 |
| 388 | Ga0105248_10002448 | 3300009177 | Bacteria | 20617 |
| 389 | Ga0105248_10026794 | 3300009177 | Bacteria | 6411 |
| 390 | Ga0105248_10052041 | 3300009177 | Bacteria | 4595 |
| 391 | Ga0105248_10055565 | 3300009177 | Bacteria | 4441 |
| 392 | Ga0105248_10219657 | 3300009177 | Bacteria | 2140 |
| 393 | Ga0105248_10254978 | 3300009177 | Bacteria | 1975 |
| 394 | Ga0105248_10688259 | 3300009177 | Bacteria | 1153 |
| 395 | Ga0105237_10449078 | 3300009545 | Bacteria | 1295 |
| 396 | Ga0105238_10324553 | 3300009551 | Bacteria | 1526 |
| 397 | Ga0105249_10261845 | 3300009553 | Bacteria | 1719 |
| 398 | Ga0105249_11854036 | 3300009553 | Bacteria | 676 |
| 399 | Ga0105239_10544206 | 3300010375 | Bacteria | 1322 |
| 400 | Ga0105239_11448792 | 3300010375 | Unclassified | 793 |
| 401 | Ga0105239_11720435 | 3300010375 | Bacteria | 726 |
| 402 | Ga0105239_13271721 | 3300010375 | Bacteria | 527 |
| 403 | Ga0105246_10064694 | 3300011119 | Bacteria | 2556 |
| 404 | Ga0105246_10641954 | 3300011119 | Bacteria | 923 |
| 405 | Ga0157327_1014092 | 3300012512 | Bacteria | 812 |
| 406 | Ga0157373_10021660 | 3300013100 | Bacteria | 4664 |
| 407 | Ga0157373_10072363 | 3300013100 | Bacteria | 2433 |
| 408 | Ga0157373_10173185 | 3300013100 | Bacteria | 1519 |
| 409 | Ga0157373_10368773 | 3300013100 | Bacteria | 1026 |
| 410 | Ga0157373_10524357 | 3300013100 | Bacteria | 857 |
| 411 | Ga0157373_10805553 | 3300013100 | Bacteria | 693 |
| 412 | Ga0157371_10051761 | 3300013102 | Bacteria | 2918 |
| 413 | Ga0157371_10053945 | 3300013102 | Bacteria | 2855 |
| 414 | Ga0157371_10225171 | 3300013102 | Bacteria | 1347 |
| 415 | Ga0157371_10257009 | 3300013102 | Bacteria | 1259 |
| 416 | Ga0157371_10312879 | 3300013102 | Bacteria | 1138 |
| 417 | Ga0157371_10357931 | 3300013102 | Bacteria | 1063 |
| 418 | Ga0157371_10472897 | 3300013102 | Bacteria | 923 |
| 419 | Ga0157370_10041941 | 3300013104 | Bacteria | 4411 |
| 420 | Ga0157370_10133136 | 3300013104 | Bacteria | 2318 |
| 421 | Ga0157370_10167170 | 3300013104 | Bacteria | 2045 |
| 422 | Ga0157370_10957146 | 3300013104 | Bacteria | 776 |
| 423 | Ga0157369_10140020 | 3300013105 | Bacteria | 2561 |
| 424 | Ga0157369_10153643 | 3300013105 | Bacteria | 2432 |
| 425 | Ga0157369_10462082 | 3300013105 | Bacteria | 1314 |
| 426 | Ga0157369_10862726 | 3300013105 | Bacteria | 929 |
| 427 | Ga0157374_10019076 | 3300013296 | Bacteria | 6068 |
| 428 | Ga0157374_10159797 | 3300013296 | Bacteria | 2195 |
| 429 | Ga0157374_10197873 | 3300013296 | Bacteria | 1967 |
| 430 | Ga0157374_11582747 | 3300013296 | Unclassified | 679 |
| 431 | Ga0157374_11988145 | 3300013296 | Archaea | 608 |
| 432 | Ga0157378_10191875 | 3300013297 | Bacteria | 1927 |
| 433 | Ga0157378_10268195 | 3300013297 | Bacteria | 1641 |
| 434 | Ga0157378_10534681 | 3300013297 | Bacteria | 1175 |
| 435 | Ga0157378_10535647 | 3300013297 | Bacteria | 1174 |
| 436 | Ga0157378_10589800 | 3300013297 | Bacteria | 1121 |
| 437 | Ga0157378_10959130 | 3300013297 | Bacteria | 888 |
| 438 | Ga0163162_10000768 | 3300013306 | Bacteria | 29827 |
| 439 | Ga0163162_10023881 | 3300013306 | Bacteria | 6034 |
| 440 | Ga0163162_10104995 | 3300013306 | Bacteria | 2920 |
| 441 | Ga0163162_10128812 | 3300013306 | Bacteria | 2639 |
| 442 | Ga0163162_12230085 | 3300013306 | Unclassified | 629 |
| 443 | Ga0157372_10118491 | 3300013307 | Bacteria | 3038 |
| 444 | Ga0157372_10409795 | 3300013307 | Bacteria | 1580 |
| 445 | Ga0157372_10591808 | 3300013307 | Bacteria | 1293 |
| 446 | Ga0157372_10890480 | 3300013307 | Bacteria | 1033 |
| 447 | Ga0157372_10917523 | 3300013307 | Bacteria | 1016 |
| 448 | Ga0157372_11572598 | 3300013307 | Bacteria | 757 |
| 449 | Ga0157372_11613633 | 3300013307 | Bacteria | 747 |
| 450 | Ga0157375_10005630 | 3300013308 | Bacteria | 10907 |
| 451 | Ga0157375_10020583 | 3300013308 | Bacteria | 6030 |
| 452 | Ga0157375_10213250 | 3300013308 | Bacteria | 2089 |
| 453 | Ga0157375_10403985 | 3300013308 | Bacteria | 1533 |
| 454 | Ga0157375_11826491 | 3300013308 | Bacteria | 721 |
| 455 | Ga0163163_10073297 | 3300014325 | Bacteria | 3415 |
| 456 | Ga0163163_10206336 | 3300014325 | Bacteria | 2013 |
| 457 | Ga0157380_10835979 | 3300014326 | Bacteria | 941 |
| 458 | Ga0157380_12285446 | 3300014326 | Bacteria | 605 |
| 459 | Ga0182008_10056733 | 3300014497 | Bacteria | 1934 |
| 460 | Ga0157377_10148714 | 3300014745 | Bacteria | 1446 |
| 461 | Ga0157379_12409262 | 3300014968 | Bacteria | 525 |
| 462 | Ga0157376_10090404 | 3300014969 | Bacteria | 2649 |
| 463 | Ga0163161_10328102 | 3300017792 | Bacteria | 1211 |
| 464 | Ga0163161_10368541 | 3300017792 | Bacteria | 1145 |
| 465 | Ga0206354_11545716 | 3300020081 | Bacteria | 1047 |
| 466 | Ga0213876_10023631 | 3300021384 | Bacteria | 3246 |
| 467 | Ga0213876_10077576 | 3300021384 | Bacteria | 1755 |
| 468 | Ga0207673_1022881 | 3300025290 | Bacteria | 849 |
| 469 | Ga0207697_10011452 | 3300025315 | Bacteria | 3751 |
| 470 | Ga0207697_10140730 | 3300025315 | Bacteria | 1046 |
| 471 | Ga0207656_10130030 | 3300025321 | Bacteria | 1179 |
| 472 | Ga0207656_10173642 | 3300025321 | Bacteria | 1031 |
| 473 | Ga0207656_10194328 | 3300025321 | Bacteria | 978 |
| 474 | Ga0207656_10321154 | 3300025321 | Bacteria | 769 |
| 475 | Ga0207682_10004204 | 3300025893 | Bacteria | 6081 |
| 476 | Ga0207682_10077134 | 3300025893 | Bacteria | 1421 |
| 477 | Ga0207642_10007391 | 3300025899 | Bacteria | 3709 |
| 478 | Ga0207642_10042153 | 3300025899 | Bacteria | 2004 |
| 479 | Ga0207642_10164071 | 3300025899 | Bacteria | 1196 |
| 480 | Ga0207642_10270163 | 3300025899 | Bacteria | 973 |
| 481 | Ga0207642_10610956 | 3300025899 | Bacteria | 680 |
| 482 | Ga0207688_10009345 | 3300025901 | Bacteria | 5344 |
| 483 | Ga0207688_10022437 | 3300025901 | Bacteria | 3454 |
| 484 | Ga0207688_10027272 | 3300025901 | Bacteria | 3142 |
| 485 | Ga0207688_10029570 | 3300025901 | Bacteria | 3017 |
| 486 | Ga0207688_10126250 | 3300025901 | Bacteria | 1496 |
| 487 | Ga0207688_10129436 | 3300025901 | Bacteria | 1479 |
| 488 | Ga0207680_10002585 | 3300025903 | Bacteria | 8443 |
| 489 | Ga0207680_10101277 | 3300025903 | Bacteria | 1851 |
| 490 | Ga0207680_10310385 | 3300025903 | Bacteria | 1101 |
| 491 | Ga0207680_10505087 | 3300025903 | Bacteria | 861 |
| 492 | Ga0207680_11234789 | 3300025903 | Bacteria | 532 |
| 493 | Ga0207680_11242879 | 3300025903 | Archaea | 531 |
| 494 | Ga0207647_10009676 | 3300025904 | Bacteria | 6843 |
| 495 | Ga0207647_10012986 | 3300025904 | Bacteria | 5785 |
| 496 | Ga0207647_10027273 | 3300025904 | Bacteria | 3724 |
| 497 | Ga0207647_10050442 | 3300025904 | Bacteria | 2576 |
| 498 | Ga0207647_10065670 | 3300025904 | Bacteria | 2202 |
| 499 | Ga0207647_10082023 | 3300025904 | Bacteria | 1932 |
| 500 | Ga0207647_10302630 | 3300025904 | Bacteria | 910 |
| 501 | Ga0207699_10146761 | 3300025906 | Bacteria | 1556 |
| 502 | Ga0207645_10020823 | 3300025907 | Bacteria | 4285 |
| 503 | Ga0207645_10031056 | 3300025907 | Bacteria | 3439 |
| 504 | Ga0207645_10046178 | 3300025907 | Bacteria | 2783 |
| 505 | Ga0207645_10762584 | 3300025907 | Bacteria | 658 |
| 506 | Ga0207645_11026039 | 3300025907 | Bacteria | 558 |
| 507 | Ga0207645_11191719 | 3300025907 | Unclassified | 511 |
| 508 | Ga0207705_10003597 | 3300025909 | Bacteria | 11806 |
| 509 | Ga0207705_10004771 | 3300025909 | Bacteria | 10210 |
| 510 | Ga0207705_10009807 | 3300025909 | Bacteria | 6970 |
| 511 | Ga0207705_10046912 | 3300025909 | Bacteria | 3106 |
| 512 | Ga0207705_10131333 | 3300025909 | Bacteria | 1864 |
| 513 | Ga0207705_10180650 | 3300025909 | Bacteria | 1592 |
| 514 | Ga0207705_10578866 | 3300025909 | Bacteria | 873 |
| 515 | Ga0207705_10799219 | 3300025909 | Bacteria | 732 |
| 516 | Ga0207705_11140637 | 3300025909 | Unclassified | 599 |
| 517 | Ga0207654_11216505 | 3300025911 | Bacteria | 549 |
| 518 | Ga0207707_10124551 | 3300025912 | Bacteria | 2254 |
| 519 | Ga0207707_10150276 | 3300025912 | Bacteria | 2036 |
| 520 | Ga0207707_10341825 | 3300025912 | Bacteria | 1290 |
| 521 | Ga0207707_10476500 | 3300025912 | Bacteria | 1066 |
| 522 | Ga0207695_10210052 | 3300025913 | Bacteria | 1858 |
| 523 | Ga0207693_10014544 | 3300025915 | Bacteria | 6324 |
| 524 | Ga0207660_10002662 | 3300025917 | Bacteria | 11716 |
| 525 | Ga0207662_10207392 | 3300025918 | Bacteria | 1271 |
| 526 | Ga0207662_10974084 | 3300025918 | Bacteria | 602 |
| 527 | Ga0207657_10000434 | 3300025919 | Bacteria | 44542 |
| 528 | Ga0207657_10001170 | 3300025919 | Bacteria | 27822 |
| 529 | Ga0207657_10002813 | 3300025919 | Bacteria | 18715 |
| 530 | Ga0207657_10024081 | 3300025919 | Bacteria | 5651 |
| 531 | Ga0207657_10040928 | 3300025919 | Bacteria | 4102 |
| 532 | Ga0207657_10042145 | 3300025919 | Bacteria | 4030 |
| 533 | Ga0207657_10098472 | 3300025919 | Bacteria | 2430 |
| 534 | Ga0207657_10102994 | 3300025919 | Bacteria | 2367 |
| 535 | Ga0207657_10124050 | 3300025919 | Bacteria | 2122 |
| 536 | Ga0207657_10167306 | 3300025919 | Bacteria | 1783 |
| 537 | Ga0207657_10268630 | 3300025919 | Bacteria | 1356 |
| 538 | Ga0207657_10356827 | 3300025919 | Bacteria | 1153 |
| 539 | Ga0207657_10510349 | 3300025919 | Bacteria | 941 |
| 540 | Ga0207657_10958389 | 3300025919 | Unclassified | 657 |
| 541 | Ga0207649_10011041 | 3300025920 | Bacteria | 4970 |
| 542 | Ga0207649_10027276 | 3300025920 | Bacteria | 3350 |
| 543 | Ga0207649_10034090 | 3300025920 | Bacteria | 3047 |
| 544 | Ga0207649_10060338 | 3300025920 | Bacteria | 2383 |
| 545 | Ga0207649_10112156 | 3300025920 | Bacteria | 1824 |
| 546 | Ga0207649_10129581 | 3300025920 | Bacteria | 1711 |
| 547 | Ga0207649_10287679 | 3300025920 | Bacteria | 1197 |
| 548 | Ga0207649_10307304 | 3300025920 | Bacteria | 1161 |
| 549 | Ga0207649_10434297 | 3300025920 | Bacteria | 988 |
| 550 | Ga0207649_10494474 | 3300025920 | Bacteria | 929 |
| 551 | Ga0207649_11694553 | 3300025920 | Bacteria | 500 |
| 552 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 553 | Ga0207652_10058852 | 3300025921 | Bacteria | 3311 |
| 554 | Ga0207652_10122947 | 3300025921 | Bacteria | 2310 |
| 555 | Ga0207652_10143490 | 3300025921 | Bacteria | 2136 |
| 556 | Ga0207652_10454642 | 3300025921 | Bacteria | 1154 |
| 557 | Ga0207681_10004355 | 3300025923 | Bacteria | 8731 |
| 558 | Ga0207681_10050998 | 3300025923 | Bacteria | 2802 |
| 559 | Ga0207681_10167103 | 3300025923 | Bacteria | 1664 |
| 560 | Ga0207681_10264112 | 3300025923 | Bacteria | 1349 |
| 561 | Ga0207681_10336792 | 3300025923 | Bacteria | 1204 |
| 562 | Ga0207681_10418805 | 3300025923 | Bacteria | 1085 |
| 563 | Ga0207694_10538823 | 3300025924 | Bacteria | 979 |
| 564 | Ga0207650_10002948 | 3300025925 | Bacteria | 11736 |
| 565 | Ga0207650_10040539 | 3300025925 | Bacteria | 3408 |
| 566 | Ga0207650_10043580 | 3300025925 | Bacteria | 3294 |
| 567 | Ga0207650_10052391 | 3300025925 | Bacteria | 3023 |
| 568 | Ga0207650_10059964 | 3300025925 | Bacteria | 2838 |
| 569 | Ga0207650_10107594 | 3300025925 | Bacteria | 2154 |
| 570 | Ga0207650_10227661 | 3300025925 | Bacteria | 1503 |
| 571 | Ga0207650_11345655 | 3300025925 | Bacteria | 608 |
| 572 | Ga0207650_11421791 | 3300025925 | Bacteria | 590 |
| 573 | Ga0207659_10076781 | 3300025926 | Bacteria | 2457 |
| 574 | Ga0207659_10085108 | 3300025926 | Bacteria | 2348 |
| 575 | Ga0207659_10829266 | 3300025926 | Bacteria | 795 |
| 576 | Ga0207659_11153323 | 3300025926 | Bacteria | 666 |
| 577 | Ga0207687_10012657 | 3300025927 | Bacteria | 5512 |
| 578 | Ga0207687_10035715 | 3300025927 | Bacteria | 3382 |
| 579 | Ga0207687_10893712 | 3300025927 | Bacteria | 760 |
| 580 | Ga0207687_11508204 | 3300025927 | Unclassified | 577 |
| 581 | Ga0207700_10388919 | 3300025928 | Bacteria | 1221 |
| 582 | Ga0207664_10018146 | 3300025929 | Bacteria | 5171 |
| 583 | Ga0207664_10079535 | 3300025929 | Bacteria | 2662 |
| 584 | Ga0207664_11394232 | 3300025929 | Unclassified | 621 |
| 585 | Ga0207644_10000052 | 3300025931 | Bacteria | 91473 |
| 586 | Ga0207644_10000943 | 3300025931 | Bacteria | 18532 |
| 587 | Ga0207644_10000996 | 3300025931 | Bacteria | 18076 |
| 588 | Ga0207644_10017678 | 3300025931 | Bacteria | 4821 |
| 589 | Ga0207644_10032654 | 3300025931 | Bacteria | 3633 |
| 590 | Ga0207644_10105072 | 3300025931 | Bacteria | 2127 |
| 591 | Ga0207644_10209244 | 3300025931 | Bacteria | 1541 |
| 592 | Ga0207644_10250949 | 3300025931 | Bacteria | 1412 |
| 593 | Ga0207644_10259752 | 3300025931 | Bacteria | 1388 |
| 594 | Ga0207644_10761302 | 3300025931 | Bacteria | 809 |
| 595 | Ga0207644_11284946 | 3300025931 | Bacteria | 615 |
| 596 | Ga0207644_11564618 | 3300025931 | Bacteria | 553 |
| 597 | Ga0207690_10002842 | 3300025932 | Bacteria | 10446 |
| 598 | Ga0207690_10013275 | 3300025932 | Bacteria | 4946 |
| 599 | Ga0207690_10034676 | 3300025932 | Bacteria | 3253 |
| 600 | Ga0207690_10049022 | 3300025932 | Bacteria | 2813 |
| 601 | Ga0207690_10109546 | 3300025932 | Bacteria | 1987 |
| 602 | Ga0207690_10149234 | 3300025932 | Bacteria | 1732 |
| 603 | Ga0207690_10199876 | 3300025932 | Bacteria | 1517 |
| 604 | Ga0207690_10260883 | 3300025932 | Bacteria | 1342 |
| 605 | Ga0207690_10427935 | 3300025932 | Bacteria | 1060 |
| 606 | Ga0207690_10691141 | 3300025932 | Bacteria | 838 |
| 607 | Ga0207690_10892420 | 3300025932 | Bacteria | 737 |
| 608 | Ga0207690_11199707 | 3300025932 | Bacteria | 634 |
| 609 | Ga0207690_11496497 | 3300025932 | Bacteria | 564 |
| 610 | Ga0207706_10000299 | 3300025933 | Bacteria | 53751 |
| 611 | Ga0207706_10000614 | 3300025933 | Bacteria | 37833 |
| 612 | Ga0207706_10007215 | 3300025933 | Bacteria | 10277 |
| 613 | Ga0207706_10020875 | 3300025933 | Bacteria | 5881 |
| 614 | Ga0207706_10040584 | 3300025933 | Bacteria | 4125 |
| 615 | Ga0207706_10048431 | 3300025933 | Bacteria | 3758 |
| 616 | Ga0207706_10124972 | 3300025933 | Bacteria | 2263 |
| 617 | Ga0207706_10155926 | 3300025933 | Bacteria | 2008 |
| 618 | Ga0207706_10180054 | 3300025933 | Bacteria | 1856 |
| 619 | Ga0207706_10528423 | 3300025933 | Bacteria | 1017 |
| 620 | Ga0207706_10601912 | 3300025933 | Bacteria | 944 |
| 621 | Ga0207706_10680466 | 3300025933 | Bacteria | 880 |
| 622 | Ga0207706_11571005 | 3300025933 | Bacteria | 534 |
| 623 | Ga0207686_10269296 | 3300025934 | Bacteria | 1252 |
| 624 | Ga0207686_10342765 | 3300025934 | Bacteria | 1123 |
| 625 | Ga0207670_10203249 | 3300025936 | Bacteria | 1506 |
| 626 | Ga0207670_10501107 | 3300025936 | Bacteria | 986 |
| 627 | Ga0207669_10153294 | 3300025937 | Bacteria | 1617 |
| 628 | Ga0207669_10168664 | 3300025937 | Bacteria | 1555 |
| 629 | Ga0207669_10186735 | 3300025937 | Bacteria | 1491 |
| 630 | Ga0207669_10410156 | 3300025937 | Bacteria | 1063 |
| 631 | Ga0207669_10556401 | 3300025937 | Bacteria | 926 |
| 632 | Ga0207669_10985967 | 3300025937 | Bacteria | 707 |
| 633 | Ga0207704_10138617 | 3300025938 | Bacteria | 1698 |
| 634 | Ga0207704_10292820 | 3300025938 | Bacteria | 1243 |
| 635 | Ga0207704_11156174 | 3300025938 | Bacteria | 659 |
| 636 | Ga0207665_10565645 | 3300025939 | Bacteria | 885 |
| 637 | Ga0207691_10000998 | 3300025940 | Bacteria | 28103 |
| 638 | Ga0207691_10013011 | 3300025940 | Bacteria | 7967 |
| 639 | Ga0207691_10016113 | 3300025940 | Bacteria | 7100 |
| 640 | Ga0207691_10071125 | 3300025940 | Bacteria | 3140 |
| 641 | Ga0207691_10108220 | 3300025940 | Bacteria | 2474 |
| 642 | Ga0207691_10128425 | 3300025940 | Bacteria | 2241 |
| 643 | Ga0207691_10339902 | 3300025940 | Bacteria | 1285 |
| 644 | Ga0207691_10471177 | 3300025940 | Bacteria | 1068 |
| 645 | Ga0207691_11150273 | 3300025940 | Bacteria | 644 |
| 646 | Ga0207711_10000420 | 3300025941 | Bacteria | 44798 |
| 647 | Ga0207711_10001311 | 3300025941 | Bacteria | 23539 |
| 648 | Ga0207711_10003129 | 3300025941 | Bacteria | 14421 |
| 649 | Ga0207711_10011832 | 3300025941 | Bacteria | 7250 |
| 650 | Ga0207711_10189622 | 3300025941 | Bacteria | 1873 |
| 651 | Ga0207711_10192745 | 3300025941 | Bacteria | 1858 |
| 652 | Ga0207711_10294821 | 3300025941 | Bacteria | 1495 |
| 653 | Ga0207689_10033251 | 3300025942 | Bacteria | 4285 |
| 654 | Ga0207661_10032385 | 3300025944 | Bacteria | 4049 |
| 655 | Ga0207661_10224509 | 3300025944 | Bacteria | 1661 |
| 656 | Ga0207661_10415947 | 3300025944 | Bacteria | 1221 |
| 657 | Ga0207661_11391683 | 3300025944 | Bacteria | 644 |
| 658 | Ga0207679_10023965 | 3300025945 | Bacteria | 4180 |
| 659 | Ga0207679_10025671 | 3300025945 | Bacteria | 4055 |
| 660 | Ga0207679_10034407 | 3300025945 | Bacteria | 3574 |
| 661 | Ga0207679_10092592 | 3300025945 | Bacteria | 2342 |
| 662 | Ga0207679_10183638 | 3300025945 | Bacteria | 1732 |
| 663 | Ga0207679_10295415 | 3300025945 | Bacteria | 1394 |
| 664 | Ga0207679_10523871 | 3300025945 | Bacteria | 1060 |
| 665 | Ga0207679_10739393 | 3300025945 | Bacteria | 894 |
| 666 | Ga0207679_10904130 | 3300025945 | Bacteria | 807 |
| 667 | Ga0207679_10961685 | 3300025945 | Bacteria | 782 |
| 668 | Ga0207667_10012261 | 3300025949 | Bacteria | 9895 |
| 669 | Ga0207667_10049447 | 3300025949 | Bacteria | 4440 |
| 670 | Ga0207667_10366878 | 3300025949 | Bacteria | 1468 |
| 671 | Ga0207667_10500052 | 3300025949 | Bacteria | 1233 |
| 672 | Ga0207651_10000652 | 3300025960 | Bacteria | 14745 |
| 673 | Ga0207651_10012001 | 3300025960 | Bacteria | 4878 |
| 674 | Ga0207651_10013969 | 3300025960 | Bacteria | 4619 |
| 675 | Ga0207651_10140058 | 3300025960 | Bacteria | 1867 |
| 676 | Ga0207651_10201589 | 3300025960 | Bacteria | 1595 |
| 677 | Ga0207651_10430531 | 3300025960 | Bacteria | 1128 |
| 678 | Ga0207651_10441912 | 3300025960 | Bacteria | 1114 |
| 679 | Ga0207651_10480599 | 3300025960 | Bacteria | 1071 |
| 680 | Ga0207651_10654794 | 3300025960 | Bacteria | 922 |
| 681 | Ga0207651_11182526 | 3300025960 | Bacteria | 686 |
| 682 | Ga0207651_11281837 | 3300025960 | Bacteria | 658 |
| 683 | Ga0207712_11482182 | 3300025961 | Bacteria | 608 |
| 684 | Ga0207668_10198870 | 3300025972 | Bacteria | 1594 |
| 685 | Ga0207668_10219539 | 3300025972 | Bacteria | 1526 |
| 686 | Ga0207668_11125351 | 3300025972 | Bacteria | 704 |
| 687 | Ga0207640_10057391 | 3300025981 | Bacteria | 2560 |
| 688 | Ga0207640_10175109 | 3300025981 | Bacteria | 1603 |
| 689 | Ga0207640_10207631 | 3300025981 | Bacteria | 1489 |
| 690 | Ga0207640_10209652 | 3300025981 | Bacteria | 1483 |
| 691 | Ga0207640_10425775 | 3300025981 | Bacteria | 1087 |
| 692 | Ga0207640_10610929 | 3300025981 | Bacteria | 924 |
| 693 | Ga0207640_10832447 | 3300025981 | Bacteria | 802 |
| 694 | Ga0207640_11160446 | 3300025981 | Bacteria | 685 |
| 695 | Ga0207640_11370765 | 3300025981 | Bacteria | 633 |
| 696 | Ga0207640_11607904 | 3300025981 | Bacteria | 585 |
| 697 | Ga0207658_10004807 | 3300025986 | Bacteria | 9347 |
| 698 | Ga0207658_10038494 | 3300025986 | Bacteria | 3445 |
| 699 | Ga0207658_10066062 | 3300025986 | Bacteria | 2719 |
| 700 | Ga0207658_10123783 | 3300025986 | Bacteria | 2066 |
| 701 | Ga0207658_10165199 | 3300025986 | Bacteria | 1818 |
| 702 | Ga0207658_10312073 | 3300025986 | Bacteria | 1359 |
| 703 | Ga0207658_10654966 | 3300025986 | Bacteria | 947 |
| 704 | Ga0207658_11098034 | 3300025986 | Bacteria | 727 |
| 705 | Ga0207677_10003117 | 3300026023 | Bacteria | 8747 |
| 706 | Ga0207677_10018354 | 3300026023 | Bacteria | 4196 |
| 707 | Ga0207677_10030638 | 3300026023 | Bacteria | 3437 |
| 708 | Ga0207677_10072056 | 3300026023 | Bacteria | 2441 |
| 709 | Ga0207677_10679258 | 3300026023 | Bacteria | 912 |
| 710 | Ga0207703_10002663 | 3300026035 | Bacteria | 15352 |
| 711 | Ga0207703_10031952 | 3300026035 | Bacteria | 4164 |
| 712 | Ga0207703_10079372 | 3300026035 | Bacteria | 2730 |
| 713 | Ga0207639_10117021 | 3300026041 | Bacteria | 2183 |
| 714 | Ga0207639_10230713 | 3300026041 | Bacteria | 1604 |
| 715 | Ga0207639_10555240 | 3300026041 | Bacteria | 1055 |
| 716 | Ga0207639_10622591 | 3300026041 | Bacteria | 997 |
| 717 | Ga0207639_10654861 | 3300026041 | Bacteria | 972 |
| 718 | Ga0207639_10679122 | 3300026041 | Bacteria | 954 |
| 719 | Ga0207639_10716064 | 3300026041 | Bacteria | 929 |
| 720 | Ga0207639_11194175 | 3300026041 | Bacteria | 714 |
| 721 | Ga0207678_10000117 | 3300026067 | Bacteria | 65678 |
| 722 | Ga0207678_10006831 | 3300026067 | Bacteria | 10119 |
| 723 | Ga0207678_10020241 | 3300026067 | Bacteria | 5841 |
| 724 | Ga0207678_10040138 | 3300026067 | Bacteria | 4060 |
| 725 | Ga0207678_10129505 | 3300026067 | Bacteria | 2152 |
| 726 | Ga0207678_10143668 | 3300026067 | Bacteria | 2037 |
| 727 | Ga0207678_10170926 | 3300026067 | Bacteria | 1856 |
| 728 | Ga0207678_10216460 | 3300026067 | Bacteria | 1639 |
| 729 | Ga0207678_10265351 | 3300026067 | Bacteria | 1472 |
| 730 | Ga0207678_11064414 | 3300026067 | Bacteria | 716 |
| 731 | Ga0207702_10079971 | 3300026078 | Bacteria | 2835 |
| 732 | Ga0207702_10408586 | 3300026078 | Bacteria | 1310 |
| 733 | Ga0207702_10993495 | 3300026078 | Unclassified | 832 |
| 734 | Ga0207702_11535377 | 3300026078 | Bacteria | 659 |
| 735 | Ga0207702_11818892 | 3300026078 | Bacteria | 601 |
| 736 | Ga0207702_12287974 | 3300026078 | Bacteria | 528 |
| 737 | Ga0207641_10006363 | 3300026088 | Bacteria | 9971 |
| 738 | Ga0207641_10092172 | 3300026088 | Bacteria | 2653 |
| 739 | Ga0207641_10810568 | 3300026088 | Bacteria | 926 |
| 740 | Ga0207641_11232560 | 3300026088 | Bacteria | 748 |
| 741 | Ga0207648_10016503 | 3300026089 | Bacteria | 6744 |
| 742 | Ga0207648_10057138 | 3300026089 | Bacteria | 3404 |
| 743 | Ga0207648_10142850 | 3300026089 | Bacteria | 2110 |
| 744 | Ga0207648_10309763 | 3300026089 | Bacteria | 1417 |
| 745 | Ga0207648_10358818 | 3300026089 | Bacteria | 1315 |
| 746 | Ga0207676_10005353 | 3300026095 | Bacteria | 9088 |
| 747 | Ga0207676_10045938 | 3300026095 | Bacteria | 3376 |
| 748 | Ga0207676_10228584 | 3300026095 | Bacteria | 1661 |
| 749 | Ga0207676_10310404 | 3300026095 | Bacteria | 1444 |
| 750 | Ga0207674_10000086 | 3300026116 | Bacteria | 100722 |
| 751 | Ga0207674_10006741 | 3300026116 | Bacteria | 13483 |
| 752 | Ga0207674_10154256 | 3300026116 | Bacteria | 2252 |
| 753 | Ga0207674_10173540 | 3300026116 | Bacteria | 2109 |
| 754 | Ga0207674_11045692 | 3300026116 | Bacteria | 786 |
| 755 | Ga0207675_100044742 | 3300026118 | Bacteria | 4137 |
| 756 | Ga0207675_100147851 | 3300026118 | Bacteria | 2235 |
| 757 | Ga0207675_101529073 | 3300026118 | Unclassified | 688 |
| 758 | Ga0207683_10000846 | 3300026121 | Bacteria | 28093 |
| 759 | Ga0207683_10003887 | 3300026121 | Bacteria | 12956 |
| 760 | Ga0207683_10067903 | 3300026121 | Bacteria | 3146 |
| 761 | Ga0207683_10100386 | 3300026121 | Bacteria | 2584 |
| 762 | Ga0207683_10106035 | 3300026121 | Bacteria | 2513 |
| 763 | Ga0207683_10177759 | 3300026121 | Bacteria | 1929 |
| 764 | Ga0207698_10078193 | 3300026142 | Bacteria | 2655 |
| 765 | Ga0207698_10089400 | 3300026142 | Bacteria | 2515 |
| 766 | Ga0207698_10147231 | 3300026142 | Bacteria | 2038 |
| 767 | Ga0207698_10149172 | 3300026142 | Bacteria | 2027 |
| 768 | Ga0207698_10232933 | 3300026142 | Bacteria | 1673 |
| 769 | Ga0207698_10245977 | 3300026142 | Bacteria | 1633 |
| 770 | Ga0207698_10277882 | 3300026142 | Bacteria | 1547 |
| 771 | Ga0207698_10293572 | 3300026142 | Bacteria | 1510 |
| 772 | Ga0207698_10355606 | 3300026142 | Bacteria | 1385 |
| 773 | Ga0207698_10508813 | 3300026142 | Bacteria | 1173 |
| 774 | Ga0207698_10782532 | 3300026142 | Bacteria | 955 |
| 775 | Ga0207698_11361809 | 3300026142 | Bacteria | 724 |
| 776 | Ga0209974_10053592 | 3300027876 | Bacteria | 1358 |
| 777 | Ga0209974_10319248 | 3300027876 | Bacteria | 598 |
| 778 | Ga0268266_10055274 | 3300028379 | Bacteria | 3412 |
| 779 | Ga0268266_10083549 | 3300028379 | Bacteria | 2787 |
| 780 | Ga0268266_10506053 | 3300028379 | Bacteria | 1154 |
| 781 | Ga0268265_10475786 | 3300028380 | Bacteria | 1172 |
| 782 | Ga0268265_11085440 | 3300028380 | Bacteria | 794 |
| 783 | Ga0268264_10503308 | 3300028381 | Bacteria | 1182 |
| 784 | Ga0268264_10641038 | 3300028381 | Bacteria | 1051 |
| 785 | Ga0307408_100336708 | 3300031548 | Bacteria | 1276 |
| 786 | Ga0307405_10004019 | 3300031731 | Bacteria | 6900 |
| 787 | Ga0307405_10025754 | 3300031731 | Bacteria | 3382 |
| 788 | Ga0307405_10414443 | 3300031731 | Bacteria | 1058 |
| 789 | Ga0307405_10591326 | 3300031731 | Bacteria | 904 |
| 790 | Ga0307413_10140181 | 3300031824 | Bacteria | 1669 |
| 791 | Ga0307413_11407450 | 3300031824 | Bacteria | 613 |
| 792 | Ga0307410_10047487 | 3300031852 | Bacteria | 2869 |
| 793 | Ga0307410_10112970 | 3300031852 | Bacteria | 1968 |
| 794 | Ga0307410_10215246 | 3300031852 | Bacteria | 1474 |
| 795 | Ga0307406_10103064 | 3300031901 | Bacteria | 1948 |
| 796 | Ga0307406_10176990 | 3300031901 | Bacteria | 1549 |
| 797 | Ga0307407_10082056 | 3300031903 | Bacteria | 1953 |
| 798 | Ga0307407_10473151 | 3300031903 | Bacteria | 913 |
| 799 | Ga0307412_10062941 | 3300031911 | Bacteria | 2501 |
| 800 | Ga0307412_10669854 | 3300031911 | Bacteria | 887 |
| 801 | Ga0307412_10778493 | 3300031911 | Bacteria | 828 |
| 802 | Ga0307412_10873923 | 3300031911 | Bacteria | 786 |
| 803 | Ga0307409_100025333 | 3300031995 | Bacteria | 4158 |
| 804 | Ga0307409_100186308 | 3300031995 | Bacteria | 1842 |
| 805 | Ga0307409_100217944 | 3300031995 | Bacteria | 1721 |
| 806 | Ga0307409_100343324 | 3300031995 | Bacteria | 1406 |
| 807 | Ga0307409_100637213 | 3300031995 | Bacteria | 1058 |
| 808 | Ga0307409_101102104 | 3300031995 | Bacteria | 815 |
| 809 | Ga0307416_100018217 | 3300032002 | Bacteria | 4942 |
| 810 | Ga0307416_100144033 | 3300032002 | Bacteria | 2172 |
| 811 | Ga0307416_100530778 | 3300032002 | Bacteria | 1247 |
| 812 | Ga0307416_102023742 | 3300032002 | Bacteria | 678 |
| 813 | Ga0307414_10102821 | 3300032004 | Bacteria | 2154 |
| 814 | Ga0307414_10600876 | 3300032004 | Bacteria | 986 |
| 815 | Ga0307414_11451945 | 3300032004 | Bacteria | 638 |
| 816 | Ga0307411_10032660 | 3300032005 | Bacteria | 3218 |
| 817 | Ga0307411_10434736 | 3300032005 | Bacteria | 1093 |
| 818 | Ga0307415_100035303 | 3300032126 | Bacteria | 3265 |
| 819 | Ga0307415_100065523 | 3300032126 | Bacteria | 2531 |
| 820 | Ga0307415_100172906 | 3300032126 | Bacteria | 1686 |
| 821 | Ga0307415_101124989 | 3300032126 | Bacteria | 736 |
| 822 | Ga0373950_0075644 | 3300034818 | Unclassified | 696 |
| 823 | Ga0373959_0177768 | 3300034820 | Bacteria | 552 |
| 824 | Ga0373938_0154874 | 3300034957 | Bacteria | 612 |
| 825 | Ga0373929_0018067 | 3300035085 | Bacteria | 1398 |
| 826 | Ga0373939_0095605 | 3300035114 | Bacteria | 1011 |
| 827 | Ga0373939_0375018 | 3300035114 | Bacteria | 584 |
| 828 | Ga0373960_0157523 | 3300035121 | Bacteria | 780 |
| 829 | Ga0373960_0338373 | 3300035121 | Bacteria | 568 |
| 830 | Ga0373943_0029916 | 3300035170 | Bacteria | 2575 |
| 831 | Ga0373961_0081310 | 3300035241 | Bacteria | 1020 |
| 832 | Ga0373931_1213654 | 3300035691 | Bacteria | 517 |
| 833 | Ga0373935_0002322 | 3300035692 | Bacteria | 10863 |
| 834 | Ga0373927_0155573 | 3300035695 | Bacteria | 1497 |
| 835 | Ga0373947_0250366 | 3300035725 | Bacteria | 1171 |
| 836 | Ga0373947_0722365 | 3300035725 | Bacteria | 680 |
| 837 | Ga0373937_0546426 | 3300036401 | Bacteria | 1100 |
| 838 | Ga0373937_0976411 | 3300036401 | Bacteria | 796 |
| 839 | Ga0373925_0044348 | 3300037068 | Bacteria | 3302 |
| 840 | Ga0395899_0002062 | 3300037312 | Bacteria | 16534 |
| 841 | Ga0395899_0007278 | 3300037312 | Bacteria | 8561 |
| 842 | Ga0395899_0017806 | 3300037312 | Bacteria | 5409 |
| 843 | Ga0395899_0044714 | 3300037312 | Bacteria | 3299 |
| 844 | Ga0395899_0108787 | 3300037312 | Bacteria | 1995 |
| 845 | Ga0395899_0127594 | 3300037312 | Bacteria | 1818 |
| 846 | Ga0395899_0176318 | 3300037312 | Bacteria | 1503 |
| 847 | Ga0395899_0177552 | 3300037312 | Bacteria | 1497 |
| 848 | Ga0395899_0198152 | 3300037312 | Bacteria | 1402 |
| 849 | Ga0395899_0239494 | 3300037312 | Bacteria | 1249 |
| 850 | Ga0395899_0263495 | 3300037312 | Bacteria | 1178 |
| 851 | Ga0395899_0479984 | 3300037312 | Bacteria | 809 |
| 852 | Ga0395899_0506867 | 3300037312 | Unclassified | 782 |
| 853 | Ga0395900_0000997 | 3300037418 | Bacteria | 36770 |
| 854 | Ga0395900_0003165 | 3300037418 | Bacteria | 17843 |
| 855 | Ga0395900_0005624 | 3300037418 | Bacteria | 13109 |
| 856 | Ga0395900_0011036 | 3300037418 | Bacteria | 9232 |
| 857 | Ga0395900_0027388 | 3300037418 | Bacteria | 5837 |
| 858 | Ga0395900_0062013 | 3300037418 | Bacteria | 3844 |
| 859 | Ga0395900_0089574 | 3300037418 | Bacteria | 3162 |
| 860 | Ga0395900_0090128 | 3300037418 | Bacteria | 3152 |
| 861 | Ga0395900_0121970 | 3300037418 | Bacteria | 2674 |
| 862 | Ga0395900_0151212 | 3300037418 | Bacteria | 2371 |
| 863 | Ga0395900_0204665 | 3300037418 | Bacteria | 1995 |
| 864 | Ga0395900_0205499 | 3300037418 | Bacteria | 1990 |
| 865 | Ga0395900_0244780 | 3300037418 | Bacteria | 1797 |
| 866 | Ga0395900_0275184 | 3300037418 | Bacteria | 1677 |
| 867 | Ga0395900_0351368 | 3300037418 | Bacteria | 1448 |
| 868 | Ga0395900_0448047 | 3300037418 | Bacteria | 1247 |
| 869 | Ga0395900_0457515 | 3300037418 | Bacteria | 1231 |
| 870 | Ga0395900_0744561 | 3300037418 | Bacteria | 911 |
| 871 | Ga0395900_0971092 | 3300037418 | Bacteria | 770 |
| 872 | Ga0395900_1070448 | 3300037418 | Bacteria | 724 |
| 873 | Ga0395900_1085104 | 3300037418 | Bacteria | 718 |
| 874 | Ga0395900_1292094 | 3300037418 | Unclassified | 644 |
| 875 | Ga0395900_1692724 | 3300037418 | Bacteria | 543 |
| 876 | Ga0395898_0003637 | 3300037466 | Bacteria | 17137 |
| 877 | Ga0395898_0006632 | 3300037466 | Bacteria | 12342 |
| 878 | Ga0395898_0116024 | 3300037466 | Bacteria | 2565 |
| 879 | Ga0395898_0157508 | 3300037466 | Bacteria | 2172 |
| 880 | Ga0395898_0212865 | 3300037466 | Bacteria | 1843 |
| 881 | Ga0395898_0668955 | 3300037466 | Bacteria | 980 |
| 882 | Ga0395898_0991061 | 3300037466 | Unclassified | 776 |
| 883 | Ga0395898_1093030 | 3300037466 | Bacteria | 731 |
| 884 | Ga0395898_1176341 | 3300037466 | Bacteria | 698 |
| 885 | Ga0395898_1605356 | 3300037466 | Bacteria | 575 |
| 886 | Ga0395905_0000226 | 3300037471 | Bacteria | 85938 |
| 887 | Ga0395905_0001164 | 3300037471 | Bacteria | 32823 |
| 888 | Ga0395905_0009116 | 3300037471 | Bacteria | 9720 |
| 889 | Ga0395905_0010087 | 3300037471 | Bacteria | 9207 |
| 890 | Ga0395905_0013695 | 3300037471 | Bacteria | 7767 |
| 891 | Ga0395905_0019939 | 3300037471 | Bacteria | 6354 |
| 892 | Ga0395905_0035158 | 3300037471 | Bacteria | 4704 |
| 893 | Ga0395905_0047368 | 3300037471 | Bacteria | 4029 |
| 894 | Ga0395905_0055100 | 3300037471 | Bacteria | 3722 |
| 895 | Ga0395905_0055679 | 3300037471 | Bacteria | 3701 |
| 896 | Ga0395905_0057172 | 3300037471 | Bacteria | 3649 |
| 897 | Ga0395905_0060505 | 3300037471 | Bacteria | 3541 |
| 898 | Ga0395905_0073743 | 3300037471 | Bacteria | 3199 |
| 899 | Ga0395905_0088555 | 3300037471 | Bacteria | 2901 |
| 900 | Ga0395905_0089238 | 3300037471 | Bacteria | 2889 |
| 901 | Ga0395905_0135203 | 3300037471 | Bacteria | 2319 |
| 902 | Ga0395905_0138969 | 3300037471 | Bacteria | 2285 |
| 903 | Ga0395905_0213181 | 3300037471 | Bacteria | 1809 |
| 904 | Ga0395905_0248596 | 3300037471 | Bacteria | 1661 |
| 905 | Ga0395905_0280336 | 3300037471 | Bacteria | 1553 |
| 906 | Ga0395905_0349456 | 3300037471 | Bacteria | 1370 |
| 907 | Ga0395905_0361712 | 3300037471 | Bacteria | 1344 |
| 908 | Ga0395905_0777761 | 3300037471 | Bacteria | 860 |
| 909 | Ga0395905_0784082 | 3300037471 | Bacteria | 856 |
| 910 | Ga0395905_0827445 | 3300037471 | Bacteria | 829 |
| 911 | Ga0395905_1451105 | 3300037471 | Unclassified | 590 |
| 912 | Ga0395905_1543824 | 3300037471 | Unclassified | 568 |
| 913 | Ga0395901_0002401 | 3300038443 | Bacteria | 19031 |
| 914 | Ga0395901_0003908 | 3300038443 | Bacteria | 14995 |
| 915 | Ga0395901_0012496 | 3300038443 | Bacteria | 8617 |
| 916 | Ga0395901_0016592 | 3300038443 | Bacteria | 7505 |
| 917 | Ga0395901_0048282 | 3300038443 | Bacteria | 4420 |
| 918 | Ga0395901_0062494 | 3300038443 | Bacteria | 3875 |
| 919 | Ga0395901_0141581 | 3300038443 | Bacteria | 2528 |
| 920 | Ga0395901_0195423 | 3300038443 | Bacteria | 2121 |
| 921 | Ga0395901_0205990 | 3300038443 | Bacteria | 2060 |
| 922 | Ga0395901_0218283 | 3300038443 | Bacteria | 1994 |
| 923 | Ga0395901_0219925 | 3300038443 | Bacteria | 1985 |
| 924 | Ga0395901_0291865 | 3300038443 | Bacteria | 1692 |
| 925 | Ga0395901_0349022 | 3300038443 | Bacteria | 1527 |
| 926 | Ga0395901_0438272 | 3300038443 | Bacteria | 1338 |
| 927 | Ga0395901_0475511 | 3300038443 | Bacteria | 1275 |
| 928 | Ga0395901_0479076 | 3300038443 | Bacteria | 1269 |
| 929 | Ga0395901_0568390 | 3300038443 | Bacteria | 1147 |
| 930 | Ga0395901_1911557 | 3300038443 | Bacteria | 541 |
| 931 | Ga0436365_0428348 | 3300039437 | Bacteria | 1267 |
| 932 | Ga0436365_1575011 | 3300039437 | Bacteria | 17698 |
| 933 | Ga0436365_1884350 | 3300039437 | Bacteria | 751 |
| 934 | Ga0439465_0034100 | 3300041413 | Bacteria | 1629 |
| 935 | Ga0451845_0414206 | 3300041501 | Bacteria | 775 |
| 936 | Ga0439445_0079259 | 3300042004 | Bacteria | 916 |
| 937 | Ga0439448_0091094 | 3300042005 | Bacteria | 1030 |
| 938 | Ga0439432_010963 | 3300042006 | Bacteria | 3127 |
| 939 | Ga0439432_022427 | 3300042006 | Bacteria | 2085 |
| 940 | Ga0439449_0027822 | 3300042007 | Bacteria | 2109 |
| 941 | Ga0439449_0278171 | 3300042007 | Bacteria | 631 |
| 942 | Ga0439455_0199918 | 3300042012 | Bacteria | 578 |
| 943 | Ga0439458_0042423 | 3300042157 | Bacteria | 1107 |
| 944 | Ga0466969_0212953 | 3300044656 | Bacteria | 880 |
| 945 | Ga0466966_0130198 | 3300044684 | Bacteria | 1541 |
| 946 | Ga0466964_0666721 | 3300044706 | Unclassified | 577 |
| 947 | Ga0466970_0579892 | 3300044765 | Bacteria | 650 |
| 948 | Ga0466957_0748177 | 3300044842 | Unclassified | 692 |
| 949 | Ga0466960_0028051 | 3300044901 | Bacteria | 2574 |
| 950 | Ga0466959_0132459 | 3300045049 | Bacteria | 1766 |
| 951 | Ga0495580_0453022 | 3300046472 | Bacteria | 861 |
| 952 | Ga0495582_0355114 | 3300046473 | Bacteria | 844 |
| 953 | Ga0495643_0223268 | 3300046522 | Unclassified | 892 |
| 954 | Ga0495663_0066801 | 3300046525 | Bacteria | 1139 |
| 955 | Ga0495663_0082632 | 3300046525 | Bacteria | 1037 |
| 956 | Ga0495642_0074659 | 3300046528 | Bacteria | 1422 |
| 957 | Ga0495598_0002306 | 3300046537 | Bacteria | 3924 |
| 958 | Ga0495621_0011102 | 3300046539 | Bacteria | 2777 |
| 959 | Ga0495633_0094425 | 3300046558 | Bacteria | 1390 |
| 960 | Ga0495659_0112117 | 3300046664 | Bacteria | 1066 |
| 961 | Ga0495669_0002275 | 3300046684 | Bacteria | 7881 |
| 962 | Ga0495669_0006331 | 3300046684 | Bacteria | 4945 |
| 963 | Ga0495669_0256576 | 3300046684 | Bacteria | 840 |
| 964 | Ga0495670_0011308 | 3300046691 | Bacteria | 4388 |
| 965 | Ga0495670_0618703 | 3300046691 | Bacteria | 590 |
| 966 | Ga0495671_0439482 | 3300046692 | Bacteria | 624 |
| 967 | Ga0495677_0020443 | 3300047445 | Bacteria | 2400 |
| 968 | Ga0495677_0196492 | 3300047445 | Bacteria | 784 |
| 969 | Ga0496100_0022281 | 3300048903 | Bacteria | 3832 |
| 970 | Ga0496100_0266676 | 3300048903 | Bacteria | 1272 |
| 971 | Ga0496100_0318986 | 3300048903 | Bacteria | 1167 |
| 972 | Ga0496100_0556035 | 3300048903 | Bacteria | 888 |
| 973 | Ga0496101_0049682 | 3300048904 | Bacteria | 3018 |
| 974 | Ga0496101_0294292 | 3300048904 | Bacteria | 1271 |
| 975 | Ga0496102_0161723 | 3300048905 | Bacteria | 2106 |
| 976 | Ga0496102_0208593 | 3300048905 | Bacteria | 1842 |
| 977 | Ga0496102_0302707 | 3300048905 | Bacteria | 1507 |
| 978 | Ga0496102_1113417 | 3300048905 | Bacteria | 709 |
| 979 | Ga0496103_0379844 | 3300048906 | Bacteria | 908 |
| 980 | Ga0496103_0799264 | 3300048906 | Bacteria | 595 |
| 981 | Ga0496103_0816550 | 3300048906 | Bacteria | 587 |
| 982 | Ga0496105_0099105 | 3300048908 | Bacteria | 2406 |
| 983 | Ga0496106_0446978 | 3300048909 | Bacteria | 1038 |
| 984 | Ga0496106_0740003 | 3300048909 | Bacteria | 782 |
| 985 | Ga0496107_0041965 | 3300048910 | Bacteria | 3286 |
| 986 | Ga0496107_0046226 | 3300048910 | Bacteria | 3133 |
| 987 | Ga0496107_0285552 | 3300048910 | Bacteria | 1228 |
| 988 | Ga0496108_0027555 | 3300048911 | Bacteria | 4693 |
| 989 | Ga0496108_0057480 | 3300048911 | Bacteria | 3268 |
| 990 | Ga0496109_0000610 | 3300048912 | Bacteria | 29899 |
| 991 | Ga0496109_0080365 | 3300048912 | Bacteria | 3003 |
| 992 | Ga0496109_1954386 | 3300048912 | Bacteria | 519 |
| 993 | Ga0496110_0042470 | 3300048913 | Bacteria | 3968 |
| 994 | Ga0496110_0209938 | 3300048913 | Bacteria | 1770 |
| 995 | Ga0496111_0122553 | 3300048914 | Bacteria | 1920 |
| 996 | Ga0496111_0547946 | 3300048914 | Bacteria | 849 |
| 997 | Ga0496112_0004014 | 3300048915 | Bacteria | 12339 |
| 998 | Ga0496112_0055685 | 3300048915 | Bacteria | 3890 |
| 999 | Ga0496112_0092290 | 3300048915 | Bacteria | 2997 |
| 1000 | Ga0496112_0216286 | 3300048915 | Bacteria | 1873 |
| 1001 | Ga0496112_0355303 | 3300048915 | Bacteria | 1407 |
| 1002 | Ga0496112_0516506 | 3300048915 | Bacteria | 1129 |
| 1003 | Ga0496113_0000952 | 3300048916 | Bacteria | 15412 |
| 1004 | Ga0496113_0158155 | 3300048916 | Bacteria | 1790 |
| 1005 | Ga0496114_0000016 | 3300048917 | Bacteria | 274656 |
| 1006 | Ga0496114_0045920 | 3300048917 | Bacteria | 3629 |
| 1007 | Ga0501292_112198 | 3300049515 | Bacteria | 550 |
| 1008 | Ga0501298_042688 | 3300049521 | Bacteria | 923 |
| 1009 | Ga0501067_0295719 | 3300049583 | Bacteria | 901 |
| 1010 | Ga0501067_0707877 | 3300049583 | Bacteria | 566 |
| 1011 | Ga0501068_0295564 | 3300049584 | Bacteria | 1036 |
| 1012 | Ga0501069_0203005 | 3300049585 | Bacteria | 1149 |
| 1013 | Ga0501069_1042432 | 3300049585 | Bacteria | 500 |
| 1014 | Ga0501071_0280020 | 3300049587 | Bacteria | 1262 |
| 1015 | Ga0501074_0708082 | 3300049590 | Bacteria | 711 |
| 1016 | Ga0501198_055091 | 3300049649 | Bacteria | 717 |
| 1017 | Ga0501202_008297 | 3300049652 | Bacteria | 1892 |
| 1018 | Ga0501217_166429 | 3300049661 | Bacteria | 668 |
| 1019 | Ga0501227_118849 | 3300049665 | Bacteria | 713 |
| 1020 | Ga0501233_030637 | 3300049668 | Bacteria | 1214 |
| 1021 | Ga0501238_027609 | 3300049671 | Bacteria | 816 |
| 1022 | Ga0501243_075528 | 3300049675 | Bacteria | 647 |
| 1023 | Ga0501247_018851 | 3300049677 | Bacteria | 884 |
| 1024 | Ga0501257_052611 | 3300049686 | Bacteria | 1018 |
| 1025 | Ga0501221_028044 | 3300049704 | Bacteria | 1156 |
| 1026 | Ga0501225_0209700 | 3300049705 | Bacteria | 622 |
| 1027 | Ga0501234_018058 | 3300049707 | Bacteria | 1116 |
| 1028 | Ga0501080_0397204 | 3300049742 | Bacteria | 1241 |
| 1029 | Ga0501262_005846 | 3300049759 | Bacteria | 1460 |
| 1030 | Ga0501268_044183 | 3300049765 | Bacteria | 847 |
| 1031 | Ga0501270_044020 | 3300049767 | Bacteria | 787 |
| 1032 | Ga0501279_058969 | 3300049775 | Bacteria | 625 |
| 1033 | Ga0501283_067293 | 3300049779 | Bacteria | 655 |
| 1034 | Ga0501212_029334 | 3300049851 | Bacteria | 882 |
| 1035 | nmdc:mga07m45_550703_c1 | 3300050496 | Bacteria | 667 |
| 1036 | nmdc:mga0n895_681245_c1 | 3300050512 | Bacteria | 1025 |
| 1037 | Ga0495655_0270679 | 3300053083 | Bacteria | 576 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025986 | Ga0207658_10165199 | Ga0207658_101651992 | 72 |
| 2 | 3300005345 | Ga0070692_10514304 | Ga0070692_105143042 | 87 |
| 3 | 3300025903 | Ga0207680_10310385 | Ga0207680_103103852 | 87 |
| 4 | 3300037418 | Ga0395900_0744561 | Ga0395900_0744561_196_495 | 87 |
| 5 | 3300005331 | Ga0070670_100076532 | Ga0070670_1000765323 | 88 |
| 6 | 3300005335 | Ga0070666_10261028 | Ga0070666_102610282 | 88 |
| 7 | 3300005355 | Ga0070671_100059930 | Ga0070671_1000599303 | 88 |
| 8 | 3300005366 | Ga0070659_101002831 | Ga0070659_1010028311 | 88 |
| 9 | 3300005457 | Ga0070662_100189587 | Ga0070662_1001895872 | 88 |
| 10 | 3300005543 | Ga0070672_101265171 | Ga0070672_1012651712 | 88 |
| 11 | 3300005618 | Ga0068864_100003198 | Ga0068864_1000031989 | 88 |
| 12 | 3300005841 | Ga0068863_100004174 | Ga0068863_1000041749 | 88 |
| 13 | 3300009177 | Ga0105248_10001894 | Ga0105248_1000189422 | 88 |
| 14 | 3300013306 | Ga0163162_12230085 | Ga0163162_122300852 | 88 |
| 15 | 3300025909 | Ga0207705_11140637 | Ga0207705_111406372 | 88 |
| 16 | 3300025925 | Ga0207650_10052391 | Ga0207650_100523912 | 88 |
| 17 | 3300025931 | Ga0207644_10000052 | Ga0207644_1000005219 | 88 |
| 18 | 3300025941 | Ga0207711_10000420 | Ga0207711_1000042030 | 88 |
| 19 | 3300026088 | Ga0207641_10006363 | Ga0207641_100063639 | 88 |
| 20 | 3300026095 | Ga0207676_10005353 | Ga0207676_100053539 | 88 |
| 21 | 3300048911 | Ga0496108_0027555 | Ga0496108_0027555_124_420 | 88 |
| 22 | 3300048912 | Ga0496109_0000610 | Ga0496109_0000610_26063_26359 | 88 |
| 23 | 3300048913 | Ga0496110_0209938 | Ga0496110_0209938_1446_1742 | 88 |
| 24 | 3300048915 | Ga0496112_0004014 | Ga0496112_0004014_98_394 | 88 |
| 25 | 3300048916 | Ga0496113_0000952 | Ga0496113_0000952_13498_13794 | 88 |
| 26 | 3300002239 | JGI24034J26672_10032452 | JGI24034J26672_100324522 | 89 |
| 27 | 3300003322 | rootL2_10140508 | rootL2_101405082 | 89 |
| 28 | 3300005330 | Ga0070690_100006336 | Ga0070690_1000063367 | 89 |
| 29 | 3300005335 | Ga0070666_10005953 | Ga0070666_100059539 | 89 |
| 30 | 3300005338 | Ga0068868_100061889 | Ga0068868_1000618893 | 89 |
| 31 | 3300005339 | Ga0070660_100651836 | Ga0070660_1006518362 | 89 |
| 32 | 3300005340 | Ga0070689_100158173 | Ga0070689_1001581732 | 89 |
| 33 | 3300005354 | Ga0070675_100924480 | Ga0070675_1009244802 | 89 |
| 34 | 3300005356 | Ga0070674_101351730 | Ga0070674_1013517302 | 89 |
| 35 | 3300005364 | Ga0070673_100011732 | Ga0070673_1000117325 | 89 |
| 36 | 3300005367 | Ga0070667_100001311 | Ga0070667_1000013112 | 89 |
| 37 | 3300005466 | Ga0070685_10129542 | Ga0070685_101295423 | 89 |
| 38 | 3300005543 | Ga0070672_100642030 | Ga0070672_1006420302 | 89 |
| 39 | 3300005544 | Ga0070686_100032521 | Ga0070686_1000325212 | 89 |
| 40 | 3300005578 | Ga0068854_100638705 | Ga0068854_1006387052 | 89 |
| 41 | 3300005616 | Ga0068852_100869340 | Ga0068852_1008693402 | 89 |
| 42 | 3300005617 | Ga0068859_100279375 | Ga0068859_1002793752 | 89 |
| 43 | 3300005618 | Ga0068864_100473741 | Ga0068864_1004737412 | 89 |
| 44 | 3300005718 | Ga0068866_10204017 | Ga0068866_102040172 | 89 |
| 45 | 3300005842 | Ga0068858_100009881 | Ga0068858_10000988110 | 89 |
| 46 | 3300005843 | Ga0068860_100264921 | Ga0068860_1002649212 | 89 |
| 47 | 3300006881 | Ga0068865_101045802 | Ga0068865_1010458022 | 89 |
| 48 | 3300006931 | Ga0097620_100279373 | Ga0097620_1002793732 | 89 |
| 49 | 3300009177 | Ga0105248_10001634 | Ga0105248_100016342 | 89 |
| 50 | 3300013297 | Ga0157378_10191875 | Ga0157378_101918752 | 89 |
| 51 | 3300013308 | Ga0157375_10403985 | Ga0157375_104039853 | 89 |
| 52 | 3300025321 | Ga0207656_10194328 | Ga0207656_101943282 | 89 |
| 53 | 3300025899 | Ga0207642_10042153 | Ga0207642_100421532 | 89 |
| 54 | 3300025903 | Ga0207680_10002585 | Ga0207680_100025859 | 89 |
| 55 | 3300025904 | Ga0207647_10012986 | Ga0207647_100129863 | 89 |
| 56 | 3300025907 | Ga0207645_10031056 | Ga0207645_100310562 | 89 |
| 57 | 3300025919 | Ga0207657_10356827 | Ga0207657_103568272 | 89 |
| 58 | 3300025927 | Ga0207687_10893712 | Ga0207687_108937121 | 89 |
| 59 | 3300025931 | Ga0207644_10105072 | Ga0207644_101050723 | 89 |
| 60 | 3300025936 | Ga0207670_10501107 | Ga0207670_105011072 | 89 |
| 61 | 3300025937 | Ga0207669_10985967 | Ga0207669_109859672 | 89 |
| 62 | 3300025938 | Ga0207704_11156174 | Ga0207704_111561741 | 89 |
| 63 | 3300025940 | Ga0207691_10128425 | Ga0207691_101284253 | 89 |
| 64 | 3300025941 | Ga0207711_10001311 | Ga0207711_100013113 | 89 |
| 65 | 3300025960 | Ga0207651_10013969 | Ga0207651_100139695 | 89 |
| 66 | 3300025981 | Ga0207640_11370765 | Ga0207640_113707652 | 89 |
| 67 | 3300025986 | Ga0207658_10004807 | Ga0207658_100048073 | 89 |
| 68 | 3300026023 | Ga0207677_10018354 | Ga0207677_100183545 | 89 |
| 69 | 3300026035 | Ga0207703_10002663 | Ga0207703_100026632 | 89 |
| 70 | 3300026035 | Ga0207703_10079372 | Ga0207703_100793725 | 89 |
| 71 | 3300026095 | Ga0207676_10310404 | Ga0207676_103104042 | 89 |
| 72 | 3300026142 | Ga0207698_10089400 | Ga0207698_100894004 | 89 |
| 73 | 3300028381 | Ga0268264_10503308 | Ga0268264_105033082 | 89 |
| 74 | 3300035121 | Ga0373960_0338373 | Ga0373960_0338373_20_319 | 89 |
| 75 | 3300042157 | Ga0439458_0042423 | Ga0439458_0042423_108_404 | 89 |
| 76 | 3300048915 | Ga0496112_0055685 | Ga0496112_0055685_341_640 | 89 |
| 77 | 3300044656 | Ga0466969_0212953 | Ga0466969_0212953_385_684 | 91 |
| 78 | 3300044765 | Ga0466970_0579892 | Ga0466970_0579892_145_444 | 91 |
| 79 | 3300044706 | Ga0466964_0666721 | Ga0466964_0666721_216_515 | 92 |
| 80 | 3300005366 | Ga0070659_100098258 | Ga0070659_1000982583 | 95 |
| 81 | 3300005614 | Ga0068856_100333314 | Ga0068856_1003333141 | 95 |
| 82 | 3300005937 | Ga0081455_10112174 | Ga0081455_101121742 | 95 |
| 83 | 3300013102 | Ga0157371_10051761 | Ga0157371_100517613 | 95 |
| 84 | 3300035692 | Ga0373935_0002322 | Ga0373935_0002322_8406_8696 | 95 |
| 85 | 3300005293 | Ga0065715_11117021 | Ga0065715_111170211 | 96 |
| 86 | 3300005617 | Ga0068859_100067219 | Ga0068859_1000672194 | 96 |
| 87 | 3300005841 | Ga0068863_100720481 | Ga0068863_1007204812 | 96 |
| 88 | 3300006931 | Ga0097620_100067222 | Ga0097620_1000672224 | 96 |
| 89 | 3300009177 | Ga0105248_10055565 | Ga0105248_100555656 | 96 |
| 90 | 3300014968 | Ga0157379_12409262 | Ga0157379_124092622 | 96 |
| 91 | 3300025936 | Ga0207670_10203249 | Ga0207670_102032492 | 96 |
| 92 | 3300025941 | Ga0207711_10192745 | Ga0207711_101927452 | 96 |
| 93 | 3300026078 | Ga0207702_11818892 | Ga0207702_118188921 | 96 |
| 94 | 3300026088 | Ga0207641_10810568 | Ga0207641_108105682 | 96 |
| 95 | 3300031852 | Ga0307410_10112970 | Ga0307410_101129703 | 96 |
| 96 | 3300031901 | Ga0307406_10103064 | Ga0307406_101030643 | 96 |
| 97 | 3300031911 | Ga0307412_10873923 | Ga0307412_108739232 | 96 |
| 98 | 3300031995 | Ga0307409_100217944 | Ga0307409_1002179443 | 96 |
| 99 | 3300031995 | Ga0307409_101102104 | Ga0307409_1011021042 | 96 |
| 100 | 3300032002 | Ga0307416_100144033 | Ga0307416_1001440333 | 96 |
| 101 | 3300037418 | Ga0395900_0275184 | Ga0395900_0275184_754_1059 | 96 |
| 102 | 3300037471 | Ga0395905_0055100 | Ga0395905_0055100_2713_3018 | 96 |
| 103 | 3300044901 | Ga0466960_0028051 | Ga0466960_0028051_1818_2114 | 96 |
| 104 | 3300049585 | Ga0501069_1042432 | Ga0501069_1042432_102_398 | 96 |
| 105 | 3300001915 | JGI24741J21665_1008557 | JGI24741J21665_10085573 | 97 |
| 106 | 3300001978 | JGI24747J21853_1002402 | JGI24747J21853_10024022 | 97 |
| 107 | 3300001979 | JGI24740J21852_10047433 | JGI24740J21852_100474332 | 97 |
| 108 | 3300001979 | JGI24740J21852_10149131 | JGI24740J21852_101491312 | 97 |
| 109 | 3300001989 | JGI24739J22299_10077383 | JGI24739J22299_100773832 | 97 |
| 110 | 3300001990 | JGI24737J22298_10151273 | JGI24737J22298_101512732 | 97 |
| 111 | 3300001990 | JGI24737J22298_10207947 | JGI24737J22298_102079472 | 97 |
| 112 | 3300002067 | JGI24735J21928_10006140 | JGI24735J21928_100061403 | 97 |
| 113 | 3300002073 | JGI24745J21846_1040230 | JGI24745J21846_10402302 | 97 |
| 114 | 3300002077 | JGI24744J21845_10001585 | JGI24744J21845_100015857 | 97 |
| 115 | 3300002459 | JGI24751J29686_10025650 | JGI24751J29686_100256502 | 97 |
| 116 | 3300005327 | Ga0070658_10085273 | Ga0070658_100852732 | 97 |
| 117 | 3300005327 | Ga0070658_10163452 | Ga0070658_101634523 | 97 |
| 118 | 3300005327 | Ga0070658_10426509 | Ga0070658_104265092 | 97 |
| 119 | 3300005327 | Ga0070658_10592463 | Ga0070658_105924632 | 97 |
| 120 | 3300005327 | Ga0070658_11177287 | Ga0070658_111772871 | 97 |
| 121 | 3300005327 | Ga0070658_11330146 | Ga0070658_113301462 | 97 |
| 122 | 3300005328 | Ga0070676_10015404 | Ga0070676_100154042 | 97 |
| 123 | 3300005328 | Ga0070676_10016027 | Ga0070676_100160272 | 97 |
| 124 | 3300005329 | Ga0070683_100211431 | Ga0070683_1002114313 | 97 |
| 125 | 3300005329 | Ga0070683_100428494 | Ga0070683_1004284942 | 97 |
| 126 | 3300005329 | Ga0070683_101088629 | Ga0070683_1010886292 | 97 |
| 127 | 3300005330 | Ga0070690_100173019 | Ga0070690_1001730192 | 97 |
| 128 | 3300005330 | Ga0070690_100536979 | Ga0070690_1005369792 | 97 |
| 129 | 3300005331 | Ga0070670_100014982 | Ga0070670_1000149822 | 97 |
| 130 | 3300005331 | Ga0070670_100080502 | Ga0070670_1000805024 | 97 |
| 131 | 3300005331 | Ga0070670_100142924 | Ga0070670_1001429242 | 97 |
| 132 | 3300005331 | Ga0070670_101937482 | Ga0070670_1019374821 | 97 |
| 133 | 3300005333 | Ga0070677_10017057 | Ga0070677_100170572 | 97 |
| 134 | 3300005334 | Ga0068869_100086966 | Ga0068869_1000869663 | 97 |
| 135 | 3300005335 | Ga0070666_10048049 | Ga0070666_100480492 | 97 |
| 136 | 3300005335 | Ga0070666_10397347 | Ga0070666_103973472 | 97 |
| 137 | 3300005335 | Ga0070666_10437209 | Ga0070666_104372092 | 97 |
| 138 | 3300005335 | Ga0070666_10949706 | Ga0070666_109497061 | 97 |
| 139 | 3300005336 | Ga0070680_101964372 | Ga0070680_1019643721 | 97 |
| 140 | 3300005337 | Ga0070682_100074295 | Ga0070682_1000742952 | 97 |
| 141 | 3300005337 | Ga0070682_100471395 | Ga0070682_1004713951 | 97 |
| 142 | 3300005338 | Ga0068868_100015245 | Ga0068868_1000152456 | 97 |
| 143 | 3300005338 | Ga0068868_100064262 | Ga0068868_1000642622 | 97 |
| 144 | 3300005338 | Ga0068868_100490199 | Ga0068868_1004901992 | 97 |
| 145 | 3300005338 | Ga0068868_100499257 | Ga0068868_1004992572 | 97 |
| 146 | 3300005339 | Ga0070660_100016614 | Ga0070660_1000166142 | 97 |
| 147 | 3300005339 | Ga0070660_100028293 | Ga0070660_1000282933 | 97 |
| 148 | 3300005339 | Ga0070660_100064071 | Ga0070660_1000640713 | 97 |
| 149 | 3300005339 | Ga0070660_100072385 | Ga0070660_1000723854 | 97 |
| 150 | 3300005339 | Ga0070660_100277699 | Ga0070660_1002776992 | 97 |
| 151 | 3300005339 | Ga0070660_101339846 | Ga0070660_1013398462 | 97 |
| 152 | 3300005339 | Ga0070660_101795208 | Ga0070660_1017952082 | 97 |
| 153 | 3300005341 | Ga0070691_10658536 | Ga0070691_106585361 | 97 |
| 154 | 3300005344 | Ga0070661_100034708 | Ga0070661_1000347084 | 97 |
| 155 | 3300005344 | Ga0070661_100036795 | Ga0070661_1000367955 | 97 |
| 156 | 3300005344 | Ga0070661_100069996 | Ga0070661_1000699961 | 97 |
| 157 | 3300005344 | Ga0070661_100129254 | Ga0070661_1001292543 | 97 |
| 158 | 3300005344 | Ga0070661_100303823 | Ga0070661_1003038232 | 97 |
| 159 | 3300005344 | Ga0070661_100504222 | Ga0070661_1005042222 | 97 |
| 160 | 3300005345 | Ga0070692_10278260 | Ga0070692_102782602 | 97 |
| 161 | 3300005347 | Ga0070668_102037572 | Ga0070668_1020375721 | 97 |
| 162 | 3300005353 | Ga0070669_100452609 | Ga0070669_1004526092 | 97 |
| 163 | 3300005353 | Ga0070669_100966435 | Ga0070669_1009664352 | 97 |
| 164 | 3300005354 | Ga0070675_100180001 | Ga0070675_1001800012 | 97 |
| 165 | 3300005354 | Ga0070675_100210201 | Ga0070675_1002102012 | 97 |
| 166 | 3300005355 | Ga0070671_100033206 | Ga0070671_1000332063 | 97 |
| 167 | 3300005355 | Ga0070671_100259607 | Ga0070671_1002596072 | 97 |
| 168 | 3300005355 | Ga0070671_100306390 | Ga0070671_1003063902 | 97 |
| 169 | 3300005356 | Ga0070674_100026956 | Ga0070674_1000269564 | 97 |
| 170 | 3300005356 | Ga0070674_100389875 | Ga0070674_1003898752 | 97 |
| 171 | 3300005364 | Ga0070673_100114366 | Ga0070673_1001143663 | 97 |
| 172 | 3300005364 | Ga0070673_100155841 | Ga0070673_1001558412 | 97 |
| 173 | 3300005364 | Ga0070673_100376767 | Ga0070673_1003767672 | 97 |
| 174 | 3300005366 | Ga0070659_100061929 | Ga0070659_1000619294 | 97 |
| 175 | 3300005366 | Ga0070659_100066651 | Ga0070659_1000666512 | 97 |
| 176 | 3300005366 | Ga0070659_100083062 | Ga0070659_1000830622 | 97 |
| 177 | 3300005366 | Ga0070659_100482086 | Ga0070659_1004820862 | 97 |
| 178 | 3300005366 | Ga0070659_101427693 | Ga0070659_1014276931 | 97 |
| 179 | 3300005366 | Ga0070659_101650748 | Ga0070659_1016507481 | 97 |
| 180 | 3300005367 | Ga0070667_100025802 | Ga0070667_1000258023 | 97 |
| 181 | 3300005367 | Ga0070667_100065494 | Ga0070667_1000654944 | 97 |
| 182 | 3300005367 | Ga0070667_101376340 | Ga0070667_1013763402 | 97 |
| 183 | 3300005434 | Ga0070709_10081361 | Ga0070709_100813612 | 97 |
| 184 | 3300005435 | Ga0070714_100252100 | Ga0070714_1002521002 | 97 |
| 185 | 3300005436 | Ga0070713_100202477 | Ga0070713_1002024772 | 97 |
| 186 | 3300005438 | Ga0070701_10395867 | Ga0070701_103958672 | 97 |
| 187 | 3300005439 | Ga0070711_101876006 | Ga0070711_1018760062 | 97 |
| 188 | 3300005455 | Ga0070663_100010764 | Ga0070663_1000107645 | 97 |
| 189 | 3300005455 | Ga0070663_100020658 | Ga0070663_1000206585 | 97 |
| 190 | 3300005455 | Ga0070663_100093271 | Ga0070663_1000932712 | 97 |
| 191 | 3300005455 | Ga0070663_100271906 | Ga0070663_1002719062 | 97 |
| 192 | 3300005455 | Ga0070663_100387113 | Ga0070663_1003871132 | 97 |
| 193 | 3300005455 | Ga0070663_100391081 | Ga0070663_1003910812 | 97 |
| 194 | 3300005455 | Ga0070663_100561215 | Ga0070663_1005612152 | 97 |
| 195 | 3300005455 | Ga0070663_101402024 | Ga0070663_1014020242 | 97 |
| 196 | 3300005456 | Ga0070678_100002490 | Ga0070678_1000024902 | 97 |
| 197 | 3300005456 | Ga0070678_100206575 | Ga0070678_1002065752 | 97 |
| 198 | 3300005456 | Ga0070678_100344490 | Ga0070678_1003444902 | 97 |
| 199 | 3300005457 | Ga0070662_100004959 | Ga0070662_1000049592 | 97 |
| 200 | 3300005457 | Ga0070662_100014122 | Ga0070662_1000141225 | 97 |
| 201 | 3300005457 | Ga0070662_100058911 | Ga0070662_1000589114 | 97 |
| 202 | 3300005457 | Ga0070662_100078053 | Ga0070662_1000780533 | 97 |
| 203 | 3300005457 | Ga0070662_100294846 | Ga0070662_1002948462 | 97 |
| 204 | 3300005457 | Ga0070662_100653742 | Ga0070662_1006537421 | 97 |
| 205 | 3300005458 | Ga0070681_10288180 | Ga0070681_102881802 | 97 |
| 206 | 3300005458 | Ga0070681_11016448 | Ga0070681_110164482 | 97 |
| 207 | 3300005459 | Ga0068867_100022766 | Ga0068867_1000227662 | 97 |
| 208 | 3300005459 | Ga0068867_100368578 | Ga0068867_1003685782 | 97 |
| 209 | 3300005459 | Ga0068867_101331753 | Ga0068867_1013317531 | 97 |
| 210 | 3300005530 | Ga0070679_100019156 | Ga0070679_1000191563 | 97 |
| 211 | 3300005530 | Ga0070679_100174555 | Ga0070679_1001745553 | 97 |
| 212 | 3300005530 | Ga0070679_100372922 | Ga0070679_1003729222 | 97 |
| 213 | 3300005530 | Ga0070679_100754260 | Ga0070679_1007542601 | 97 |
| 214 | 3300005530 | Ga0070679_101353121 | Ga0070679_1013531211 | 97 |
| 215 | 3300005539 | Ga0068853_100025405 | Ga0068853_1000254052 | 97 |
| 216 | 3300005539 | Ga0068853_100387060 | Ga0068853_1003870602 | 97 |
| 217 | 3300005539 | Ga0068853_100469235 | Ga0068853_1004692352 | 97 |
| 218 | 3300005539 | Ga0068853_100522702 | Ga0068853_1005227022 | 97 |
| 219 | 3300005539 | Ga0068853_101155853 | Ga0068853_1011558532 | 97 |
| 220 | 3300005539 | Ga0068853_101483083 | Ga0068853_1014830831 | 97 |
| 221 | 3300005539 | Ga0068853_101643763 | Ga0068853_1016437632 | 97 |
| 222 | 3300005543 | Ga0070672_100003335 | Ga0070672_10000333510 | 97 |
| 223 | 3300005543 | Ga0070672_101549882 | Ga0070672_1015498821 | 97 |
| 224 | 3300005547 | Ga0070693_100425669 | Ga0070693_1004256692 | 97 |
| 225 | 3300005548 | Ga0070665_100019750 | Ga0070665_1000197503 | 97 |
| 226 | 3300005563 | Ga0068855_100377383 | Ga0068855_1003773832 | 97 |
| 227 | 3300005563 | Ga0068855_100994134 | Ga0068855_1009941342 | 97 |
| 228 | 3300005564 | Ga0070664_100005488 | Ga0070664_10000548810 | 97 |
| 229 | 3300005564 | Ga0070664_100010804 | Ga0070664_1000108048 | 97 |
| 230 | 3300005564 | Ga0070664_100073402 | Ga0070664_1000734022 | 97 |
| 231 | 3300005564 | Ga0070664_100088706 | Ga0070664_1000887062 | 97 |
| 232 | 3300005564 | Ga0070664_100286767 | Ga0070664_1002867672 | 97 |
| 233 | 3300005564 | Ga0070664_100734566 | Ga0070664_1007345662 | 97 |
| 234 | 3300005564 | Ga0070664_102197857 | Ga0070664_1021978572 | 97 |
| 235 | 3300005577 | Ga0068857_100126060 | Ga0068857_1001260603 | 97 |
| 236 | 3300005577 | Ga0068857_100151220 | Ga0068857_1001512201 | 97 |
| 237 | 3300005577 | Ga0068857_100315172 | Ga0068857_1003151722 | 97 |
| 238 | 3300005578 | Ga0068854_100020300 | Ga0068854_1000203003 | 97 |
| 239 | 3300005578 | Ga0068854_100047329 | Ga0068854_1000473293 | 97 |
| 240 | 3300005578 | Ga0068854_100074929 | Ga0068854_1000749292 | 97 |
| 241 | 3300005578 | Ga0068854_100165138 | Ga0068854_1001651382 | 97 |
| 242 | 3300005578 | Ga0068854_100275076 | Ga0068854_1002750762 | 97 |
| 243 | 3300005578 | Ga0068854_100884689 | Ga0068854_1008846892 | 97 |
| 244 | 3300005614 | Ga0068856_100185923 | Ga0068856_1001859232 | 97 |
| 245 | 3300005614 | Ga0068856_100323893 | Ga0068856_1003238932 | 97 |
| 246 | 3300005614 | Ga0068856_101618028 | Ga0068856_1016180282 | 97 |
| 247 | 3300005614 | Ga0068856_102449087 | Ga0068856_1024490871 | 97 |
| 248 | 3300005616 | Ga0068852_100035258 | Ga0068852_1000352585 | 97 |
| 249 | 3300005616 | Ga0068852_100045745 | Ga0068852_1000457452 | 97 |
| 250 | 3300005616 | Ga0068852_100122683 | Ga0068852_1001226834 | 97 |
| 251 | 3300005616 | Ga0068852_100182868 | Ga0068852_1001828682 | 97 |
| 252 | 3300005616 | Ga0068852_100310680 | Ga0068852_1003106802 | 97 |
| 253 | 3300005616 | Ga0068852_100471672 | Ga0068852_1004716722 | 97 |
| 254 | 3300005616 | Ga0068852_100566468 | Ga0068852_1005664682 | 97 |
| 255 | 3300005617 | Ga0068859_100186379 | Ga0068859_1001863793 | 97 |
| 256 | 3300005617 | Ga0068859_101433960 | Ga0068859_1014339602 | 97 |
| 257 | 3300005718 | Ga0068866_10023764 | Ga0068866_100237643 | 97 |
| 258 | 3300005718 | Ga0068866_10026409 | Ga0068866_100264093 | 97 |
| 259 | 3300005718 | Ga0068866_10339675 | Ga0068866_103396752 | 97 |
| 260 | 3300005719 | Ga0068861_100754928 | Ga0068861_1007549282 | 97 |
| 261 | 3300005719 | Ga0068861_101503858 | Ga0068861_1015038582 | 97 |
| 262 | 3300005719 | Ga0068861_101728555 | Ga0068861_1017285552 | 97 |
| 263 | 3300005834 | Ga0068851_10052156 | Ga0068851_100521563 | 97 |
| 264 | 3300005834 | Ga0068851_10068571 | Ga0068851_100685713 | 97 |
| 265 | 3300005834 | Ga0068851_10091247 | Ga0068851_100912472 | 97 |
| 266 | 3300005841 | Ga0068863_100003336 | Ga0068863_10000333610 | 97 |
| 267 | 3300005841 | Ga0068863_100503547 | Ga0068863_1005035472 | 97 |
| 268 | 3300005842 | Ga0068858_100024491 | Ga0068858_1000244916 | 97 |
| 269 | 3300005842 | Ga0068858_100551693 | Ga0068858_1005516932 | 97 |
| 270 | 3300005844 | Ga0068862_100889838 | Ga0068862_1008898382 | 97 |
| 271 | 3300006028 | Ga0070717_11321974 | Ga0070717_113219742 | 97 |
| 272 | 3300006173 | Ga0070716_100237612 | Ga0070716_1002376122 | 97 |
| 273 | 3300006175 | Ga0070712_100043513 | Ga0070712_1000435132 | 97 |
| 274 | 3300006175 | Ga0070712_100199713 | Ga0070712_1001997132 | 97 |
| 275 | 3300006237 | Ga0097621_100036057 | Ga0097621_1000360573 | 97 |
| 276 | 3300006237 | Ga0097621_100200994 | Ga0097621_1002009942 | 97 |
| 277 | 3300006358 | Ga0068871_100200469 | Ga0068871_1002004692 | 97 |
| 278 | 3300006358 | Ga0068871_100460286 | Ga0068871_1004602861 | 97 |
| 279 | 3300006871 | Ga0075434_100306851 | Ga0075434_1003068511 | 97 |
| 280 | 3300006881 | Ga0068865_100072973 | Ga0068865_1000729733 | 97 |
| 281 | 3300006881 | Ga0068865_100615315 | Ga0068865_1006153152 | 97 |
| 282 | 3300006881 | Ga0068865_100978046 | Ga0068865_1009780462 | 97 |
| 283 | 3300006931 | Ga0097620_100186370 | Ga0097620_1001863702 | 97 |
| 284 | 3300006931 | Ga0097620_101433801 | Ga0097620_1014338012 | 97 |
| 285 | 3300009036 | Ga0105244_10507981 | Ga0105244_105079812 | 97 |
| 286 | 3300009098 | Ga0105245_10019606 | Ga0105245_100196065 | 97 |
| 287 | 3300009098 | Ga0105245_10023282 | Ga0105245_100232826 | 97 |
| 288 | 3300009098 | Ga0105245_11610038 | Ga0105245_116100381 | 97 |
| 289 | 3300009148 | Ga0105243_10592442 | Ga0105243_105924422 | 97 |
| 290 | 3300009174 | Ga0105241_10685630 | Ga0105241_106856302 | 97 |
| 291 | 3300009174 | Ga0105241_11342443 | Ga0105241_113424432 | 97 |
| 292 | 3300009176 | Ga0105242_10155550 | Ga0105242_101555501 | 97 |
| 293 | 3300009177 | Ga0105248_10002448 | Ga0105248_1000244815 | 97 |
| 294 | 3300009177 | Ga0105248_10026794 | Ga0105248_100267942 | 97 |
| 295 | 3300009177 | Ga0105248_10052041 | Ga0105248_100520416 | 97 |
| 296 | 3300009551 | Ga0105238_10324553 | Ga0105238_103245532 | 97 |
| 297 | 3300009553 | Ga0105249_10261845 | Ga0105249_102618452 | 97 |
| 298 | 3300010375 | Ga0105239_11448792 | Ga0105239_114487922 | 97 |
| 299 | 3300011119 | Ga0105246_10064694 | Ga0105246_100646944 | 97 |
| 300 | 3300013100 | Ga0157373_10173185 | Ga0157373_101731852 | 97 |
| 301 | 3300013100 | Ga0157373_10368773 | Ga0157373_103687732 | 97 |
| 302 | 3300013102 | Ga0157371_10053945 | Ga0157371_100539452 | 97 |
| 303 | 3300013102 | Ga0157371_10225171 | Ga0157371_102251712 | 97 |
| 304 | 3300013102 | Ga0157371_10257009 | Ga0157371_102570092 | 97 |
| 305 | 3300013102 | Ga0157371_10357931 | Ga0157371_103579311 | 97 |
| 306 | 3300013102 | Ga0157371_10472897 | Ga0157371_104728971 | 97 |
| 307 | 3300013104 | Ga0157370_10167170 | Ga0157370_101671703 | 97 |
| 308 | 3300013104 | Ga0157370_10957146 | Ga0157370_109571462 | 97 |
| 309 | 3300013105 | Ga0157369_10153643 | Ga0157369_101536433 | 97 |
| 310 | 3300013105 | Ga0157369_10462082 | Ga0157369_104620822 | 97 |
| 311 | 3300013296 | Ga0157374_10159797 | Ga0157374_101597972 | 97 |
| 312 | 3300013296 | Ga0157374_10197873 | Ga0157374_101978733 | 97 |
| 313 | 3300013296 | Ga0157374_11582747 | Ga0157374_115827472 | 97 |
| 314 | 3300013296 | Ga0157374_11988145 | Ga0157374_119881452 | 97 |
| 315 | 3300013297 | Ga0157378_10268195 | Ga0157378_102681952 | 97 |
| 316 | 3300013297 | Ga0157378_10535647 | Ga0157378_105356472 | 97 |
| 317 | 3300013306 | Ga0163162_10000768 | Ga0163162_1000076823 | 97 |
| 318 | 3300013306 | Ga0163162_10128812 | Ga0163162_101288122 | 97 |
| 319 | 3300013307 | Ga0157372_10591808 | Ga0157372_105918082 | 97 |
| 320 | 3300013307 | Ga0157372_10890480 | Ga0157372_108904802 | 97 |
| 321 | 3300013307 | Ga0157372_10917523 | Ga0157372_109175232 | 97 |
| 322 | 3300013308 | Ga0157375_10005630 | Ga0157375_100056302 | 97 |
| 323 | 3300013308 | Ga0157375_10213250 | Ga0157375_102132503 | 97 |
| 324 | 3300014325 | Ga0163163_10206336 | Ga0163163_102063362 | 97 |
| 325 | 3300014326 | Ga0157380_12285446 | Ga0157380_122854461 | 97 |
| 326 | 3300017792 | Ga0163161_10328102 | Ga0163161_103281022 | 97 |
| 327 | 3300017792 | Ga0163161_10368541 | Ga0163161_103685412 | 97 |
| 328 | 3300021384 | Ga0213876_10023631 | Ga0213876_100236312 | 97 |
| 329 | 3300021384 | Ga0213876_10077576 | Ga0213876_100775763 | 97 |
| 330 | 3300025315 | Ga0207697_10011452 | Ga0207697_100114525 | 97 |
| 331 | 3300025321 | Ga0207656_10130030 | Ga0207656_101300302 | 97 |
| 332 | 3300025321 | Ga0207656_10173642 | Ga0207656_101736422 | 97 |
| 333 | 3300025321 | Ga0207656_10321154 | Ga0207656_103211542 | 97 |
| 334 | 3300025893 | Ga0207682_10004204 | Ga0207682_100042043 | 97 |
| 335 | 3300025899 | Ga0207642_10007391 | Ga0207642_100073913 | 97 |
| 336 | 3300025899 | Ga0207642_10164071 | Ga0207642_101640712 | 97 |
| 337 | 3300025899 | Ga0207642_10270163 | Ga0207642_102701632 | 97 |
| 338 | 3300025901 | Ga0207688_10126250 | Ga0207688_101262502 | 97 |
| 339 | 3300025901 | Ga0207688_10129436 | Ga0207688_101294362 | 97 |
| 340 | 3300025903 | Ga0207680_11234789 | Ga0207680_112347891 | 97 |
| 341 | 3300025903 | Ga0207680_11242879 | Ga0207680_112428791 | 97 |
| 342 | 3300025904 | Ga0207647_10050442 | Ga0207647_100504423 | 97 |
| 343 | 3300025904 | Ga0207647_10065670 | Ga0207647_100656703 | 97 |
| 344 | 3300025904 | Ga0207647_10302630 | Ga0207647_103026302 | 97 |
| 345 | 3300025906 | Ga0207699_10146761 | Ga0207699_101467612 | 97 |
| 346 | 3300025907 | Ga0207645_10020823 | Ga0207645_100208235 | 97 |
| 347 | 3300025907 | Ga0207645_10046178 | Ga0207645_100461784 | 97 |
| 348 | 3300025907 | Ga0207645_10762584 | Ga0207645_107625842 | 97 |
| 349 | 3300025907 | Ga0207645_11026039 | Ga0207645_110260392 | 97 |
| 350 | 3300025909 | Ga0207705_10003597 | Ga0207705_100035978 | 97 |
| 351 | 3300025909 | Ga0207705_10004771 | Ga0207705_1000477113 | 97 |
| 352 | 3300025909 | Ga0207705_10131333 | Ga0207705_101313332 | 97 |
| 353 | 3300025909 | Ga0207705_10180650 | Ga0207705_101806502 | 97 |
| 354 | 3300025909 | Ga0207705_10799219 | Ga0207705_107992192 | 97 |
| 355 | 3300025911 | Ga0207654_11216505 | Ga0207654_112165052 | 97 |
| 356 | 3300025912 | Ga0207707_10150276 | Ga0207707_101502762 | 97 |
| 357 | 3300025912 | Ga0207707_10476500 | Ga0207707_104765001 | 97 |
| 358 | 3300025915 | Ga0207693_10014544 | Ga0207693_100145442 | 97 |
| 359 | 3300025918 | Ga0207662_10207392 | Ga0207662_102073922 | 97 |
| 360 | 3300025918 | Ga0207662_10974084 | Ga0207662_109740842 | 97 |
| 361 | 3300025919 | Ga0207657_10002813 | Ga0207657_1000281311 | 97 |
| 362 | 3300025919 | Ga0207657_10024081 | Ga0207657_100240813 | 97 |
| 363 | 3300025919 | Ga0207657_10040928 | Ga0207657_100409284 | 97 |
| 364 | 3300025919 | Ga0207657_10042145 | Ga0207657_100421452 | 97 |
| 365 | 3300025919 | Ga0207657_10102994 | Ga0207657_101029942 | 97 |
| 366 | 3300025919 | Ga0207657_10124050 | Ga0207657_101240503 | 97 |
| 367 | 3300025919 | Ga0207657_10268630 | Ga0207657_102686302 | 97 |
| 368 | 3300025919 | Ga0207657_10958389 | Ga0207657_109583892 | 97 |
| 369 | 3300025920 | Ga0207649_10011041 | Ga0207649_100110414 | 97 |
| 370 | 3300025920 | Ga0207649_10027276 | Ga0207649_100272762 | 97 |
| 371 | 3300025920 | Ga0207649_10034090 | Ga0207649_100340901 | 97 |
| 372 | 3300025920 | Ga0207649_10060338 | Ga0207649_100603382 | 97 |
| 373 | 3300025920 | Ga0207649_10129581 | Ga0207649_101295812 | 97 |
| 374 | 3300025920 | Ga0207649_10287679 | Ga0207649_102876792 | 97 |
| 375 | 3300025920 | Ga0207649_10307304 | Ga0207649_103073042 | 97 |
| 376 | 3300025920 | Ga0207649_11694553 | Ga0207649_116945531 | 97 |
| 377 | 3300025921 | Ga0207652_10122947 | Ga0207652_101229473 | 97 |
| 378 | 3300025921 | Ga0207652_10143490 | Ga0207652_101434903 | 97 |
| 379 | 3300025921 | Ga0207652_10454642 | Ga0207652_104546422 | 97 |
| 380 | 3300025923 | Ga0207681_10336792 | Ga0207681_103367922 | 97 |
| 381 | 3300025923 | Ga0207681_10418805 | Ga0207681_104188052 | 97 |
| 382 | 3300025925 | Ga0207650_10002948 | Ga0207650_1000294810 | 97 |
| 383 | 3300025925 | Ga0207650_10043580 | Ga0207650_100435803 | 97 |
| 384 | 3300025925 | Ga0207650_10107594 | Ga0207650_101075942 | 97 |
| 385 | 3300025925 | Ga0207650_10227661 | Ga0207650_102276613 | 97 |
| 386 | 3300025925 | Ga0207650_11421791 | Ga0207650_114217911 | 97 |
| 387 | 3300025926 | Ga0207659_10085108 | Ga0207659_100851083 | 97 |
| 388 | 3300025927 | Ga0207687_10012657 | Ga0207687_100126576 | 97 |
| 389 | 3300025927 | Ga0207687_10035715 | Ga0207687_100357153 | 97 |
| 390 | 3300025931 | Ga0207644_10017678 | Ga0207644_100176784 | 97 |
| 391 | 3300025931 | Ga0207644_10209244 | Ga0207644_102092442 | 97 |
| 392 | 3300025931 | Ga0207644_10259752 | Ga0207644_102597522 | 97 |
| 393 | 3300025931 | Ga0207644_10761302 | Ga0207644_107613022 | 97 |
| 394 | 3300025932 | Ga0207690_10013275 | Ga0207690_100132753 | 97 |
| 395 | 3300025932 | Ga0207690_10049022 | Ga0207690_100490222 | 97 |
| 396 | 3300025932 | Ga0207690_10109546 | Ga0207690_101095462 | 97 |
| 397 | 3300025932 | Ga0207690_10199876 | Ga0207690_101998762 | 97 |
| 398 | 3300025932 | Ga0207690_10427935 | Ga0207690_104279352 | 97 |
| 399 | 3300025932 | Ga0207690_11496497 | Ga0207690_114964972 | 97 |
| 400 | 3300025933 | Ga0207706_10000614 | Ga0207706_1000061420 | 97 |
| 401 | 3300025933 | Ga0207706_10007215 | Ga0207706_100072154 | 97 |
| 402 | 3300025933 | Ga0207706_10040584 | Ga0207706_100405843 | 97 |
| 403 | 3300025933 | Ga0207706_10048431 | Ga0207706_100484312 | 97 |
| 404 | 3300025933 | Ga0207706_10124972 | Ga0207706_101249723 | 97 |
| 405 | 3300025933 | Ga0207706_10680466 | Ga0207706_106804662 | 97 |
| 406 | 3300025937 | Ga0207669_10410156 | Ga0207669_104101562 | 97 |
| 407 | 3300025937 | Ga0207669_10556401 | Ga0207669_105564012 | 97 |
| 408 | 3300025938 | Ga0207704_10138617 | Ga0207704_101386172 | 97 |
| 409 | 3300025938 | Ga0207704_10292820 | Ga0207704_102928202 | 97 |
| 410 | 3300025939 | Ga0207665_10565645 | Ga0207665_105656452 | 97 |
| 411 | 3300025940 | Ga0207691_10000998 | Ga0207691_1000099819 | 97 |
| 412 | 3300025940 | Ga0207691_10071125 | Ga0207691_100711253 | 97 |
| 413 | 3300025940 | Ga0207691_11150273 | Ga0207691_111502731 | 97 |
| 414 | 3300025941 | Ga0207711_10003129 | Ga0207711_100031298 | 97 |
| 415 | 3300025941 | Ga0207711_10011832 | Ga0207711_100118325 | 97 |
| 416 | 3300025942 | Ga0207689_10033251 | Ga0207689_100332515 | 97 |
| 417 | 3300025944 | Ga0207661_10224509 | Ga0207661_102245093 | 97 |
| 418 | 3300025945 | Ga0207679_10025671 | Ga0207679_100256713 | 97 |
| 419 | 3300025945 | Ga0207679_10034407 | Ga0207679_100344075 | 97 |
| 420 | 3300025945 | Ga0207679_10092592 | Ga0207679_100925922 | 97 |
| 421 | 3300025945 | Ga0207679_10183638 | Ga0207679_101836382 | 97 |
| 422 | 3300025945 | Ga0207679_10295415 | Ga0207679_102954153 | 97 |
| 423 | 3300025945 | Ga0207679_10961685 | Ga0207679_109616852 | 97 |
| 424 | 3300025949 | Ga0207667_10500052 | Ga0207667_105000522 | 97 |
| 425 | 3300025960 | Ga0207651_10000652 | Ga0207651_100006529 | 97 |
| 426 | 3300025960 | Ga0207651_10654794 | Ga0207651_106547942 | 97 |
| 427 | 3300025960 | Ga0207651_11281837 | Ga0207651_112818372 | 97 |
| 428 | 3300025961 | Ga0207712_11482182 | Ga0207712_114821822 | 97 |
| 429 | 3300025972 | Ga0207668_10219539 | Ga0207668_102195392 | 97 |
| 430 | 3300025981 | Ga0207640_10057391 | Ga0207640_100573913 | 97 |
| 431 | 3300025981 | Ga0207640_10175109 | Ga0207640_101751092 | 97 |
| 432 | 3300025981 | Ga0207640_10209652 | Ga0207640_102096522 | 97 |
| 433 | 3300025981 | Ga0207640_10832447 | Ga0207640_108324472 | 97 |
| 434 | 3300025981 | Ga0207640_11607904 | Ga0207640_116079042 | 97 |
| 435 | 3300025986 | Ga0207658_10038494 | Ga0207658_100384943 | 97 |
| 436 | 3300025986 | Ga0207658_10123783 | Ga0207658_101237832 | 97 |
| 437 | 3300025986 | Ga0207658_10654966 | Ga0207658_106549662 | 97 |
| 438 | 3300025986 | Ga0207658_11098034 | Ga0207658_110980342 | 97 |
| 439 | 3300026023 | Ga0207677_10003117 | Ga0207677_100031176 | 97 |
| 440 | 3300026023 | Ga0207677_10072056 | Ga0207677_100720562 | 97 |
| 441 | 3300026023 | Ga0207677_10679258 | Ga0207677_106792582 | 97 |
| 442 | 3300026035 | Ga0207703_10031952 | Ga0207703_100319524 | 97 |
| 443 | 3300026041 | Ga0207639_10117021 | Ga0207639_101170212 | 97 |
| 444 | 3300026041 | Ga0207639_10230713 | Ga0207639_102307132 | 97 |
| 445 | 3300026041 | Ga0207639_10555240 | Ga0207639_105552402 | 97 |
| 446 | 3300026041 | Ga0207639_10622591 | Ga0207639_106225912 | 97 |
| 447 | 3300026041 | Ga0207639_10716064 | Ga0207639_107160642 | 97 |
| 448 | 3300026041 | Ga0207639_11194175 | Ga0207639_111941752 | 97 |
| 449 | 3300026067 | Ga0207678_10006831 | Ga0207678_100068313 | 97 |
| 450 | 3300026067 | Ga0207678_10020241 | Ga0207678_100202413 | 97 |
| 451 | 3300026067 | Ga0207678_10040138 | Ga0207678_100401385 | 97 |
| 452 | 3300026067 | Ga0207678_10129505 | Ga0207678_101295052 | 97 |
| 453 | 3300026067 | Ga0207678_10143668 | Ga0207678_101436683 | 97 |
| 454 | 3300026067 | Ga0207678_10170926 | Ga0207678_101709263 | 97 |
| 455 | 3300026067 | Ga0207678_10216460 | Ga0207678_102164602 | 97 |
| 456 | 3300026067 | Ga0207678_10265351 | Ga0207678_102653512 | 97 |
| 457 | 3300026078 | Ga0207702_10993495 | Ga0207702_109934952 | 97 |
| 458 | 3300026078 | Ga0207702_11535377 | Ga0207702_115353772 | 97 |
| 459 | 3300026078 | Ga0207702_12287974 | Ga0207702_122879742 | 97 |
| 460 | 3300026088 | Ga0207641_10092172 | Ga0207641_100921722 | 97 |
| 461 | 3300026088 | Ga0207641_11232560 | Ga0207641_112325602 | 97 |
| 462 | 3300026089 | Ga0207648_10016503 | Ga0207648_1001650310 | 97 |
| 463 | 3300026089 | Ga0207648_10057138 | Ga0207648_100571382 | 97 |
| 464 | 3300026089 | Ga0207648_10358818 | Ga0207648_103588182 | 97 |
| 465 | 3300026095 | Ga0207676_10045938 | Ga0207676_100459383 | 97 |
| 466 | 3300026116 | Ga0207674_10006741 | Ga0207674_100067418 | 97 |
| 467 | 3300026116 | Ga0207674_10154256 | Ga0207674_101542561 | 97 |
| 468 | 3300026116 | Ga0207674_10173540 | Ga0207674_101735403 | 97 |
| 469 | 3300026118 | Ga0207675_100147851 | Ga0207675_1001478513 | 97 |
| 470 | 3300026121 | Ga0207683_10000846 | Ga0207683_1000084610 | 97 |
| 471 | 3300026121 | Ga0207683_10106035 | Ga0207683_101060352 | 97 |
| 472 | 3300026121 | Ga0207683_10177759 | Ga0207683_101777593 | 97 |
| 473 | 3300026142 | Ga0207698_10078193 | Ga0207698_100781933 | 97 |
| 474 | 3300026142 | Ga0207698_10147231 | Ga0207698_101472313 | 97 |
| 475 | 3300026142 | Ga0207698_10149172 | Ga0207698_101491722 | 97 |
| 476 | 3300026142 | Ga0207698_10232933 | Ga0207698_102329332 | 97 |
| 477 | 3300026142 | Ga0207698_10245977 | Ga0207698_102459772 | 97 |
| 478 | 3300026142 | Ga0207698_10355606 | Ga0207698_103556062 | 97 |
| 479 | 3300026142 | Ga0207698_10508813 | Ga0207698_105088132 | 97 |
| 480 | 3300026142 | Ga0207698_11361809 | Ga0207698_113618092 | 97 |
| 481 | 3300028380 | Ga0268265_11085440 | Ga0268265_110854402 | 97 |
| 482 | 3300028381 | Ga0268264_10641038 | Ga0268264_106410382 | 97 |
| 483 | 3300031548 | Ga0307408_100336708 | Ga0307408_1003367082 | 97 |
| 484 | 3300031731 | Ga0307405_10025754 | Ga0307405_100257542 | 97 |
| 485 | 3300031731 | Ga0307405_10414443 | Ga0307405_104144431 | 97 |
| 486 | 3300031731 | Ga0307405_10591326 | Ga0307405_105913262 | 97 |
| 487 | 3300031824 | Ga0307413_10140181 | Ga0307413_101401812 | 97 |
| 488 | 3300031852 | Ga0307410_10047487 | Ga0307410_100474872 | 97 |
| 489 | 3300031903 | Ga0307407_10082056 | Ga0307407_100820563 | 97 |
| 490 | 3300031911 | Ga0307412_10062941 | Ga0307412_100629412 | 97 |
| 491 | 3300031911 | Ga0307412_10669854 | Ga0307412_106698542 | 97 |
| 492 | 3300031995 | Ga0307409_100186308 | Ga0307409_1001863082 | 97 |
| 493 | 3300031995 | Ga0307409_100343324 | Ga0307409_1003433242 | 97 |
| 494 | 3300031995 | Ga0307409_100637213 | Ga0307409_1006372132 | 97 |
| 495 | 3300032002 | Ga0307416_100018217 | Ga0307416_1000182172 | 97 |
| 496 | 3300032002 | Ga0307416_100530778 | Ga0307416_1005307782 | 97 |
| 497 | 3300032004 | Ga0307414_10102821 | Ga0307414_101028212 | 97 |
| 498 | 3300032005 | Ga0307411_10032660 | Ga0307411_100326602 | 97 |
| 499 | 3300032126 | Ga0307415_100035303 | Ga0307415_1000353034 | 97 |
| 500 | 3300032126 | Ga0307415_100172906 | Ga0307415_1001729061 | 97 |
| 501 | 3300032126 | Ga0307415_101124989 | Ga0307415_1011249892 | 97 |
| 502 | 3300035085 | Ga0373929_0018067 | Ga0373929_0018067_513_824 | 97 |
| 503 | 3300035114 | Ga0373939_0095605 | Ga0373939_0095605_293_604 | 97 |
| 504 | 3300035121 | Ga0373960_0157523 | Ga0373960_0157523_204_503 | 97 |
| 505 | 3300035170 | Ga0373943_0029916 | Ga0373943_0029916_969_1268 | 97 |
| 506 | 3300035695 | Ga0373927_0155573 | Ga0373927_0155573_429_728 | 97 |
| 507 | 3300035725 | Ga0373947_0250366 | Ga0373947_0250366_596_895 | 97 |
| 508 | 3300037068 | Ga0373925_0044348 | Ga0373925_0044348_903_1202 | 97 |
| 509 | 3300037312 | Ga0395899_0017806 | Ga0395899_0017806_918_1217 | 97 |
| 510 | 3300037312 | Ga0395899_0108787 | Ga0395899_0108787_141_440 | 97 |
| 511 | 3300037312 | Ga0395899_0239494 | Ga0395899_0239494_557_856 | 97 |
| 512 | 3300037312 | Ga0395899_0263495 | Ga0395899_0263495_155_454 | 97 |
| 513 | 3300037418 | Ga0395900_0089574 | Ga0395900_0089574_2506_2805 | 97 |
| 514 | 3300037418 | Ga0395900_0244780 | Ga0395900_0244780_1369_1668 | 97 |
| 515 | 3300037418 | Ga0395900_0448047 | Ga0395900_0448047_891_1190 | 97 |
| 516 | 3300037418 | Ga0395900_1292094 | Ga0395900_1292094_13_312 | 97 |
| 517 | 3300037418 | Ga0395900_1692724 | Ga0395900_1692724_155_454 | 97 |
| 518 | 3300037466 | Ga0395898_0116024 | Ga0395898_0116024_1743_2042 | 97 |
| 519 | 3300037466 | Ga0395898_0157508 | Ga0395898_0157508_555_854 | 97 |
| 520 | 3300037466 | Ga0395898_1093030 | Ga0395898_1093030_123_422 | 97 |
| 521 | 3300037471 | Ga0395905_0000226 | Ga0395905_0000226_35635_35934 | 97 |
| 522 | 3300037471 | Ga0395905_0019939 | Ga0395905_0019939_2285_2584 | 97 |
| 523 | 3300037471 | Ga0395905_0035158 | Ga0395905_0035158_3781_4080 | 97 |
| 524 | 3300037471 | Ga0395905_0073743 | Ga0395905_0073743_859_1158 | 97 |
| 525 | 3300037471 | Ga0395905_0135203 | Ga0395905_0135203_258_557 | 97 |
| 526 | 3300037471 | Ga0395905_0138969 | Ga0395905_0138969_1719_2018 | 97 |
| 527 | 3300037471 | Ga0395905_0349456 | Ga0395905_0349456_513_812 | 97 |
| 528 | 3300037471 | Ga0395905_0361712 | Ga0395905_0361712_638_937 | 97 |
| 529 | 3300037471 | Ga0395905_0777761 | Ga0395905_0777761_413_712 | 97 |
| 530 | 3300037471 | Ga0395905_0827445 | Ga0395905_0827445_216_515 | 97 |
| 531 | 3300038443 | Ga0395901_0195423 | Ga0395901_0195423_900_1199 | 97 |
| 532 | 3300038443 | Ga0395901_0219925 | Ga0395901_0219925_1161_1460 | 97 |
| 533 | 3300038443 | Ga0395901_0349022 | Ga0395901_0349022_1062_1361 | 97 |
| 534 | 3300038443 | Ga0395901_1911557 | Ga0395901_1911557_153_452 | 97 |
| 535 | 3300039437 | Ga0436365_0428348 | Ga0436365_0428348_454_753 | 97 |
| 536 | 3300039437 | Ga0436365_1575011 | Ga0436365_1575011_6078_6377 | 97 |
| 537 | 3300044842 | Ga0466957_0748177 | Ga0466957_0748177_104_409 | 97 |
| 538 | 3300046472 | Ga0495580_0453022 | Ga0495580_0453022_56_355 | 97 |
| 539 | 3300046691 | Ga0495670_0618703 | Ga0495670_0618703_230_529 | 97 |
| 540 | 3300046692 | Ga0495671_0439482 | Ga0495671_0439482_195_494 | 97 |
| 541 | 3300048903 | Ga0496100_0022281 | Ga0496100_0022281_3494_3793 | 97 |
| 542 | 3300048903 | Ga0496100_0318986 | Ga0496100_0318986_30_335 | 97 |
| 543 | 3300048904 | Ga0496101_0049682 | Ga0496101_0049682_1602_1901 | 97 |
| 544 | 3300048904 | Ga0496101_0294292 | Ga0496101_0294292_801_1106 | 97 |
| 545 | 3300048905 | Ga0496102_0161723 | Ga0496102_0161723_138_437 | 97 |
| 546 | 3300048905 | Ga0496102_0208593 | Ga0496102_0208593_1068_1373 | 97 |
| 547 | 3300048905 | Ga0496102_0302707 | Ga0496102_0302707_764_1060 | 97 |
| 548 | 3300048906 | Ga0496103_0379844 | Ga0496103_0379844_423_722 | 97 |
| 549 | 3300048906 | Ga0496103_0799264 | Ga0496103_0799264_285_584 | 97 |
| 550 | 3300048906 | Ga0496103_0816550 | Ga0496103_0816550_177_473 | 97 |
| 551 | 3300048908 | Ga0496105_0099105 | Ga0496105_0099105_1678_1977 | 97 |
| 552 | 3300048909 | Ga0496106_0446978 | Ga0496106_0446978_341_640 | 97 |
| 553 | 3300048910 | Ga0496107_0041965 | Ga0496107_0041965_2230_2529 | 97 |
| 554 | 3300048910 | Ga0496107_0046226 | Ga0496107_0046226_1071_1376 | 97 |
| 555 | 3300048910 | Ga0496107_0285552 | Ga0496107_0285552_335_631 | 97 |
| 556 | 3300048911 | Ga0496108_0057480 | Ga0496108_0057480_1073_1378 | 97 |
| 557 | 3300048912 | Ga0496109_0080365 | Ga0496109_0080365_1473_1778 | 97 |
| 558 | 3300048913 | Ga0496110_0042470 | Ga0496110_0042470_2414_2719 | 97 |
| 559 | 3300048914 | Ga0496111_0122553 | Ga0496111_0122553_352_657 | 97 |
| 560 | 3300048914 | Ga0496111_0547946 | Ga0496111_0547946_187_492 | 97 |
| 561 | 3300048915 | Ga0496112_0092290 | Ga0496112_0092290_1520_1825 | 97 |
| 562 | 3300048915 | Ga0496112_0216286 | Ga0496112_0216286_411_716 | 97 |
| 563 | 3300048915 | Ga0496112_0516506 | Ga0496112_0516506_200_496 | 97 |
| 564 | 3300048916 | Ga0496113_0158155 | Ga0496113_0158155_798_1103 | 97 |
| 565 | 3300048917 | Ga0496114_0000016 | Ga0496114_0000016_196189_196488 | 97 |
| 566 | 3300048917 | Ga0496114_0045920 | Ga0496114_0045920_2932_3231 | 97 |
| 567 | 3300049583 | Ga0501067_0295719 | Ga0501067_0295719_576_875 | 97 |
| 568 | 3300049583 | Ga0501067_0707877 | Ga0501067_0707877_172_471 | 97 |
| 569 | 3300049584 | Ga0501068_0295564 | Ga0501068_0295564_114_413 | 97 |
| 570 | 3300049585 | Ga0501069_0203005 | Ga0501069_0203005_770_1069 | 97 |
| 571 | 3300050512 | nmdc:mga0n895_681245_c1 | nmdc:mga0n895_681245_c1_641_940 | 97 |
| 572 | 3300001904 | JGI24736J21556_1020912 | JGI24736J21556_10209122 | 98 |
| 573 | 3300001915 | JGI24741J21665_1008594 | JGI24741J21665_10085943 | 98 |
| 574 | 3300001978 | JGI24747J21853_1011601 | JGI24747J21853_10116012 | 98 |
| 575 | 3300001979 | JGI24740J21852_10009374 | JGI24740J21852_100093745 | 98 |
| 576 | 3300001989 | JGI24739J22299_10084372 | JGI24739J22299_100843722 | 98 |
| 577 | 3300001990 | JGI24737J22298_10007721 | JGI24737J22298_100077213 | 98 |
| 578 | 3300001990 | JGI24737J22298_10019478 | JGI24737J22298_100194783 | 98 |
| 579 | 3300001991 | JGI24743J22301_10002872 | JGI24743J22301_100028724 | 98 |
| 580 | 3300001991 | JGI24743J22301_10017326 | JGI24743J22301_100173262 | 98 |
| 581 | 3300002067 | JGI24735J21928_10101212 | JGI24735J21928_101012122 | 98 |
| 582 | 3300002067 | JGI24735J21928_10214129 | JGI24735J21928_102141292 | 98 |
| 583 | 3300002075 | JGI24738J21930_10046291 | JGI24738J21930_100462912 | 98 |
| 584 | 3300002077 | JGI24744J21845_10077148 | JGI24744J21845_100771482 | 98 |
| 585 | 3300002244 | JGI24742J22300_10021446 | JGI24742J22300_100214462 | 98 |
| 586 | 3300002459 | JGI24751J29686_10083501 | JGI24751J29686_100835011 | 98 |
| 587 | 3300003203 | JGI25406J46586_10057619 | JGI25406J46586_100576192 | 98 |
| 588 | 3300005293 | Ga0065715_10432613 | Ga0065715_104326131 | 98 |
| 589 | 3300005327 | Ga0070658_10066207 | Ga0070658_100662073 | 98 |
| 590 | 3300005327 | Ga0070658_10075391 | Ga0070658_100753913 | 98 |
| 591 | 3300005327 | Ga0070658_10165847 | Ga0070658_101658473 | 98 |
| 592 | 3300005327 | Ga0070658_10272833 | Ga0070658_102728333 | 98 |
| 593 | 3300005328 | Ga0070676_10110959 | Ga0070676_101109592 | 98 |
| 594 | 3300005328 | Ga0070676_10461999 | Ga0070676_104619992 | 98 |
| 595 | 3300005329 | Ga0070683_100038899 | Ga0070683_1000388993 | 98 |
| 596 | 3300005330 | Ga0070690_100531153 | Ga0070690_1005311532 | 98 |
| 597 | 3300005331 | Ga0070670_100013225 | Ga0070670_1000132259 | 98 |
| 598 | 3300005331 | Ga0070670_100519148 | Ga0070670_1005191482 | 98 |
| 599 | 3300005331 | Ga0070670_101740013 | Ga0070670_1017400132 | 98 |
| 600 | 3300005333 | Ga0070677_10011735 | Ga0070677_100117352 | 98 |
| 601 | 3300005334 | Ga0068869_101720882 | Ga0068869_1017208822 | 98 |
| 602 | 3300005335 | Ga0070666_10065966 | Ga0070666_100659663 | 98 |
| 603 | 3300005335 | Ga0070666_10166582 | Ga0070666_101665822 | 98 |
| 604 | 3300005335 | Ga0070666_11010986 | Ga0070666_110109862 | 98 |
| 605 | 3300005336 | Ga0070680_100024380 | Ga0070680_1000243803 | 98 |
| 606 | 3300005336 | Ga0070680_101948317 | Ga0070680_1019483172 | 98 |
| 607 | 3300005338 | Ga0068868_100048166 | Ga0068868_1000481664 | 98 |
| 608 | 3300005338 | Ga0068868_101153908 | Ga0068868_1011539082 | 98 |
| 609 | 3300005338 | Ga0068868_101436788 | Ga0068868_1014367881 | 98 |
| 610 | 3300005339 | Ga0070660_100000156 | Ga0070660_1000001567 | 98 |
| 611 | 3300005339 | Ga0070660_100002966 | Ga0070660_10000296616 | 98 |
| 612 | 3300005339 | Ga0070660_100144401 | Ga0070660_1001444012 | 98 |
| 613 | 3300005339 | Ga0070660_100341182 | Ga0070660_1003411822 | 98 |
| 614 | 3300005344 | Ga0070661_100081244 | Ga0070661_1000812442 | 98 |
| 615 | 3300005344 | Ga0070661_100087732 | Ga0070661_1000877322 | 98 |
| 616 | 3300005344 | Ga0070661_100128134 | Ga0070661_1001281342 | 98 |
| 617 | 3300005344 | Ga0070661_100374693 | Ga0070661_1003746932 | 98 |
| 618 | 3300005345 | Ga0070692_10411460 | Ga0070692_104114602 | 98 |
| 619 | 3300005347 | Ga0070668_100379161 | Ga0070668_1003791612 | 98 |
| 620 | 3300005347 | Ga0070668_100840641 | Ga0070668_1008406412 | 98 |
| 621 | 3300005353 | Ga0070669_100033518 | Ga0070669_1000335183 | 98 |
| 622 | 3300005353 | Ga0070669_100164872 | Ga0070669_1001648721 | 98 |
| 623 | 3300005353 | Ga0070669_100454631 | Ga0070669_1004546312 | 98 |
| 624 | 3300005354 | Ga0070675_100023558 | Ga0070675_1000235583 | 98 |
| 625 | 3300005354 | Ga0070675_100257207 | Ga0070675_1002572073 | 98 |
| 626 | 3300005355 | Ga0070671_100000051 | Ga0070671_10000005136 | 98 |
| 627 | 3300005355 | Ga0070671_100006975 | Ga0070671_1000069759 | 98 |
| 628 | 3300005355 | Ga0070671_100143990 | Ga0070671_1001439902 | 98 |
| 629 | 3300005355 | Ga0070671_100235834 | Ga0070671_1002358342 | 98 |
| 630 | 3300005355 | Ga0070671_100420832 | Ga0070671_1004208322 | 98 |
| 631 | 3300005355 | Ga0070671_101540279 | Ga0070671_1015402792 | 98 |
| 632 | 3300005356 | Ga0070674_100011997 | Ga0070674_1000119976 | 98 |
| 633 | 3300005356 | Ga0070674_100014729 | Ga0070674_1000147295 | 98 |
| 634 | 3300005356 | Ga0070674_100051171 | Ga0070674_1000511713 | 98 |
| 635 | 3300005356 | Ga0070674_100175509 | Ga0070674_1001755092 | 98 |
| 636 | 3300005364 | Ga0070673_100011602 | Ga0070673_1000116024 | 98 |
| 637 | 3300005364 | Ga0070673_100302014 | Ga0070673_1003020142 | 98 |
| 638 | 3300005364 | Ga0070673_100413693 | Ga0070673_1004136932 | 98 |
| 639 | 3300005364 | Ga0070673_100677424 | Ga0070673_1006774242 | 98 |
| 640 | 3300005364 | Ga0070673_101754116 | Ga0070673_1017541162 | 98 |
| 641 | 3300005365 | Ga0070688_100554371 | Ga0070688_1005543712 | 98 |
| 642 | 3300005365 | Ga0070688_101610996 | Ga0070688_1016109961 | 98 |
| 643 | 3300005366 | Ga0070659_100003926 | Ga0070659_10000392610 | 98 |
| 644 | 3300005366 | Ga0070659_100083740 | Ga0070659_1000837402 | 98 |
| 645 | 3300005366 | Ga0070659_100199196 | Ga0070659_1001991963 | 98 |
| 646 | 3300005366 | Ga0070659_101047034 | Ga0070659_1010470342 | 98 |
| 647 | 3300005366 | Ga0070659_101341076 | Ga0070659_1013410761 | 98 |
| 648 | 3300005366 | Ga0070659_101394140 | Ga0070659_1013941401 | 98 |
| 649 | 3300005367 | Ga0070667_100104177 | Ga0070667_1001041774 | 98 |
| 650 | 3300005367 | Ga0070667_100569914 | Ga0070667_1005699142 | 98 |
| 651 | 3300005367 | Ga0070667_101669081 | Ga0070667_1016690811 | 98 |
| 652 | 3300005367 | Ga0070667_101798653 | Ga0070667_1017986532 | 98 |
| 653 | 3300005434 | Ga0070709_11415187 | Ga0070709_114151871 | 98 |
| 654 | 3300005435 | Ga0070714_100055739 | Ga0070714_1000557392 | 98 |
| 655 | 3300005435 | Ga0070714_100063691 | Ga0070714_1000636913 | 98 |
| 656 | 3300005435 | Ga0070714_101824868 | Ga0070714_1018248682 | 98 |
| 657 | 3300005436 | Ga0070713_100032969 | Ga0070713_1000329692 | 98 |
| 658 | 3300005436 | Ga0070713_100449365 | Ga0070713_1004493652 | 98 |
| 659 | 3300005455 | Ga0070663_100026400 | Ga0070663_1000264003 | 98 |
| 660 | 3300005455 | Ga0070663_101370547 | Ga0070663_1013705471 | 98 |
| 661 | 3300005456 | Ga0070678_100001121 | Ga0070678_1000011215 | 98 |
| 662 | 3300005456 | Ga0070678_100034382 | Ga0070678_1000343825 | 98 |
| 663 | 3300005456 | Ga0070678_100137937 | Ga0070678_1001379372 | 98 |
| 664 | 3300005457 | Ga0070662_100001195 | Ga0070662_10000119521 | 98 |
| 665 | 3300005457 | Ga0070662_100017911 | Ga0070662_1000179112 | 98 |
| 666 | 3300005457 | Ga0070662_100039331 | Ga0070662_1000393312 | 98 |
| 667 | 3300005457 | Ga0070662_100039339 | Ga0070662_1000393395 | 98 |
| 668 | 3300005457 | Ga0070662_100045906 | Ga0070662_1000459064 | 98 |
| 669 | 3300005457 | Ga0070662_100198471 | Ga0070662_1001984711 | 98 |
| 670 | 3300005457 | Ga0070662_101502363 | Ga0070662_1015023631 | 98 |
| 671 | 3300005458 | Ga0070681_10058866 | Ga0070681_100588665 | 98 |
| 672 | 3300005459 | Ga0068867_100493649 | Ga0068867_1004936492 | 98 |
| 673 | 3300005459 | Ga0068867_101153741 | Ga0068867_1011537412 | 98 |
| 674 | 3300005530 | Ga0070679_100009722 | Ga0070679_1000097228 | 98 |
| 675 | 3300005530 | Ga0070679_101421165 | Ga0070679_1014211652 | 98 |
| 676 | 3300005535 | Ga0070684_100068081 | Ga0070684_1000680813 | 98 |
| 677 | 3300005535 | Ga0070684_102115280 | Ga0070684_1021152802 | 98 |
| 678 | 3300005539 | Ga0068853_100640747 | Ga0068853_1006407472 | 98 |
| 679 | 3300005539 | Ga0068853_101276403 | Ga0068853_1012764032 | 98 |
| 680 | 3300005543 | Ga0070672_100015335 | Ga0070672_1000153354 | 98 |
| 681 | 3300005543 | Ga0070672_100128397 | Ga0070672_1001283972 | 98 |
| 682 | 3300005543 | Ga0070672_100278366 | Ga0070672_1002783662 | 98 |
| 683 | 3300005543 | Ga0070672_100300936 | Ga0070672_1003009361 | 98 |
| 684 | 3300005545 | Ga0070695_100335500 | Ga0070695_1003355002 | 98 |
| 685 | 3300005546 | Ga0070696_100585448 | Ga0070696_1005854481 | 98 |
| 686 | 3300005548 | Ga0070665_100013547 | Ga0070665_1000135472 | 98 |
| 687 | 3300005548 | Ga0070665_100021059 | Ga0070665_1000210598 | 98 |
| 688 | 3300005548 | Ga0070665_100566968 | Ga0070665_1005669682 | 98 |
| 689 | 3300005563 | Ga0068855_100042906 | Ga0068855_1000429065 | 98 |
| 690 | 3300005563 | Ga0068855_100553106 | Ga0068855_1005531062 | 98 |
| 691 | 3300005564 | Ga0070664_100229423 | Ga0070664_1002294233 | 98 |
| 692 | 3300005564 | Ga0070664_100563832 | Ga0070664_1005638322 | 98 |
| 693 | 3300005564 | Ga0070664_100714899 | Ga0070664_1007148992 | 98 |
| 694 | 3300005577 | Ga0068857_100008116 | Ga0068857_1000081167 | 98 |
| 695 | 3300005577 | Ga0068857_100434983 | Ga0068857_1004349832 | 98 |
| 696 | 3300005577 | Ga0068857_102278722 | Ga0068857_1022787222 | 98 |
| 697 | 3300005578 | Ga0068854_100111507 | Ga0068854_1001115073 | 98 |
| 698 | 3300005578 | Ga0068854_100271063 | Ga0068854_1002710632 | 98 |
| 699 | 3300005578 | Ga0068854_100566578 | Ga0068854_1005665782 | 98 |
| 700 | 3300005578 | Ga0068854_102151494 | Ga0068854_1021514941 | 98 |
| 701 | 3300005614 | Ga0068856_100023762 | Ga0068856_1000237626 | 98 |
| 702 | 3300005614 | Ga0068856_100027363 | Ga0068856_1000273634 | 98 |
| 703 | 3300005615 | Ga0070702_101482694 | Ga0070702_1014826941 | 98 |
| 704 | 3300005616 | Ga0068852_100038835 | Ga0068852_1000388352 | 98 |
| 705 | 3300005616 | Ga0068852_100333219 | Ga0068852_1003332192 | 98 |
| 706 | 3300005616 | Ga0068852_100456244 | Ga0068852_1004562442 | 98 |
| 707 | 3300005616 | Ga0068852_101273366 | Ga0068852_1012733662 | 98 |
| 708 | 3300005618 | Ga0068864_100023399 | Ga0068864_1000233996 | 98 |
| 709 | 3300005719 | Ga0068861_100027898 | Ga0068861_1000278985 | 98 |
| 710 | 3300005719 | Ga0068861_100531459 | Ga0068861_1005314592 | 98 |
| 711 | 3300005834 | Ga0068851_10268414 | Ga0068851_102684142 | 98 |
| 712 | 3300005840 | Ga0068870_11141887 | Ga0068870_111418872 | 98 |
| 713 | 3300005844 | Ga0068862_100345812 | Ga0068862_1003458122 | 98 |
| 714 | 3300005985 | Ga0081539_10021962 | Ga0081539_100219622 | 98 |
| 715 | 3300006173 | Ga0070716_100017029 | Ga0070716_1000170292 | 98 |
| 716 | 3300006175 | Ga0070712_100409844 | Ga0070712_1004098442 | 98 |
| 717 | 3300006186 | Ga0075369_10224746 | Ga0075369_102247462 | 98 |
| 718 | 3300006195 | Ga0075366_10634674 | Ga0075366_106346742 | 98 |
| 719 | 3300006237 | Ga0097621_100874416 | Ga0097621_1008744162 | 98 |
| 720 | 3300006237 | Ga0097621_101060345 | Ga0097621_1010603452 | 98 |
| 721 | 3300006353 | Ga0075370_10373493 | Ga0075370_103734932 | 98 |
| 722 | 3300009093 | Ga0105240_11027586 | Ga0105240_110275862 | 98 |
| 723 | 3300009093 | Ga0105240_11248634 | Ga0105240_112486342 | 98 |
| 724 | 3300009098 | Ga0105245_10198795 | Ga0105245_101987952 | 98 |
| 725 | 3300009098 | Ga0105245_11304672 | Ga0105245_113046721 | 98 |
| 726 | 3300009098 | Ga0105245_12384180 | Ga0105245_123841802 | 98 |
| 727 | 3300009148 | Ga0105243_10017247 | Ga0105243_100172476 | 98 |
| 728 | 3300009148 | Ga0105243_11201855 | Ga0105243_112018552 | 98 |
| 729 | 3300009176 | Ga0105242_11181354 | Ga0105242_111813542 | 98 |
| 730 | 3300009177 | Ga0105248_10219657 | Ga0105248_102196572 | 98 |
| 731 | 3300009177 | Ga0105248_10254978 | Ga0105248_102549782 | 98 |
| 732 | 3300009177 | Ga0105248_10688259 | Ga0105248_106882592 | 98 |
| 733 | 3300009545 | Ga0105237_10449078 | Ga0105237_104490782 | 98 |
| 734 | 3300009553 | Ga0105249_11854036 | Ga0105249_118540361 | 98 |
| 735 | 3300010375 | Ga0105239_10544206 | Ga0105239_105442062 | 98 |
| 736 | 3300010375 | Ga0105239_11720435 | Ga0105239_117204352 | 98 |
| 737 | 3300010375 | Ga0105239_13271721 | Ga0105239_132717212 | 98 |
| 738 | 3300011119 | Ga0105246_10641954 | Ga0105246_106419542 | 98 |
| 739 | 3300012512 | Ga0157327_1014092 | Ga0157327_10140922 | 98 |
| 740 | 3300013100 | Ga0157373_10021660 | Ga0157373_100216602 | 98 |
| 741 | 3300013100 | Ga0157373_10072363 | Ga0157373_100723634 | 98 |
| 742 | 3300013100 | Ga0157373_10524357 | Ga0157373_105243572 | 98 |
| 743 | 3300013100 | Ga0157373_10805553 | Ga0157373_108055532 | 98 |
| 744 | 3300013102 | Ga0157371_10312879 | Ga0157371_103128792 | 98 |
| 745 | 3300013104 | Ga0157370_10041941 | Ga0157370_100419414 | 98 |
| 746 | 3300013104 | Ga0157370_10133136 | Ga0157370_101331363 | 98 |
| 747 | 3300013105 | Ga0157369_10140020 | Ga0157369_101400203 | 98 |
| 748 | 3300013105 | Ga0157369_10862726 | Ga0157369_108627262 | 98 |
| 749 | 3300013296 | Ga0157374_10019076 | Ga0157374_100190764 | 98 |
| 750 | 3300013297 | Ga0157378_10534681 | Ga0157378_105346812 | 98 |
| 751 | 3300013297 | Ga0157378_10589800 | Ga0157378_105898002 | 98 |
| 752 | 3300013297 | Ga0157378_10959130 | Ga0157378_109591302 | 98 |
| 753 | 3300013306 | Ga0163162_10023881 | Ga0163162_100238814 | 98 |
| 754 | 3300013306 | Ga0163162_10104995 | Ga0163162_101049954 | 98 |
| 755 | 3300013307 | Ga0157372_10118491 | Ga0157372_101184912 | 98 |
| 756 | 3300013307 | Ga0157372_10409795 | Ga0157372_104097952 | 98 |
| 757 | 3300013307 | Ga0157372_11572598 | Ga0157372_115725982 | 98 |
| 758 | 3300013307 | Ga0157372_11613633 | Ga0157372_116136332 | 98 |
| 759 | 3300013308 | Ga0157375_10020583 | Ga0157375_100205835 | 98 |
| 760 | 3300013308 | Ga0157375_11826491 | Ga0157375_118264911 | 98 |
| 761 | 3300014325 | Ga0163163_10073297 | Ga0163163_100732973 | 98 |
| 762 | 3300014326 | Ga0157380_10835979 | Ga0157380_108359792 | 98 |
| 763 | 3300014497 | Ga0182008_10056733 | Ga0182008_100567333 | 98 |
| 764 | 3300014745 | Ga0157377_10148714 | Ga0157377_101487143 | 98 |
| 765 | 3300014969 | Ga0157376_10090404 | Ga0157376_100904044 | 98 |
| 766 | 3300020081 | Ga0206354_11545716 | Ga0206354_115457162 | 98 |
| 767 | 3300025290 | Ga0207673_1022881 | Ga0207673_10228812 | 98 |
| 768 | 3300025315 | Ga0207697_10140730 | Ga0207697_101407302 | 98 |
| 769 | 3300025893 | Ga0207682_10077134 | Ga0207682_100771342 | 98 |
| 770 | 3300025899 | Ga0207642_10610956 | Ga0207642_106109562 | 98 |
| 771 | 3300025901 | Ga0207688_10009345 | Ga0207688_100093452 | 98 |
| 772 | 3300025901 | Ga0207688_10022437 | Ga0207688_100224371 | 98 |
| 773 | 3300025901 | Ga0207688_10027272 | Ga0207688_100272723 | 98 |
| 774 | 3300025901 | Ga0207688_10029570 | Ga0207688_100295702 | 98 |
| 775 | 3300025903 | Ga0207680_10101277 | Ga0207680_101012773 | 98 |
| 776 | 3300025903 | Ga0207680_10505087 | Ga0207680_105050872 | 98 |
| 777 | 3300025904 | Ga0207647_10009676 | Ga0207647_100096766 | 98 |
| 778 | 3300025904 | Ga0207647_10027273 | Ga0207647_100272733 | 98 |
| 779 | 3300025904 | Ga0207647_10082023 | Ga0207647_100820233 | 98 |
| 780 | 3300025907 | Ga0207645_11191719 | Ga0207645_111917191 | 98 |
| 781 | 3300025909 | Ga0207705_10009807 | Ga0207705_100098073 | 98 |
| 782 | 3300025909 | Ga0207705_10046912 | Ga0207705_100469124 | 98 |
| 783 | 3300025909 | Ga0207705_10578866 | Ga0207705_105788662 | 98 |
| 784 | 3300025912 | Ga0207707_10124551 | Ga0207707_101245512 | 98 |
| 785 | 3300025912 | Ga0207707_10341825 | Ga0207707_103418252 | 98 |
| 786 | 3300025913 | Ga0207695_10210052 | Ga0207695_102100522 | 98 |
| 787 | 3300025917 | Ga0207660_10002662 | Ga0207660_100026629 | 98 |
| 788 | 3300025919 | Ga0207657_10000434 | Ga0207657_1000043430 | 98 |
| 789 | 3300025919 | Ga0207657_10001170 | Ga0207657_1000117014 | 98 |
| 790 | 3300025919 | Ga0207657_10098472 | Ga0207657_100984723 | 98 |
| 791 | 3300025919 | Ga0207657_10167306 | Ga0207657_101673063 | 98 |
| 792 | 3300025919 | Ga0207657_10510349 | Ga0207657_105103492 | 98 |
| 793 | 3300025920 | Ga0207649_10112156 | Ga0207649_101121563 | 98 |
| 794 | 3300025920 | Ga0207649_10434297 | Ga0207649_104342972 | 98 |
| 795 | 3300025920 | Ga0207649_10494474 | Ga0207649_104944742 | 98 |
| 796 | 3300025921 | Ga0207652_10000034 | Ga0207652_100000349 | 98 |
| 797 | 3300025921 | Ga0207652_10058852 | Ga0207652_100588523 | 98 |
| 798 | 3300025923 | Ga0207681_10004355 | Ga0207681_100043555 | 98 |
| 799 | 3300025923 | Ga0207681_10050998 | Ga0207681_100509984 | 98 |
| 800 | 3300025923 | Ga0207681_10167103 | Ga0207681_101671033 | 98 |
| 801 | 3300025923 | Ga0207681_10264112 | Ga0207681_102641122 | 98 |
| 802 | 3300025924 | Ga0207694_10538823 | Ga0207694_105388232 | 98 |
| 803 | 3300025925 | Ga0207650_10040539 | Ga0207650_100405393 | 98 |
| 804 | 3300025925 | Ga0207650_10059964 | Ga0207650_100599644 | 98 |
| 805 | 3300025925 | Ga0207650_11345655 | Ga0207650_113456552 | 98 |
| 806 | 3300025926 | Ga0207659_10076781 | Ga0207659_100767813 | 98 |
| 807 | 3300025926 | Ga0207659_10829266 | Ga0207659_108292662 | 98 |
| 808 | 3300025926 | Ga0207659_11153323 | Ga0207659_111533232 | 98 |
| 809 | 3300025927 | Ga0207687_11508204 | Ga0207687_115082042 | 98 |
| 810 | 3300025928 | Ga0207700_10388919 | Ga0207700_103889192 | 98 |
| 811 | 3300025929 | Ga0207664_10018146 | Ga0207664_100181464 | 98 |
| 812 | 3300025929 | Ga0207664_10079535 | Ga0207664_100795352 | 98 |
| 813 | 3300025929 | Ga0207664_11394232 | Ga0207664_113942321 | 98 |
| 814 | 3300025931 | Ga0207644_10000943 | Ga0207644_100009433 | 98 |
| 815 | 3300025931 | Ga0207644_10000996 | Ga0207644_100009969 | 98 |
| 816 | 3300025931 | Ga0207644_10032654 | Ga0207644_100326542 | 98 |
| 817 | 3300025931 | Ga0207644_10250949 | Ga0207644_102509492 | 98 |
| 818 | 3300025931 | Ga0207644_11284946 | Ga0207644_112849462 | 98 |
| 819 | 3300025931 | Ga0207644_11564618 | Ga0207644_115646181 | 98 |
| 820 | 3300025932 | Ga0207690_10002842 | Ga0207690_100028426 | 98 |
| 821 | 3300025932 | Ga0207690_10034676 | Ga0207690_100346763 | 98 |
| 822 | 3300025932 | Ga0207690_10149234 | Ga0207690_101492343 | 98 |
| 823 | 3300025932 | Ga0207690_10260883 | Ga0207690_102608832 | 98 |
| 824 | 3300025932 | Ga0207690_10691141 | Ga0207690_106911411 | 98 |
| 825 | 3300025932 | Ga0207690_10892420 | Ga0207690_108924202 | 98 |
| 826 | 3300025932 | Ga0207690_11199707 | Ga0207690_111997072 | 98 |
| 827 | 3300025933 | Ga0207706_10000299 | Ga0207706_1000029936 | 98 |
| 828 | 3300025933 | Ga0207706_10020875 | Ga0207706_100208752 | 98 |
| 829 | 3300025933 | Ga0207706_10155926 | Ga0207706_101559263 | 98 |
| 830 | 3300025933 | Ga0207706_10180054 | Ga0207706_101800542 | 98 |
| 831 | 3300025933 | Ga0207706_10528423 | Ga0207706_105284232 | 98 |
| 832 | 3300025933 | Ga0207706_10601912 | Ga0207706_106019122 | 98 |
| 833 | 3300025933 | Ga0207706_11571005 | Ga0207706_115710052 | 98 |
| 834 | 3300025934 | Ga0207686_10269296 | Ga0207686_102692962 | 98 |
| 835 | 3300025934 | Ga0207686_10342765 | Ga0207686_103427652 | 98 |
| 836 | 3300025937 | Ga0207669_10153294 | Ga0207669_101532942 | 98 |
| 837 | 3300025937 | Ga0207669_10168664 | Ga0207669_101686642 | 98 |
| 838 | 3300025937 | Ga0207669_10186735 | Ga0207669_101867351 | 98 |
| 839 | 3300025940 | Ga0207691_10013011 | Ga0207691_100130117 | 98 |
| 840 | 3300025940 | Ga0207691_10016113 | Ga0207691_100161138 | 98 |
| 841 | 3300025940 | Ga0207691_10108220 | Ga0207691_101082203 | 98 |
| 842 | 3300025940 | Ga0207691_10339902 | Ga0207691_103399022 | 98 |
| 843 | 3300025940 | Ga0207691_10471177 | Ga0207691_104711771 | 98 |
| 844 | 3300025941 | Ga0207711_10189622 | Ga0207711_101896222 | 98 |
| 845 | 3300025941 | Ga0207711_10294821 | Ga0207711_102948212 | 98 |
| 846 | 3300025944 | Ga0207661_10032385 | Ga0207661_100323855 | 98 |
| 847 | 3300025944 | Ga0207661_10415947 | Ga0207661_104159472 | 98 |
| 848 | 3300025944 | Ga0207661_11391683 | Ga0207661_113916832 | 98 |
| 849 | 3300025945 | Ga0207679_10023965 | Ga0207679_100239652 | 98 |
| 850 | 3300025945 | Ga0207679_10523871 | Ga0207679_105238712 | 98 |
| 851 | 3300025945 | Ga0207679_10739393 | Ga0207679_107393932 | 98 |
| 852 | 3300025945 | Ga0207679_10904130 | Ga0207679_109041302 | 98 |
| 853 | 3300025949 | Ga0207667_10012261 | Ga0207667_1001226111 | 98 |
| 854 | 3300025949 | Ga0207667_10049447 | Ga0207667_100494473 | 98 |
| 855 | 3300025949 | Ga0207667_10366878 | Ga0207667_103668782 | 98 |
| 856 | 3300025960 | Ga0207651_10012001 | Ga0207651_100120013 | 98 |
| 857 | 3300025960 | Ga0207651_10140058 | Ga0207651_101400582 | 98 |
| 858 | 3300025960 | Ga0207651_10201589 | Ga0207651_102015892 | 98 |
| 859 | 3300025960 | Ga0207651_10430531 | Ga0207651_104305312 | 98 |
| 860 | 3300025960 | Ga0207651_10441912 | Ga0207651_104419122 | 98 |
| 861 | 3300025960 | Ga0207651_10480599 | Ga0207651_104805992 | 98 |
| 862 | 3300025960 | Ga0207651_11182526 | Ga0207651_111825262 | 98 |
| 863 | 3300025972 | Ga0207668_10198870 | Ga0207668_101988702 | 98 |
| 864 | 3300025972 | Ga0207668_11125351 | Ga0207668_111253512 | 98 |
| 865 | 3300025981 | Ga0207640_10207631 | Ga0207640_102076312 | 98 |
| 866 | 3300025981 | Ga0207640_10425775 | Ga0207640_104257752 | 98 |
| 867 | 3300025981 | Ga0207640_10610929 | Ga0207640_106109292 | 98 |
| 868 | 3300025981 | Ga0207640_11160446 | Ga0207640_111604462 | 98 |
| 869 | 3300025986 | Ga0207658_10066062 | Ga0207658_100660622 | 98 |
| 870 | 3300025986 | Ga0207658_10312073 | Ga0207658_103120732 | 98 |
| 871 | 3300026023 | Ga0207677_10030638 | Ga0207677_100306383 | 98 |
| 872 | 3300026041 | Ga0207639_10654861 | Ga0207639_106548612 | 98 |
| 873 | 3300026041 | Ga0207639_10679122 | Ga0207639_106791222 | 98 |
| 874 | 3300026067 | Ga0207678_10000117 | Ga0207678_1000011744 | 98 |
| 875 | 3300026067 | Ga0207678_11064414 | Ga0207678_110644141 | 98 |
| 876 | 3300026078 | Ga0207702_10079971 | Ga0207702_100799713 | 98 |
| 877 | 3300026078 | Ga0207702_10408586 | Ga0207702_104085862 | 98 |
| 878 | 3300026089 | Ga0207648_10142850 | Ga0207648_101428503 | 98 |
| 879 | 3300026089 | Ga0207648_10309763 | Ga0207648_103097632 | 98 |
| 880 | 3300026095 | Ga0207676_10228584 | Ga0207676_102285843 | 98 |
| 881 | 3300026116 | Ga0207674_10000086 | Ga0207674_1000008645 | 98 |
| 882 | 3300026116 | Ga0207674_11045692 | Ga0207674_110456922 | 98 |
| 883 | 3300026118 | Ga0207675_100044742 | Ga0207675_1000447425 | 98 |
| 884 | 3300026118 | Ga0207675_101529073 | Ga0207675_1015290732 | 98 |
| 885 | 3300026121 | Ga0207683_10003887 | Ga0207683_100038872 | 98 |
| 886 | 3300026121 | Ga0207683_10067903 | Ga0207683_100679034 | 98 |
| 887 | 3300026121 | Ga0207683_10100386 | Ga0207683_101003862 | 98 |
| 888 | 3300026142 | Ga0207698_10277882 | Ga0207698_102778822 | 98 |
| 889 | 3300026142 | Ga0207698_10293572 | Ga0207698_102935722 | 98 |
| 890 | 3300026142 | Ga0207698_10782532 | Ga0207698_107825322 | 98 |
| 891 | 3300027876 | Ga0209974_10053592 | Ga0209974_100535922 | 98 |
| 892 | 3300027876 | Ga0209974_10319248 | Ga0209974_103192482 | 98 |
| 893 | 3300028379 | Ga0268266_10055274 | Ga0268266_100552743 | 98 |
| 894 | 3300028379 | Ga0268266_10083549 | Ga0268266_100835494 | 98 |
| 895 | 3300028379 | Ga0268266_10506053 | Ga0268266_105060531 | 98 |
| 896 | 3300028380 | Ga0268265_10475786 | Ga0268265_104757862 | 98 |
| 897 | 3300031731 | Ga0307405_10004019 | Ga0307405_1000401910 | 98 |
| 898 | 3300031824 | Ga0307413_11407450 | Ga0307413_114074502 | 98 |
| 899 | 3300031852 | Ga0307410_10215246 | Ga0307410_102152462 | 98 |
| 900 | 3300031901 | Ga0307406_10176990 | Ga0307406_101769903 | 98 |
| 901 | 3300031903 | Ga0307407_10473151 | Ga0307407_104731512 | 98 |
| 902 | 3300031911 | Ga0307412_10778493 | Ga0307412_107784932 | 98 |
| 903 | 3300031995 | Ga0307409_100025333 | Ga0307409_1000253332 | 98 |
| 904 | 3300032002 | Ga0307416_102023742 | Ga0307416_1020237422 | 98 |
| 905 | 3300032004 | Ga0307414_10600876 | Ga0307414_106008762 | 98 |
| 906 | 3300032004 | Ga0307414_11451945 | Ga0307414_114519452 | 98 |
| 907 | 3300032005 | Ga0307411_10434736 | Ga0307411_104347362 | 98 |
| 908 | 3300032126 | Ga0307415_100065523 | Ga0307415_1000655232 | 98 |
| 909 | 3300034818 | Ga0373950_0075644 | Ga0373950_0075644_331_627 | 98 |
| 910 | 3300034820 | Ga0373959_0177768 | Ga0373959_0177768_165_464 | 98 |
| 911 | 3300034957 | Ga0373938_0154874 | Ga0373938_0154874_51_353 | 98 |
| 912 | 3300035114 | Ga0373939_0375018 | Ga0373939_0375018_62_364 | 98 |
| 913 | 3300035241 | Ga0373961_0081310 | Ga0373961_0081310_655_951 | 98 |
| 914 | 3300035691 | Ga0373931_1213654 | Ga0373931_1213654_169_465 | 98 |
| 915 | 3300035725 | Ga0373947_0722365 | Ga0373947_0722365_262_561 | 98 |
| 916 | 3300036401 | Ga0373937_0546426 | Ga0373937_0546426_85_384 | 98 |
| 917 | 3300036401 | Ga0373937_0976411 | Ga0373937_0976411_96_395 | 98 |
| 918 | 3300037312 | Ga0395899_0002062 | Ga0395899_0002062_7601_7897 | 98 |
| 919 | 3300037312 | Ga0395899_0007278 | Ga0395899_0007278_6637_6969 | 98 |
| 920 | 3300037312 | Ga0395899_0044714 | Ga0395899_0044714_2721_3017 | 98 |
| 921 | 3300037312 | Ga0395899_0127594 | Ga0395899_0127594_1240_1539 | 98 |
| 922 | 3300037312 | Ga0395899_0176318 | Ga0395899_0176318_237_539 | 98 |
| 923 | 3300037312 | Ga0395899_0177552 | Ga0395899_0177552_287_589 | 98 |
| 924 | 3300037312 | Ga0395899_0198152 | Ga0395899_0198152_1010_1309 | 98 |
| 925 | 3300037312 | Ga0395899_0479984 | Ga0395899_0479984_231_530 | 98 |
| 926 | 3300037312 | Ga0395899_0506867 | Ga0395899_0506867_235_534 | 98 |
| 927 | 3300037418 | Ga0395900_0000997 | Ga0395900_0000997_22396_22695 | 98 |
| 928 | 3300037418 | Ga0395900_0003165 | Ga0395900_0003165_10503_10799 | 98 |
| 929 | 3300037418 | Ga0395900_0005624 | Ga0395900_0005624_8300_8599 | 98 |
| 930 | 3300037418 | Ga0395900_0011036 | Ga0395900_0011036_3008_3307 | 98 |
| 931 | 3300037418 | Ga0395900_0027388 | Ga0395900_0027388_5028_5324 | 98 |
| 932 | 3300037418 | Ga0395900_0062013 | Ga0395900_0062013_819_1118 | 98 |
| 933 | 3300037418 | Ga0395900_0090128 | Ga0395900_0090128_1083_1385 | 98 |
| 934 | 3300037418 | Ga0395900_0121970 | Ga0395900_0121970_760_1059 | 98 |
| 935 | 3300037418 | Ga0395900_0151212 | Ga0395900_0151212_913_1245 | 98 |
| 936 | 3300037418 | Ga0395900_0204665 | Ga0395900_0204665_1502_1801 | 98 |
| 937 | 3300037418 | Ga0395900_0205499 | Ga0395900_0205499_455_754 | 98 |
| 938 | 3300037418 | Ga0395900_0351368 | Ga0395900_0351368_1139_1438 | 98 |
| 939 | 3300037418 | Ga0395900_0457515 | Ga0395900_0457515_782_1081 | 98 |
| 940 | 3300037418 | Ga0395900_0971092 | Ga0395900_0971092_253_552 | 98 |
| 941 | 3300037418 | Ga0395900_1070448 | Ga0395900_1070448_230_532 | 98 |
| 942 | 3300037418 | Ga0395900_1085104 | Ga0395900_1085104_228_530 | 98 |
| 943 | 3300037466 | Ga0395898_0003637 | Ga0395898_0003637_2374_2706 | 98 |
| 944 | 3300037466 | Ga0395898_0006632 | Ga0395898_0006632_5883_6179 | 98 |
| 945 | 3300037466 | Ga0395898_0212865 | Ga0395898_0212865_305_604 | 98 |
| 946 | 3300037466 | Ga0395898_0668955 | Ga0395898_0668955_499_798 | 98 |
| 947 | 3300037466 | Ga0395898_0991061 | Ga0395898_0991061_195_494 | 98 |
| 948 | 3300037466 | Ga0395898_1176341 | Ga0395898_1176341_29_328 | 98 |
| 949 | 3300037466 | Ga0395898_1605356 | Ga0395898_1605356_149_445 | 98 |
| 950 | 3300037471 | Ga0395905_0001164 | Ga0395905_0001164_14061_14360 | 98 |
| 951 | 3300037471 | Ga0395905_0009116 | Ga0395905_0009116_9037_9333 | 98 |
| 952 | 3300037471 | Ga0395905_0010087 | Ga0395905_0010087_2415_2714 | 98 |
| 953 | 3300037471 | Ga0395905_0013695 | Ga0395905_0013695_5393_5725 | 98 |
| 954 | 3300037471 | Ga0395905_0047368 | Ga0395905_0047368_1130_1426 | 98 |
| 955 | 3300037471 | Ga0395905_0055679 | Ga0395905_0055679_1530_1829 | 98 |
| 956 | 3300037471 | Ga0395905_0057172 | Ga0395905_0057172_175_477 | 98 |
| 957 | 3300037471 | Ga0395905_0060505 | Ga0395905_0060505_3032_3331 | 98 |
| 958 | 3300037471 | Ga0395905_0088555 | Ga0395905_0088555_2102_2401 | 98 |
| 959 | 3300037471 | Ga0395905_0089238 | Ga0395905_0089238_1509_1808 | 98 |
| 960 | 3300037471 | Ga0395905_0213181 | Ga0395905_0213181_836_1135 | 98 |
| 961 | 3300037471 | Ga0395905_0248596 | Ga0395905_0248596_858_1154 | 98 |
| 962 | 3300037471 | Ga0395905_0280336 | Ga0395905_0280336_612_911 | 98 |
| 963 | 3300037471 | Ga0395905_0784082 | Ga0395905_0784082_225_527 | 98 |
| 964 | 3300037471 | Ga0395905_1451105 | Ga0395905_1451105_96_392 | 98 |
| 965 | 3300037471 | Ga0395905_1543824 | Ga0395905_1543824_232_531 | 98 |
| 966 | 3300038443 | Ga0395901_0002401 | Ga0395901_0002401_5657_5953 | 98 |
| 967 | 3300038443 | Ga0395901_0003908 | Ga0395901_0003908_5392_5691 | 98 |
| 968 | 3300038443 | Ga0395901_0012496 | Ga0395901_0012496_2973_3272 | 98 |
| 969 | 3300038443 | Ga0395901_0016592 | Ga0395901_0016592_6613_6912 | 98 |
| 970 | 3300038443 | Ga0395901_0048282 | Ga0395901_0048282_2701_3000 | 98 |
| 971 | 3300038443 | Ga0395901_0062494 | Ga0395901_0062494_3260_3556 | 98 |
| 972 | 3300038443 | Ga0395901_0141581 | Ga0395901_0141581_606_908 | 98 |
| 973 | 3300038443 | Ga0395901_0205990 | Ga0395901_0205990_280_579 | 98 |
| 974 | 3300038443 | Ga0395901_0218283 | Ga0395901_0218283_550_849 | 98 |
| 975 | 3300038443 | Ga0395901_0291865 | Ga0395901_0291865_125_427 | 98 |
| 976 | 3300038443 | Ga0395901_0438272 | Ga0395901_0438272_691_993 | 98 |
| 977 | 3300038443 | Ga0395901_0475511 | Ga0395901_0475511_180_479 | 98 |
| 978 | 3300038443 | Ga0395901_0479076 | Ga0395901_0479076_29_361 | 98 |
| 979 | 3300038443 | Ga0395901_0568390 | Ga0395901_0568390_254_553 | 98 |
| 980 | 3300039437 | Ga0436365_1884350 | Ga0436365_1884350_66_371 | 98 |
| 981 | 3300041413 | Ga0439465_0034100 | Ga0439465_0034100_1049_1345 | 98 |
| 982 | 3300041501 | Ga0451845_0414206 | Ga0451845_0414206_134_436 | 98 |
| 983 | 3300042004 | Ga0439445_0079259 | Ga0439445_0079259_261_563 | 98 |
| 984 | 3300042005 | Ga0439448_0091094 | Ga0439448_0091094_175_474 | 98 |
| 985 | 3300042006 | Ga0439432_010963 | Ga0439432_010963_2082_2378 | 98 |
| 986 | 3300042006 | Ga0439432_022427 | Ga0439432_022427_356_658 | 98 |
| 987 | 3300042007 | Ga0439449_0027822 | Ga0439449_0027822_1747_2043 | 98 |
| 988 | 3300042007 | Ga0439449_0278171 | Ga0439449_0278171_292_594 | 98 |
| 989 | 3300042012 | Ga0439455_0199918 | Ga0439455_0199918_181_480 | 98 |
| 990 | 3300044684 | Ga0466966_0130198 | Ga0466966_0130198_490_795 | 98 |
| 991 | 3300045049 | Ga0466959_0132459 | Ga0466959_0132459_849_1154 | 98 |
| 992 | 3300046473 | Ga0495582_0355114 | Ga0495582_0355114_24_323 | 98 |
| 993 | 3300046522 | Ga0495643_0223268 | Ga0495643_0223268_225_524 | 98 |
| 994 | 3300046525 | Ga0495663_0066801 | Ga0495663_0066801_497_793 | 98 |
| 995 | 3300046525 | Ga0495663_0082632 | Ga0495663_0082632_193_492 | 98 |
| 996 | 3300046528 | Ga0495642_0074659 | Ga0495642_0074659_356_652 | 98 |
| 997 | 3300046537 | Ga0495598_0002306 | Ga0495598_0002306_2561_2860 | 98 |
| 998 | 3300046539 | Ga0495621_0011102 | Ga0495621_0011102_1760_2059 | 98 |
| 999 | 3300046558 | Ga0495633_0094425 | Ga0495633_0094425_979_1278 | 98 |
| 1000 | 3300046664 | Ga0495659_0112117 | Ga0495659_0112117_176_475 | 98 |
| 1001 | 3300046684 | Ga0495669_0002275 | Ga0495669_0002275_5686_5982 | 98 |
| 1002 | 3300046684 | Ga0495669_0006331 | Ga0495669_0006331_3966_4265 | 98 |
| 1003 | 3300046684 | Ga0495669_0256576 | Ga0495669_0256576_481_780 | 98 |
| 1004 | 3300046691 | Ga0495670_0011308 | Ga0495670_0011308_2285_2584 | 98 |
| 1005 | 3300047445 | Ga0495677_0020443 | Ga0495677_0020443_770_1066 | 98 |
| 1006 | 3300047445 | Ga0495677_0196492 | Ga0495677_0196492_134_430 | 98 |
| 1007 | 3300048903 | Ga0496100_0266676 | Ga0496100_0266676_232_528 | 98 |
| 1008 | 3300048903 | Ga0496100_0556035 | Ga0496100_0556035_290_589 | 98 |
| 1009 | 3300048905 | Ga0496102_1113417 | Ga0496102_1113417_41_340 | 98 |
| 1010 | 3300048909 | Ga0496106_0740003 | Ga0496106_0740003_250_549 | 98 |
| 1011 | 3300048912 | Ga0496109_1954386 | Ga0496109_1954386_71_370 | 98 |
| 1012 | 3300048915 | Ga0496112_0355303 | Ga0496112_0355303_599_895 | 98 |
| 1013 | 3300049515 | Ga0501292_112198 | Ga0501292_112198_67_363 | 98 |
| 1014 | 3300049521 | Ga0501298_042688 | Ga0501298_042688_539_835 | 98 |
| 1015 | 3300049587 | Ga0501071_0280020 | Ga0501071_0280020_467_769 | 98 |
| 1016 | 3300049590 | Ga0501074_0708082 | Ga0501074_0708082_228_530 | 98 |
| 1017 | 3300049649 | Ga0501198_055091 | Ga0501198_055091_217_513 | 98 |
| 1018 | 3300049652 | Ga0501202_008297 | Ga0501202_008297_962_1258 | 98 |
| 1019 | 3300049661 | Ga0501217_166429 | Ga0501217_166429_133_429 | 98 |
| 1020 | 3300049665 | Ga0501227_118849 | Ga0501227_118849_70_366 | 98 |
| 1021 | 3300049668 | Ga0501233_030637 | Ga0501233_030637_563_859 | 98 |
| 1022 | 3300049671 | Ga0501238_027609 | Ga0501238_027609_76_372 | 98 |
| 1023 | 3300049675 | Ga0501243_075528 | Ga0501243_075528_263_559 | 98 |
| 1024 | 3300049677 | Ga0501247_018851 | Ga0501247_018851_94_390 | 98 |
| 1025 | 3300049686 | Ga0501257_052611 | Ga0501257_052611_576_872 | 98 |
| 1026 | 3300049704 | Ga0501221_028044 | Ga0501221_028044_636_932 | 98 |
| 1027 | 3300049705 | Ga0501225_0209700 | Ga0501225_0209700_73_369 | 98 |
| 1028 | 3300049707 | Ga0501234_018058 | Ga0501234_018058_21_317 | 98 |
| 1029 | 3300049742 | Ga0501080_0397204 | Ga0501080_0397204_633_935 | 98 |
| 1030 | 3300049759 | Ga0501262_005846 | Ga0501262_005846_892_1188 | 98 |
| 1031 | 3300049765 | Ga0501268_044183 | Ga0501268_044183_518_814 | 98 |
| 1032 | 3300049767 | Ga0501270_044020 | Ga0501270_044020_357_653 | 98 |
| 1033 | 3300049775 | Ga0501279_058969 | Ga0501279_058969_226_522 | 98 |
| 1034 | 3300049779 | Ga0501283_067293 | Ga0501283_067293_276_572 | 98 |
| 1035 | 3300049851 | Ga0501212_029334 | Ga0501212_029334_225_521 | 98 |
| 1036 | 3300050496 | nmdc:mga07m45_550703_c1 | nmdc:mga07m45_550703_c1_67_366 | 98 |
| 1037 | 3300053083 | Ga0495655_0270679 | Ga0495655_0270679_55_351 | 98 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xzi-assembly1.cif.gz_D | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.761 | 3 | 88 |
| 7xzi-assembly1.cif.gz_D | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.6358 | 3 | 88 |
| 8cas-assembly1.cif.gz_Y | cryo-em structure of native otu2-bound ubiquitinated 48s initiation complex (partial) | 0.5588 | 14 | 78 |
| 4v6w-assembly1.cif.gz_AN | structure of the d. melanogaster 80s ribosome | 0.5483 | 14 | 78 |
| 6okk-assembly1.cif.gz_U | cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit | 0.5401 | 17 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5it9N02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.5476 | 17 | 72 | 1.10.287.10 |
| 4ukmr02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.543 | 14 | 78 | 1.10.287.10 |
| af_A0A1D6LXR0_391_543_1.20.58.1520 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.542 | 3 | 98 | 1.20.58.1520 |
| 6okkU02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.5401 | 17 | 78 | 1.10.287.10 |
| 4ujhr02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.5371 | 14 | 78 | 1.10.287.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D4AT38-F1-model_v4 | YggT family protein | 0.9722 | 4 | 90 |
GO:0016020
|
| AF-A0A3D4MGU8-F1-model_v4 | Osmotic-shock protein | 0.9696 | 4 | 91 |
GO:0016020
|
| AF-A0A6M8VLT5-F1-model_v4 | YggT family protein | 0.9665 | 5 | 90 |
GO:0016020
|
| AF-A0A2D7HNT6-F1-model_v4 | YggT family protein | 0.9658 | 4 | 89 |
GO:0016020
|
| AF-A0A522DDP3-F1-model_v4 | YggT family protein | 0.9655 | 4 | 91 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar