F488743

General Info

Members Datasets Scaffolds Average Seq Length
1037 288 1037 98

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0007278|Ga0395899_0007278_6637_6969
Length 110
Sequence LRRNDRAAKPAIMLIALVDIANLLLSVVTWIIIIQVILSWLFAFNVLNTSSQGVRTVAVAIDRITAPLYRPVRRILPDFGGIDFSPLVILILIQVIKKLLAGVVMQYYGI

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
261 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
268 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
269 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
270 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
271 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
272 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
273 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
274 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
277 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
278 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
281 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
282 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
283 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
284 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
285 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 3.66
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1020912 3300001904 Bacteria 1027
2 JGI24741J21665_1008557 3300001915 Bacteria 1924
3 JGI24741J21665_1008594 3300001915 Bacteria 1919
4 JGI24747J21853_1002402 3300001978 Bacteria 1525
5 JGI24747J21853_1011601 3300001978 Bacteria 893
6 JGI24740J21852_10009374 3300001979 Bacteria 3836
7 JGI24740J21852_10047433 3300001979 Bacteria 1254
8 JGI24740J21852_10149131 3300001979 Unclassified 581
9 JGI24739J22299_10077383 3300001989 Bacteria 1026
10 JGI24739J22299_10084372 3300001989 Bacteria 972
11 JGI24737J22298_10007721 3300001990 Bacteria 3625
12 JGI24737J22298_10019478 3300001990 Bacteria 2170
13 JGI24737J22298_10151273 3300001990 Bacteria 685
14 JGI24737J22298_10207947 3300001990 Bacteria 577
15 JGI24743J22301_10002872 3300001991 Bacteria 2655
16 JGI24743J22301_10017326 3300001991 Bacteria 1351
17 JGI24735J21928_10006140 3300002067 Bacteria 3966
18 JGI24735J21928_10101212 3300002067 Bacteria 827
19 JGI24735J21928_10214129 3300002067 Bacteria 559
20 JGI24745J21846_1040230 3300002073 Bacteria 578
21 JGI24738J21930_10046291 3300002075 Bacteria 885
22 JGI24744J21845_10001585 3300002077 Bacteria 4537
23 JGI24744J21845_10077148 3300002077 Bacteria 609
24 JGI24034J26672_10032452 3300002239 Bacteria 855
25 JGI24742J22300_10021446 3300002244 Bacteria 1103
26 JGI24751J29686_10025650 3300002459 Bacteria 1223
27 JGI24751J29686_10083501 3300002459 Bacteria 662
28 JGI25406J46586_10057619 3300003203 Bacteria 1270
29 rootL2_10140508 3300003322 Bacteria 1453
30 Ga0065715_10432613 3300005293 Bacteria 828
31 Ga0065715_11117021 3300005293 Bacteria 516
32 Ga0070658_10066207 3300005327 Bacteria 2951
33 Ga0070658_10075391 3300005327 Bacteria 2766
34 Ga0070658_10085273 3300005327 Bacteria 2597
35 Ga0070658_10163452 3300005327 Bacteria 1868
36 Ga0070658_10165847 3300005327 Bacteria 1854
37 Ga0070658_10272833 3300005327 Bacteria 1439
38 Ga0070658_10426509 3300005327 Bacteria 1141
39 Ga0070658_10592463 3300005327 Bacteria 961
40 Ga0070658_11177287 3300005327 Bacteria 666
41 Ga0070658_11330146 3300005327 Bacteria 624
42 Ga0070676_10015404 3300005328 Bacteria 4218
43 Ga0070676_10016027 3300005328 Bacteria 4139
44 Ga0070676_10110959 3300005328 Bacteria 1708
45 Ga0070676_10461999 3300005328 Bacteria 895
46 Ga0070683_100038899 3300005329 Bacteria 4363
47 Ga0070683_100211431 3300005329 Bacteria 1843
48 Ga0070683_100428494 3300005329 Bacteria 1262
49 Ga0070683_101088629 3300005329 Bacteria 768
50 Ga0070690_100006336 3300005330 Bacteria 6709
51 Ga0070690_100173019 3300005330 Bacteria 1487
52 Ga0070690_100531153 3300005330 Bacteria 884
53 Ga0070690_100536979 3300005330 Bacteria 880
54 Ga0070670_100013225 3300005331 Bacteria 7070
55 Ga0070670_100014982 3300005331 Bacteria 6654
56 Ga0070670_100076532 3300005331 Bacteria 2875
57 Ga0070670_100080502 3300005331 Bacteria 2799
58 Ga0070670_100142924 3300005331 Bacteria 2069
59 Ga0070670_100519148 3300005331 Bacteria 1060
60 Ga0070670_101740013 3300005331 Bacteria 574
61 Ga0070670_101937482 3300005331 Bacteria 543
62 Ga0070677_10011735 3300005333 Bacteria 3028
63 Ga0070677_10017057 3300005333 Bacteria 2594
64 Ga0068869_100086966 3300005334 Bacteria 2344
65 Ga0068869_101720882 3300005334 Bacteria 560
66 Ga0070666_10005953 3300005335 Bacteria 7486
67 Ga0070666_10048049 3300005335 Bacteria 2866
68 Ga0070666_10065966 3300005335 Bacteria 2456
69 Ga0070666_10166582 3300005335 Bacteria 1542
70 Ga0070666_10261028 3300005335 Bacteria 1228
71 Ga0070666_10397347 3300005335 Bacteria 991
72 Ga0070666_10437209 3300005335 Bacteria 944
73 Ga0070666_10949706 3300005335 Bacteria 637
74 Ga0070666_11010986 3300005335 Bacteria 617
75 Ga0070680_100024380 3300005336 Bacteria 4832
76 Ga0070680_101948317 3300005336 Bacteria 509
77 Ga0070680_101964372 3300005336 Bacteria 507
78 Ga0070682_100074295 3300005337 Bacteria 2183
79 Ga0070682_100471395 3300005337 Bacteria 966
80 Ga0068868_100015245 3300005338 Bacteria 5681
81 Ga0068868_100048166 3300005338 Bacteria 3343
82 Ga0068868_100061889 3300005338 Bacteria 2966
83 Ga0068868_100064262 3300005338 Bacteria 2913
84 Ga0068868_100490199 3300005338 Bacteria 1075
85 Ga0068868_100499257 3300005338 Bacteria 1065
86 Ga0068868_101153908 3300005338 Bacteria 715
87 Ga0068868_101436788 3300005338 Bacteria 644
88 Ga0070660_100000156 3300005339 Bacteria 44192
89 Ga0070660_100002966 3300005339 Bacteria 11674
90 Ga0070660_100016614 3300005339 Bacteria 5346
91 Ga0070660_100028293 3300005339 Bacteria 4192
92 Ga0070660_100064071 3300005339 Bacteria 2859
93 Ga0070660_100072385 3300005339 Bacteria 2693
94 Ga0070660_100144401 3300005339 Bacteria 1911
95 Ga0070660_100277699 3300005339 Bacteria 1370
96 Ga0070660_100341182 3300005339 Bacteria 1233
97 Ga0070660_100651836 3300005339 Bacteria 882
98 Ga0070660_101339846 3300005339 Unclassified 608
99 Ga0070660_101795208 3300005339 Bacteria 522
100 Ga0070689_100158173 3300005340 Bacteria 1830
101 Ga0070691_10658536 3300005341 Bacteria 624
102 Ga0070661_100034708 3300005344 Bacteria 3659
103 Ga0070661_100036795 3300005344 Bacteria 3557
104 Ga0070661_100069996 3300005344 Bacteria 2580
105 Ga0070661_100081244 3300005344 Bacteria 2393
106 Ga0070661_100087732 3300005344 Bacteria 2302
107 Ga0070661_100128134 3300005344 Bacteria 1905
108 Ga0070661_100129254 3300005344 Bacteria 1896
109 Ga0070661_100303823 3300005344 Bacteria 1243
110 Ga0070661_100374693 3300005344 Bacteria 1121
111 Ga0070661_100504222 3300005344 Bacteria 969
112 Ga0070692_10278260 3300005345 Bacteria 1013
113 Ga0070692_10411460 3300005345 Bacteria 856
114 Ga0070692_10514304 3300005345 Bacteria 778
115 Ga0070668_100379161 3300005347 Bacteria 1203
116 Ga0070668_100840641 3300005347 Unclassified 818
117 Ga0070668_102037572 3300005347 Bacteria 529
118 Ga0070669_100033518 3300005353 Bacteria 3715
119 Ga0070669_100164872 3300005353 Bacteria 1724
120 Ga0070669_100452609 3300005353 Bacteria 1058
121 Ga0070669_100454631 3300005353 Bacteria 1056
122 Ga0070669_100966435 3300005353 Bacteria 730
123 Ga0070675_100023558 3300005354 Bacteria 4925
124 Ga0070675_100180001 3300005354 Bacteria 1827
125 Ga0070675_100210201 3300005354 Bacteria 1691
126 Ga0070675_100257207 3300005354 Bacteria 1529
127 Ga0070675_100924480 3300005354 Bacteria 800
128 Ga0070671_100000051 3300005355 Bacteria 79207
129 Ga0070671_100006975 3300005355 Bacteria 9048
130 Ga0070671_100033206 3300005355 Bacteria 4267
131 Ga0070671_100059930 3300005355 Bacteria 3168
132 Ga0070671_100143990 3300005355 Bacteria 2012
133 Ga0070671_100235834 3300005355 Bacteria 1553
134 Ga0070671_100259607 3300005355 Bacteria 1476
135 Ga0070671_100306390 3300005355 Bacteria 1352
136 Ga0070671_100420832 3300005355 Bacteria 1144
137 Ga0070671_101540279 3300005355 Bacteria 589
138 Ga0070674_100011997 3300005356 Bacteria 5306
139 Ga0070674_100014729 3300005356 Bacteria 4866
140 Ga0070674_100026956 3300005356 Bacteria 3760
141 Ga0070674_100051171 3300005356 Bacteria 2846
142 Ga0070674_100175509 3300005356 Bacteria 1637
143 Ga0070674_100389875 3300005356 Unclassified 1135
144 Ga0070674_101351730 3300005356 Bacteria 637
145 Ga0070673_100011602 3300005364 Bacteria 6020
146 Ga0070673_100011732 3300005364 Bacteria 5992
147 Ga0070673_100114366 3300005364 Bacteria 2242
148 Ga0070673_100155841 3300005364 Bacteria 1938
149 Ga0070673_100302014 3300005364 Bacteria 1409
150 Ga0070673_100376767 3300005364 Bacteria 1264
151 Ga0070673_100413693 3300005364 Bacteria 1208
152 Ga0070673_100677424 3300005364 Bacteria 946
153 Ga0070673_101754116 3300005364 Bacteria 588
154 Ga0070688_100554371 3300005365 Bacteria 874
155 Ga0070688_101610996 3300005365 Bacteria 530
156 Ga0070659_100003926 3300005366 Bacteria 10583
157 Ga0070659_100061929 3300005366 Bacteria 2957
158 Ga0070659_100066651 3300005366 Bacteria 2853
159 Ga0070659_100083062 3300005366 Bacteria 2560
160 Ga0070659_100083740 3300005366 Bacteria 2549
161 Ga0070659_100098258 3300005366 Bacteria 2354
162 Ga0070659_100199196 3300005366 Bacteria 1648
163 Ga0070659_100482086 3300005366 Bacteria 1055
164 Ga0070659_101002831 3300005366 Bacteria 733
165 Ga0070659_101047034 3300005366 Bacteria 718
166 Ga0070659_101341076 3300005366 Bacteria 635
167 Ga0070659_101394140 3300005366 Bacteria 623
168 Ga0070659_101427693 3300005366 Bacteria 616
169 Ga0070659_101650748 3300005366 Bacteria 573
170 Ga0070667_100001311 3300005367 Bacteria 22374
171 Ga0070667_100025802 3300005367 Bacteria 4887
172 Ga0070667_100065494 3300005367 Bacteria 3085
173 Ga0070667_100104177 3300005367 Bacteria 2454
174 Ga0070667_100569914 3300005367 Bacteria 1042
175 Ga0070667_101376340 3300005367 Bacteria 662
176 Ga0070667_101669081 3300005367 Bacteria 599
177 Ga0070667_101798653 3300005367 Bacteria 577
178 Ga0070709_10081361 3300005434 Bacteria 2114
179 Ga0070709_11415187 3300005434 Unclassified 563
180 Ga0070714_100055739 3300005435 Bacteria 3379
181 Ga0070714_100063691 3300005435 Bacteria 3171
182 Ga0070714_100252100 3300005435 Bacteria 1632
183 Ga0070714_101824868 3300005435 Bacteria 594
184 Ga0070713_100032969 3300005436 Bacteria 4144
185 Ga0070713_100202477 3300005436 Bacteria 1793
186 Ga0070713_100449365 3300005436 Bacteria 1210
187 Ga0070701_10395867 3300005438 Bacteria 874
188 Ga0070711_101876006 3300005439 Bacteria 526
189 Ga0070663_100010764 3300005455 Bacteria 5711
190 Ga0070663_100020658 3300005455 Bacteria 4363
191 Ga0070663_100026400 3300005455 Bacteria 3934
192 Ga0070663_100093271 3300005455 Bacteria 2234
193 Ga0070663_100271906 3300005455 Bacteria 1347
194 Ga0070663_100387113 3300005455 Bacteria 1140
195 Ga0070663_100391081 3300005455 Bacteria 1134
196 Ga0070663_100561215 3300005455 Bacteria 955
197 Ga0070663_101370547 3300005455 Bacteria 626
198 Ga0070663_101402024 3300005455 Bacteria 619
199 Ga0070678_100001121 3300005456 Bacteria 14070
200 Ga0070678_100002490 3300005456 Bacteria 10099
201 Ga0070678_100034382 3300005456 Bacteria 3529
202 Ga0070678_100137937 3300005456 Bacteria 1948
203 Ga0070678_100206575 3300005456 Bacteria 1624
204 Ga0070678_100344490 3300005456 Bacteria 1279
205 Ga0070662_100001195 3300005457 Bacteria 15948
206 Ga0070662_100004959 3300005457 Bacteria 8456
207 Ga0070662_100014122 3300005457 Bacteria 5327
208 Ga0070662_100017911 3300005457 Bacteria 4782
209 Ga0070662_100039331 3300005457 Bacteria 3363
210 Ga0070662_100039339 3300005457 Bacteria 3363
211 Ga0070662_100045906 3300005457 Bacteria 3137
212 Ga0070662_100058911 3300005457 Bacteria 2796
213 Ga0070662_100078053 3300005457 Bacteria 2459
214 Ga0070662_100189587 3300005457 Bacteria 1625
215 Ga0070662_100198471 3300005457 Bacteria 1591
216 Ga0070662_100294846 3300005457 Bacteria 1316
217 Ga0070662_100653742 3300005457 Unclassified 887
218 Ga0070662_101502363 3300005457 Bacteria 581
219 Ga0070681_10058866 3300005458 Bacteria 3822
220 Ga0070681_10288180 3300005458 Bacteria 1552
221 Ga0070681_11016448 3300005458 Bacteria 749
222 Ga0068867_100022766 3300005459 Bacteria 4482
223 Ga0068867_100368578 3300005459 Bacteria 1203
224 Ga0068867_100493649 3300005459 Bacteria 1051
225 Ga0068867_101153741 3300005459 Bacteria 710
226 Ga0068867_101331753 3300005459 Unclassified 664
227 Ga0070685_10129542 3300005466 Bacteria 1576
228 Ga0070679_100009722 3300005530 Bacteria 9098
229 Ga0070679_100019156 3300005530 Bacteria 6649
230 Ga0070679_100174555 3300005530 Bacteria 2121
231 Ga0070679_100372922 3300005530 Unclassified 1374
232 Ga0070679_100754260 3300005530 Bacteria 916
233 Ga0070679_101353121 3300005530 Unclassified 658
234 Ga0070679_101421165 3300005530 Bacteria 640
235 Ga0070684_100068081 3300005535 Bacteria 3129
236 Ga0070684_102115280 3300005535 Bacteria 531
237 Ga0068853_100025405 3300005539 Bacteria 4969
238 Ga0068853_100387060 3300005539 Bacteria 1307
239 Ga0068853_100469235 3300005539 Bacteria 1185
240 Ga0068853_100522702 3300005539 Bacteria 1122
241 Ga0068853_100640747 3300005539 Bacteria 1011
242 Ga0068853_101155853 3300005539 Unclassified 747
243 Ga0068853_101276403 3300005539 Bacteria 710
244 Ga0068853_101483083 3300005539 Bacteria 657
245 Ga0068853_101643763 3300005539 Bacteria 622
246 Ga0070672_100003335 3300005543 Bacteria 10402
247 Ga0070672_100015335 3300005543 Bacteria 5454
248 Ga0070672_100128397 3300005543 Bacteria 2081
249 Ga0070672_100278366 3300005543 Bacteria 1414
250 Ga0070672_100300936 3300005543 Bacteria 1359
251 Ga0070672_100642030 3300005543 Bacteria 927
252 Ga0070672_101265171 3300005543 Bacteria 658
253 Ga0070672_101549882 3300005543 Bacteria 594
254 Ga0070686_100032521 3300005544 Bacteria 3199
255 Ga0070695_100335500 3300005545 Bacteria 1128
256 Ga0070696_100585448 3300005546 Bacteria 898
257 Ga0070693_100425669 3300005547 Bacteria 926
258 Ga0070665_100013547 3300005548 Bacteria 8203
259 Ga0070665_100019750 3300005548 Bacteria 6763
260 Ga0070665_100021059 3300005548 Bacteria 6556
261 Ga0070665_100566968 3300005548 Bacteria 1148
262 Ga0068855_100042906 3300005563 Bacteria 5359
263 Ga0068855_100377383 3300005563 Bacteria 1557
264 Ga0068855_100553106 3300005563 Bacteria 1245
265 Ga0068855_100994134 3300005563 Bacteria 882
266 Ga0070664_100005488 3300005564 Bacteria 10184
267 Ga0070664_100010804 3300005564 Bacteria 7403
268 Ga0070664_100073402 3300005564 Bacteria 2935
269 Ga0070664_100088706 3300005564 Bacteria 2674
270 Ga0070664_100229423 3300005564 Bacteria 1664
271 Ga0070664_100286767 3300005564 Bacteria 1486
272 Ga0070664_100563832 3300005564 Bacteria 1054
273 Ga0070664_100714899 3300005564 Bacteria 934
274 Ga0070664_100734566 3300005564 Unclassified 921
275 Ga0070664_102197857 3300005564 Unclassified 524
276 Ga0068857_100008116 3300005577 Bacteria 9064
277 Ga0068857_100126060 3300005577 Bacteria 2307
278 Ga0068857_100151220 3300005577 Bacteria 2103
279 Ga0068857_100315172 3300005577 Bacteria 1444
280 Ga0068857_100434983 3300005577 Bacteria 1225
281 Ga0068857_102278722 3300005577 Bacteria 532
282 Ga0068854_100020300 3300005578 Bacteria 4493
283 Ga0068854_100047329 3300005578 Bacteria 3065
284 Ga0068854_100074929 3300005578 Bacteria 2484
285 Ga0068854_100111507 3300005578 Bacteria 2064
286 Ga0068854_100165138 3300005578 Bacteria 1718
287 Ga0068854_100271063 3300005578 Bacteria 1363
288 Ga0068854_100275076 3300005578 Bacteria 1353
289 Ga0068854_100566578 3300005578 Bacteria 965
290 Ga0068854_100638705 3300005578 Bacteria 913
291 Ga0068854_100884689 3300005578 Bacteria 784
292 Ga0068854_102151494 3300005578 Bacteria 516
293 Ga0068856_100023762 3300005614 Bacteria 5961
294 Ga0068856_100027363 3300005614 Bacteria 5563
295 Ga0068856_100185923 3300005614 Bacteria 2091
296 Ga0068856_100323893 3300005614 Bacteria 1558
297 Ga0068856_100333314 3300005614 Bacteria 1535
298 Ga0068856_101618028 3300005614 Bacteria 661
299 Ga0068856_102449087 3300005614 Bacteria 529
300 Ga0070702_101482694 3300005615 Bacteria 557
301 Ga0068852_100035258 3300005616 Bacteria 4171
302 Ga0068852_100038835 3300005616 Bacteria 4004
303 Ga0068852_100045745 3300005616 Bacteria 3725
304 Ga0068852_100122683 3300005616 Bacteria 2382
305 Ga0068852_100182868 3300005616 Bacteria 1972
306 Ga0068852_100310680 3300005616 Bacteria 1528
307 Ga0068852_100333219 3300005616 Bacteria 1477
308 Ga0068852_100456244 3300005616 Bacteria 1266
309 Ga0068852_100471672 3300005616 Bacteria 1246
310 Ga0068852_100566468 3300005616 Bacteria 1138
311 Ga0068852_100869340 3300005616 Bacteria 918
312 Ga0068852_101273366 3300005616 Bacteria 757
313 Ga0068859_100067219 3300005617 Bacteria 3619
314 Ga0068859_100186379 3300005617 Bacteria 2159
315 Ga0068859_100279375 3300005617 Bacteria 1762
316 Ga0068859_101433960 3300005617 Bacteria 762
317 Ga0068864_100003198 3300005618 Bacteria 13529
318 Ga0068864_100023399 3300005618 Bacteria 5187
319 Ga0068864_100473741 3300005618 Bacteria 1201
320 Ga0068866_10023764 3300005718 Bacteria 2855
321 Ga0068866_10026409 3300005718 Bacteria 2742
322 Ga0068866_10204017 3300005718 Bacteria 1183
323 Ga0068866_10339675 3300005718 Bacteria 951
324 Ga0068861_100027898 3300005719 Bacteria 4117
325 Ga0068861_100531459 3300005719 Bacteria 1068
326 Ga0068861_100754928 3300005719 Unclassified 909
327 Ga0068861_101503858 3300005719 Unclassified 661
328 Ga0068861_101728555 3300005719 Bacteria 619
329 Ga0068851_10052156 3300005834 Bacteria 2080
330 Ga0068851_10068571 3300005834 Bacteria 1831
331 Ga0068851_10091247 3300005834 Bacteria 1604
332 Ga0068851_10268414 3300005834 Bacteria 972
333 Ga0068870_11141887 3300005840 Bacteria 562
334 Ga0068863_100003336 3300005841 Bacteria 15863
335 Ga0068863_100004174 3300005841 Bacteria 14263
336 Ga0068863_100503547 3300005841 Bacteria 1193
337 Ga0068863_100720481 3300005841 Bacteria 992
338 Ga0068858_100009881 3300005842 Bacteria 9065
339 Ga0068858_100024491 3300005842 Bacteria 5622
340 Ga0068858_100551693 3300005842 Bacteria 1116
341 Ga0068860_100264921 3300005843 Bacteria 1676
342 Ga0068862_100345812 3300005844 Bacteria 1378
343 Ga0068862_100889838 3300005844 Bacteria 875
344 Ga0081455_10112174 3300005937 Bacteria 2165
345 Ga0081539_10021962 3300005985 Bacteria 4240
346 Ga0070717_11321974 3300006028 Bacteria 655
347 Ga0070716_100017029 3300006173 Bacteria 3761
348 Ga0070716_100237612 3300006173 Bacteria 1234
349 Ga0070712_100043513 3300006175 Bacteria 3091
350 Ga0070712_100199713 3300006175 Bacteria 1570
351 Ga0070712_100409844 3300006175 Unclassified 1121
352 Ga0075369_10224746 3300006186 Bacteria 869
353 Ga0075366_10634674 3300006195 Bacteria 662
354 Ga0097621_100036057 3300006237 Bacteria 3954
355 Ga0097621_100200994 3300006237 Bacteria 1730
356 Ga0097621_100874416 3300006237 Bacteria 836
357 Ga0097621_101060345 3300006237 Bacteria 760
358 Ga0075370_10373493 3300006353 Bacteria 854
359 Ga0068871_100200469 3300006358 Bacteria 1723
360 Ga0068871_100460286 3300006358 Bacteria 1141
361 Ga0075434_100306851 3300006871 Bacteria 1607
362 Ga0068865_100072973 3300006881 Bacteria 2439
363 Ga0068865_100615315 3300006881 Bacteria 920
364 Ga0068865_100978046 3300006881 Bacteria 740
365 Ga0068865_101045802 3300006881 Bacteria 717
366 Ga0097620_100067222 3300006931 Bacteria 3619
367 Ga0097620_100186370 3300006931 Bacteria 2159
368 Ga0097620_100279373 3300006931 Bacteria 1762
369 Ga0097620_101433801 3300006931 Bacteria 762
370 Ga0105244_10507981 3300009036 Bacteria 555
371 Ga0105240_11027586 3300009093 Unclassified 880
372 Ga0105240_11248634 3300009093 Unclassified 785
373 Ga0105245_10019606 3300009098 Bacteria 5925
374 Ga0105245_10023282 3300009098 Bacteria 5437
375 Ga0105245_10198795 3300009098 Bacteria 1924
376 Ga0105245_11304672 3300009098 Bacteria 775
377 Ga0105245_11610038 3300009098 Bacteria 701
378 Ga0105245_12384180 3300009098 Bacteria 583
379 Ga0105243_10017247 3300009148 Bacteria 5460
380 Ga0105243_10592442 3300009148 Bacteria 1066
381 Ga0105243_11201855 3300009148 Bacteria 771
382 Ga0105241_10685630 3300009174 Bacteria 934
383 Ga0105241_11342443 3300009174 Unclassified 682
384 Ga0105242_10155550 3300009176 Bacteria 1997
385 Ga0105242_11181354 3300009176 Bacteria 783
386 Ga0105248_10001634 3300009177 Bacteria 24926
387 Ga0105248_10001894 3300009177 Bacteria 23189
388 Ga0105248_10002448 3300009177 Bacteria 20617
389 Ga0105248_10026794 3300009177 Bacteria 6411
390 Ga0105248_10052041 3300009177 Bacteria 4595
391 Ga0105248_10055565 3300009177 Bacteria 4441
392 Ga0105248_10219657 3300009177 Bacteria 2140
393 Ga0105248_10254978 3300009177 Bacteria 1975
394 Ga0105248_10688259 3300009177 Bacteria 1153
395 Ga0105237_10449078 3300009545 Bacteria 1295
396 Ga0105238_10324553 3300009551 Bacteria 1526
397 Ga0105249_10261845 3300009553 Bacteria 1719
398 Ga0105249_11854036 3300009553 Bacteria 676
399 Ga0105239_10544206 3300010375 Bacteria 1322
400 Ga0105239_11448792 3300010375 Unclassified 793
401 Ga0105239_11720435 3300010375 Bacteria 726
402 Ga0105239_13271721 3300010375 Bacteria 527
403 Ga0105246_10064694 3300011119 Bacteria 2556
404 Ga0105246_10641954 3300011119 Bacteria 923
405 Ga0157327_1014092 3300012512 Bacteria 812
406 Ga0157373_10021660 3300013100 Bacteria 4664
407 Ga0157373_10072363 3300013100 Bacteria 2433
408 Ga0157373_10173185 3300013100 Bacteria 1519
409 Ga0157373_10368773 3300013100 Bacteria 1026
410 Ga0157373_10524357 3300013100 Bacteria 857
411 Ga0157373_10805553 3300013100 Bacteria 693
412 Ga0157371_10051761 3300013102 Bacteria 2918
413 Ga0157371_10053945 3300013102 Bacteria 2855
414 Ga0157371_10225171 3300013102 Bacteria 1347
415 Ga0157371_10257009 3300013102 Bacteria 1259
416 Ga0157371_10312879 3300013102 Bacteria 1138
417 Ga0157371_10357931 3300013102 Bacteria 1063
418 Ga0157371_10472897 3300013102 Bacteria 923
419 Ga0157370_10041941 3300013104 Bacteria 4411
420 Ga0157370_10133136 3300013104 Bacteria 2318
421 Ga0157370_10167170 3300013104 Bacteria 2045
422 Ga0157370_10957146 3300013104 Bacteria 776
423 Ga0157369_10140020 3300013105 Bacteria 2561
424 Ga0157369_10153643 3300013105 Bacteria 2432
425 Ga0157369_10462082 3300013105 Bacteria 1314
426 Ga0157369_10862726 3300013105 Bacteria 929
427 Ga0157374_10019076 3300013296 Bacteria 6068
428 Ga0157374_10159797 3300013296 Bacteria 2195
429 Ga0157374_10197873 3300013296 Bacteria 1967
430 Ga0157374_11582747 3300013296 Unclassified 679
431 Ga0157374_11988145 3300013296 Archaea 608
432 Ga0157378_10191875 3300013297 Bacteria 1927
433 Ga0157378_10268195 3300013297 Bacteria 1641
434 Ga0157378_10534681 3300013297 Bacteria 1175
435 Ga0157378_10535647 3300013297 Bacteria 1174
436 Ga0157378_10589800 3300013297 Bacteria 1121
437 Ga0157378_10959130 3300013297 Bacteria 888
438 Ga0163162_10000768 3300013306 Bacteria 29827
439 Ga0163162_10023881 3300013306 Bacteria 6034
440 Ga0163162_10104995 3300013306 Bacteria 2920
441 Ga0163162_10128812 3300013306 Bacteria 2639
442 Ga0163162_12230085 3300013306 Unclassified 629
443 Ga0157372_10118491 3300013307 Bacteria 3038
444 Ga0157372_10409795 3300013307 Bacteria 1580
445 Ga0157372_10591808 3300013307 Bacteria 1293
446 Ga0157372_10890480 3300013307 Bacteria 1033
447 Ga0157372_10917523 3300013307 Bacteria 1016
448 Ga0157372_11572598 3300013307 Bacteria 757
449 Ga0157372_11613633 3300013307 Bacteria 747
450 Ga0157375_10005630 3300013308 Bacteria 10907
451 Ga0157375_10020583 3300013308 Bacteria 6030
452 Ga0157375_10213250 3300013308 Bacteria 2089
453 Ga0157375_10403985 3300013308 Bacteria 1533
454 Ga0157375_11826491 3300013308 Bacteria 721
455 Ga0163163_10073297 3300014325 Bacteria 3415
456 Ga0163163_10206336 3300014325 Bacteria 2013
457 Ga0157380_10835979 3300014326 Bacteria 941
458 Ga0157380_12285446 3300014326 Bacteria 605
459 Ga0182008_10056733 3300014497 Bacteria 1934
460 Ga0157377_10148714 3300014745 Bacteria 1446
461 Ga0157379_12409262 3300014968 Bacteria 525
462 Ga0157376_10090404 3300014969 Bacteria 2649
463 Ga0163161_10328102 3300017792 Bacteria 1211
464 Ga0163161_10368541 3300017792 Bacteria 1145
465 Ga0206354_11545716 3300020081 Bacteria 1047
466 Ga0213876_10023631 3300021384 Bacteria 3246
467 Ga0213876_10077576 3300021384 Bacteria 1755
468 Ga0207673_1022881 3300025290 Bacteria 849
469 Ga0207697_10011452 3300025315 Bacteria 3751
470 Ga0207697_10140730 3300025315 Bacteria 1046
471 Ga0207656_10130030 3300025321 Bacteria 1179
472 Ga0207656_10173642 3300025321 Bacteria 1031
473 Ga0207656_10194328 3300025321 Bacteria 978
474 Ga0207656_10321154 3300025321 Bacteria 769
475 Ga0207682_10004204 3300025893 Bacteria 6081
476 Ga0207682_10077134 3300025893 Bacteria 1421
477 Ga0207642_10007391 3300025899 Bacteria 3709
478 Ga0207642_10042153 3300025899 Bacteria 2004
479 Ga0207642_10164071 3300025899 Bacteria 1196
480 Ga0207642_10270163 3300025899 Bacteria 973
481 Ga0207642_10610956 3300025899 Bacteria 680
482 Ga0207688_10009345 3300025901 Bacteria 5344
483 Ga0207688_10022437 3300025901 Bacteria 3454
484 Ga0207688_10027272 3300025901 Bacteria 3142
485 Ga0207688_10029570 3300025901 Bacteria 3017
486 Ga0207688_10126250 3300025901 Bacteria 1496
487 Ga0207688_10129436 3300025901 Bacteria 1479
488 Ga0207680_10002585 3300025903 Bacteria 8443
489 Ga0207680_10101277 3300025903 Bacteria 1851
490 Ga0207680_10310385 3300025903 Bacteria 1101
491 Ga0207680_10505087 3300025903 Bacteria 861
492 Ga0207680_11234789 3300025903 Bacteria 532
493 Ga0207680_11242879 3300025903 Archaea 531
494 Ga0207647_10009676 3300025904 Bacteria 6843
495 Ga0207647_10012986 3300025904 Bacteria 5785
496 Ga0207647_10027273 3300025904 Bacteria 3724
497 Ga0207647_10050442 3300025904 Bacteria 2576
498 Ga0207647_10065670 3300025904 Bacteria 2202
499 Ga0207647_10082023 3300025904 Bacteria 1932
500 Ga0207647_10302630 3300025904 Bacteria 910
501 Ga0207699_10146761 3300025906 Bacteria 1556
502 Ga0207645_10020823 3300025907 Bacteria 4285
503 Ga0207645_10031056 3300025907 Bacteria 3439
504 Ga0207645_10046178 3300025907 Bacteria 2783
505 Ga0207645_10762584 3300025907 Bacteria 658
506 Ga0207645_11026039 3300025907 Bacteria 558
507 Ga0207645_11191719 3300025907 Unclassified 511
508 Ga0207705_10003597 3300025909 Bacteria 11806
509 Ga0207705_10004771 3300025909 Bacteria 10210
510 Ga0207705_10009807 3300025909 Bacteria 6970
511 Ga0207705_10046912 3300025909 Bacteria 3106
512 Ga0207705_10131333 3300025909 Bacteria 1864
513 Ga0207705_10180650 3300025909 Bacteria 1592
514 Ga0207705_10578866 3300025909 Bacteria 873
515 Ga0207705_10799219 3300025909 Bacteria 732
516 Ga0207705_11140637 3300025909 Unclassified 599
517 Ga0207654_11216505 3300025911 Bacteria 549
518 Ga0207707_10124551 3300025912 Bacteria 2254
519 Ga0207707_10150276 3300025912 Bacteria 2036
520 Ga0207707_10341825 3300025912 Bacteria 1290
521 Ga0207707_10476500 3300025912 Bacteria 1066
522 Ga0207695_10210052 3300025913 Bacteria 1858
523 Ga0207693_10014544 3300025915 Bacteria 6324
524 Ga0207660_10002662 3300025917 Bacteria 11716
525 Ga0207662_10207392 3300025918 Bacteria 1271
526 Ga0207662_10974084 3300025918 Bacteria 602
527 Ga0207657_10000434 3300025919 Bacteria 44542
528 Ga0207657_10001170 3300025919 Bacteria 27822
529 Ga0207657_10002813 3300025919 Bacteria 18715
530 Ga0207657_10024081 3300025919 Bacteria 5651
531 Ga0207657_10040928 3300025919 Bacteria 4102
532 Ga0207657_10042145 3300025919 Bacteria 4030
533 Ga0207657_10098472 3300025919 Bacteria 2430
534 Ga0207657_10102994 3300025919 Bacteria 2367
535 Ga0207657_10124050 3300025919 Bacteria 2122
536 Ga0207657_10167306 3300025919 Bacteria 1783
537 Ga0207657_10268630 3300025919 Bacteria 1356
538 Ga0207657_10356827 3300025919 Bacteria 1153
539 Ga0207657_10510349 3300025919 Bacteria 941
540 Ga0207657_10958389 3300025919 Unclassified 657
541 Ga0207649_10011041 3300025920 Bacteria 4970
542 Ga0207649_10027276 3300025920 Bacteria 3350
543 Ga0207649_10034090 3300025920 Bacteria 3047
544 Ga0207649_10060338 3300025920 Bacteria 2383
545 Ga0207649_10112156 3300025920 Bacteria 1824
546 Ga0207649_10129581 3300025920 Bacteria 1711
547 Ga0207649_10287679 3300025920 Bacteria 1197
548 Ga0207649_10307304 3300025920 Bacteria 1161
549 Ga0207649_10434297 3300025920 Bacteria 988
550 Ga0207649_10494474 3300025920 Bacteria 929
551 Ga0207649_11694553 3300025920 Bacteria 500
552 Ga0207652_10000034 3300025921 Bacteria 138571
553 Ga0207652_10058852 3300025921 Bacteria 3311
554 Ga0207652_10122947 3300025921 Bacteria 2310
555 Ga0207652_10143490 3300025921 Bacteria 2136
556 Ga0207652_10454642 3300025921 Bacteria 1154
557 Ga0207681_10004355 3300025923 Bacteria 8731
558 Ga0207681_10050998 3300025923 Bacteria 2802
559 Ga0207681_10167103 3300025923 Bacteria 1664
560 Ga0207681_10264112 3300025923 Bacteria 1349
561 Ga0207681_10336792 3300025923 Bacteria 1204
562 Ga0207681_10418805 3300025923 Bacteria 1085
563 Ga0207694_10538823 3300025924 Bacteria 979
564 Ga0207650_10002948 3300025925 Bacteria 11736
565 Ga0207650_10040539 3300025925 Bacteria 3408
566 Ga0207650_10043580 3300025925 Bacteria 3294
567 Ga0207650_10052391 3300025925 Bacteria 3023
568 Ga0207650_10059964 3300025925 Bacteria 2838
569 Ga0207650_10107594 3300025925 Bacteria 2154
570 Ga0207650_10227661 3300025925 Bacteria 1503
571 Ga0207650_11345655 3300025925 Bacteria 608
572 Ga0207650_11421791 3300025925 Bacteria 590
573 Ga0207659_10076781 3300025926 Bacteria 2457
574 Ga0207659_10085108 3300025926 Bacteria 2348
575 Ga0207659_10829266 3300025926 Bacteria 795
576 Ga0207659_11153323 3300025926 Bacteria 666
577 Ga0207687_10012657 3300025927 Bacteria 5512
578 Ga0207687_10035715 3300025927 Bacteria 3382
579 Ga0207687_10893712 3300025927 Bacteria 760
580 Ga0207687_11508204 3300025927 Unclassified 577
581 Ga0207700_10388919 3300025928 Bacteria 1221
582 Ga0207664_10018146 3300025929 Bacteria 5171
583 Ga0207664_10079535 3300025929 Bacteria 2662
584 Ga0207664_11394232 3300025929 Unclassified 621
585 Ga0207644_10000052 3300025931 Bacteria 91473
586 Ga0207644_10000943 3300025931 Bacteria 18532
587 Ga0207644_10000996 3300025931 Bacteria 18076
588 Ga0207644_10017678 3300025931 Bacteria 4821
589 Ga0207644_10032654 3300025931 Bacteria 3633
590 Ga0207644_10105072 3300025931 Bacteria 2127
591 Ga0207644_10209244 3300025931 Bacteria 1541
592 Ga0207644_10250949 3300025931 Bacteria 1412
593 Ga0207644_10259752 3300025931 Bacteria 1388
594 Ga0207644_10761302 3300025931 Bacteria 809
595 Ga0207644_11284946 3300025931 Bacteria 615
596 Ga0207644_11564618 3300025931 Bacteria 553
597 Ga0207690_10002842 3300025932 Bacteria 10446
598 Ga0207690_10013275 3300025932 Bacteria 4946
599 Ga0207690_10034676 3300025932 Bacteria 3253
600 Ga0207690_10049022 3300025932 Bacteria 2813
601 Ga0207690_10109546 3300025932 Bacteria 1987
602 Ga0207690_10149234 3300025932 Bacteria 1732
603 Ga0207690_10199876 3300025932 Bacteria 1517
604 Ga0207690_10260883 3300025932 Bacteria 1342
605 Ga0207690_10427935 3300025932 Bacteria 1060
606 Ga0207690_10691141 3300025932 Bacteria 838
607 Ga0207690_10892420 3300025932 Bacteria 737
608 Ga0207690_11199707 3300025932 Bacteria 634
609 Ga0207690_11496497 3300025932 Bacteria 564
610 Ga0207706_10000299 3300025933 Bacteria 53751
611 Ga0207706_10000614 3300025933 Bacteria 37833
612 Ga0207706_10007215 3300025933 Bacteria 10277
613 Ga0207706_10020875 3300025933 Bacteria 5881
614 Ga0207706_10040584 3300025933 Bacteria 4125
615 Ga0207706_10048431 3300025933 Bacteria 3758
616 Ga0207706_10124972 3300025933 Bacteria 2263
617 Ga0207706_10155926 3300025933 Bacteria 2008
618 Ga0207706_10180054 3300025933 Bacteria 1856
619 Ga0207706_10528423 3300025933 Bacteria 1017
620 Ga0207706_10601912 3300025933 Bacteria 944
621 Ga0207706_10680466 3300025933 Bacteria 880
622 Ga0207706_11571005 3300025933 Bacteria 534
623 Ga0207686_10269296 3300025934 Bacteria 1252
624 Ga0207686_10342765 3300025934 Bacteria 1123
625 Ga0207670_10203249 3300025936 Bacteria 1506
626 Ga0207670_10501107 3300025936 Bacteria 986
627 Ga0207669_10153294 3300025937 Bacteria 1617
628 Ga0207669_10168664 3300025937 Bacteria 1555
629 Ga0207669_10186735 3300025937 Bacteria 1491
630 Ga0207669_10410156 3300025937 Bacteria 1063
631 Ga0207669_10556401 3300025937 Bacteria 926
632 Ga0207669_10985967 3300025937 Bacteria 707
633 Ga0207704_10138617 3300025938 Bacteria 1698
634 Ga0207704_10292820 3300025938 Bacteria 1243
635 Ga0207704_11156174 3300025938 Bacteria 659
636 Ga0207665_10565645 3300025939 Bacteria 885
637 Ga0207691_10000998 3300025940 Bacteria 28103
638 Ga0207691_10013011 3300025940 Bacteria 7967
639 Ga0207691_10016113 3300025940 Bacteria 7100
640 Ga0207691_10071125 3300025940 Bacteria 3140
641 Ga0207691_10108220 3300025940 Bacteria 2474
642 Ga0207691_10128425 3300025940 Bacteria 2241
643 Ga0207691_10339902 3300025940 Bacteria 1285
644 Ga0207691_10471177 3300025940 Bacteria 1068
645 Ga0207691_11150273 3300025940 Bacteria 644
646 Ga0207711_10000420 3300025941 Bacteria 44798
647 Ga0207711_10001311 3300025941 Bacteria 23539
648 Ga0207711_10003129 3300025941 Bacteria 14421
649 Ga0207711_10011832 3300025941 Bacteria 7250
650 Ga0207711_10189622 3300025941 Bacteria 1873
651 Ga0207711_10192745 3300025941 Bacteria 1858
652 Ga0207711_10294821 3300025941 Bacteria 1495
653 Ga0207689_10033251 3300025942 Bacteria 4285
654 Ga0207661_10032385 3300025944 Bacteria 4049
655 Ga0207661_10224509 3300025944 Bacteria 1661
656 Ga0207661_10415947 3300025944 Bacteria 1221
657 Ga0207661_11391683 3300025944 Bacteria 644
658 Ga0207679_10023965 3300025945 Bacteria 4180
659 Ga0207679_10025671 3300025945 Bacteria 4055
660 Ga0207679_10034407 3300025945 Bacteria 3574
661 Ga0207679_10092592 3300025945 Bacteria 2342
662 Ga0207679_10183638 3300025945 Bacteria 1732
663 Ga0207679_10295415 3300025945 Bacteria 1394
664 Ga0207679_10523871 3300025945 Bacteria 1060
665 Ga0207679_10739393 3300025945 Bacteria 894
666 Ga0207679_10904130 3300025945 Bacteria 807
667 Ga0207679_10961685 3300025945 Bacteria 782
668 Ga0207667_10012261 3300025949 Bacteria 9895
669 Ga0207667_10049447 3300025949 Bacteria 4440
670 Ga0207667_10366878 3300025949 Bacteria 1468
671 Ga0207667_10500052 3300025949 Bacteria 1233
672 Ga0207651_10000652 3300025960 Bacteria 14745
673 Ga0207651_10012001 3300025960 Bacteria 4878
674 Ga0207651_10013969 3300025960 Bacteria 4619
675 Ga0207651_10140058 3300025960 Bacteria 1867
676 Ga0207651_10201589 3300025960 Bacteria 1595
677 Ga0207651_10430531 3300025960 Bacteria 1128
678 Ga0207651_10441912 3300025960 Bacteria 1114
679 Ga0207651_10480599 3300025960 Bacteria 1071
680 Ga0207651_10654794 3300025960 Bacteria 922
681 Ga0207651_11182526 3300025960 Bacteria 686
682 Ga0207651_11281837 3300025960 Bacteria 658
683 Ga0207712_11482182 3300025961 Bacteria 608
684 Ga0207668_10198870 3300025972 Bacteria 1594
685 Ga0207668_10219539 3300025972 Bacteria 1526
686 Ga0207668_11125351 3300025972 Bacteria 704
687 Ga0207640_10057391 3300025981 Bacteria 2560
688 Ga0207640_10175109 3300025981 Bacteria 1603
689 Ga0207640_10207631 3300025981 Bacteria 1489
690 Ga0207640_10209652 3300025981 Bacteria 1483
691 Ga0207640_10425775 3300025981 Bacteria 1087
692 Ga0207640_10610929 3300025981 Bacteria 924
693 Ga0207640_10832447 3300025981 Bacteria 802
694 Ga0207640_11160446 3300025981 Bacteria 685
695 Ga0207640_11370765 3300025981 Bacteria 633
696 Ga0207640_11607904 3300025981 Bacteria 585
697 Ga0207658_10004807 3300025986 Bacteria 9347
698 Ga0207658_10038494 3300025986 Bacteria 3445
699 Ga0207658_10066062 3300025986 Bacteria 2719
700 Ga0207658_10123783 3300025986 Bacteria 2066
701 Ga0207658_10165199 3300025986 Bacteria 1818
702 Ga0207658_10312073 3300025986 Bacteria 1359
703 Ga0207658_10654966 3300025986 Bacteria 947
704 Ga0207658_11098034 3300025986 Bacteria 727
705 Ga0207677_10003117 3300026023 Bacteria 8747
706 Ga0207677_10018354 3300026023 Bacteria 4196
707 Ga0207677_10030638 3300026023 Bacteria 3437
708 Ga0207677_10072056 3300026023 Bacteria 2441
709 Ga0207677_10679258 3300026023 Bacteria 912
710 Ga0207703_10002663 3300026035 Bacteria 15352
711 Ga0207703_10031952 3300026035 Bacteria 4164
712 Ga0207703_10079372 3300026035 Bacteria 2730
713 Ga0207639_10117021 3300026041 Bacteria 2183
714 Ga0207639_10230713 3300026041 Bacteria 1604
715 Ga0207639_10555240 3300026041 Bacteria 1055
716 Ga0207639_10622591 3300026041 Bacteria 997
717 Ga0207639_10654861 3300026041 Bacteria 972
718 Ga0207639_10679122 3300026041 Bacteria 954
719 Ga0207639_10716064 3300026041 Bacteria 929
720 Ga0207639_11194175 3300026041 Bacteria 714
721 Ga0207678_10000117 3300026067 Bacteria 65678
722 Ga0207678_10006831 3300026067 Bacteria 10119
723 Ga0207678_10020241 3300026067 Bacteria 5841
724 Ga0207678_10040138 3300026067 Bacteria 4060
725 Ga0207678_10129505 3300026067 Bacteria 2152
726 Ga0207678_10143668 3300026067 Bacteria 2037
727 Ga0207678_10170926 3300026067 Bacteria 1856
728 Ga0207678_10216460 3300026067 Bacteria 1639
729 Ga0207678_10265351 3300026067 Bacteria 1472
730 Ga0207678_11064414 3300026067 Bacteria 716
731 Ga0207702_10079971 3300026078 Bacteria 2835
732 Ga0207702_10408586 3300026078 Bacteria 1310
733 Ga0207702_10993495 3300026078 Unclassified 832
734 Ga0207702_11535377 3300026078 Bacteria 659
735 Ga0207702_11818892 3300026078 Bacteria 601
736 Ga0207702_12287974 3300026078 Bacteria 528
737 Ga0207641_10006363 3300026088 Bacteria 9971
738 Ga0207641_10092172 3300026088 Bacteria 2653
739 Ga0207641_10810568 3300026088 Bacteria 926
740 Ga0207641_11232560 3300026088 Bacteria 748
741 Ga0207648_10016503 3300026089 Bacteria 6744
742 Ga0207648_10057138 3300026089 Bacteria 3404
743 Ga0207648_10142850 3300026089 Bacteria 2110
744 Ga0207648_10309763 3300026089 Bacteria 1417
745 Ga0207648_10358818 3300026089 Bacteria 1315
746 Ga0207676_10005353 3300026095 Bacteria 9088
747 Ga0207676_10045938 3300026095 Bacteria 3376
748 Ga0207676_10228584 3300026095 Bacteria 1661
749 Ga0207676_10310404 3300026095 Bacteria 1444
750 Ga0207674_10000086 3300026116 Bacteria 100722
751 Ga0207674_10006741 3300026116 Bacteria 13483
752 Ga0207674_10154256 3300026116 Bacteria 2252
753 Ga0207674_10173540 3300026116 Bacteria 2109
754 Ga0207674_11045692 3300026116 Bacteria 786
755 Ga0207675_100044742 3300026118 Bacteria 4137
756 Ga0207675_100147851 3300026118 Bacteria 2235
757 Ga0207675_101529073 3300026118 Unclassified 688
758 Ga0207683_10000846 3300026121 Bacteria 28093
759 Ga0207683_10003887 3300026121 Bacteria 12956
760 Ga0207683_10067903 3300026121 Bacteria 3146
761 Ga0207683_10100386 3300026121 Bacteria 2584
762 Ga0207683_10106035 3300026121 Bacteria 2513
763 Ga0207683_10177759 3300026121 Bacteria 1929
764 Ga0207698_10078193 3300026142 Bacteria 2655
765 Ga0207698_10089400 3300026142 Bacteria 2515
766 Ga0207698_10147231 3300026142 Bacteria 2038
767 Ga0207698_10149172 3300026142 Bacteria 2027
768 Ga0207698_10232933 3300026142 Bacteria 1673
769 Ga0207698_10245977 3300026142 Bacteria 1633
770 Ga0207698_10277882 3300026142 Bacteria 1547
771 Ga0207698_10293572 3300026142 Bacteria 1510
772 Ga0207698_10355606 3300026142 Bacteria 1385
773 Ga0207698_10508813 3300026142 Bacteria 1173
774 Ga0207698_10782532 3300026142 Bacteria 955
775 Ga0207698_11361809 3300026142 Bacteria 724
776 Ga0209974_10053592 3300027876 Bacteria 1358
777 Ga0209974_10319248 3300027876 Bacteria 598
778 Ga0268266_10055274 3300028379 Bacteria 3412
779 Ga0268266_10083549 3300028379 Bacteria 2787
780 Ga0268266_10506053 3300028379 Bacteria 1154
781 Ga0268265_10475786 3300028380 Bacteria 1172
782 Ga0268265_11085440 3300028380 Bacteria 794
783 Ga0268264_10503308 3300028381 Bacteria 1182
784 Ga0268264_10641038 3300028381 Bacteria 1051
785 Ga0307408_100336708 3300031548 Bacteria 1276
786 Ga0307405_10004019 3300031731 Bacteria 6900
787 Ga0307405_10025754 3300031731 Bacteria 3382
788 Ga0307405_10414443 3300031731 Bacteria 1058
789 Ga0307405_10591326 3300031731 Bacteria 904
790 Ga0307413_10140181 3300031824 Bacteria 1669
791 Ga0307413_11407450 3300031824 Bacteria 613
792 Ga0307410_10047487 3300031852 Bacteria 2869
793 Ga0307410_10112970 3300031852 Bacteria 1968
794 Ga0307410_10215246 3300031852 Bacteria 1474
795 Ga0307406_10103064 3300031901 Bacteria 1948
796 Ga0307406_10176990 3300031901 Bacteria 1549
797 Ga0307407_10082056 3300031903 Bacteria 1953
798 Ga0307407_10473151 3300031903 Bacteria 913
799 Ga0307412_10062941 3300031911 Bacteria 2501
800 Ga0307412_10669854 3300031911 Bacteria 887
801 Ga0307412_10778493 3300031911 Bacteria 828
802 Ga0307412_10873923 3300031911 Bacteria 786
803 Ga0307409_100025333 3300031995 Bacteria 4158
804 Ga0307409_100186308 3300031995 Bacteria 1842
805 Ga0307409_100217944 3300031995 Bacteria 1721
806 Ga0307409_100343324 3300031995 Bacteria 1406
807 Ga0307409_100637213 3300031995 Bacteria 1058
808 Ga0307409_101102104 3300031995 Bacteria 815
809 Ga0307416_100018217 3300032002 Bacteria 4942
810 Ga0307416_100144033 3300032002 Bacteria 2172
811 Ga0307416_100530778 3300032002 Bacteria 1247
812 Ga0307416_102023742 3300032002 Bacteria 678
813 Ga0307414_10102821 3300032004 Bacteria 2154
814 Ga0307414_10600876 3300032004 Bacteria 986
815 Ga0307414_11451945 3300032004 Bacteria 638
816 Ga0307411_10032660 3300032005 Bacteria 3218
817 Ga0307411_10434736 3300032005 Bacteria 1093
818 Ga0307415_100035303 3300032126 Bacteria 3265
819 Ga0307415_100065523 3300032126 Bacteria 2531
820 Ga0307415_100172906 3300032126 Bacteria 1686
821 Ga0307415_101124989 3300032126 Bacteria 736
822 Ga0373950_0075644 3300034818 Unclassified 696
823 Ga0373959_0177768 3300034820 Bacteria 552
824 Ga0373938_0154874 3300034957 Bacteria 612
825 Ga0373929_0018067 3300035085 Bacteria 1398
826 Ga0373939_0095605 3300035114 Bacteria 1011
827 Ga0373939_0375018 3300035114 Bacteria 584
828 Ga0373960_0157523 3300035121 Bacteria 780
829 Ga0373960_0338373 3300035121 Bacteria 568
830 Ga0373943_0029916 3300035170 Bacteria 2575
831 Ga0373961_0081310 3300035241 Bacteria 1020
832 Ga0373931_1213654 3300035691 Bacteria 517
833 Ga0373935_0002322 3300035692 Bacteria 10863
834 Ga0373927_0155573 3300035695 Bacteria 1497
835 Ga0373947_0250366 3300035725 Bacteria 1171
836 Ga0373947_0722365 3300035725 Bacteria 680
837 Ga0373937_0546426 3300036401 Bacteria 1100
838 Ga0373937_0976411 3300036401 Bacteria 796
839 Ga0373925_0044348 3300037068 Bacteria 3302
840 Ga0395899_0002062 3300037312 Bacteria 16534
841 Ga0395899_0007278 3300037312 Bacteria 8561
842 Ga0395899_0017806 3300037312 Bacteria 5409
843 Ga0395899_0044714 3300037312 Bacteria 3299
844 Ga0395899_0108787 3300037312 Bacteria 1995
845 Ga0395899_0127594 3300037312 Bacteria 1818
846 Ga0395899_0176318 3300037312 Bacteria 1503
847 Ga0395899_0177552 3300037312 Bacteria 1497
848 Ga0395899_0198152 3300037312 Bacteria 1402
849 Ga0395899_0239494 3300037312 Bacteria 1249
850 Ga0395899_0263495 3300037312 Bacteria 1178
851 Ga0395899_0479984 3300037312 Bacteria 809
852 Ga0395899_0506867 3300037312 Unclassified 782
853 Ga0395900_0000997 3300037418 Bacteria 36770
854 Ga0395900_0003165 3300037418 Bacteria 17843
855 Ga0395900_0005624 3300037418 Bacteria 13109
856 Ga0395900_0011036 3300037418 Bacteria 9232
857 Ga0395900_0027388 3300037418 Bacteria 5837
858 Ga0395900_0062013 3300037418 Bacteria 3844
859 Ga0395900_0089574 3300037418 Bacteria 3162
860 Ga0395900_0090128 3300037418 Bacteria 3152
861 Ga0395900_0121970 3300037418 Bacteria 2674
862 Ga0395900_0151212 3300037418 Bacteria 2371
863 Ga0395900_0204665 3300037418 Bacteria 1995
864 Ga0395900_0205499 3300037418 Bacteria 1990
865 Ga0395900_0244780 3300037418 Bacteria 1797
866 Ga0395900_0275184 3300037418 Bacteria 1677
867 Ga0395900_0351368 3300037418 Bacteria 1448
868 Ga0395900_0448047 3300037418 Bacteria 1247
869 Ga0395900_0457515 3300037418 Bacteria 1231
870 Ga0395900_0744561 3300037418 Bacteria 911
871 Ga0395900_0971092 3300037418 Bacteria 770
872 Ga0395900_1070448 3300037418 Bacteria 724
873 Ga0395900_1085104 3300037418 Bacteria 718
874 Ga0395900_1292094 3300037418 Unclassified 644
875 Ga0395900_1692724 3300037418 Bacteria 543
876 Ga0395898_0003637 3300037466 Bacteria 17137
877 Ga0395898_0006632 3300037466 Bacteria 12342
878 Ga0395898_0116024 3300037466 Bacteria 2565
879 Ga0395898_0157508 3300037466 Bacteria 2172
880 Ga0395898_0212865 3300037466 Bacteria 1843
881 Ga0395898_0668955 3300037466 Bacteria 980
882 Ga0395898_0991061 3300037466 Unclassified 776
883 Ga0395898_1093030 3300037466 Bacteria 731
884 Ga0395898_1176341 3300037466 Bacteria 698
885 Ga0395898_1605356 3300037466 Bacteria 575
886 Ga0395905_0000226 3300037471 Bacteria 85938
887 Ga0395905_0001164 3300037471 Bacteria 32823
888 Ga0395905_0009116 3300037471 Bacteria 9720
889 Ga0395905_0010087 3300037471 Bacteria 9207
890 Ga0395905_0013695 3300037471 Bacteria 7767
891 Ga0395905_0019939 3300037471 Bacteria 6354
892 Ga0395905_0035158 3300037471 Bacteria 4704
893 Ga0395905_0047368 3300037471 Bacteria 4029
894 Ga0395905_0055100 3300037471 Bacteria 3722
895 Ga0395905_0055679 3300037471 Bacteria 3701
896 Ga0395905_0057172 3300037471 Bacteria 3649
897 Ga0395905_0060505 3300037471 Bacteria 3541
898 Ga0395905_0073743 3300037471 Bacteria 3199
899 Ga0395905_0088555 3300037471 Bacteria 2901
900 Ga0395905_0089238 3300037471 Bacteria 2889
901 Ga0395905_0135203 3300037471 Bacteria 2319
902 Ga0395905_0138969 3300037471 Bacteria 2285
903 Ga0395905_0213181 3300037471 Bacteria 1809
904 Ga0395905_0248596 3300037471 Bacteria 1661
905 Ga0395905_0280336 3300037471 Bacteria 1553
906 Ga0395905_0349456 3300037471 Bacteria 1370
907 Ga0395905_0361712 3300037471 Bacteria 1344
908 Ga0395905_0777761 3300037471 Bacteria 860
909 Ga0395905_0784082 3300037471 Bacteria 856
910 Ga0395905_0827445 3300037471 Bacteria 829
911 Ga0395905_1451105 3300037471 Unclassified 590
912 Ga0395905_1543824 3300037471 Unclassified 568
913 Ga0395901_0002401 3300038443 Bacteria 19031
914 Ga0395901_0003908 3300038443 Bacteria 14995
915 Ga0395901_0012496 3300038443 Bacteria 8617
916 Ga0395901_0016592 3300038443 Bacteria 7505
917 Ga0395901_0048282 3300038443 Bacteria 4420
918 Ga0395901_0062494 3300038443 Bacteria 3875
919 Ga0395901_0141581 3300038443 Bacteria 2528
920 Ga0395901_0195423 3300038443 Bacteria 2121
921 Ga0395901_0205990 3300038443 Bacteria 2060
922 Ga0395901_0218283 3300038443 Bacteria 1994
923 Ga0395901_0219925 3300038443 Bacteria 1985
924 Ga0395901_0291865 3300038443 Bacteria 1692
925 Ga0395901_0349022 3300038443 Bacteria 1527
926 Ga0395901_0438272 3300038443 Bacteria 1338
927 Ga0395901_0475511 3300038443 Bacteria 1275
928 Ga0395901_0479076 3300038443 Bacteria 1269
929 Ga0395901_0568390 3300038443 Bacteria 1147
930 Ga0395901_1911557 3300038443 Bacteria 541
931 Ga0436365_0428348 3300039437 Bacteria 1267
932 Ga0436365_1575011 3300039437 Bacteria 17698
933 Ga0436365_1884350 3300039437 Bacteria 751
934 Ga0439465_0034100 3300041413 Bacteria 1629
935 Ga0451845_0414206 3300041501 Bacteria 775
936 Ga0439445_0079259 3300042004 Bacteria 916
937 Ga0439448_0091094 3300042005 Bacteria 1030
938 Ga0439432_010963 3300042006 Bacteria 3127
939 Ga0439432_022427 3300042006 Bacteria 2085
940 Ga0439449_0027822 3300042007 Bacteria 2109
941 Ga0439449_0278171 3300042007 Bacteria 631
942 Ga0439455_0199918 3300042012 Bacteria 578
943 Ga0439458_0042423 3300042157 Bacteria 1107
944 Ga0466969_0212953 3300044656 Bacteria 880
945 Ga0466966_0130198 3300044684 Bacteria 1541
946 Ga0466964_0666721 3300044706 Unclassified 577
947 Ga0466970_0579892 3300044765 Bacteria 650
948 Ga0466957_0748177 3300044842 Unclassified 692
949 Ga0466960_0028051 3300044901 Bacteria 2574
950 Ga0466959_0132459 3300045049 Bacteria 1766
951 Ga0495580_0453022 3300046472 Bacteria 861
952 Ga0495582_0355114 3300046473 Bacteria 844
953 Ga0495643_0223268 3300046522 Unclassified 892
954 Ga0495663_0066801 3300046525 Bacteria 1139
955 Ga0495663_0082632 3300046525 Bacteria 1037
956 Ga0495642_0074659 3300046528 Bacteria 1422
957 Ga0495598_0002306 3300046537 Bacteria 3924
958 Ga0495621_0011102 3300046539 Bacteria 2777
959 Ga0495633_0094425 3300046558 Bacteria 1390
960 Ga0495659_0112117 3300046664 Bacteria 1066
961 Ga0495669_0002275 3300046684 Bacteria 7881
962 Ga0495669_0006331 3300046684 Bacteria 4945
963 Ga0495669_0256576 3300046684 Bacteria 840
964 Ga0495670_0011308 3300046691 Bacteria 4388
965 Ga0495670_0618703 3300046691 Bacteria 590
966 Ga0495671_0439482 3300046692 Bacteria 624
967 Ga0495677_0020443 3300047445 Bacteria 2400
968 Ga0495677_0196492 3300047445 Bacteria 784
969 Ga0496100_0022281 3300048903 Bacteria 3832
970 Ga0496100_0266676 3300048903 Bacteria 1272
971 Ga0496100_0318986 3300048903 Bacteria 1167
972 Ga0496100_0556035 3300048903 Bacteria 888
973 Ga0496101_0049682 3300048904 Bacteria 3018
974 Ga0496101_0294292 3300048904 Bacteria 1271
975 Ga0496102_0161723 3300048905 Bacteria 2106
976 Ga0496102_0208593 3300048905 Bacteria 1842
977 Ga0496102_0302707 3300048905 Bacteria 1507
978 Ga0496102_1113417 3300048905 Bacteria 709
979 Ga0496103_0379844 3300048906 Bacteria 908
980 Ga0496103_0799264 3300048906 Bacteria 595
981 Ga0496103_0816550 3300048906 Bacteria 587
982 Ga0496105_0099105 3300048908 Bacteria 2406
983 Ga0496106_0446978 3300048909 Bacteria 1038
984 Ga0496106_0740003 3300048909 Bacteria 782
985 Ga0496107_0041965 3300048910 Bacteria 3286
986 Ga0496107_0046226 3300048910 Bacteria 3133
987 Ga0496107_0285552 3300048910 Bacteria 1228
988 Ga0496108_0027555 3300048911 Bacteria 4693
989 Ga0496108_0057480 3300048911 Bacteria 3268
990 Ga0496109_0000610 3300048912 Bacteria 29899
991 Ga0496109_0080365 3300048912 Bacteria 3003
992 Ga0496109_1954386 3300048912 Bacteria 519
993 Ga0496110_0042470 3300048913 Bacteria 3968
994 Ga0496110_0209938 3300048913 Bacteria 1770
995 Ga0496111_0122553 3300048914 Bacteria 1920
996 Ga0496111_0547946 3300048914 Bacteria 849
997 Ga0496112_0004014 3300048915 Bacteria 12339
998 Ga0496112_0055685 3300048915 Bacteria 3890
999 Ga0496112_0092290 3300048915 Bacteria 2997
1000 Ga0496112_0216286 3300048915 Bacteria 1873
1001 Ga0496112_0355303 3300048915 Bacteria 1407
1002 Ga0496112_0516506 3300048915 Bacteria 1129
1003 Ga0496113_0000952 3300048916 Bacteria 15412
1004 Ga0496113_0158155 3300048916 Bacteria 1790
1005 Ga0496114_0000016 3300048917 Bacteria 274656
1006 Ga0496114_0045920 3300048917 Bacteria 3629
1007 Ga0501292_112198 3300049515 Bacteria 550
1008 Ga0501298_042688 3300049521 Bacteria 923
1009 Ga0501067_0295719 3300049583 Bacteria 901
1010 Ga0501067_0707877 3300049583 Bacteria 566
1011 Ga0501068_0295564 3300049584 Bacteria 1036
1012 Ga0501069_0203005 3300049585 Bacteria 1149
1013 Ga0501069_1042432 3300049585 Bacteria 500
1014 Ga0501071_0280020 3300049587 Bacteria 1262
1015 Ga0501074_0708082 3300049590 Bacteria 711
1016 Ga0501198_055091 3300049649 Bacteria 717
1017 Ga0501202_008297 3300049652 Bacteria 1892
1018 Ga0501217_166429 3300049661 Bacteria 668
1019 Ga0501227_118849 3300049665 Bacteria 713
1020 Ga0501233_030637 3300049668 Bacteria 1214
1021 Ga0501238_027609 3300049671 Bacteria 816
1022 Ga0501243_075528 3300049675 Bacteria 647
1023 Ga0501247_018851 3300049677 Bacteria 884
1024 Ga0501257_052611 3300049686 Bacteria 1018
1025 Ga0501221_028044 3300049704 Bacteria 1156
1026 Ga0501225_0209700 3300049705 Bacteria 622
1027 Ga0501234_018058 3300049707 Bacteria 1116
1028 Ga0501080_0397204 3300049742 Bacteria 1241
1029 Ga0501262_005846 3300049759 Bacteria 1460
1030 Ga0501268_044183 3300049765 Bacteria 847
1031 Ga0501270_044020 3300049767 Bacteria 787
1032 Ga0501279_058969 3300049775 Bacteria 625
1033 Ga0501283_067293 3300049779 Bacteria 655
1034 Ga0501212_029334 3300049851 Bacteria 882
1035 nmdc:mga07m45_550703_c1 3300050496 Bacteria 667
1036 nmdc:mga0n895_681245_c1 3300050512 Bacteria 1025
1037 Ga0495655_0270679 3300053083 Bacteria 576

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025986 Ga0207658_10165199 Ga0207658_101651992 72
2 3300005345 Ga0070692_10514304 Ga0070692_105143042 87
3 3300025903 Ga0207680_10310385 Ga0207680_103103852 87
4 3300037418 Ga0395900_0744561 Ga0395900_0744561_196_495 87
5 3300005331 Ga0070670_100076532 Ga0070670_1000765323 88
6 3300005335 Ga0070666_10261028 Ga0070666_102610282 88
7 3300005355 Ga0070671_100059930 Ga0070671_1000599303 88
8 3300005366 Ga0070659_101002831 Ga0070659_1010028311 88
9 3300005457 Ga0070662_100189587 Ga0070662_1001895872 88
10 3300005543 Ga0070672_101265171 Ga0070672_1012651712 88
11 3300005618 Ga0068864_100003198 Ga0068864_1000031989 88
12 3300005841 Ga0068863_100004174 Ga0068863_1000041749 88
13 3300009177 Ga0105248_10001894 Ga0105248_1000189422 88
14 3300013306 Ga0163162_12230085 Ga0163162_122300852 88
15 3300025909 Ga0207705_11140637 Ga0207705_111406372 88
16 3300025925 Ga0207650_10052391 Ga0207650_100523912 88
17 3300025931 Ga0207644_10000052 Ga0207644_1000005219 88
18 3300025941 Ga0207711_10000420 Ga0207711_1000042030 88
19 3300026088 Ga0207641_10006363 Ga0207641_100063639 88
20 3300026095 Ga0207676_10005353 Ga0207676_100053539 88
21 3300048911 Ga0496108_0027555 Ga0496108_0027555_124_420 88
22 3300048912 Ga0496109_0000610 Ga0496109_0000610_26063_26359 88
23 3300048913 Ga0496110_0209938 Ga0496110_0209938_1446_1742 88
24 3300048915 Ga0496112_0004014 Ga0496112_0004014_98_394 88
25 3300048916 Ga0496113_0000952 Ga0496113_0000952_13498_13794 88
26 3300002239 JGI24034J26672_10032452 JGI24034J26672_100324522 89
27 3300003322 rootL2_10140508 rootL2_101405082 89
28 3300005330 Ga0070690_100006336 Ga0070690_1000063367 89
29 3300005335 Ga0070666_10005953 Ga0070666_100059539 89
30 3300005338 Ga0068868_100061889 Ga0068868_1000618893 89
31 3300005339 Ga0070660_100651836 Ga0070660_1006518362 89
32 3300005340 Ga0070689_100158173 Ga0070689_1001581732 89
33 3300005354 Ga0070675_100924480 Ga0070675_1009244802 89
34 3300005356 Ga0070674_101351730 Ga0070674_1013517302 89
35 3300005364 Ga0070673_100011732 Ga0070673_1000117325 89
36 3300005367 Ga0070667_100001311 Ga0070667_1000013112 89
37 3300005466 Ga0070685_10129542 Ga0070685_101295423 89
38 3300005543 Ga0070672_100642030 Ga0070672_1006420302 89
39 3300005544 Ga0070686_100032521 Ga0070686_1000325212 89
40 3300005578 Ga0068854_100638705 Ga0068854_1006387052 89
41 3300005616 Ga0068852_100869340 Ga0068852_1008693402 89
42 3300005617 Ga0068859_100279375 Ga0068859_1002793752 89
43 3300005618 Ga0068864_100473741 Ga0068864_1004737412 89
44 3300005718 Ga0068866_10204017 Ga0068866_102040172 89
45 3300005842 Ga0068858_100009881 Ga0068858_10000988110 89
46 3300005843 Ga0068860_100264921 Ga0068860_1002649212 89
47 3300006881 Ga0068865_101045802 Ga0068865_1010458022 89
48 3300006931 Ga0097620_100279373 Ga0097620_1002793732 89
49 3300009177 Ga0105248_10001634 Ga0105248_100016342 89
50 3300013297 Ga0157378_10191875 Ga0157378_101918752 89
51 3300013308 Ga0157375_10403985 Ga0157375_104039853 89
52 3300025321 Ga0207656_10194328 Ga0207656_101943282 89
53 3300025899 Ga0207642_10042153 Ga0207642_100421532 89
54 3300025903 Ga0207680_10002585 Ga0207680_100025859 89
55 3300025904 Ga0207647_10012986 Ga0207647_100129863 89
56 3300025907 Ga0207645_10031056 Ga0207645_100310562 89
57 3300025919 Ga0207657_10356827 Ga0207657_103568272 89
58 3300025927 Ga0207687_10893712 Ga0207687_108937121 89
59 3300025931 Ga0207644_10105072 Ga0207644_101050723 89
60 3300025936 Ga0207670_10501107 Ga0207670_105011072 89
61 3300025937 Ga0207669_10985967 Ga0207669_109859672 89
62 3300025938 Ga0207704_11156174 Ga0207704_111561741 89
63 3300025940 Ga0207691_10128425 Ga0207691_101284253 89
64 3300025941 Ga0207711_10001311 Ga0207711_100013113 89
65 3300025960 Ga0207651_10013969 Ga0207651_100139695 89
66 3300025981 Ga0207640_11370765 Ga0207640_113707652 89
67 3300025986 Ga0207658_10004807 Ga0207658_100048073 89
68 3300026023 Ga0207677_10018354 Ga0207677_100183545 89
69 3300026035 Ga0207703_10002663 Ga0207703_100026632 89
70 3300026035 Ga0207703_10079372 Ga0207703_100793725 89
71 3300026095 Ga0207676_10310404 Ga0207676_103104042 89
72 3300026142 Ga0207698_10089400 Ga0207698_100894004 89
73 3300028381 Ga0268264_10503308 Ga0268264_105033082 89
74 3300035121 Ga0373960_0338373 Ga0373960_0338373_20_319 89
75 3300042157 Ga0439458_0042423 Ga0439458_0042423_108_404 89
76 3300048915 Ga0496112_0055685 Ga0496112_0055685_341_640 89
77 3300044656 Ga0466969_0212953 Ga0466969_0212953_385_684 91
78 3300044765 Ga0466970_0579892 Ga0466970_0579892_145_444 91
79 3300044706 Ga0466964_0666721 Ga0466964_0666721_216_515 92
80 3300005366 Ga0070659_100098258 Ga0070659_1000982583 95
81 3300005614 Ga0068856_100333314 Ga0068856_1003333141 95
82 3300005937 Ga0081455_10112174 Ga0081455_101121742 95
83 3300013102 Ga0157371_10051761 Ga0157371_100517613 95
84 3300035692 Ga0373935_0002322 Ga0373935_0002322_8406_8696 95
85 3300005293 Ga0065715_11117021 Ga0065715_111170211 96
86 3300005617 Ga0068859_100067219 Ga0068859_1000672194 96
87 3300005841 Ga0068863_100720481 Ga0068863_1007204812 96
88 3300006931 Ga0097620_100067222 Ga0097620_1000672224 96
89 3300009177 Ga0105248_10055565 Ga0105248_100555656 96
90 3300014968 Ga0157379_12409262 Ga0157379_124092622 96
91 3300025936 Ga0207670_10203249 Ga0207670_102032492 96
92 3300025941 Ga0207711_10192745 Ga0207711_101927452 96
93 3300026078 Ga0207702_11818892 Ga0207702_118188921 96
94 3300026088 Ga0207641_10810568 Ga0207641_108105682 96
95 3300031852 Ga0307410_10112970 Ga0307410_101129703 96
96 3300031901 Ga0307406_10103064 Ga0307406_101030643 96
97 3300031911 Ga0307412_10873923 Ga0307412_108739232 96
98 3300031995 Ga0307409_100217944 Ga0307409_1002179443 96
99 3300031995 Ga0307409_101102104 Ga0307409_1011021042 96
100 3300032002 Ga0307416_100144033 Ga0307416_1001440333 96
101 3300037418 Ga0395900_0275184 Ga0395900_0275184_754_1059 96
102 3300037471 Ga0395905_0055100 Ga0395905_0055100_2713_3018 96
103 3300044901 Ga0466960_0028051 Ga0466960_0028051_1818_2114 96
104 3300049585 Ga0501069_1042432 Ga0501069_1042432_102_398 96
105 3300001915 JGI24741J21665_1008557 JGI24741J21665_10085573 97
106 3300001978 JGI24747J21853_1002402 JGI24747J21853_10024022 97
107 3300001979 JGI24740J21852_10047433 JGI24740J21852_100474332 97
108 3300001979 JGI24740J21852_10149131 JGI24740J21852_101491312 97
109 3300001989 JGI24739J22299_10077383 JGI24739J22299_100773832 97
110 3300001990 JGI24737J22298_10151273 JGI24737J22298_101512732 97
111 3300001990 JGI24737J22298_10207947 JGI24737J22298_102079472 97
112 3300002067 JGI24735J21928_10006140 JGI24735J21928_100061403 97
113 3300002073 JGI24745J21846_1040230 JGI24745J21846_10402302 97
114 3300002077 JGI24744J21845_10001585 JGI24744J21845_100015857 97
115 3300002459 JGI24751J29686_10025650 JGI24751J29686_100256502 97
116 3300005327 Ga0070658_10085273 Ga0070658_100852732 97
117 3300005327 Ga0070658_10163452 Ga0070658_101634523 97
118 3300005327 Ga0070658_10426509 Ga0070658_104265092 97
119 3300005327 Ga0070658_10592463 Ga0070658_105924632 97
120 3300005327 Ga0070658_11177287 Ga0070658_111772871 97
121 3300005327 Ga0070658_11330146 Ga0070658_113301462 97
122 3300005328 Ga0070676_10015404 Ga0070676_100154042 97
123 3300005328 Ga0070676_10016027 Ga0070676_100160272 97
124 3300005329 Ga0070683_100211431 Ga0070683_1002114313 97
125 3300005329 Ga0070683_100428494 Ga0070683_1004284942 97
126 3300005329 Ga0070683_101088629 Ga0070683_1010886292 97
127 3300005330 Ga0070690_100173019 Ga0070690_1001730192 97
128 3300005330 Ga0070690_100536979 Ga0070690_1005369792 97
129 3300005331 Ga0070670_100014982 Ga0070670_1000149822 97
130 3300005331 Ga0070670_100080502 Ga0070670_1000805024 97
131 3300005331 Ga0070670_100142924 Ga0070670_1001429242 97
132 3300005331 Ga0070670_101937482 Ga0070670_1019374821 97
133 3300005333 Ga0070677_10017057 Ga0070677_100170572 97
134 3300005334 Ga0068869_100086966 Ga0068869_1000869663 97
135 3300005335 Ga0070666_10048049 Ga0070666_100480492 97
136 3300005335 Ga0070666_10397347 Ga0070666_103973472 97
137 3300005335 Ga0070666_10437209 Ga0070666_104372092 97
138 3300005335 Ga0070666_10949706 Ga0070666_109497061 97
139 3300005336 Ga0070680_101964372 Ga0070680_1019643721 97
140 3300005337 Ga0070682_100074295 Ga0070682_1000742952 97
141 3300005337 Ga0070682_100471395 Ga0070682_1004713951 97
142 3300005338 Ga0068868_100015245 Ga0068868_1000152456 97
143 3300005338 Ga0068868_100064262 Ga0068868_1000642622 97
144 3300005338 Ga0068868_100490199 Ga0068868_1004901992 97
145 3300005338 Ga0068868_100499257 Ga0068868_1004992572 97
146 3300005339 Ga0070660_100016614 Ga0070660_1000166142 97
147 3300005339 Ga0070660_100028293 Ga0070660_1000282933 97
148 3300005339 Ga0070660_100064071 Ga0070660_1000640713 97
149 3300005339 Ga0070660_100072385 Ga0070660_1000723854 97
150 3300005339 Ga0070660_100277699 Ga0070660_1002776992 97
151 3300005339 Ga0070660_101339846 Ga0070660_1013398462 97
152 3300005339 Ga0070660_101795208 Ga0070660_1017952082 97
153 3300005341 Ga0070691_10658536 Ga0070691_106585361 97
154 3300005344 Ga0070661_100034708 Ga0070661_1000347084 97
155 3300005344 Ga0070661_100036795 Ga0070661_1000367955 97
156 3300005344 Ga0070661_100069996 Ga0070661_1000699961 97
157 3300005344 Ga0070661_100129254 Ga0070661_1001292543 97
158 3300005344 Ga0070661_100303823 Ga0070661_1003038232 97
159 3300005344 Ga0070661_100504222 Ga0070661_1005042222 97
160 3300005345 Ga0070692_10278260 Ga0070692_102782602 97
161 3300005347 Ga0070668_102037572 Ga0070668_1020375721 97
162 3300005353 Ga0070669_100452609 Ga0070669_1004526092 97
163 3300005353 Ga0070669_100966435 Ga0070669_1009664352 97
164 3300005354 Ga0070675_100180001 Ga0070675_1001800012 97
165 3300005354 Ga0070675_100210201 Ga0070675_1002102012 97
166 3300005355 Ga0070671_100033206 Ga0070671_1000332063 97
167 3300005355 Ga0070671_100259607 Ga0070671_1002596072 97
168 3300005355 Ga0070671_100306390 Ga0070671_1003063902 97
169 3300005356 Ga0070674_100026956 Ga0070674_1000269564 97
170 3300005356 Ga0070674_100389875 Ga0070674_1003898752 97
171 3300005364 Ga0070673_100114366 Ga0070673_1001143663 97
172 3300005364 Ga0070673_100155841 Ga0070673_1001558412 97
173 3300005364 Ga0070673_100376767 Ga0070673_1003767672 97
174 3300005366 Ga0070659_100061929 Ga0070659_1000619294 97
175 3300005366 Ga0070659_100066651 Ga0070659_1000666512 97
176 3300005366 Ga0070659_100083062 Ga0070659_1000830622 97
177 3300005366 Ga0070659_100482086 Ga0070659_1004820862 97
178 3300005366 Ga0070659_101427693 Ga0070659_1014276931 97
179 3300005366 Ga0070659_101650748 Ga0070659_1016507481 97
180 3300005367 Ga0070667_100025802 Ga0070667_1000258023 97
181 3300005367 Ga0070667_100065494 Ga0070667_1000654944 97
182 3300005367 Ga0070667_101376340 Ga0070667_1013763402 97
183 3300005434 Ga0070709_10081361 Ga0070709_100813612 97
184 3300005435 Ga0070714_100252100 Ga0070714_1002521002 97
185 3300005436 Ga0070713_100202477 Ga0070713_1002024772 97
186 3300005438 Ga0070701_10395867 Ga0070701_103958672 97
187 3300005439 Ga0070711_101876006 Ga0070711_1018760062 97
188 3300005455 Ga0070663_100010764 Ga0070663_1000107645 97
189 3300005455 Ga0070663_100020658 Ga0070663_1000206585 97
190 3300005455 Ga0070663_100093271 Ga0070663_1000932712 97
191 3300005455 Ga0070663_100271906 Ga0070663_1002719062 97
192 3300005455 Ga0070663_100387113 Ga0070663_1003871132 97
193 3300005455 Ga0070663_100391081 Ga0070663_1003910812 97
194 3300005455 Ga0070663_100561215 Ga0070663_1005612152 97
195 3300005455 Ga0070663_101402024 Ga0070663_1014020242 97
196 3300005456 Ga0070678_100002490 Ga0070678_1000024902 97
197 3300005456 Ga0070678_100206575 Ga0070678_1002065752 97
198 3300005456 Ga0070678_100344490 Ga0070678_1003444902 97
199 3300005457 Ga0070662_100004959 Ga0070662_1000049592 97
200 3300005457 Ga0070662_100014122 Ga0070662_1000141225 97
201 3300005457 Ga0070662_100058911 Ga0070662_1000589114 97
202 3300005457 Ga0070662_100078053 Ga0070662_1000780533 97
203 3300005457 Ga0070662_100294846 Ga0070662_1002948462 97
204 3300005457 Ga0070662_100653742 Ga0070662_1006537421 97
205 3300005458 Ga0070681_10288180 Ga0070681_102881802 97
206 3300005458 Ga0070681_11016448 Ga0070681_110164482 97
207 3300005459 Ga0068867_100022766 Ga0068867_1000227662 97
208 3300005459 Ga0068867_100368578 Ga0068867_1003685782 97
209 3300005459 Ga0068867_101331753 Ga0068867_1013317531 97
210 3300005530 Ga0070679_100019156 Ga0070679_1000191563 97
211 3300005530 Ga0070679_100174555 Ga0070679_1001745553 97
212 3300005530 Ga0070679_100372922 Ga0070679_1003729222 97
213 3300005530 Ga0070679_100754260 Ga0070679_1007542601 97
214 3300005530 Ga0070679_101353121 Ga0070679_1013531211 97
215 3300005539 Ga0068853_100025405 Ga0068853_1000254052 97
216 3300005539 Ga0068853_100387060 Ga0068853_1003870602 97
217 3300005539 Ga0068853_100469235 Ga0068853_1004692352 97
218 3300005539 Ga0068853_100522702 Ga0068853_1005227022 97
219 3300005539 Ga0068853_101155853 Ga0068853_1011558532 97
220 3300005539 Ga0068853_101483083 Ga0068853_1014830831 97
221 3300005539 Ga0068853_101643763 Ga0068853_1016437632 97
222 3300005543 Ga0070672_100003335 Ga0070672_10000333510 97
223 3300005543 Ga0070672_101549882 Ga0070672_1015498821 97
224 3300005547 Ga0070693_100425669 Ga0070693_1004256692 97
225 3300005548 Ga0070665_100019750 Ga0070665_1000197503 97
226 3300005563 Ga0068855_100377383 Ga0068855_1003773832 97
227 3300005563 Ga0068855_100994134 Ga0068855_1009941342 97
228 3300005564 Ga0070664_100005488 Ga0070664_10000548810 97
229 3300005564 Ga0070664_100010804 Ga0070664_1000108048 97
230 3300005564 Ga0070664_100073402 Ga0070664_1000734022 97
231 3300005564 Ga0070664_100088706 Ga0070664_1000887062 97
232 3300005564 Ga0070664_100286767 Ga0070664_1002867672 97
233 3300005564 Ga0070664_100734566 Ga0070664_1007345662 97
234 3300005564 Ga0070664_102197857 Ga0070664_1021978572 97
235 3300005577 Ga0068857_100126060 Ga0068857_1001260603 97
236 3300005577 Ga0068857_100151220 Ga0068857_1001512201 97
237 3300005577 Ga0068857_100315172 Ga0068857_1003151722 97
238 3300005578 Ga0068854_100020300 Ga0068854_1000203003 97
239 3300005578 Ga0068854_100047329 Ga0068854_1000473293 97
240 3300005578 Ga0068854_100074929 Ga0068854_1000749292 97
241 3300005578 Ga0068854_100165138 Ga0068854_1001651382 97
242 3300005578 Ga0068854_100275076 Ga0068854_1002750762 97
243 3300005578 Ga0068854_100884689 Ga0068854_1008846892 97
244 3300005614 Ga0068856_100185923 Ga0068856_1001859232 97
245 3300005614 Ga0068856_100323893 Ga0068856_1003238932 97
246 3300005614 Ga0068856_101618028 Ga0068856_1016180282 97
247 3300005614 Ga0068856_102449087 Ga0068856_1024490871 97
248 3300005616 Ga0068852_100035258 Ga0068852_1000352585 97
249 3300005616 Ga0068852_100045745 Ga0068852_1000457452 97
250 3300005616 Ga0068852_100122683 Ga0068852_1001226834 97
251 3300005616 Ga0068852_100182868 Ga0068852_1001828682 97
252 3300005616 Ga0068852_100310680 Ga0068852_1003106802 97
253 3300005616 Ga0068852_100471672 Ga0068852_1004716722 97
254 3300005616 Ga0068852_100566468 Ga0068852_1005664682 97
255 3300005617 Ga0068859_100186379 Ga0068859_1001863793 97
256 3300005617 Ga0068859_101433960 Ga0068859_1014339602 97
257 3300005718 Ga0068866_10023764 Ga0068866_100237643 97
258 3300005718 Ga0068866_10026409 Ga0068866_100264093 97
259 3300005718 Ga0068866_10339675 Ga0068866_103396752 97
260 3300005719 Ga0068861_100754928 Ga0068861_1007549282 97
261 3300005719 Ga0068861_101503858 Ga0068861_1015038582 97
262 3300005719 Ga0068861_101728555 Ga0068861_1017285552 97
263 3300005834 Ga0068851_10052156 Ga0068851_100521563 97
264 3300005834 Ga0068851_10068571 Ga0068851_100685713 97
265 3300005834 Ga0068851_10091247 Ga0068851_100912472 97
266 3300005841 Ga0068863_100003336 Ga0068863_10000333610 97
267 3300005841 Ga0068863_100503547 Ga0068863_1005035472 97
268 3300005842 Ga0068858_100024491 Ga0068858_1000244916 97
269 3300005842 Ga0068858_100551693 Ga0068858_1005516932 97
270 3300005844 Ga0068862_100889838 Ga0068862_1008898382 97
271 3300006028 Ga0070717_11321974 Ga0070717_113219742 97
272 3300006173 Ga0070716_100237612 Ga0070716_1002376122 97
273 3300006175 Ga0070712_100043513 Ga0070712_1000435132 97
274 3300006175 Ga0070712_100199713 Ga0070712_1001997132 97
275 3300006237 Ga0097621_100036057 Ga0097621_1000360573 97
276 3300006237 Ga0097621_100200994 Ga0097621_1002009942 97
277 3300006358 Ga0068871_100200469 Ga0068871_1002004692 97
278 3300006358 Ga0068871_100460286 Ga0068871_1004602861 97
279 3300006871 Ga0075434_100306851 Ga0075434_1003068511 97
280 3300006881 Ga0068865_100072973 Ga0068865_1000729733 97
281 3300006881 Ga0068865_100615315 Ga0068865_1006153152 97
282 3300006881 Ga0068865_100978046 Ga0068865_1009780462 97
283 3300006931 Ga0097620_100186370 Ga0097620_1001863702 97
284 3300006931 Ga0097620_101433801 Ga0097620_1014338012 97
285 3300009036 Ga0105244_10507981 Ga0105244_105079812 97
286 3300009098 Ga0105245_10019606 Ga0105245_100196065 97
287 3300009098 Ga0105245_10023282 Ga0105245_100232826 97
288 3300009098 Ga0105245_11610038 Ga0105245_116100381 97
289 3300009148 Ga0105243_10592442 Ga0105243_105924422 97
290 3300009174 Ga0105241_10685630 Ga0105241_106856302 97
291 3300009174 Ga0105241_11342443 Ga0105241_113424432 97
292 3300009176 Ga0105242_10155550 Ga0105242_101555501 97
293 3300009177 Ga0105248_10002448 Ga0105248_1000244815 97
294 3300009177 Ga0105248_10026794 Ga0105248_100267942 97
295 3300009177 Ga0105248_10052041 Ga0105248_100520416 97
296 3300009551 Ga0105238_10324553 Ga0105238_103245532 97
297 3300009553 Ga0105249_10261845 Ga0105249_102618452 97
298 3300010375 Ga0105239_11448792 Ga0105239_114487922 97
299 3300011119 Ga0105246_10064694 Ga0105246_100646944 97
300 3300013100 Ga0157373_10173185 Ga0157373_101731852 97
301 3300013100 Ga0157373_10368773 Ga0157373_103687732 97
302 3300013102 Ga0157371_10053945 Ga0157371_100539452 97
303 3300013102 Ga0157371_10225171 Ga0157371_102251712 97
304 3300013102 Ga0157371_10257009 Ga0157371_102570092 97
305 3300013102 Ga0157371_10357931 Ga0157371_103579311 97
306 3300013102 Ga0157371_10472897 Ga0157371_104728971 97
307 3300013104 Ga0157370_10167170 Ga0157370_101671703 97
308 3300013104 Ga0157370_10957146 Ga0157370_109571462 97
309 3300013105 Ga0157369_10153643 Ga0157369_101536433 97
310 3300013105 Ga0157369_10462082 Ga0157369_104620822 97
311 3300013296 Ga0157374_10159797 Ga0157374_101597972 97
312 3300013296 Ga0157374_10197873 Ga0157374_101978733 97
313 3300013296 Ga0157374_11582747 Ga0157374_115827472 97
314 3300013296 Ga0157374_11988145 Ga0157374_119881452 97
315 3300013297 Ga0157378_10268195 Ga0157378_102681952 97
316 3300013297 Ga0157378_10535647 Ga0157378_105356472 97
317 3300013306 Ga0163162_10000768 Ga0163162_1000076823 97
318 3300013306 Ga0163162_10128812 Ga0163162_101288122 97
319 3300013307 Ga0157372_10591808 Ga0157372_105918082 97
320 3300013307 Ga0157372_10890480 Ga0157372_108904802 97
321 3300013307 Ga0157372_10917523 Ga0157372_109175232 97
322 3300013308 Ga0157375_10005630 Ga0157375_100056302 97
323 3300013308 Ga0157375_10213250 Ga0157375_102132503 97
324 3300014325 Ga0163163_10206336 Ga0163163_102063362 97
325 3300014326 Ga0157380_12285446 Ga0157380_122854461 97
326 3300017792 Ga0163161_10328102 Ga0163161_103281022 97
327 3300017792 Ga0163161_10368541 Ga0163161_103685412 97
328 3300021384 Ga0213876_10023631 Ga0213876_100236312 97
329 3300021384 Ga0213876_10077576 Ga0213876_100775763 97
330 3300025315 Ga0207697_10011452 Ga0207697_100114525 97
331 3300025321 Ga0207656_10130030 Ga0207656_101300302 97
332 3300025321 Ga0207656_10173642 Ga0207656_101736422 97
333 3300025321 Ga0207656_10321154 Ga0207656_103211542 97
334 3300025893 Ga0207682_10004204 Ga0207682_100042043 97
335 3300025899 Ga0207642_10007391 Ga0207642_100073913 97
336 3300025899 Ga0207642_10164071 Ga0207642_101640712 97
337 3300025899 Ga0207642_10270163 Ga0207642_102701632 97
338 3300025901 Ga0207688_10126250 Ga0207688_101262502 97
339 3300025901 Ga0207688_10129436 Ga0207688_101294362 97
340 3300025903 Ga0207680_11234789 Ga0207680_112347891 97
341 3300025903 Ga0207680_11242879 Ga0207680_112428791 97
342 3300025904 Ga0207647_10050442 Ga0207647_100504423 97
343 3300025904 Ga0207647_10065670 Ga0207647_100656703 97
344 3300025904 Ga0207647_10302630 Ga0207647_103026302 97
345 3300025906 Ga0207699_10146761 Ga0207699_101467612 97
346 3300025907 Ga0207645_10020823 Ga0207645_100208235 97
347 3300025907 Ga0207645_10046178 Ga0207645_100461784 97
348 3300025907 Ga0207645_10762584 Ga0207645_107625842 97
349 3300025907 Ga0207645_11026039 Ga0207645_110260392 97
350 3300025909 Ga0207705_10003597 Ga0207705_100035978 97
351 3300025909 Ga0207705_10004771 Ga0207705_1000477113 97
352 3300025909 Ga0207705_10131333 Ga0207705_101313332 97
353 3300025909 Ga0207705_10180650 Ga0207705_101806502 97
354 3300025909 Ga0207705_10799219 Ga0207705_107992192 97
355 3300025911 Ga0207654_11216505 Ga0207654_112165052 97
356 3300025912 Ga0207707_10150276 Ga0207707_101502762 97
357 3300025912 Ga0207707_10476500 Ga0207707_104765001 97
358 3300025915 Ga0207693_10014544 Ga0207693_100145442 97
359 3300025918 Ga0207662_10207392 Ga0207662_102073922 97
360 3300025918 Ga0207662_10974084 Ga0207662_109740842 97
361 3300025919 Ga0207657_10002813 Ga0207657_1000281311 97
362 3300025919 Ga0207657_10024081 Ga0207657_100240813 97
363 3300025919 Ga0207657_10040928 Ga0207657_100409284 97
364 3300025919 Ga0207657_10042145 Ga0207657_100421452 97
365 3300025919 Ga0207657_10102994 Ga0207657_101029942 97
366 3300025919 Ga0207657_10124050 Ga0207657_101240503 97
367 3300025919 Ga0207657_10268630 Ga0207657_102686302 97
368 3300025919 Ga0207657_10958389 Ga0207657_109583892 97
369 3300025920 Ga0207649_10011041 Ga0207649_100110414 97
370 3300025920 Ga0207649_10027276 Ga0207649_100272762 97
371 3300025920 Ga0207649_10034090 Ga0207649_100340901 97
372 3300025920 Ga0207649_10060338 Ga0207649_100603382 97
373 3300025920 Ga0207649_10129581 Ga0207649_101295812 97
374 3300025920 Ga0207649_10287679 Ga0207649_102876792 97
375 3300025920 Ga0207649_10307304 Ga0207649_103073042 97
376 3300025920 Ga0207649_11694553 Ga0207649_116945531 97
377 3300025921 Ga0207652_10122947 Ga0207652_101229473 97
378 3300025921 Ga0207652_10143490 Ga0207652_101434903 97
379 3300025921 Ga0207652_10454642 Ga0207652_104546422 97
380 3300025923 Ga0207681_10336792 Ga0207681_103367922 97
381 3300025923 Ga0207681_10418805 Ga0207681_104188052 97
382 3300025925 Ga0207650_10002948 Ga0207650_1000294810 97
383 3300025925 Ga0207650_10043580 Ga0207650_100435803 97
384 3300025925 Ga0207650_10107594 Ga0207650_101075942 97
385 3300025925 Ga0207650_10227661 Ga0207650_102276613 97
386 3300025925 Ga0207650_11421791 Ga0207650_114217911 97
387 3300025926 Ga0207659_10085108 Ga0207659_100851083 97
388 3300025927 Ga0207687_10012657 Ga0207687_100126576 97
389 3300025927 Ga0207687_10035715 Ga0207687_100357153 97
390 3300025931 Ga0207644_10017678 Ga0207644_100176784 97
391 3300025931 Ga0207644_10209244 Ga0207644_102092442 97
392 3300025931 Ga0207644_10259752 Ga0207644_102597522 97
393 3300025931 Ga0207644_10761302 Ga0207644_107613022 97
394 3300025932 Ga0207690_10013275 Ga0207690_100132753 97
395 3300025932 Ga0207690_10049022 Ga0207690_100490222 97
396 3300025932 Ga0207690_10109546 Ga0207690_101095462 97
397 3300025932 Ga0207690_10199876 Ga0207690_101998762 97
398 3300025932 Ga0207690_10427935 Ga0207690_104279352 97
399 3300025932 Ga0207690_11496497 Ga0207690_114964972 97
400 3300025933 Ga0207706_10000614 Ga0207706_1000061420 97
401 3300025933 Ga0207706_10007215 Ga0207706_100072154 97
402 3300025933 Ga0207706_10040584 Ga0207706_100405843 97
403 3300025933 Ga0207706_10048431 Ga0207706_100484312 97
404 3300025933 Ga0207706_10124972 Ga0207706_101249723 97
405 3300025933 Ga0207706_10680466 Ga0207706_106804662 97
406 3300025937 Ga0207669_10410156 Ga0207669_104101562 97
407 3300025937 Ga0207669_10556401 Ga0207669_105564012 97
408 3300025938 Ga0207704_10138617 Ga0207704_101386172 97
409 3300025938 Ga0207704_10292820 Ga0207704_102928202 97
410 3300025939 Ga0207665_10565645 Ga0207665_105656452 97
411 3300025940 Ga0207691_10000998 Ga0207691_1000099819 97
412 3300025940 Ga0207691_10071125 Ga0207691_100711253 97
413 3300025940 Ga0207691_11150273 Ga0207691_111502731 97
414 3300025941 Ga0207711_10003129 Ga0207711_100031298 97
415 3300025941 Ga0207711_10011832 Ga0207711_100118325 97
416 3300025942 Ga0207689_10033251 Ga0207689_100332515 97
417 3300025944 Ga0207661_10224509 Ga0207661_102245093 97
418 3300025945 Ga0207679_10025671 Ga0207679_100256713 97
419 3300025945 Ga0207679_10034407 Ga0207679_100344075 97
420 3300025945 Ga0207679_10092592 Ga0207679_100925922 97
421 3300025945 Ga0207679_10183638 Ga0207679_101836382 97
422 3300025945 Ga0207679_10295415 Ga0207679_102954153 97
423 3300025945 Ga0207679_10961685 Ga0207679_109616852 97
424 3300025949 Ga0207667_10500052 Ga0207667_105000522 97
425 3300025960 Ga0207651_10000652 Ga0207651_100006529 97
426 3300025960 Ga0207651_10654794 Ga0207651_106547942 97
427 3300025960 Ga0207651_11281837 Ga0207651_112818372 97
428 3300025961 Ga0207712_11482182 Ga0207712_114821822 97
429 3300025972 Ga0207668_10219539 Ga0207668_102195392 97
430 3300025981 Ga0207640_10057391 Ga0207640_100573913 97
431 3300025981 Ga0207640_10175109 Ga0207640_101751092 97
432 3300025981 Ga0207640_10209652 Ga0207640_102096522 97
433 3300025981 Ga0207640_10832447 Ga0207640_108324472 97
434 3300025981 Ga0207640_11607904 Ga0207640_116079042 97
435 3300025986 Ga0207658_10038494 Ga0207658_100384943 97
436 3300025986 Ga0207658_10123783 Ga0207658_101237832 97
437 3300025986 Ga0207658_10654966 Ga0207658_106549662 97
438 3300025986 Ga0207658_11098034 Ga0207658_110980342 97
439 3300026023 Ga0207677_10003117 Ga0207677_100031176 97
440 3300026023 Ga0207677_10072056 Ga0207677_100720562 97
441 3300026023 Ga0207677_10679258 Ga0207677_106792582 97
442 3300026035 Ga0207703_10031952 Ga0207703_100319524 97
443 3300026041 Ga0207639_10117021 Ga0207639_101170212 97
444 3300026041 Ga0207639_10230713 Ga0207639_102307132 97
445 3300026041 Ga0207639_10555240 Ga0207639_105552402 97
446 3300026041 Ga0207639_10622591 Ga0207639_106225912 97
447 3300026041 Ga0207639_10716064 Ga0207639_107160642 97
448 3300026041 Ga0207639_11194175 Ga0207639_111941752 97
449 3300026067 Ga0207678_10006831 Ga0207678_100068313 97
450 3300026067 Ga0207678_10020241 Ga0207678_100202413 97
451 3300026067 Ga0207678_10040138 Ga0207678_100401385 97
452 3300026067 Ga0207678_10129505 Ga0207678_101295052 97
453 3300026067 Ga0207678_10143668 Ga0207678_101436683 97
454 3300026067 Ga0207678_10170926 Ga0207678_101709263 97
455 3300026067 Ga0207678_10216460 Ga0207678_102164602 97
456 3300026067 Ga0207678_10265351 Ga0207678_102653512 97
457 3300026078 Ga0207702_10993495 Ga0207702_109934952 97
458 3300026078 Ga0207702_11535377 Ga0207702_115353772 97
459 3300026078 Ga0207702_12287974 Ga0207702_122879742 97
460 3300026088 Ga0207641_10092172 Ga0207641_100921722 97
461 3300026088 Ga0207641_11232560 Ga0207641_112325602 97
462 3300026089 Ga0207648_10016503 Ga0207648_1001650310 97
463 3300026089 Ga0207648_10057138 Ga0207648_100571382 97
464 3300026089 Ga0207648_10358818 Ga0207648_103588182 97
465 3300026095 Ga0207676_10045938 Ga0207676_100459383 97
466 3300026116 Ga0207674_10006741 Ga0207674_100067418 97
467 3300026116 Ga0207674_10154256 Ga0207674_101542561 97
468 3300026116 Ga0207674_10173540 Ga0207674_101735403 97
469 3300026118 Ga0207675_100147851 Ga0207675_1001478513 97
470 3300026121 Ga0207683_10000846 Ga0207683_1000084610 97
471 3300026121 Ga0207683_10106035 Ga0207683_101060352 97
472 3300026121 Ga0207683_10177759 Ga0207683_101777593 97
473 3300026142 Ga0207698_10078193 Ga0207698_100781933 97
474 3300026142 Ga0207698_10147231 Ga0207698_101472313 97
475 3300026142 Ga0207698_10149172 Ga0207698_101491722 97
476 3300026142 Ga0207698_10232933 Ga0207698_102329332 97
477 3300026142 Ga0207698_10245977 Ga0207698_102459772 97
478 3300026142 Ga0207698_10355606 Ga0207698_103556062 97
479 3300026142 Ga0207698_10508813 Ga0207698_105088132 97
480 3300026142 Ga0207698_11361809 Ga0207698_113618092 97
481 3300028380 Ga0268265_11085440 Ga0268265_110854402 97
482 3300028381 Ga0268264_10641038 Ga0268264_106410382 97
483 3300031548 Ga0307408_100336708 Ga0307408_1003367082 97
484 3300031731 Ga0307405_10025754 Ga0307405_100257542 97
485 3300031731 Ga0307405_10414443 Ga0307405_104144431 97
486 3300031731 Ga0307405_10591326 Ga0307405_105913262 97
487 3300031824 Ga0307413_10140181 Ga0307413_101401812 97
488 3300031852 Ga0307410_10047487 Ga0307410_100474872 97
489 3300031903 Ga0307407_10082056 Ga0307407_100820563 97
490 3300031911 Ga0307412_10062941 Ga0307412_100629412 97
491 3300031911 Ga0307412_10669854 Ga0307412_106698542 97
492 3300031995 Ga0307409_100186308 Ga0307409_1001863082 97
493 3300031995 Ga0307409_100343324 Ga0307409_1003433242 97
494 3300031995 Ga0307409_100637213 Ga0307409_1006372132 97
495 3300032002 Ga0307416_100018217 Ga0307416_1000182172 97
496 3300032002 Ga0307416_100530778 Ga0307416_1005307782 97
497 3300032004 Ga0307414_10102821 Ga0307414_101028212 97
498 3300032005 Ga0307411_10032660 Ga0307411_100326602 97
499 3300032126 Ga0307415_100035303 Ga0307415_1000353034 97
500 3300032126 Ga0307415_100172906 Ga0307415_1001729061 97
501 3300032126 Ga0307415_101124989 Ga0307415_1011249892 97
502 3300035085 Ga0373929_0018067 Ga0373929_0018067_513_824 97
503 3300035114 Ga0373939_0095605 Ga0373939_0095605_293_604 97
504 3300035121 Ga0373960_0157523 Ga0373960_0157523_204_503 97
505 3300035170 Ga0373943_0029916 Ga0373943_0029916_969_1268 97
506 3300035695 Ga0373927_0155573 Ga0373927_0155573_429_728 97
507 3300035725 Ga0373947_0250366 Ga0373947_0250366_596_895 97
508 3300037068 Ga0373925_0044348 Ga0373925_0044348_903_1202 97
509 3300037312 Ga0395899_0017806 Ga0395899_0017806_918_1217 97
510 3300037312 Ga0395899_0108787 Ga0395899_0108787_141_440 97
511 3300037312 Ga0395899_0239494 Ga0395899_0239494_557_856 97
512 3300037312 Ga0395899_0263495 Ga0395899_0263495_155_454 97
513 3300037418 Ga0395900_0089574 Ga0395900_0089574_2506_2805 97
514 3300037418 Ga0395900_0244780 Ga0395900_0244780_1369_1668 97
515 3300037418 Ga0395900_0448047 Ga0395900_0448047_891_1190 97
516 3300037418 Ga0395900_1292094 Ga0395900_1292094_13_312 97
517 3300037418 Ga0395900_1692724 Ga0395900_1692724_155_454 97
518 3300037466 Ga0395898_0116024 Ga0395898_0116024_1743_2042 97
519 3300037466 Ga0395898_0157508 Ga0395898_0157508_555_854 97
520 3300037466 Ga0395898_1093030 Ga0395898_1093030_123_422 97
521 3300037471 Ga0395905_0000226 Ga0395905_0000226_35635_35934 97
522 3300037471 Ga0395905_0019939 Ga0395905_0019939_2285_2584 97
523 3300037471 Ga0395905_0035158 Ga0395905_0035158_3781_4080 97
524 3300037471 Ga0395905_0073743 Ga0395905_0073743_859_1158 97
525 3300037471 Ga0395905_0135203 Ga0395905_0135203_258_557 97
526 3300037471 Ga0395905_0138969 Ga0395905_0138969_1719_2018 97
527 3300037471 Ga0395905_0349456 Ga0395905_0349456_513_812 97
528 3300037471 Ga0395905_0361712 Ga0395905_0361712_638_937 97
529 3300037471 Ga0395905_0777761 Ga0395905_0777761_413_712 97
530 3300037471 Ga0395905_0827445 Ga0395905_0827445_216_515 97
531 3300038443 Ga0395901_0195423 Ga0395901_0195423_900_1199 97
532 3300038443 Ga0395901_0219925 Ga0395901_0219925_1161_1460 97
533 3300038443 Ga0395901_0349022 Ga0395901_0349022_1062_1361 97
534 3300038443 Ga0395901_1911557 Ga0395901_1911557_153_452 97
535 3300039437 Ga0436365_0428348 Ga0436365_0428348_454_753 97
536 3300039437 Ga0436365_1575011 Ga0436365_1575011_6078_6377 97
537 3300044842 Ga0466957_0748177 Ga0466957_0748177_104_409 97
538 3300046472 Ga0495580_0453022 Ga0495580_0453022_56_355 97
539 3300046691 Ga0495670_0618703 Ga0495670_0618703_230_529 97
540 3300046692 Ga0495671_0439482 Ga0495671_0439482_195_494 97
541 3300048903 Ga0496100_0022281 Ga0496100_0022281_3494_3793 97
542 3300048903 Ga0496100_0318986 Ga0496100_0318986_30_335 97
543 3300048904 Ga0496101_0049682 Ga0496101_0049682_1602_1901 97
544 3300048904 Ga0496101_0294292 Ga0496101_0294292_801_1106 97
545 3300048905 Ga0496102_0161723 Ga0496102_0161723_138_437 97
546 3300048905 Ga0496102_0208593 Ga0496102_0208593_1068_1373 97
547 3300048905 Ga0496102_0302707 Ga0496102_0302707_764_1060 97
548 3300048906 Ga0496103_0379844 Ga0496103_0379844_423_722 97
549 3300048906 Ga0496103_0799264 Ga0496103_0799264_285_584 97
550 3300048906 Ga0496103_0816550 Ga0496103_0816550_177_473 97
551 3300048908 Ga0496105_0099105 Ga0496105_0099105_1678_1977 97
552 3300048909 Ga0496106_0446978 Ga0496106_0446978_341_640 97
553 3300048910 Ga0496107_0041965 Ga0496107_0041965_2230_2529 97
554 3300048910 Ga0496107_0046226 Ga0496107_0046226_1071_1376 97
555 3300048910 Ga0496107_0285552 Ga0496107_0285552_335_631 97
556 3300048911 Ga0496108_0057480 Ga0496108_0057480_1073_1378 97
557 3300048912 Ga0496109_0080365 Ga0496109_0080365_1473_1778 97
558 3300048913 Ga0496110_0042470 Ga0496110_0042470_2414_2719 97
559 3300048914 Ga0496111_0122553 Ga0496111_0122553_352_657 97
560 3300048914 Ga0496111_0547946 Ga0496111_0547946_187_492 97
561 3300048915 Ga0496112_0092290 Ga0496112_0092290_1520_1825 97
562 3300048915 Ga0496112_0216286 Ga0496112_0216286_411_716 97
563 3300048915 Ga0496112_0516506 Ga0496112_0516506_200_496 97
564 3300048916 Ga0496113_0158155 Ga0496113_0158155_798_1103 97
565 3300048917 Ga0496114_0000016 Ga0496114_0000016_196189_196488 97
566 3300048917 Ga0496114_0045920 Ga0496114_0045920_2932_3231 97
567 3300049583 Ga0501067_0295719 Ga0501067_0295719_576_875 97
568 3300049583 Ga0501067_0707877 Ga0501067_0707877_172_471 97
569 3300049584 Ga0501068_0295564 Ga0501068_0295564_114_413 97
570 3300049585 Ga0501069_0203005 Ga0501069_0203005_770_1069 97
571 3300050512 nmdc:mga0n895_681245_c1 nmdc:mga0n895_681245_c1_641_940 97
572 3300001904 JGI24736J21556_1020912 JGI24736J21556_10209122 98
573 3300001915 JGI24741J21665_1008594 JGI24741J21665_10085943 98
574 3300001978 JGI24747J21853_1011601 JGI24747J21853_10116012 98
575 3300001979 JGI24740J21852_10009374 JGI24740J21852_100093745 98
576 3300001989 JGI24739J22299_10084372 JGI24739J22299_100843722 98
577 3300001990 JGI24737J22298_10007721 JGI24737J22298_100077213 98
578 3300001990 JGI24737J22298_10019478 JGI24737J22298_100194783 98
579 3300001991 JGI24743J22301_10002872 JGI24743J22301_100028724 98
580 3300001991 JGI24743J22301_10017326 JGI24743J22301_100173262 98
581 3300002067 JGI24735J21928_10101212 JGI24735J21928_101012122 98
582 3300002067 JGI24735J21928_10214129 JGI24735J21928_102141292 98
583 3300002075 JGI24738J21930_10046291 JGI24738J21930_100462912 98
584 3300002077 JGI24744J21845_10077148 JGI24744J21845_100771482 98
585 3300002244 JGI24742J22300_10021446 JGI24742J22300_100214462 98
586 3300002459 JGI24751J29686_10083501 JGI24751J29686_100835011 98
587 3300003203 JGI25406J46586_10057619 JGI25406J46586_100576192 98
588 3300005293 Ga0065715_10432613 Ga0065715_104326131 98
589 3300005327 Ga0070658_10066207 Ga0070658_100662073 98
590 3300005327 Ga0070658_10075391 Ga0070658_100753913 98
591 3300005327 Ga0070658_10165847 Ga0070658_101658473 98
592 3300005327 Ga0070658_10272833 Ga0070658_102728333 98
593 3300005328 Ga0070676_10110959 Ga0070676_101109592 98
594 3300005328 Ga0070676_10461999 Ga0070676_104619992 98
595 3300005329 Ga0070683_100038899 Ga0070683_1000388993 98
596 3300005330 Ga0070690_100531153 Ga0070690_1005311532 98
597 3300005331 Ga0070670_100013225 Ga0070670_1000132259 98
598 3300005331 Ga0070670_100519148 Ga0070670_1005191482 98
599 3300005331 Ga0070670_101740013 Ga0070670_1017400132 98
600 3300005333 Ga0070677_10011735 Ga0070677_100117352 98
601 3300005334 Ga0068869_101720882 Ga0068869_1017208822 98
602 3300005335 Ga0070666_10065966 Ga0070666_100659663 98
603 3300005335 Ga0070666_10166582 Ga0070666_101665822 98
604 3300005335 Ga0070666_11010986 Ga0070666_110109862 98
605 3300005336 Ga0070680_100024380 Ga0070680_1000243803 98
606 3300005336 Ga0070680_101948317 Ga0070680_1019483172 98
607 3300005338 Ga0068868_100048166 Ga0068868_1000481664 98
608 3300005338 Ga0068868_101153908 Ga0068868_1011539082 98
609 3300005338 Ga0068868_101436788 Ga0068868_1014367881 98
610 3300005339 Ga0070660_100000156 Ga0070660_1000001567 98
611 3300005339 Ga0070660_100002966 Ga0070660_10000296616 98
612 3300005339 Ga0070660_100144401 Ga0070660_1001444012 98
613 3300005339 Ga0070660_100341182 Ga0070660_1003411822 98
614 3300005344 Ga0070661_100081244 Ga0070661_1000812442 98
615 3300005344 Ga0070661_100087732 Ga0070661_1000877322 98
616 3300005344 Ga0070661_100128134 Ga0070661_1001281342 98
617 3300005344 Ga0070661_100374693 Ga0070661_1003746932 98
618 3300005345 Ga0070692_10411460 Ga0070692_104114602 98
619 3300005347 Ga0070668_100379161 Ga0070668_1003791612 98
620 3300005347 Ga0070668_100840641 Ga0070668_1008406412 98
621 3300005353 Ga0070669_100033518 Ga0070669_1000335183 98
622 3300005353 Ga0070669_100164872 Ga0070669_1001648721 98
623 3300005353 Ga0070669_100454631 Ga0070669_1004546312 98
624 3300005354 Ga0070675_100023558 Ga0070675_1000235583 98
625 3300005354 Ga0070675_100257207 Ga0070675_1002572073 98
626 3300005355 Ga0070671_100000051 Ga0070671_10000005136 98
627 3300005355 Ga0070671_100006975 Ga0070671_1000069759 98
628 3300005355 Ga0070671_100143990 Ga0070671_1001439902 98
629 3300005355 Ga0070671_100235834 Ga0070671_1002358342 98
630 3300005355 Ga0070671_100420832 Ga0070671_1004208322 98
631 3300005355 Ga0070671_101540279 Ga0070671_1015402792 98
632 3300005356 Ga0070674_100011997 Ga0070674_1000119976 98
633 3300005356 Ga0070674_100014729 Ga0070674_1000147295 98
634 3300005356 Ga0070674_100051171 Ga0070674_1000511713 98
635 3300005356 Ga0070674_100175509 Ga0070674_1001755092 98
636 3300005364 Ga0070673_100011602 Ga0070673_1000116024 98
637 3300005364 Ga0070673_100302014 Ga0070673_1003020142 98
638 3300005364 Ga0070673_100413693 Ga0070673_1004136932 98
639 3300005364 Ga0070673_100677424 Ga0070673_1006774242 98
640 3300005364 Ga0070673_101754116 Ga0070673_1017541162 98
641 3300005365 Ga0070688_100554371 Ga0070688_1005543712 98
642 3300005365 Ga0070688_101610996 Ga0070688_1016109961 98
643 3300005366 Ga0070659_100003926 Ga0070659_10000392610 98
644 3300005366 Ga0070659_100083740 Ga0070659_1000837402 98
645 3300005366 Ga0070659_100199196 Ga0070659_1001991963 98
646 3300005366 Ga0070659_101047034 Ga0070659_1010470342 98
647 3300005366 Ga0070659_101341076 Ga0070659_1013410761 98
648 3300005366 Ga0070659_101394140 Ga0070659_1013941401 98
649 3300005367 Ga0070667_100104177 Ga0070667_1001041774 98
650 3300005367 Ga0070667_100569914 Ga0070667_1005699142 98
651 3300005367 Ga0070667_101669081 Ga0070667_1016690811 98
652 3300005367 Ga0070667_101798653 Ga0070667_1017986532 98
653 3300005434 Ga0070709_11415187 Ga0070709_114151871 98
654 3300005435 Ga0070714_100055739 Ga0070714_1000557392 98
655 3300005435 Ga0070714_100063691 Ga0070714_1000636913 98
656 3300005435 Ga0070714_101824868 Ga0070714_1018248682 98
657 3300005436 Ga0070713_100032969 Ga0070713_1000329692 98
658 3300005436 Ga0070713_100449365 Ga0070713_1004493652 98
659 3300005455 Ga0070663_100026400 Ga0070663_1000264003 98
660 3300005455 Ga0070663_101370547 Ga0070663_1013705471 98
661 3300005456 Ga0070678_100001121 Ga0070678_1000011215 98
662 3300005456 Ga0070678_100034382 Ga0070678_1000343825 98
663 3300005456 Ga0070678_100137937 Ga0070678_1001379372 98
664 3300005457 Ga0070662_100001195 Ga0070662_10000119521 98
665 3300005457 Ga0070662_100017911 Ga0070662_1000179112 98
666 3300005457 Ga0070662_100039331 Ga0070662_1000393312 98
667 3300005457 Ga0070662_100039339 Ga0070662_1000393395 98
668 3300005457 Ga0070662_100045906 Ga0070662_1000459064 98
669 3300005457 Ga0070662_100198471 Ga0070662_1001984711 98
670 3300005457 Ga0070662_101502363 Ga0070662_1015023631 98
671 3300005458 Ga0070681_10058866 Ga0070681_100588665 98
672 3300005459 Ga0068867_100493649 Ga0068867_1004936492 98
673 3300005459 Ga0068867_101153741 Ga0068867_1011537412 98
674 3300005530 Ga0070679_100009722 Ga0070679_1000097228 98
675 3300005530 Ga0070679_101421165 Ga0070679_1014211652 98
676 3300005535 Ga0070684_100068081 Ga0070684_1000680813 98
677 3300005535 Ga0070684_102115280 Ga0070684_1021152802 98
678 3300005539 Ga0068853_100640747 Ga0068853_1006407472 98
679 3300005539 Ga0068853_101276403 Ga0068853_1012764032 98
680 3300005543 Ga0070672_100015335 Ga0070672_1000153354 98
681 3300005543 Ga0070672_100128397 Ga0070672_1001283972 98
682 3300005543 Ga0070672_100278366 Ga0070672_1002783662 98
683 3300005543 Ga0070672_100300936 Ga0070672_1003009361 98
684 3300005545 Ga0070695_100335500 Ga0070695_1003355002 98
685 3300005546 Ga0070696_100585448 Ga0070696_1005854481 98
686 3300005548 Ga0070665_100013547 Ga0070665_1000135472 98
687 3300005548 Ga0070665_100021059 Ga0070665_1000210598 98
688 3300005548 Ga0070665_100566968 Ga0070665_1005669682 98
689 3300005563 Ga0068855_100042906 Ga0068855_1000429065 98
690 3300005563 Ga0068855_100553106 Ga0068855_1005531062 98
691 3300005564 Ga0070664_100229423 Ga0070664_1002294233 98
692 3300005564 Ga0070664_100563832 Ga0070664_1005638322 98
693 3300005564 Ga0070664_100714899 Ga0070664_1007148992 98
694 3300005577 Ga0068857_100008116 Ga0068857_1000081167 98
695 3300005577 Ga0068857_100434983 Ga0068857_1004349832 98
696 3300005577 Ga0068857_102278722 Ga0068857_1022787222 98
697 3300005578 Ga0068854_100111507 Ga0068854_1001115073 98
698 3300005578 Ga0068854_100271063 Ga0068854_1002710632 98
699 3300005578 Ga0068854_100566578 Ga0068854_1005665782 98
700 3300005578 Ga0068854_102151494 Ga0068854_1021514941 98
701 3300005614 Ga0068856_100023762 Ga0068856_1000237626 98
702 3300005614 Ga0068856_100027363 Ga0068856_1000273634 98
703 3300005615 Ga0070702_101482694 Ga0070702_1014826941 98
704 3300005616 Ga0068852_100038835 Ga0068852_1000388352 98
705 3300005616 Ga0068852_100333219 Ga0068852_1003332192 98
706 3300005616 Ga0068852_100456244 Ga0068852_1004562442 98
707 3300005616 Ga0068852_101273366 Ga0068852_1012733662 98
708 3300005618 Ga0068864_100023399 Ga0068864_1000233996 98
709 3300005719 Ga0068861_100027898 Ga0068861_1000278985 98
710 3300005719 Ga0068861_100531459 Ga0068861_1005314592 98
711 3300005834 Ga0068851_10268414 Ga0068851_102684142 98
712 3300005840 Ga0068870_11141887 Ga0068870_111418872 98
713 3300005844 Ga0068862_100345812 Ga0068862_1003458122 98
714 3300005985 Ga0081539_10021962 Ga0081539_100219622 98
715 3300006173 Ga0070716_100017029 Ga0070716_1000170292 98
716 3300006175 Ga0070712_100409844 Ga0070712_1004098442 98
717 3300006186 Ga0075369_10224746 Ga0075369_102247462 98
718 3300006195 Ga0075366_10634674 Ga0075366_106346742 98
719 3300006237 Ga0097621_100874416 Ga0097621_1008744162 98
720 3300006237 Ga0097621_101060345 Ga0097621_1010603452 98
721 3300006353 Ga0075370_10373493 Ga0075370_103734932 98
722 3300009093 Ga0105240_11027586 Ga0105240_110275862 98
723 3300009093 Ga0105240_11248634 Ga0105240_112486342 98
724 3300009098 Ga0105245_10198795 Ga0105245_101987952 98
725 3300009098 Ga0105245_11304672 Ga0105245_113046721 98
726 3300009098 Ga0105245_12384180 Ga0105245_123841802 98
727 3300009148 Ga0105243_10017247 Ga0105243_100172476 98
728 3300009148 Ga0105243_11201855 Ga0105243_112018552 98
729 3300009176 Ga0105242_11181354 Ga0105242_111813542 98
730 3300009177 Ga0105248_10219657 Ga0105248_102196572 98
731 3300009177 Ga0105248_10254978 Ga0105248_102549782 98
732 3300009177 Ga0105248_10688259 Ga0105248_106882592 98
733 3300009545 Ga0105237_10449078 Ga0105237_104490782 98
734 3300009553 Ga0105249_11854036 Ga0105249_118540361 98
735 3300010375 Ga0105239_10544206 Ga0105239_105442062 98
736 3300010375 Ga0105239_11720435 Ga0105239_117204352 98
737 3300010375 Ga0105239_13271721 Ga0105239_132717212 98
738 3300011119 Ga0105246_10641954 Ga0105246_106419542 98
739 3300012512 Ga0157327_1014092 Ga0157327_10140922 98
740 3300013100 Ga0157373_10021660 Ga0157373_100216602 98
741 3300013100 Ga0157373_10072363 Ga0157373_100723634 98
742 3300013100 Ga0157373_10524357 Ga0157373_105243572 98
743 3300013100 Ga0157373_10805553 Ga0157373_108055532 98
744 3300013102 Ga0157371_10312879 Ga0157371_103128792 98
745 3300013104 Ga0157370_10041941 Ga0157370_100419414 98
746 3300013104 Ga0157370_10133136 Ga0157370_101331363 98
747 3300013105 Ga0157369_10140020 Ga0157369_101400203 98
748 3300013105 Ga0157369_10862726 Ga0157369_108627262 98
749 3300013296 Ga0157374_10019076 Ga0157374_100190764 98
750 3300013297 Ga0157378_10534681 Ga0157378_105346812 98
751 3300013297 Ga0157378_10589800 Ga0157378_105898002 98
752 3300013297 Ga0157378_10959130 Ga0157378_109591302 98
753 3300013306 Ga0163162_10023881 Ga0163162_100238814 98
754 3300013306 Ga0163162_10104995 Ga0163162_101049954 98
755 3300013307 Ga0157372_10118491 Ga0157372_101184912 98
756 3300013307 Ga0157372_10409795 Ga0157372_104097952 98
757 3300013307 Ga0157372_11572598 Ga0157372_115725982 98
758 3300013307 Ga0157372_11613633 Ga0157372_116136332 98
759 3300013308 Ga0157375_10020583 Ga0157375_100205835 98
760 3300013308 Ga0157375_11826491 Ga0157375_118264911 98
761 3300014325 Ga0163163_10073297 Ga0163163_100732973 98
762 3300014326 Ga0157380_10835979 Ga0157380_108359792 98
763 3300014497 Ga0182008_10056733 Ga0182008_100567333 98
764 3300014745 Ga0157377_10148714 Ga0157377_101487143 98
765 3300014969 Ga0157376_10090404 Ga0157376_100904044 98
766 3300020081 Ga0206354_11545716 Ga0206354_115457162 98
767 3300025290 Ga0207673_1022881 Ga0207673_10228812 98
768 3300025315 Ga0207697_10140730 Ga0207697_101407302 98
769 3300025893 Ga0207682_10077134 Ga0207682_100771342 98
770 3300025899 Ga0207642_10610956 Ga0207642_106109562 98
771 3300025901 Ga0207688_10009345 Ga0207688_100093452 98
772 3300025901 Ga0207688_10022437 Ga0207688_100224371 98
773 3300025901 Ga0207688_10027272 Ga0207688_100272723 98
774 3300025901 Ga0207688_10029570 Ga0207688_100295702 98
775 3300025903 Ga0207680_10101277 Ga0207680_101012773 98
776 3300025903 Ga0207680_10505087 Ga0207680_105050872 98
777 3300025904 Ga0207647_10009676 Ga0207647_100096766 98
778 3300025904 Ga0207647_10027273 Ga0207647_100272733 98
779 3300025904 Ga0207647_10082023 Ga0207647_100820233 98
780 3300025907 Ga0207645_11191719 Ga0207645_111917191 98
781 3300025909 Ga0207705_10009807 Ga0207705_100098073 98
782 3300025909 Ga0207705_10046912 Ga0207705_100469124 98
783 3300025909 Ga0207705_10578866 Ga0207705_105788662 98
784 3300025912 Ga0207707_10124551 Ga0207707_101245512 98
785 3300025912 Ga0207707_10341825 Ga0207707_103418252 98
786 3300025913 Ga0207695_10210052 Ga0207695_102100522 98
787 3300025917 Ga0207660_10002662 Ga0207660_100026629 98
788 3300025919 Ga0207657_10000434 Ga0207657_1000043430 98
789 3300025919 Ga0207657_10001170 Ga0207657_1000117014 98
790 3300025919 Ga0207657_10098472 Ga0207657_100984723 98
791 3300025919 Ga0207657_10167306 Ga0207657_101673063 98
792 3300025919 Ga0207657_10510349 Ga0207657_105103492 98
793 3300025920 Ga0207649_10112156 Ga0207649_101121563 98
794 3300025920 Ga0207649_10434297 Ga0207649_104342972 98
795 3300025920 Ga0207649_10494474 Ga0207649_104944742 98
796 3300025921 Ga0207652_10000034 Ga0207652_100000349 98
797 3300025921 Ga0207652_10058852 Ga0207652_100588523 98
798 3300025923 Ga0207681_10004355 Ga0207681_100043555 98
799 3300025923 Ga0207681_10050998 Ga0207681_100509984 98
800 3300025923 Ga0207681_10167103 Ga0207681_101671033 98
801 3300025923 Ga0207681_10264112 Ga0207681_102641122 98
802 3300025924 Ga0207694_10538823 Ga0207694_105388232 98
803 3300025925 Ga0207650_10040539 Ga0207650_100405393 98
804 3300025925 Ga0207650_10059964 Ga0207650_100599644 98
805 3300025925 Ga0207650_11345655 Ga0207650_113456552 98
806 3300025926 Ga0207659_10076781 Ga0207659_100767813 98
807 3300025926 Ga0207659_10829266 Ga0207659_108292662 98
808 3300025926 Ga0207659_11153323 Ga0207659_111533232 98
809 3300025927 Ga0207687_11508204 Ga0207687_115082042 98
810 3300025928 Ga0207700_10388919 Ga0207700_103889192 98
811 3300025929 Ga0207664_10018146 Ga0207664_100181464 98
812 3300025929 Ga0207664_10079535 Ga0207664_100795352 98
813 3300025929 Ga0207664_11394232 Ga0207664_113942321 98
814 3300025931 Ga0207644_10000943 Ga0207644_100009433 98
815 3300025931 Ga0207644_10000996 Ga0207644_100009969 98
816 3300025931 Ga0207644_10032654 Ga0207644_100326542 98
817 3300025931 Ga0207644_10250949 Ga0207644_102509492 98
818 3300025931 Ga0207644_11284946 Ga0207644_112849462 98
819 3300025931 Ga0207644_11564618 Ga0207644_115646181 98
820 3300025932 Ga0207690_10002842 Ga0207690_100028426 98
821 3300025932 Ga0207690_10034676 Ga0207690_100346763 98
822 3300025932 Ga0207690_10149234 Ga0207690_101492343 98
823 3300025932 Ga0207690_10260883 Ga0207690_102608832 98
824 3300025932 Ga0207690_10691141 Ga0207690_106911411 98
825 3300025932 Ga0207690_10892420 Ga0207690_108924202 98
826 3300025932 Ga0207690_11199707 Ga0207690_111997072 98
827 3300025933 Ga0207706_10000299 Ga0207706_1000029936 98
828 3300025933 Ga0207706_10020875 Ga0207706_100208752 98
829 3300025933 Ga0207706_10155926 Ga0207706_101559263 98
830 3300025933 Ga0207706_10180054 Ga0207706_101800542 98
831 3300025933 Ga0207706_10528423 Ga0207706_105284232 98
832 3300025933 Ga0207706_10601912 Ga0207706_106019122 98
833 3300025933 Ga0207706_11571005 Ga0207706_115710052 98
834 3300025934 Ga0207686_10269296 Ga0207686_102692962 98
835 3300025934 Ga0207686_10342765 Ga0207686_103427652 98
836 3300025937 Ga0207669_10153294 Ga0207669_101532942 98
837 3300025937 Ga0207669_10168664 Ga0207669_101686642 98
838 3300025937 Ga0207669_10186735 Ga0207669_101867351 98
839 3300025940 Ga0207691_10013011 Ga0207691_100130117 98
840 3300025940 Ga0207691_10016113 Ga0207691_100161138 98
841 3300025940 Ga0207691_10108220 Ga0207691_101082203 98
842 3300025940 Ga0207691_10339902 Ga0207691_103399022 98
843 3300025940 Ga0207691_10471177 Ga0207691_104711771 98
844 3300025941 Ga0207711_10189622 Ga0207711_101896222 98
845 3300025941 Ga0207711_10294821 Ga0207711_102948212 98
846 3300025944 Ga0207661_10032385 Ga0207661_100323855 98
847 3300025944 Ga0207661_10415947 Ga0207661_104159472 98
848 3300025944 Ga0207661_11391683 Ga0207661_113916832 98
849 3300025945 Ga0207679_10023965 Ga0207679_100239652 98
850 3300025945 Ga0207679_10523871 Ga0207679_105238712 98
851 3300025945 Ga0207679_10739393 Ga0207679_107393932 98
852 3300025945 Ga0207679_10904130 Ga0207679_109041302 98
853 3300025949 Ga0207667_10012261 Ga0207667_1001226111 98
854 3300025949 Ga0207667_10049447 Ga0207667_100494473 98
855 3300025949 Ga0207667_10366878 Ga0207667_103668782 98
856 3300025960 Ga0207651_10012001 Ga0207651_100120013 98
857 3300025960 Ga0207651_10140058 Ga0207651_101400582 98
858 3300025960 Ga0207651_10201589 Ga0207651_102015892 98
859 3300025960 Ga0207651_10430531 Ga0207651_104305312 98
860 3300025960 Ga0207651_10441912 Ga0207651_104419122 98
861 3300025960 Ga0207651_10480599 Ga0207651_104805992 98
862 3300025960 Ga0207651_11182526 Ga0207651_111825262 98
863 3300025972 Ga0207668_10198870 Ga0207668_101988702 98
864 3300025972 Ga0207668_11125351 Ga0207668_111253512 98
865 3300025981 Ga0207640_10207631 Ga0207640_102076312 98
866 3300025981 Ga0207640_10425775 Ga0207640_104257752 98
867 3300025981 Ga0207640_10610929 Ga0207640_106109292 98
868 3300025981 Ga0207640_11160446 Ga0207640_111604462 98
869 3300025986 Ga0207658_10066062 Ga0207658_100660622 98
870 3300025986 Ga0207658_10312073 Ga0207658_103120732 98
871 3300026023 Ga0207677_10030638 Ga0207677_100306383 98
872 3300026041 Ga0207639_10654861 Ga0207639_106548612 98
873 3300026041 Ga0207639_10679122 Ga0207639_106791222 98
874 3300026067 Ga0207678_10000117 Ga0207678_1000011744 98
875 3300026067 Ga0207678_11064414 Ga0207678_110644141 98
876 3300026078 Ga0207702_10079971 Ga0207702_100799713 98
877 3300026078 Ga0207702_10408586 Ga0207702_104085862 98
878 3300026089 Ga0207648_10142850 Ga0207648_101428503 98
879 3300026089 Ga0207648_10309763 Ga0207648_103097632 98
880 3300026095 Ga0207676_10228584 Ga0207676_102285843 98
881 3300026116 Ga0207674_10000086 Ga0207674_1000008645 98
882 3300026116 Ga0207674_11045692 Ga0207674_110456922 98
883 3300026118 Ga0207675_100044742 Ga0207675_1000447425 98
884 3300026118 Ga0207675_101529073 Ga0207675_1015290732 98
885 3300026121 Ga0207683_10003887 Ga0207683_100038872 98
886 3300026121 Ga0207683_10067903 Ga0207683_100679034 98
887 3300026121 Ga0207683_10100386 Ga0207683_101003862 98
888 3300026142 Ga0207698_10277882 Ga0207698_102778822 98
889 3300026142 Ga0207698_10293572 Ga0207698_102935722 98
890 3300026142 Ga0207698_10782532 Ga0207698_107825322 98
891 3300027876 Ga0209974_10053592 Ga0209974_100535922 98
892 3300027876 Ga0209974_10319248 Ga0209974_103192482 98
893 3300028379 Ga0268266_10055274 Ga0268266_100552743 98
894 3300028379 Ga0268266_10083549 Ga0268266_100835494 98
895 3300028379 Ga0268266_10506053 Ga0268266_105060531 98
896 3300028380 Ga0268265_10475786 Ga0268265_104757862 98
897 3300031731 Ga0307405_10004019 Ga0307405_1000401910 98
898 3300031824 Ga0307413_11407450 Ga0307413_114074502 98
899 3300031852 Ga0307410_10215246 Ga0307410_102152462 98
900 3300031901 Ga0307406_10176990 Ga0307406_101769903 98
901 3300031903 Ga0307407_10473151 Ga0307407_104731512 98
902 3300031911 Ga0307412_10778493 Ga0307412_107784932 98
903 3300031995 Ga0307409_100025333 Ga0307409_1000253332 98
904 3300032002 Ga0307416_102023742 Ga0307416_1020237422 98
905 3300032004 Ga0307414_10600876 Ga0307414_106008762 98
906 3300032004 Ga0307414_11451945 Ga0307414_114519452 98
907 3300032005 Ga0307411_10434736 Ga0307411_104347362 98
908 3300032126 Ga0307415_100065523 Ga0307415_1000655232 98
909 3300034818 Ga0373950_0075644 Ga0373950_0075644_331_627 98
910 3300034820 Ga0373959_0177768 Ga0373959_0177768_165_464 98
911 3300034957 Ga0373938_0154874 Ga0373938_0154874_51_353 98
912 3300035114 Ga0373939_0375018 Ga0373939_0375018_62_364 98
913 3300035241 Ga0373961_0081310 Ga0373961_0081310_655_951 98
914 3300035691 Ga0373931_1213654 Ga0373931_1213654_169_465 98
915 3300035725 Ga0373947_0722365 Ga0373947_0722365_262_561 98
916 3300036401 Ga0373937_0546426 Ga0373937_0546426_85_384 98
917 3300036401 Ga0373937_0976411 Ga0373937_0976411_96_395 98
918 3300037312 Ga0395899_0002062 Ga0395899_0002062_7601_7897 98
919 3300037312 Ga0395899_0007278 Ga0395899_0007278_6637_6969 98
920 3300037312 Ga0395899_0044714 Ga0395899_0044714_2721_3017 98
921 3300037312 Ga0395899_0127594 Ga0395899_0127594_1240_1539 98
922 3300037312 Ga0395899_0176318 Ga0395899_0176318_237_539 98
923 3300037312 Ga0395899_0177552 Ga0395899_0177552_287_589 98
924 3300037312 Ga0395899_0198152 Ga0395899_0198152_1010_1309 98
925 3300037312 Ga0395899_0479984 Ga0395899_0479984_231_530 98
926 3300037312 Ga0395899_0506867 Ga0395899_0506867_235_534 98
927 3300037418 Ga0395900_0000997 Ga0395900_0000997_22396_22695 98
928 3300037418 Ga0395900_0003165 Ga0395900_0003165_10503_10799 98
929 3300037418 Ga0395900_0005624 Ga0395900_0005624_8300_8599 98
930 3300037418 Ga0395900_0011036 Ga0395900_0011036_3008_3307 98
931 3300037418 Ga0395900_0027388 Ga0395900_0027388_5028_5324 98
932 3300037418 Ga0395900_0062013 Ga0395900_0062013_819_1118 98
933 3300037418 Ga0395900_0090128 Ga0395900_0090128_1083_1385 98
934 3300037418 Ga0395900_0121970 Ga0395900_0121970_760_1059 98
935 3300037418 Ga0395900_0151212 Ga0395900_0151212_913_1245 98
936 3300037418 Ga0395900_0204665 Ga0395900_0204665_1502_1801 98
937 3300037418 Ga0395900_0205499 Ga0395900_0205499_455_754 98
938 3300037418 Ga0395900_0351368 Ga0395900_0351368_1139_1438 98
939 3300037418 Ga0395900_0457515 Ga0395900_0457515_782_1081 98
940 3300037418 Ga0395900_0971092 Ga0395900_0971092_253_552 98
941 3300037418 Ga0395900_1070448 Ga0395900_1070448_230_532 98
942 3300037418 Ga0395900_1085104 Ga0395900_1085104_228_530 98
943 3300037466 Ga0395898_0003637 Ga0395898_0003637_2374_2706 98
944 3300037466 Ga0395898_0006632 Ga0395898_0006632_5883_6179 98
945 3300037466 Ga0395898_0212865 Ga0395898_0212865_305_604 98
946 3300037466 Ga0395898_0668955 Ga0395898_0668955_499_798 98
947 3300037466 Ga0395898_0991061 Ga0395898_0991061_195_494 98
948 3300037466 Ga0395898_1176341 Ga0395898_1176341_29_328 98
949 3300037466 Ga0395898_1605356 Ga0395898_1605356_149_445 98
950 3300037471 Ga0395905_0001164 Ga0395905_0001164_14061_14360 98
951 3300037471 Ga0395905_0009116 Ga0395905_0009116_9037_9333 98
952 3300037471 Ga0395905_0010087 Ga0395905_0010087_2415_2714 98
953 3300037471 Ga0395905_0013695 Ga0395905_0013695_5393_5725 98
954 3300037471 Ga0395905_0047368 Ga0395905_0047368_1130_1426 98
955 3300037471 Ga0395905_0055679 Ga0395905_0055679_1530_1829 98
956 3300037471 Ga0395905_0057172 Ga0395905_0057172_175_477 98
957 3300037471 Ga0395905_0060505 Ga0395905_0060505_3032_3331 98
958 3300037471 Ga0395905_0088555 Ga0395905_0088555_2102_2401 98
959 3300037471 Ga0395905_0089238 Ga0395905_0089238_1509_1808 98
960 3300037471 Ga0395905_0213181 Ga0395905_0213181_836_1135 98
961 3300037471 Ga0395905_0248596 Ga0395905_0248596_858_1154 98
962 3300037471 Ga0395905_0280336 Ga0395905_0280336_612_911 98
963 3300037471 Ga0395905_0784082 Ga0395905_0784082_225_527 98
964 3300037471 Ga0395905_1451105 Ga0395905_1451105_96_392 98
965 3300037471 Ga0395905_1543824 Ga0395905_1543824_232_531 98
966 3300038443 Ga0395901_0002401 Ga0395901_0002401_5657_5953 98
967 3300038443 Ga0395901_0003908 Ga0395901_0003908_5392_5691 98
968 3300038443 Ga0395901_0012496 Ga0395901_0012496_2973_3272 98
969 3300038443 Ga0395901_0016592 Ga0395901_0016592_6613_6912 98
970 3300038443 Ga0395901_0048282 Ga0395901_0048282_2701_3000 98
971 3300038443 Ga0395901_0062494 Ga0395901_0062494_3260_3556 98
972 3300038443 Ga0395901_0141581 Ga0395901_0141581_606_908 98
973 3300038443 Ga0395901_0205990 Ga0395901_0205990_280_579 98
974 3300038443 Ga0395901_0218283 Ga0395901_0218283_550_849 98
975 3300038443 Ga0395901_0291865 Ga0395901_0291865_125_427 98
976 3300038443 Ga0395901_0438272 Ga0395901_0438272_691_993 98
977 3300038443 Ga0395901_0475511 Ga0395901_0475511_180_479 98
978 3300038443 Ga0395901_0479076 Ga0395901_0479076_29_361 98
979 3300038443 Ga0395901_0568390 Ga0395901_0568390_254_553 98
980 3300039437 Ga0436365_1884350 Ga0436365_1884350_66_371 98
981 3300041413 Ga0439465_0034100 Ga0439465_0034100_1049_1345 98
982 3300041501 Ga0451845_0414206 Ga0451845_0414206_134_436 98
983 3300042004 Ga0439445_0079259 Ga0439445_0079259_261_563 98
984 3300042005 Ga0439448_0091094 Ga0439448_0091094_175_474 98
985 3300042006 Ga0439432_010963 Ga0439432_010963_2082_2378 98
986 3300042006 Ga0439432_022427 Ga0439432_022427_356_658 98
987 3300042007 Ga0439449_0027822 Ga0439449_0027822_1747_2043 98
988 3300042007 Ga0439449_0278171 Ga0439449_0278171_292_594 98
989 3300042012 Ga0439455_0199918 Ga0439455_0199918_181_480 98
990 3300044684 Ga0466966_0130198 Ga0466966_0130198_490_795 98
991 3300045049 Ga0466959_0132459 Ga0466959_0132459_849_1154 98
992 3300046473 Ga0495582_0355114 Ga0495582_0355114_24_323 98
993 3300046522 Ga0495643_0223268 Ga0495643_0223268_225_524 98
994 3300046525 Ga0495663_0066801 Ga0495663_0066801_497_793 98
995 3300046525 Ga0495663_0082632 Ga0495663_0082632_193_492 98
996 3300046528 Ga0495642_0074659 Ga0495642_0074659_356_652 98
997 3300046537 Ga0495598_0002306 Ga0495598_0002306_2561_2860 98
998 3300046539 Ga0495621_0011102 Ga0495621_0011102_1760_2059 98
999 3300046558 Ga0495633_0094425 Ga0495633_0094425_979_1278 98
1000 3300046664 Ga0495659_0112117 Ga0495659_0112117_176_475 98
1001 3300046684 Ga0495669_0002275 Ga0495669_0002275_5686_5982 98
1002 3300046684 Ga0495669_0006331 Ga0495669_0006331_3966_4265 98
1003 3300046684 Ga0495669_0256576 Ga0495669_0256576_481_780 98
1004 3300046691 Ga0495670_0011308 Ga0495670_0011308_2285_2584 98
1005 3300047445 Ga0495677_0020443 Ga0495677_0020443_770_1066 98
1006 3300047445 Ga0495677_0196492 Ga0495677_0196492_134_430 98
1007 3300048903 Ga0496100_0266676 Ga0496100_0266676_232_528 98
1008 3300048903 Ga0496100_0556035 Ga0496100_0556035_290_589 98
1009 3300048905 Ga0496102_1113417 Ga0496102_1113417_41_340 98
1010 3300048909 Ga0496106_0740003 Ga0496106_0740003_250_549 98
1011 3300048912 Ga0496109_1954386 Ga0496109_1954386_71_370 98
1012 3300048915 Ga0496112_0355303 Ga0496112_0355303_599_895 98
1013 3300049515 Ga0501292_112198 Ga0501292_112198_67_363 98
1014 3300049521 Ga0501298_042688 Ga0501298_042688_539_835 98
1015 3300049587 Ga0501071_0280020 Ga0501071_0280020_467_769 98
1016 3300049590 Ga0501074_0708082 Ga0501074_0708082_228_530 98
1017 3300049649 Ga0501198_055091 Ga0501198_055091_217_513 98
1018 3300049652 Ga0501202_008297 Ga0501202_008297_962_1258 98
1019 3300049661 Ga0501217_166429 Ga0501217_166429_133_429 98
1020 3300049665 Ga0501227_118849 Ga0501227_118849_70_366 98
1021 3300049668 Ga0501233_030637 Ga0501233_030637_563_859 98
1022 3300049671 Ga0501238_027609 Ga0501238_027609_76_372 98
1023 3300049675 Ga0501243_075528 Ga0501243_075528_263_559 98
1024 3300049677 Ga0501247_018851 Ga0501247_018851_94_390 98
1025 3300049686 Ga0501257_052611 Ga0501257_052611_576_872 98
1026 3300049704 Ga0501221_028044 Ga0501221_028044_636_932 98
1027 3300049705 Ga0501225_0209700 Ga0501225_0209700_73_369 98
1028 3300049707 Ga0501234_018058 Ga0501234_018058_21_317 98
1029 3300049742 Ga0501080_0397204 Ga0501080_0397204_633_935 98
1030 3300049759 Ga0501262_005846 Ga0501262_005846_892_1188 98
1031 3300049765 Ga0501268_044183 Ga0501268_044183_518_814 98
1032 3300049767 Ga0501270_044020 Ga0501270_044020_357_653 98
1033 3300049775 Ga0501279_058969 Ga0501279_058969_226_522 98
1034 3300049779 Ga0501283_067293 Ga0501283_067293_276_572 98
1035 3300049851 Ga0501212_029334 Ga0501212_029334_225_521 98
1036 3300050496 nmdc:mga07m45_550703_c1 nmdc:mga07m45_550703_c1_67_366 98
1037 3300053083 Ga0495655_0270679 Ga0495655_0270679_55_351 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

22

100

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.761 3 88
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.6358 3 88
8cas-assembly1.cif.gz_Y cryo-em structure of native otu2-bound ubiquitinated 48s initiation complex (partial) 0.5588 14 78
4v6w-assembly1.cif.gz_AN structure of the d. melanogaster 80s ribosome 0.5483 14 78
6okk-assembly1.cif.gz_U cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit 0.5401 17 78
ID Description Score Start End Superfamily
5it9N02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5476 17 72 1.10.287.10
4ukmr02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.543 14 78 1.10.287.10
af_A0A1D6LXR0_391_543_1.20.58.1520 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.542 3 98 1.20.58.1520
6okkU02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5401 17 78 1.10.287.10
4ujhr02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5371 14 78 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A7D4AT38-F1-model_v4 YggT family protein 0.9722 4 90 GO:0016020
AF-A0A3D4MGU8-F1-model_v4 Osmotic-shock protein 0.9696 4 91 GO:0016020
AF-A0A6M8VLT5-F1-model_v4 YggT family protein 0.9665 5 90 GO:0016020
AF-A0A2D7HNT6-F1-model_v4 YggT family protein 0.9658 4 89 GO:0016020
AF-A0A522DDP3-F1-model_v4 YggT family protein 0.9655 4 91 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.72 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map