F488749
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1037 | 418 | 2074 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0076431|Ga0496109_0076431_1319_2356 |
| Length | 345 |
| Sequence | MAFSGNSKISREANVSFYRGRRKSTQSLATQRFSGVPRRACWRPRPYAIGDLGRANQADQEMPEVPGLMRGKRGLIMGVANHRSLAWGIAKACHAHGAALAFTYQGDALKKRVEPLARDVGGMLVGDCDVTEPKSIDAVFAAVGSAWGALDFLVHAIAFSDKNELKGRYADTTRENFVRTLIISCFSFTEVAKRAAALMPAGGAMVTLTYNGGQRAMPNYNVMGVAKAALEASVRYLAVDFGPSGIRVNAISAGPIRTLAGAGIGDARQMFAFQQRHSPLRRGVTLEEIGGAALYLLSDLSTGVTGDIHFVDSGYNIITMPHPAALKNGDETQNGNGDSAKDAAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 135 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 148 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 400 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 418 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 0 |
| Rhizoplane | 9.35 |
| Rhizosphere | 88.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0076431 | 3300048912 | Bacteria | 3080 |
| 2 | SwRhRL2b_contig_2457651 | 2162886007 | Bacteria | 2777 |
| 3 | 2214750779 | 2209111006 | Bacteria | 3342 |
| 4 | ARSoilYngRDRAFT_c00001 | 3300000042 | Bacteria | 59233 |
| 5 | ARcpr5yngRDRAFT_c000001 | 3300000043 | Bacteria | 58937 |
| 6 | ARSoilOldRDRAFT_c000001 | 3300000044 | Bacteria | 104759 |
| 7 | ARCol0oldRDRAFT_c00115 | 3300000045 | Bacteria | 6999 |
| 8 | ARCol0yngRDRAFT_1000040 | 3300000652 | Bacteria | 21810 |
| 9 | JGI24752J21851_1013074 | 3300001976 | Bacteria | 1084 |
| 10 | JGI24737J22298_10000431 | 3300001990 | Bacteria | 14380 |
| 11 | JGI24737J22298_10017937 | 3300001990 | Bacteria | 2276 |
| 12 | JGI24750J21931_1000799 | 3300002070 | Bacteria | 4380 |
| 13 | JGI24738J21930_10005986 | 3300002075 | Bacteria | 2886 |
| 14 | JGI24749J21850_1001616 | 3300002076 | Bacteria | 3196 |
| 15 | JGI24744J21845_10001498 | 3300002077 | Bacteria | 4643 |
| 16 | JGI24033J26618_1002186 | 3300002155 | Bacteria | 1978 |
| 17 | JGI24034J26672_10002342 | 3300002239 | Bacteria | 2599 |
| 18 | JGI24742J22300_10009051 | 3300002244 | Bacteria | 1643 |
| 19 | JGI25405J52794_10000676 | 3300003911 | Bacteria | 5167 |
| 20 | JGI25405J52794_10009351 | 3300003911 | Bacteria | 1850 |
| 21 | Ga0065717_1002101 | 3300005276 | Bacteria | 2950 |
| 22 | Ga0065704_10073572 | 3300005289 | Bacteria | 7002 |
| 23 | Ga0065712_10000310 | 3300005290 | Bacteria | 17827 |
| 24 | Ga0065715_10001068 | 3300005293 | Bacteria | 20888 |
| 25 | Ga0065715_10237603 | 3300005293 | Bacteria | 1211 |
| 26 | Ga0065707_10136390 | 3300005295 | Bacteria | 1835 |
| 27 | Ga0070676_10092683 | 3300005328 | Bacteria | 1853 |
| 28 | Ga0070683_100288918 | 3300005329 | Bacteria | 1560 |
| 29 | Ga0070690_100015471 | 3300005330 | Bacteria | 4552 |
| 30 | Ga0070690_100065577 | 3300005330 | Bacteria | 2348 |
| 31 | Ga0068869_100132477 | 3300005334 | Bacteria | 1918 |
| 32 | Ga0070666_10000987 | 3300005335 | Bacteria | 17384 |
| 33 | Ga0070666_10048740 | 3300005335 | Bacteria | 2847 |
| 34 | Ga0070680_100022299 | 3300005336 | Bacteria | 5041 |
| 35 | Ga0070682_100003298 | 3300005337 | Bacteria | 8949 |
| 36 | Ga0070682_100086238 | 3300005337 | Bacteria | 2044 |
| 37 | Ga0070682_100091931 | 3300005337 | Bacteria | 1987 |
| 38 | Ga0070682_100096294 | 3300005337 | Bacteria | 1945 |
| 39 | Ga0070682_100165192 | 3300005337 | Bacteria | 1533 |
| 40 | Ga0068868_100005947 | 3300005338 | Bacteria | 8604 |
| 41 | Ga0070660_100030705 | 3300005339 | Bacteria | 4032 |
| 42 | Ga0070660_100137038 | 3300005339 | Bacteria | 1961 |
| 43 | Ga0070689_100007857 | 3300005340 | Bacteria | 7479 |
| 44 | Ga0070689_100102372 | 3300005340 | Bacteria | 2268 |
| 45 | Ga0070689_100258580 | 3300005340 | Bacteria | 1438 |
| 46 | Ga0070691_10020730 | 3300005341 | Bacteria | 3038 |
| 47 | Ga0070687_100005090 | 3300005343 | Bacteria | 5302 |
| 48 | Ga0070661_100215911 | 3300005344 | Bacteria | 1469 |
| 49 | Ga0070668_100049976 | 3300005347 | Bacteria | 3218 |
| 50 | Ga0070668_100146341 | 3300005347 | Bacteria | 1907 |
| 51 | Ga0070669_100014859 | 3300005353 | Bacteria | 5547 |
| 52 | Ga0070669_100110258 | 3300005353 | Bacteria | 2088 |
| 53 | Ga0070675_100016243 | 3300005354 | Bacteria | 5906 |
| 54 | Ga0070675_100047554 | 3300005354 | Bacteria | 3515 |
| 55 | Ga0070675_100109398 | 3300005354 | Bacteria | 2336 |
| 56 | Ga0070671_100003533 | 3300005355 | Bacteria | 12222 |
| 57 | Ga0070671_100015553 | 3300005355 | Bacteria | 6147 |
| 58 | Ga0070671_100018478 | 3300005355 | Bacteria | 5663 |
| 59 | Ga0070671_100126796 | 3300005355 | Bacteria | 2149 |
| 60 | Ga0070674_100018513 | 3300005356 | Bacteria | 4405 |
| 61 | Ga0070674_100070823 | 3300005356 | Bacteria | 2465 |
| 62 | Ga0070674_100435637 | 3300005356 | Bacteria | 1079 |
| 63 | Ga0070688_100012356 | 3300005365 | Bacteria | 4782 |
| 64 | Ga0070688_100018378 | 3300005365 | Bacteria | 4033 |
| 65 | Ga0070688_100064253 | 3300005365 | Bacteria | 2328 |
| 66 | Ga0070688_100185102 | 3300005365 | Bacteria | 1447 |
| 67 | Ga0070688_100230461 | 3300005365 | Bacteria | 1310 |
| 68 | Ga0070659_100009166 | 3300005366 | Bacteria | 7259 |
| 69 | Ga0070659_100013043 | 3300005366 | Bacteria | 6180 |
| 70 | Ga0070667_100003900 | 3300005367 | Bacteria | 12667 |
| 71 | Ga0070667_100012179 | 3300005367 | Bacteria | 7117 |
| 72 | Ga0070667_100031879 | 3300005367 | Bacteria | 4393 |
| 73 | Ga0070667_100081105 | 3300005367 | Bacteria | 2776 |
| 74 | Ga0070667_100412403 | 3300005367 | Bacteria | 1231 |
| 75 | Ga0070703_10010430 | 3300005406 | Bacteria | 2620 |
| 76 | Ga0070709_10022545 | 3300005434 | Bacteria | 3686 |
| 77 | Ga0070713_100003508 | 3300005436 | Bacteria | 10357 |
| 78 | Ga0070713_100019553 | 3300005436 | Bacteria | 5175 |
| 79 | Ga0070713_100150662 | 3300005436 | Bacteria | 2069 |
| 80 | Ga0070713_100198471 | 3300005436 | Bacteria | 1811 |
| 81 | Ga0070713_100348984 | 3300005436 | Bacteria | 1372 |
| 82 | Ga0070713_100606813 | 3300005436 | Bacteria | 1040 |
| 83 | Ga0070710_10004640 | 3300005437 | Bacteria | 6499 |
| 84 | Ga0070710_10009621 | 3300005437 | Bacteria | 4732 |
| 85 | Ga0070710_10122989 | 3300005437 | Bacteria | 1573 |
| 86 | Ga0070701_10007644 | 3300005438 | Bacteria | 4633 |
| 87 | Ga0070701_10010004 | 3300005438 | Bacteria | 4179 |
| 88 | Ga0070711_100019594 | 3300005439 | Bacteria | 4342 |
| 89 | Ga0070711_100021848 | 3300005439 | Bacteria | 4142 |
| 90 | Ga0070711_100146280 | 3300005439 | Bacteria | 1777 |
| 91 | Ga0070711_100153910 | 3300005439 | Bacteria | 1736 |
| 92 | Ga0070711_100407715 | 3300005439 | Bacteria | 1105 |
| 93 | Ga0070705_100033862 | 3300005440 | Bacteria | 2851 |
| 94 | Ga0070705_100266538 | 3300005440 | Bacteria | 1211 |
| 95 | Ga0070705_100282957 | 3300005440 | Bacteria | 1180 |
| 96 | Ga0070700_100056506 | 3300005441 | Bacteria | 2460 |
| 97 | Ga0070700_100299182 | 3300005441 | Bacteria | 1174 |
| 98 | Ga0070694_100018911 | 3300005444 | Bacteria | 4377 |
| 99 | Ga0070694_100080003 | 3300005444 | Bacteria | 2270 |
| 100 | Ga0070708_100548049 | 3300005445 | Bacteria | 1091 |
| 101 | Ga0070663_100007188 | 3300005455 | Bacteria | 6762 |
| 102 | Ga0070663_100037779 | 3300005455 | Bacteria | 3364 |
| 103 | Ga0070663_100126330 | 3300005455 | Bacteria | 1938 |
| 104 | Ga0070678_100002775 | 3300005456 | Bacteria | 9674 |
| 105 | Ga0070662_100135528 | 3300005457 | Bacteria | 1903 |
| 106 | Ga0070681_10016483 | 3300005458 | Bacteria | 7378 |
| 107 | Ga0070681_10240286 | 3300005458 | Bacteria | 1725 |
| 108 | Ga0070681_10470782 | 3300005458 | Bacteria | 1169 |
| 109 | Ga0068867_100006959 | 3300005459 | Bacteria | 7999 |
| 110 | Ga0070685_10003351 | 3300005466 | Bacteria | 8153 |
| 111 | Ga0070685_10005997 | 3300005466 | Bacteria | 6190 |
| 112 | Ga0070706_100145229 | 3300005467 | Bacteria | 2215 |
| 113 | Ga0070707_100325122 | 3300005468 | Bacteria | 1494 |
| 114 | Ga0070698_100264289 | 3300005471 | Bacteria | 1653 |
| 115 | Ga0070699_100047726 | 3300005518 | Bacteria | 3705 |
| 116 | Ga0070679_100010613 | 3300005530 | Bacteria | 8743 |
| 117 | Ga0070679_100020939 | 3300005530 | Bacteria | 6379 |
| 118 | Ga0070679_100073164 | 3300005530 | Bacteria | 3419 |
| 119 | Ga0070679_100268442 | 3300005530 | Bacteria | 1661 |
| 120 | Ga0070684_100062981 | 3300005535 | Bacteria | 3250 |
| 121 | Ga0070684_100218719 | 3300005535 | Bacteria | 1738 |
| 122 | Ga0070684_100362047 | 3300005535 | Bacteria | 1335 |
| 123 | Ga0070697_100036801 | 3300005536 | Bacteria | 3953 |
| 124 | Ga0068853_100001612 | 3300005539 | Bacteria | 16462 |
| 125 | Ga0068853_100037570 | 3300005539 | Bacteria | 4120 |
| 126 | Ga0068853_100170164 | 3300005539 | Bacteria | 1971 |
| 127 | Ga0070672_100112940 | 3300005543 | Bacteria | 2217 |
| 128 | Ga0070686_100009112 | 3300005544 | Bacteria | 5568 |
| 129 | Ga0070686_100038090 | 3300005544 | Bacteria | 2987 |
| 130 | Ga0070686_100083245 | 3300005544 | Bacteria | 2123 |
| 131 | Ga0070695_100009133 | 3300005545 | Bacteria | 5892 |
| 132 | Ga0070695_100182952 | 3300005545 | Bacteria | 1486 |
| 133 | Ga0070696_100012792 | 3300005546 | Bacteria | 5635 |
| 134 | Ga0070696_100296167 | 3300005546 | Bacteria | 1238 |
| 135 | Ga0070693_100009642 | 3300005547 | Bacteria | 4807 |
| 136 | Ga0070693_100307326 | 3300005547 | Bacteria | 1071 |
| 137 | Ga0070665_100063128 | 3300005548 | Bacteria | 3714 |
| 138 | Ga0070704_100033966 | 3300005549 | Bacteria | 3454 |
| 139 | Ga0070704_100110356 | 3300005549 | Bacteria | 2092 |
| 140 | Ga0070704_100216295 | 3300005549 | Bacteria | 1555 |
| 141 | Ga0068855_100003400 | 3300005563 | Bacteria | 19482 |
| 142 | Ga0068855_100198202 | 3300005563 | Bacteria | 2261 |
| 143 | Ga0070664_100088888 | 3300005564 | Bacteria | 2672 |
| 144 | Ga0070664_100126324 | 3300005564 | Bacteria | 2244 |
| 145 | Ga0070664_100147384 | 3300005564 | Bacteria | 2076 |
| 146 | Ga0068856_100100020 | 3300005614 | Bacteria | 2892 |
| 147 | Ga0068856_100626857 | 3300005614 | Bacteria | 1096 |
| 148 | Ga0068856_100810199 | 3300005614 | Bacteria | 956 |
| 149 | Ga0070702_100020075 | 3300005615 | Bacteria | 3495 |
| 150 | Ga0068852_100013654 | 3300005616 | Bacteria | 6221 |
| 151 | Ga0068852_100093625 | 3300005616 | Bacteria | 2694 |
| 152 | Ga0068859_100028474 | 3300005617 | Bacteria | 5601 |
| 153 | Ga0068859_100076343 | 3300005617 | Bacteria | 3391 |
| 154 | Ga0068859_100196995 | 3300005617 | Bacteria | 2099 |
| 155 | Ga0068864_100004952 | 3300005618 | Bacteria | 10916 |
| 156 | Ga0068864_100122537 | 3300005618 | Bacteria | 2326 |
| 157 | Ga0068861_100026741 | 3300005719 | Bacteria | 4198 |
| 158 | Ga0068870_10002588 | 3300005840 | Bacteria | 7566 |
| 159 | Ga0068870_10244661 | 3300005840 | Bacteria | 1109 |
| 160 | Ga0068863_100066888 | 3300005841 | Bacteria | 3399 |
| 161 | Ga0068858_100045358 | 3300005842 | Bacteria | 4073 |
| 162 | Ga0068858_100065195 | 3300005842 | Bacteria | 3370 |
| 163 | Ga0068860_100009906 | 3300005843 | Bacteria | 9449 |
| 164 | Ga0068860_100011216 | 3300005843 | Bacteria | 8833 |
| 165 | Ga0068862_100160968 | 3300005844 | Bacteria | 2003 |
| 166 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 167 | Ga0081455_10004932 | 3300005937 | Bacteria | 14751 |
| 168 | Ga0081455_10008420 | 3300005937 | Bacteria | 10727 |
| 169 | Ga0081455_10057181 | 3300005937 | Bacteria | 3307 |
| 170 | Ga0081538_10002583 | 3300005981 | Bacteria | 17565 |
| 171 | Ga0081538_10030812 | 3300005981 | Bacteria | 3633 |
| 172 | Ga0081540_1001340 | 3300005983 | Bacteria | 21426 |
| 173 | Ga0081540_1008163 | 3300005983 | Bacteria | 7342 |
| 174 | Ga0081540_1010314 | 3300005983 | Bacteria | 6335 |
| 175 | Ga0081540_1011704 | 3300005983 | Bacteria | 5840 |
| 176 | Ga0081539_10005816 | 3300005985 | Bacteria | 12256 |
| 177 | Ga0070717_10005088 | 3300006028 | Bacteria | 9591 |
| 178 | Ga0070717_10024817 | 3300006028 | Bacteria | 4764 |
| 179 | Ga0070717_10062327 | 3300006028 | Bacteria | 3092 |
| 180 | Ga0070717_10407040 | 3300006028 | Bacteria | 1223 |
| 181 | Ga0070717_10567076 | 3300006028 | Bacteria | 1029 |
| 182 | Ga0075365_10001115 | 3300006038 | Bacteria | 11722 |
| 183 | Ga0075365_10026232 | 3300006038 | Bacteria | 3697 |
| 184 | Ga0075365_10043276 | 3300006038 | Bacteria | 2948 |
| 185 | Ga0075363_100056248 | 3300006048 | Bacteria | 2109 |
| 186 | Ga0075364_10151566 | 3300006051 | Bacteria | 1562 |
| 187 | Ga0075432_10010346 | 3300006058 | Bacteria | 3164 |
| 188 | Ga0070715_10000228 | 3300006163 | Bacteria | 13420 |
| 189 | Ga0070716_100002514 | 3300006173 | Bacteria | 8490 |
| 190 | Ga0070716_100002657 | 3300006173 | Bacteria | 8268 |
| 191 | Ga0070716_100174166 | 3300006173 | Bacteria | 1407 |
| 192 | Ga0070716_100298995 | 3300006173 | Bacteria | 1119 |
| 193 | Ga0070712_100004899 | 3300006175 | Bacteria | 8279 |
| 194 | Ga0070712_100113137 | 3300006175 | Bacteria | 2029 |
| 195 | Ga0070712_100474563 | 3300006175 | Bacteria | 1045 |
| 196 | Ga0075362_10031006 | 3300006177 | Bacteria | 2312 |
| 197 | Ga0075367_10109833 | 3300006178 | Bacteria | 1692 |
| 198 | Ga0075427_10000177 | 3300006194 | Bacteria | 6278 |
| 199 | Ga0075366_10109470 | 3300006195 | Bacteria | 1661 |
| 200 | Ga0097621_100003454 | 3300006237 | Bacteria | 10890 |
| 201 | Ga0097621_100031649 | 3300006237 | Bacteria | 4199 |
| 202 | Ga0097621_100064409 | 3300006237 | Bacteria | 3014 |
| 203 | Ga0075370_10172860 | 3300006353 | Bacteria | 1270 |
| 204 | Ga0068871_100013353 | 3300006358 | Bacteria | 6095 |
| 205 | Ga0068871_100100007 | 3300006358 | Bacteria | 2428 |
| 206 | Ga0068871_100144782 | 3300006358 | Bacteria | 2022 |
| 207 | Ga0075428_100002731 | 3300006844 | Bacteria | 19203 |
| 208 | Ga0075428_100005626 | 3300006844 | Bacteria | 13923 |
| 209 | Ga0075428_100019585 | 3300006844 | Bacteria | 7487 |
| 210 | Ga0075428_100098453 | 3300006844 | Bacteria | 3188 |
| 211 | Ga0075428_100324037 | 3300006844 | Bacteria | 1655 |
| 212 | Ga0075430_100000129 | 3300006846 | Bacteria | 47714 |
| 213 | Ga0075430_100000671 | 3300006846 | Bacteria | 26160 |
| 214 | Ga0075430_100056451 | 3300006846 | Bacteria | 3302 |
| 215 | Ga0075430_100216879 | 3300006846 | Bacteria | 1588 |
| 216 | Ga0075431_100000191 | 3300006847 | Bacteria | 44571 |
| 217 | Ga0075431_100000234 | 3300006847 | Bacteria | 41571 |
| 218 | Ga0075431_100000703 | 3300006847 | Bacteria | 28837 |
| 219 | Ga0075431_100003687 | 3300006847 | Bacteria | 14878 |
| 220 | Ga0075431_100046187 | 3300006847 | Bacteria | 4490 |
| 221 | Ga0075431_100106202 | 3300006847 | Bacteria | 2897 |
| 222 | Ga0075431_100144285 | 3300006847 | Bacteria | 2453 |
| 223 | Ga0075431_100165170 | 3300006847 | Bacteria | 2275 |
| 224 | Ga0075433_10011581 | 3300006852 | Bacteria | 7104 |
| 225 | Ga0075433_10330572 | 3300006852 | Bacteria | 1348 |
| 226 | Ga0075433_10379553 | 3300006852 | Bacteria | 1248 |
| 227 | Ga0075434_100046515 | 3300006871 | Bacteria | 4305 |
| 228 | Ga0075434_100046619 | 3300006871 | Bacteria | 4301 |
| 229 | Ga0075434_100085048 | 3300006871 | Bacteria | 3162 |
| 230 | Ga0075434_100099822 | 3300006871 | Bacteria | 2908 |
| 231 | Ga0075434_100232570 | 3300006871 | Bacteria | 1863 |
| 232 | Ga0075434_100343167 | 3300006871 | Bacteria | 1514 |
| 233 | Ga0075434_100540324 | 3300006871 | Bacteria | 1185 |
| 234 | Ga0075429_100000278 | 3300006880 | Bacteria | 36057 |
| 235 | Ga0075429_100009144 | 3300006880 | Bacteria | 8602 |
| 236 | Ga0075429_100047607 | 3300006880 | Bacteria | 3730 |
| 237 | Ga0075429_100058753 | 3300006880 | Bacteria | 3349 |
| 238 | Ga0075429_100138422 | 3300006880 | Bacteria | 2131 |
| 239 | Ga0075429_100390275 | 3300006880 | Bacteria | 1219 |
| 240 | Ga0068865_100019549 | 3300006881 | Bacteria | 4384 |
| 241 | Ga0068865_100058808 | 3300006881 | Bacteria | 2687 |
| 242 | Ga0068865_100129872 | 3300006881 | Bacteria | 1886 |
| 243 | Ga0075436_100001205 | 3300006914 | Bacteria | 17600 |
| 244 | Ga0075436_100020207 | 3300006914 | Bacteria | 4571 |
| 245 | Ga0075436_100104141 | 3300006914 | Bacteria | 1978 |
| 246 | Ga0097620_100028474 | 3300006931 | Bacteria | 5601 |
| 247 | Ga0097620_100076345 | 3300006931 | Bacteria | 3391 |
| 248 | Ga0097620_100197006 | 3300006931 | Bacteria | 2099 |
| 249 | Ga0075435_100029132 | 3300007076 | Bacteria | 4332 |
| 250 | Ga0075435_100034779 | 3300007076 | Bacteria | 3994 |
| 251 | Ga0075435_100265873 | 3300007076 | Bacteria | 1462 |
| 252 | Ga0099794_10009640 | 3300007265 | Bacteria | 4071 |
| 253 | Ga0099795_10000463 | 3300007788 | Bacteria | 7512 |
| 254 | Ga0099795_10106889 | 3300007788 | Bacteria | 1104 |
| 255 | Ga0105240_10190345 | 3300009093 | Bacteria | 2413 |
| 256 | Ga0111539_10000066 | 3300009094 | Bacteria | 106021 |
| 257 | Ga0111539_10004252 | 3300009094 | Bacteria | 18756 |
| 258 | Ga0111539_10008250 | 3300009094 | Bacteria | 13259 |
| 259 | Ga0111539_10068014 | 3300009094 | Bacteria | 4205 |
| 260 | Ga0111539_10071300 | 3300009094 | Bacteria | 4100 |
| 261 | Ga0111539_10337243 | 3300009094 | Bacteria | 1755 |
| 262 | Ga0105245_10161914 | 3300009098 | Bacteria | 2124 |
| 263 | Ga0105245_10790899 | 3300009098 | Bacteria | 986 |
| 264 | Ga0105247_10034720 | 3300009101 | Bacteria | 3072 |
| 265 | Ga0114129_10000159 | 3300009147 | Bacteria | 72498 |
| 266 | Ga0114129_10005628 | 3300009147 | Bacteria | 17722 |
| 267 | Ga0114129_10020936 | 3300009147 | Bacteria | 9290 |
| 268 | Ga0114129_10032307 | 3300009147 | Bacteria | 7398 |
| 269 | Ga0114129_10052787 | 3300009147 | Bacteria | 5704 |
| 270 | Ga0114129_10393469 | 3300009147 | Bacteria | 1828 |
| 271 | Ga0114129_10424624 | 3300009147 | Bacteria | 1748 |
| 272 | Ga0114129_10874470 | 3300009147 | Bacteria | 1141 |
| 273 | Ga0105243_10008817 | 3300009148 | Bacteria | 7723 |
| 274 | Ga0105243_10016875 | 3300009148 | Bacteria | 5520 |
| 275 | Ga0105243_10222074 | 3300009148 | Bacteria | 1671 |
| 276 | Ga0105243_10234648 | 3300009148 | Bacteria | 1629 |
| 277 | Ga0105241_10203927 | 3300009174 | Bacteria | 1653 |
| 278 | Ga0105241_10276665 | 3300009174 | Bacteria | 1432 |
| 279 | Ga0105241_10282906 | 3300009174 | Bacteria | 1417 |
| 280 | Ga0105242_10005175 | 3300009176 | Bacteria | 10066 |
| 281 | Ga0105242_10170653 | 3300009176 | Bacteria | 1912 |
| 282 | Ga0105242_10531143 | 3300009176 | Bacteria | 1124 |
| 283 | Ga0105248_10046436 | 3300009177 | Bacteria | 4868 |
| 284 | Ga0105248_10066169 | 3300009177 | Bacteria | 4058 |
| 285 | Ga0105248_10206376 | 3300009177 | Bacteria | 2214 |
| 286 | Ga0105248_10212420 | 3300009177 | Bacteria | 2180 |
| 287 | Ga0105237_10039779 | 3300009545 | Bacteria | 4745 |
| 288 | Ga0105237_10041447 | 3300009545 | Bacteria | 4643 |
| 289 | Ga0105237_10279330 | 3300009545 | Bacteria | 1672 |
| 290 | Ga0105238_10013836 | 3300009551 | Bacteria | 8155 |
| 291 | Ga0105238_10286565 | 3300009551 | Bacteria | 1629 |
| 292 | Ga0105249_10000366 | 3300009553 | Bacteria | 44857 |
| 293 | Ga0105249_10003074 | 3300009553 | Bacteria | 14409 |
| 294 | Ga0105249_10079232 | 3300009553 | Bacteria | 3049 |
| 295 | Ga0105249_10205085 | 3300009553 | Bacteria | 1931 |
| 296 | Ga0105239_10085574 | 3300010375 | Bacteria | 3475 |
| 297 | Ga0105239_10131244 | 3300010375 | Bacteria | 2787 |
| 298 | Ga0105239_10145325 | 3300010375 | Bacteria | 2644 |
| 299 | Ga0105246_10016740 | 3300011119 | Bacteria | 4648 |
| 300 | Ga0157336_1001638 | 3300012477 | Bacteria | 1181 |
| 301 | Ga0157342_1000661 | 3300012507 | Bacteria | 2231 |
| 302 | Ga0157373_10008032 | 3300013100 | Bacteria | 7842 |
| 303 | Ga0157373_10187468 | 3300013100 | Bacteria | 1457 |
| 304 | Ga0157370_10024903 | 3300013104 | Bacteria | 5924 |
| 305 | Ga0157374_10029029 | 3300013296 | Bacteria | 5002 |
| 306 | Ga0157378_10109940 | 3300013297 | Bacteria | 2525 |
| 307 | Ga0157378_10156184 | 3300013297 | Bacteria | 2130 |
| 308 | Ga0163162_10025888 | 3300013306 | Bacteria | 5798 |
| 309 | Ga0163162_10047764 | 3300013306 | Bacteria | 4288 |
| 310 | Ga0163162_10084159 | 3300013306 | Bacteria | 3256 |
| 311 | Ga0157372_10001212 | 3300013307 | Bacteria | 27905 |
| 312 | Ga0157372_10753631 | 3300013307 | Bacteria | 1132 |
| 313 | Ga0157375_10038644 | 3300013308 | Bacteria | 4583 |
| 314 | Ga0157375_10304817 | 3300013308 | Bacteria | 1757 |
| 315 | Ga0157375_10460645 | 3300013308 | Bacteria | 1437 |
| 316 | Ga0163163_10047970 | 3300014325 | Bacteria | 4198 |
| 317 | Ga0163163_10050783 | 3300014325 | Bacteria | 4085 |
| 318 | Ga0163163_10215299 | 3300014325 | Bacteria | 1970 |
| 319 | Ga0157379_10020496 | 3300014968 | Bacteria | 5846 |
| 320 | Ga0157379_10083289 | 3300014968 | Bacteria | 2867 |
| 321 | Ga0157379_10226809 | 3300014968 | Bacteria | 1693 |
| 322 | Ga0157376_10157187 | 3300014969 | Bacteria | 2057 |
| 323 | Ga0163161_10044263 | 3300017792 | Bacteria | 3206 |
| 324 | Ga0213873_10054702 | 3300021358 | Bacteria | 1066 |
| 325 | Ga0213874_10010798 | 3300021377 | Bacteria | 2296 |
| 326 | Ga0213876_10061744 | 3300021384 | Bacteria | 1977 |
| 327 | Ga0207666_1000399 | 3300025271 | Bacteria | 5721 |
| 328 | Ga0207697_10005455 | 3300025315 | Bacteria | 5912 |
| 329 | Ga0207653_10059001 | 3300025885 | Bacteria | 1291 |
| 330 | Ga0207710_10004947 | 3300025900 | Bacteria | 5773 |
| 331 | Ga0207710_10013340 | 3300025900 | Bacteria | 3460 |
| 332 | Ga0207710_10136909 | 3300025900 | Bacteria | 1180 |
| 333 | Ga0207688_10003803 | 3300025901 | Bacteria | 8231 |
| 334 | Ga0207680_10153963 | 3300025903 | Bacteria | 1535 |
| 335 | Ga0207647_10003487 | 3300025904 | Bacteria | 11791 |
| 336 | Ga0207685_10002351 | 3300025905 | Bacteria | 4309 |
| 337 | Ga0207699_10000830 | 3300025906 | Bacteria | 14702 |
| 338 | Ga0207645_10005911 | 3300025907 | Bacteria | 8818 |
| 339 | Ga0207645_10036276 | 3300025907 | Bacteria | 3165 |
| 340 | Ga0207643_10000282 | 3300025908 | Bacteria | 35347 |
| 341 | Ga0207684_10021548 | 3300025910 | Bacteria | 5502 |
| 342 | Ga0207707_10038275 | 3300025912 | Bacteria | 4191 |
| 343 | Ga0207707_10384521 | 3300025912 | Bacteria | 1206 |
| 344 | Ga0207695_10348618 | 3300025913 | Bacteria | 1368 |
| 345 | Ga0207671_10094413 | 3300025914 | Bacteria | 2258 |
| 346 | Ga0207671_10325879 | 3300025914 | Bacteria | 1216 |
| 347 | Ga0207693_10000825 | 3300025915 | Bacteria | 27536 |
| 348 | Ga0207693_10004231 | 3300025915 | Bacteria | 12175 |
| 349 | Ga0207693_10076550 | 3300025915 | Bacteria | 2620 |
| 350 | Ga0207693_10169314 | 3300025915 | Bacteria | 1720 |
| 351 | Ga0207693_10274725 | 3300025915 | Bacteria | 1320 |
| 352 | Ga0207663_10072167 | 3300025916 | Bacteria | 2230 |
| 353 | Ga0207663_10192564 | 3300025916 | Bacteria | 1465 |
| 354 | Ga0207660_10293819 | 3300025917 | Bacteria | 1292 |
| 355 | Ga0207662_10002641 | 3300025918 | Bacteria | 9042 |
| 356 | Ga0207662_10012407 | 3300025918 | Bacteria | 4744 |
| 357 | Ga0207657_10013369 | 3300025919 | Bacteria | 8054 |
| 358 | Ga0207657_10035991 | 3300025919 | Bacteria | 4435 |
| 359 | Ga0207649_10006266 | 3300025920 | Bacteria | 6464 |
| 360 | Ga0207652_10045297 | 3300025921 | Bacteria | 3750 |
| 361 | Ga0207652_10160650 | 3300025921 | Bacteria | 2014 |
| 362 | Ga0207652_10341636 | 3300025921 | Bacteria | 1351 |
| 363 | Ga0207681_10037999 | 3300025923 | Bacteria | 3186 |
| 364 | Ga0207681_10426771 | 3300025923 | Bacteria | 1075 |
| 365 | Ga0207650_10012239 | 3300025925 | Bacteria | 5921 |
| 366 | Ga0207650_10018124 | 3300025925 | Bacteria | 4936 |
| 367 | Ga0207650_10023849 | 3300025925 | Bacteria | 4343 |
| 368 | Ga0207659_10053434 | 3300025926 | Bacteria | 2881 |
| 369 | Ga0207659_10293924 | 3300025926 | Bacteria | 1332 |
| 370 | Ga0207687_10011618 | 3300025927 | Bacteria | 5755 |
| 371 | Ga0207687_10012335 | 3300025927 | Bacteria | 5588 |
| 372 | Ga0207687_10306746 | 3300025927 | Bacteria | 1280 |
| 373 | Ga0207700_10000357 | 3300025928 | Bacteria | 26717 |
| 374 | Ga0207700_10010421 | 3300025928 | Bacteria | 5864 |
| 375 | Ga0207700_10254170 | 3300025928 | Bacteria | 1502 |
| 376 | Ga0207700_10336327 | 3300025928 | Bacteria | 1312 |
| 377 | Ga0207664_10030512 | 3300025929 | Bacteria | 4117 |
| 378 | Ga0207644_10004870 | 3300025931 | Bacteria | 8743 |
| 379 | Ga0207644_10012722 | 3300025931 | Bacteria | 5595 |
| 380 | Ga0207644_10077830 | 3300025931 | Bacteria | 2443 |
| 381 | Ga0207644_10178457 | 3300025931 | Bacteria | 1663 |
| 382 | Ga0207690_10033218 | 3300025932 | Bacteria | 3316 |
| 383 | Ga0207690_10074626 | 3300025932 | Bacteria | 2349 |
| 384 | Ga0207690_10229164 | 3300025932 | Bacteria | 1425 |
| 385 | Ga0207706_10009306 | 3300025933 | Bacteria | 9019 |
| 386 | Ga0207706_10010708 | 3300025933 | Bacteria | 8377 |
| 387 | Ga0207706_10108972 | 3300025933 | Bacteria | 2437 |
| 388 | Ga0207706_10121426 | 3300025933 | Bacteria | 2298 |
| 389 | Ga0207686_10039044 | 3300025934 | Bacteria | 2878 |
| 390 | Ga0207686_10039415 | 3300025934 | Bacteria | 2867 |
| 391 | Ga0207709_10009063 | 3300025935 | Bacteria | 5487 |
| 392 | Ga0207709_10127906 | 3300025935 | Bacteria | 1726 |
| 393 | Ga0207709_10254369 | 3300025935 | Bacteria | 1285 |
| 394 | Ga0207670_10027178 | 3300025936 | Bacteria | 3615 |
| 395 | Ga0207670_10067009 | 3300025936 | Bacteria | 2468 |
| 396 | Ga0207670_10359697 | 3300025936 | Bacteria | 1155 |
| 397 | Ga0207669_10128172 | 3300025937 | Bacteria | 1738 |
| 398 | Ga0207669_10226770 | 3300025937 | Bacteria | 1375 |
| 399 | Ga0207704_10004523 | 3300025938 | Bacteria | 6358 |
| 400 | Ga0207665_10000350 | 3300025939 | Bacteria | 31910 |
| 401 | Ga0207665_10000712 | 3300025939 | Bacteria | 22565 |
| 402 | Ga0207665_10103635 | 3300025939 | Bacteria | 1990 |
| 403 | Ga0207665_10136920 | 3300025939 | Bacteria | 1743 |
| 404 | Ga0207691_10000635 | 3300025940 | Bacteria | 34764 |
| 405 | Ga0207691_10108638 | 3300025940 | Bacteria | 2469 |
| 406 | Ga0207711_10007270 | 3300025941 | Bacteria | 9280 |
| 407 | Ga0207711_10045572 | 3300025941 | Bacteria | 3747 |
| 408 | Ga0207711_10315950 | 3300025941 | Bacteria | 1443 |
| 409 | Ga0207689_10100015 | 3300025942 | Bacteria | 2383 |
| 410 | Ga0207689_10137901 | 3300025942 | Bacteria | 2009 |
| 411 | Ga0207661_10015887 | 3300025944 | Bacteria | 5546 |
| 412 | Ga0207679_10064114 | 3300025945 | Bacteria | 2745 |
| 413 | Ga0207679_10120030 | 3300025945 | Bacteria | 2091 |
| 414 | Ga0207667_10057070 | 3300025949 | Bacteria | 4100 |
| 415 | Ga0207667_10256301 | 3300025949 | Bacteria | 1789 |
| 416 | Ga0207651_10014878 | 3300025960 | Bacteria | 4505 |
| 417 | Ga0207712_10012436 | 3300025961 | Bacteria | 5437 |
| 418 | Ga0207712_10137123 | 3300025961 | Bacteria | 1873 |
| 419 | Ga0207712_10199182 | 3300025961 | Bacteria | 1587 |
| 420 | Ga0207668_10312578 | 3300025972 | Bacteria | 1301 |
| 421 | Ga0207640_10180727 | 3300025981 | Bacteria | 1581 |
| 422 | Ga0207658_10005792 | 3300025986 | Bacteria | 8455 |
| 423 | Ga0207658_10008239 | 3300025986 | Bacteria | 7100 |
| 424 | Ga0207658_10090914 | 3300025986 | Bacteria | 2367 |
| 425 | Ga0207658_10184023 | 3300025986 | Bacteria | 1731 |
| 426 | Ga0207658_10408818 | 3300025986 | Bacteria | 1194 |
| 427 | Ga0207677_10010752 | 3300026023 | Bacteria | 5188 |
| 428 | Ga0207703_10001597 | 3300026035 | Bacteria | 20511 |
| 429 | Ga0207703_10020521 | 3300026035 | Bacteria | 5167 |
| 430 | Ga0207639_10021130 | 3300026041 | Bacteria | 4670 |
| 431 | Ga0207678_10017565 | 3300026067 | Bacteria | 6283 |
| 432 | Ga0207678_10076502 | 3300026067 | Bacteria | 2867 |
| 433 | Ga0207708_10006680 | 3300026075 | Bacteria | 8532 |
| 434 | Ga0207708_10017203 | 3300026075 | Bacteria | 5442 |
| 435 | Ga0207708_10252927 | 3300026075 | Bacteria | 1420 |
| 436 | Ga0207708_10258272 | 3300026075 | Bacteria | 1406 |
| 437 | Ga0207702_10088399 | 3300026078 | Bacteria | 2707 |
| 438 | Ga0207702_10315817 | 3300026078 | Bacteria | 1487 |
| 439 | Ga0207641_10001852 | 3300026088 | Bacteria | 20304 |
| 440 | Ga0207641_10113107 | 3300026088 | Bacteria | 2410 |
| 441 | Ga0207648_10001759 | 3300026089 | Bacteria | 23721 |
| 442 | Ga0207648_10033362 | 3300026089 | Bacteria | 4541 |
| 443 | Ga0207676_10003928 | 3300026095 | Bacteria | 10495 |
| 444 | Ga0207676_10119625 | 3300026095 | Bacteria | 2218 |
| 445 | Ga0207674_10333038 | 3300026116 | Bacteria | 1468 |
| 446 | Ga0207674_10398844 | 3300026116 | Bacteria | 1329 |
| 447 | Ga0207675_100001019 | 3300026118 | Bacteria | 27761 |
| 448 | Ga0207675_100077629 | 3300026118 | Bacteria | 3111 |
| 449 | Ga0207675_100242677 | 3300026118 | Bacteria | 1741 |
| 450 | Ga0207683_10005171 | 3300026121 | Bacteria | 11201 |
| 451 | Ga0207683_10008774 | 3300026121 | Bacteria | 8632 |
| 452 | Ga0207683_10069231 | 3300026121 | Bacteria | 3116 |
| 453 | Ga0207698_10131826 | 3300026142 | Bacteria | 2137 |
| 454 | Ga0209179_1016087 | 3300027512 | Bacteria | 1399 |
| 455 | Ga0209588_1003054 | 3300027671 | Bacteria | 4613 |
| 456 | Ga0209998_10001514 | 3300027717 | Bacteria | 5586 |
| 457 | Ga0209813_10029850 | 3300027866 | Bacteria | 1599 |
| 458 | Ga0207428_10000146 | 3300027907 | Bacteria | 95417 |
| 459 | Ga0207428_10000590 | 3300027907 | Bacteria | 42889 |
| 460 | Ga0207428_10001295 | 3300027907 | Bacteria | 26654 |
| 461 | Ga0268266_10005025 | 3300028379 | Bacteria | 12489 |
| 462 | Ga0268266_10033266 | 3300028379 | Bacteria | 4383 |
| 463 | Ga0268265_10007254 | 3300028380 | Bacteria | 7493 |
| 464 | Ga0268265_10278131 | 3300028380 | Bacteria | 1496 |
| 465 | Ga0268265_10818198 | 3300028380 | Bacteria | 909 |
| 466 | Ga0268264_10043442 | 3300028381 | Bacteria | 3724 |
| 467 | Ga0268264_10062146 | 3300028381 | Bacteria | 3135 |
| 468 | Ga0265337_1004366 | 3300028556 | Bacteria | 5876 |
| 469 | Ga0265332_10000775 | 3300031238 | Bacteria | 19591 |
| 470 | Ga0265328_10009992 | 3300031239 | Bacteria | 3838 |
| 471 | Ga0265325_10001890 | 3300031241 | Bacteria | 14468 |
| 472 | Ga0265325_10005723 | 3300031241 | Bacteria | 7635 |
| 473 | Ga0265340_10025379 | 3300031247 | Bacteria | 3001 |
| 474 | Ga0265340_10044107 | 3300031247 | Bacteria | 2182 |
| 475 | Ga0265339_10000776 | 3300031249 | Bacteria | 24705 |
| 476 | Ga0265339_10006606 | 3300031249 | Bacteria | 7588 |
| 477 | Ga0265331_10001173 | 3300031250 | Bacteria | 19984 |
| 478 | Ga0265331_10024213 | 3300031250 | Bacteria | 3074 |
| 479 | Ga0265327_10009646 | 3300031251 | Bacteria | 6930 |
| 480 | Ga0265316_10015840 | 3300031344 | Bacteria | 6566 |
| 481 | Ga0265316_10177401 | 3300031344 | Bacteria | 1587 |
| 482 | Ga0265316_10275577 | 3300031344 | Bacteria | 1230 |
| 483 | Ga0265313_10000175 | 3300031595 | Bacteria | 68104 |
| 484 | Ga0265313_10000682 | 3300031595 | Bacteria | 34986 |
| 485 | Ga0265314_10057024 | 3300031711 | Bacteria | 2686 |
| 486 | Ga0265342_10000364 | 3300031712 | Bacteria | 50013 |
| 487 | Ga0373930_0000005 | 3300034816 | Bacteria | 25122 |
| 488 | Ga0373948_0000195 | 3300034817 | Bacteria | 7004 |
| 489 | Ga0373948_0002757 | 3300034817 | Bacteria | 2632 |
| 490 | Ga0373950_0000295 | 3300034818 | Bacteria | 6252 |
| 491 | Ga0373958_0001568 | 3300034819 | Bacteria | 3092 |
| 492 | Ga0373938_0000414 | 3300034957 | Bacteria | 6886 |
| 493 | Ga0373926_0005849 | 3300035083 | Bacteria | 4064 |
| 494 | Ga0373926_0076268 | 3300035083 | Bacteria | 1236 |
| 495 | Ga0373928_0003138 | 3300035084 | Bacteria | 3169 |
| 496 | Ga0373928_0019371 | 3300035084 | Bacteria | 1419 |
| 497 | Ga0373934_0015528 | 3300035086 | Bacteria | 2890 |
| 498 | Ga0373940_0000260 | 3300035088 | Bacteria | 7593 |
| 499 | Ga0373944_0002022 | 3300035089 | Bacteria | 5141 |
| 500 | Ga0373944_0046082 | 3300035089 | Bacteria | 1362 |
| 501 | Ga0373949_0000302 | 3300035090 | Bacteria | 17850 |
| 502 | Ga0373951_0009014 | 3300035091 | Bacteria | 2249 |
| 503 | Ga0373951_0012124 | 3300035091 | Bacteria | 1938 |
| 504 | Ga0373952_0001165 | 3300035092 | Bacteria | 4791 |
| 505 | Ga0373952_0001199 | 3300035092 | Bacteria | 4720 |
| 506 | Ga0373923_0055315 | 3300035111 | Bacteria | 1672 |
| 507 | Ga0373932_0002389 | 3300035112 | Bacteria | 4764 |
| 508 | Ga0373932_0002551 | 3300035112 | Bacteria | 4561 |
| 509 | Ga0373932_0045324 | 3300035112 | Bacteria | 1286 |
| 510 | Ga0373936_0050698 | 3300035113 | Bacteria | 1679 |
| 511 | Ga0373936_0059402 | 3300035113 | Bacteria | 1558 |
| 512 | Ga0373936_0082148 | 3300035113 | Bacteria | 1342 |
| 513 | Ga0373941_0000116 | 3300035115 | Bacteria | 13637 |
| 514 | Ga0373945_0001576 | 3300035116 | Bacteria | 6986 |
| 515 | Ga0373953_0062577 | 3300035117 | Bacteria | 1523 |
| 516 | Ga0373954_0006555 | 3300035118 | Bacteria | 5074 |
| 517 | Ga0373954_0100900 | 3300035118 | Bacteria | 1392 |
| 518 | Ga0373956_0049573 | 3300035119 | Bacteria | 1883 |
| 519 | Ga0373956_0076367 | 3300035119 | Bacteria | 1533 |
| 520 | Ga0373956_0128184 | 3300035119 | Bacteria | 1187 |
| 521 | Ga0373956_0144854 | 3300035119 | Bacteria | 1116 |
| 522 | Ga0373957_0064067 | 3300035120 | Bacteria | 1428 |
| 523 | Ga0373960_0002193 | 3300035121 | Bacteria | 4389 |
| 524 | Ga0373960_0012058 | 3300035121 | Bacteria | 2141 |
| 525 | Ga0373943_0005783 | 3300035170 | Bacteria | 5554 |
| 526 | Ga0373943_0126881 | 3300035170 | Bacteria | 1361 |
| 527 | Ga0373946_0013805 | 3300035171 | Bacteria | 3041 |
| 528 | Ga0373946_0038608 | 3300035171 | Bacteria | 1945 |
| 529 | Ga0373946_0194450 | 3300035171 | Bacteria | 969 |
| 530 | Ga0373955_0004149 | 3300035172 | Bacteria | 6395 |
| 531 | Ga0373955_0025797 | 3300035172 | Bacteria | 3021 |
| 532 | Ga0373955_0044493 | 3300035172 | Bacteria | 2392 |
| 533 | Ga0373955_0057905 | 3300035172 | Bacteria | 2130 |
| 534 | Ga0373942_0005527 | 3300035207 | Bacteria | 2929 |
| 535 | Ga0373961_0000828 | 3300035241 | Bacteria | 10508 |
| 536 | Ga0373962_0000650 | 3300035242 | Bacteria | 7900 |
| 537 | Ga0373962_0005168 | 3300035242 | Bacteria | 3154 |
| 538 | Ga0316574_0001939 | 3300035398 | Bacteria | 10146 |
| 539 | Ga0373924_0002029 | 3300035410 | Bacteria | 6749 |
| 540 | Ga0373931_0111992 | 3300035691 | Bacteria | 1549 |
| 541 | Ga0373931_0127272 | 3300035691 | Bacteria | 1462 |
| 542 | Ga0373935_0002255 | 3300035692 | Bacteria | 10975 |
| 543 | Ga0373935_0008678 | 3300035692 | Bacteria | 6084 |
| 544 | Ga0373935_0338881 | 3300035692 | Bacteria | 1070 |
| 545 | Ga0373927_0006726 | 3300035695 | Bacteria | 7826 |
| 546 | Ga0373927_0012770 | 3300035695 | Bacteria | 5588 |
| 547 | Ga0373927_0035269 | 3300035695 | Bacteria | 3253 |
| 548 | Ga0373927_0047612 | 3300035695 | Bacteria | 2773 |
| 549 | Ga0373933_0001165 | 3300035724 | Bacteria | 15591 |
| 550 | Ga0373933_0020208 | 3300035724 | Bacteria | 3773 |
| 551 | Ga0373933_0081410 | 3300035724 | Bacteria | 1986 |
| 552 | Ga0373933_0169185 | 3300035724 | Bacteria | 1390 |
| 553 | Ga0373947_0019847 | 3300035725 | Bacteria | 3879 |
| 554 | Ga0373947_0058836 | 3300035725 | Bacteria | 2329 |
| 555 | Ga0373947_0096798 | 3300035725 | Bacteria | 1849 |
| 556 | Ga0373937_0000421 | 3300036401 | Bacteria | 39506 |
| 557 | Ga0373937_0006973 | 3300036401 | Bacteria | 9754 |
| 558 | Ga0373937_0036698 | 3300036401 | Bacteria | 4467 |
| 559 | Ga0373937_0078334 | 3300036401 | Bacteria | 3054 |
| 560 | Ga0316584_0041862 | 3300036712 | Bacteria | 3415 |
| 561 | Ga0373925_0001412 | 3300037068 | Bacteria | 20860 |
| 562 | Ga0373925_0018265 | 3300037068 | Bacteria | 5096 |
| 563 | Ga0373925_0090465 | 3300037068 | Bacteria | 2339 |
| 564 | Ga0373925_0209854 | 3300037068 | Bacteria | 1551 |
| 565 | Ga0395900_0003909 | 3300037418 | Bacteria | 15916 |
| 566 | Ga0395898_0003084 | 3300037466 | Bacteria | 18858 |
| 567 | Ga0395898_0069133 | 3300037466 | Bacteria | 3417 |
| 568 | Ga0395898_0567244 | 3300037466 | Bacteria | 1077 |
| 569 | Ga0395905_0051391 | 3300037471 | Bacteria | 3861 |
| 570 | Ga0395901_0290348 | 3300038443 | Bacteria | 1697 |
| 571 | Ga0395901_0394512 | 3300038443 | Bacteria | 1422 |
| 572 | Ga0436365_0349290 | 3300039437 | Bacteria | 985 |
| 573 | Ga0436365_0399377 | 3300039437 | Bacteria | 16297 |
| 574 | Ga0436365_0783605 | 3300039437 | Bacteria | 5936 |
| 575 | Ga0436360_0949241 | 3300039438 | Bacteria | 2941 |
| 576 | Ga0436361_0314414 | 3300039447 | Bacteria | 2663 |
| 577 | Ga0436361_0346331 | 3300039447 | Bacteria | 11535 |
| 578 | Ga0436363_1326955 | 3300039450 | Bacteria | 5570 |
| 579 | Ga0451853_0003971 | 3300041512 | Bacteria | 935 |
| 580 | Ga0439460_0061488 | 3300042461 | Bacteria | 1147 |
| 581 | Ga0451577_0089937 | 3300042876 | Bacteria | 2740 |
| 582 | Ga0466966_0116766 | 3300044684 | Bacteria | 1642 |
| 583 | Ga0466961_0133414 | 3300044693 | Bacteria | 1556 |
| 584 | Ga0466963_0228567 | 3300044694 | Bacteria | 1303 |
| 585 | Ga0453684_0296980 | 3300044712 | Bacteria | 1837 |
| 586 | Ga0495603_0007476 | 3300046455 | Bacteria | 6571 |
| 587 | Ga0495603_0036789 | 3300046455 | Bacteria | 2938 |
| 588 | Ga0495629_0000909 | 3300046459 | Bacteria | 23761 |
| 589 | Ga0495629_0061542 | 3300046459 | Bacteria | 2623 |
| 590 | Ga0495629_0125578 | 3300046459 | Bacteria | 1787 |
| 591 | Ga0495629_0153262 | 3300046459 | Bacteria | 1601 |
| 592 | Ga0495638_0064672 | 3300046460 | Bacteria | 2253 |
| 593 | Ga0495641_0020796 | 3300046461 | Bacteria | 3317 |
| 594 | Ga0495651_0003409 | 3300046462 | Bacteria | 12188 |
| 595 | Ga0495651_0111824 | 3300046462 | Bacteria | 2018 |
| 596 | Ga0495651_0134781 | 3300046462 | Bacteria | 1798 |
| 597 | Ga0495653_0015806 | 3300046463 | Bacteria | 6154 |
| 598 | Ga0495653_0055494 | 3300046463 | Bacteria | 3023 |
| 599 | Ga0495653_0091973 | 3300046463 | Bacteria | 2216 |
| 600 | Ga0495580_0014461 | 3300046472 | Bacteria | 5986 |
| 601 | Ga0495580_0031835 | 3300046472 | Bacteria | 3809 |
| 602 | Ga0495580_0077208 | 3300046472 | Bacteria | 2323 |
| 603 | Ga0495582_0003962 | 3300046473 | Bacteria | 8319 |
| 604 | Ga0495582_0020491 | 3300046473 | Bacteria | 3620 |
| 605 | Ga0495582_0049117 | 3300046473 | Bacteria | 2323 |
| 606 | Ga0495582_0184184 | 3300046473 | Bacteria | 1190 |
| 607 | Ga0495605_0182790 | 3300046474 | Bacteria | 921 |
| 608 | Ga0495639_0052696 | 3300046475 | Bacteria | 1853 |
| 609 | Ga0495639_0092073 | 3300046475 | Bacteria | 1423 |
| 610 | Ga0495639_0144124 | 3300046475 | Bacteria | 1146 |
| 611 | Ga0495664_0021709 | 3300046477 | Bacteria | 3709 |
| 612 | Ga0495584_0005371 | 3300046491 | Bacteria | 6792 |
| 613 | Ga0495584_0035946 | 3300046491 | Bacteria | 2503 |
| 614 | Ga0495584_0036313 | 3300046491 | Bacteria | 2490 |
| 615 | Ga0495585_0002497 | 3300046492 | Bacteria | 13093 |
| 616 | Ga0495585_0004211 | 3300046492 | Bacteria | 9392 |
| 617 | Ga0495594_0012627 | 3300046499 | Bacteria | 4403 |
| 618 | Ga0495607_0001563 | 3300046501 | Bacteria | 20034 |
| 619 | Ga0495607_0035657 | 3300046501 | Bacteria | 3007 |
| 620 | Ga0495608_0035888 | 3300046511 | Bacteria | 3340 |
| 621 | Ga0495608_0036295 | 3300046511 | Bacteria | 3318 |
| 622 | Ga0495616_0130505 | 3300046513 | Bacteria | 1152 |
| 623 | Ga0495618_0017389 | 3300046514 | Bacteria | 4409 |
| 624 | Ga0495618_0049854 | 3300046514 | Bacteria | 2644 |
| 625 | Ga0495618_0326349 | 3300046514 | Bacteria | 950 |
| 626 | Ga0495628_0055747 | 3300046516 | Bacteria | 3112 |
| 627 | Ga0495630_0050210 | 3300046517 | Bacteria | 3122 |
| 628 | Ga0495630_0056532 | 3300046517 | Bacteria | 2940 |
| 629 | Ga0495630_0407556 | 3300046517 | Bacteria | 1042 |
| 630 | Ga0495644_0002018 | 3300046523 | Bacteria | 8164 |
| 631 | Ga0495666_0049082 | 3300046526 | Bacteria | 2031 |
| 632 | Ga0495642_0075532 | 3300046528 | Bacteria | 1414 |
| 633 | Ga0495652_0078500 | 3300046529 | Bacteria | 2732 |
| 634 | Ga0495652_0101406 | 3300046529 | Bacteria | 2333 |
| 635 | Ga0495665_0020984 | 3300046531 | Bacteria | 3510 |
| 636 | Ga0495640_0020265 | 3300046533 | Bacteria | 4897 |
| 637 | Ga0495640_0024328 | 3300046533 | Bacteria | 4408 |
| 638 | Ga0495640_0066127 | 3300046533 | Bacteria | 2438 |
| 639 | Ga0495586_0007988 | 3300046535 | Bacteria | 5645 |
| 640 | Ga0495587_0001462 | 3300046536 | Bacteria | 15744 |
| 641 | Ga0495587_0005579 | 3300046536 | Bacteria | 8211 |
| 642 | Ga0495598_0000136 | 3300046537 | Bacteria | 12449 |
| 643 | Ga0495645_0024716 | 3300046543 | Bacteria | 4359 |
| 644 | Ga0495645_0033675 | 3300046543 | Bacteria | 3737 |
| 645 | Ga0495645_0177222 | 3300046543 | Bacteria | 1463 |
| 646 | Ga0495633_0000645 | 3300046558 | Bacteria | 32436 |
| 647 | Ga0495633_0076441 | 3300046558 | Bacteria | 1559 |
| 648 | Ga0495667_0003889 | 3300046559 | Bacteria | 10023 |
| 649 | Ga0495667_0006572 | 3300046559 | Bacteria | 7891 |
| 650 | Ga0495656_0000157 | 3300046615 | Bacteria | 24846 |
| 651 | Ga0495656_0011926 | 3300046615 | Bacteria | 3198 |
| 652 | Ga0495634_0223214 | 3300046642 | Bacteria | 1162 |
| 653 | Ga0495634_0289790 | 3300046642 | Bacteria | 992 |
| 654 | Ga0495611_0002887 | 3300046648 | Bacteria | 7676 |
| 655 | Ga0495635_0014721 | 3300046663 | Bacteria | 5472 |
| 656 | Ga0495635_0024328 | 3300046663 | Bacteria | 4221 |
| 657 | Ga0495635_0138766 | 3300046663 | Bacteria | 1656 |
| 658 | Ga0495635_0274592 | 3300046663 | Bacteria | 1133 |
| 659 | Ga0495659_0000479 | 3300046664 | Bacteria | 14780 |
| 660 | Ga0495659_0006252 | 3300046664 | Bacteria | 3763 |
| 661 | Ga0495659_0054341 | 3300046664 | Bacteria | 1465 |
| 662 | Ga0495661_0058137 | 3300046665 | Bacteria | 2306 |
| 663 | Ga0495588_0003988 | 3300046674 | Bacteria | 6485 |
| 664 | Ga0495657_0023233 | 3300046675 | Bacteria | 4432 |
| 665 | Ga0495599_0004437 | 3300046678 | Bacteria | 8304 |
| 666 | Ga0495599_0014742 | 3300046678 | Bacteria | 4839 |
| 667 | Ga0495623_0004691 | 3300046679 | Bacteria | 8982 |
| 668 | Ga0495623_0008559 | 3300046679 | Bacteria | 6644 |
| 669 | Ga0495646_0054629 | 3300046680 | Bacteria | 2401 |
| 670 | Ga0495647_0003000 | 3300046681 | Bacteria | 5370 |
| 671 | Ga0495647_0028699 | 3300046681 | Bacteria | 2053 |
| 672 | Ga0495658_0008890 | 3300046683 | Bacteria | 4994 |
| 673 | Ga0495658_0014487 | 3300046683 | Bacteria | 4031 |
| 674 | Ga0495658_0017954 | 3300046683 | Bacteria | 3668 |
| 675 | Ga0495658_0047342 | 3300046683 | Bacteria | 2421 |
| 676 | Ga0495613_0041365 | 3300046689 | Bacteria | 3413 |
| 677 | Ga0495613_0058462 | 3300046689 | Bacteria | 2829 |
| 678 | Ga0495624_0049293 | 3300046690 | Bacteria | 2671 |
| 679 | Ga0495624_0079950 | 3300046690 | Bacteria | 2026 |
| 680 | Ga0495670_0000299 | 3300046691 | Bacteria | 23362 |
| 681 | Ga0495670_0021379 | 3300046691 | Bacteria | 3190 |
| 682 | Ga0495649_0155445 | 3300046694 | Bacteria | 1200 |
| 683 | Ga0495589_0018300 | 3300046794 | Bacteria | 3594 |
| 684 | Ga0495600_0020831 | 3300046809 | Bacteria | 4196 |
| 685 | Ga0495600_0022028 | 3300046809 | Bacteria | 4088 |
| 686 | Ga0495581_0012984 | 3300047315 | Bacteria | 4828 |
| 687 | Ga0495581_0177565 | 3300047315 | Bacteria | 1245 |
| 688 | Ga0495581_0317975 | 3300047315 | Bacteria | 909 |
| 689 | Ga0495604_0013118 | 3300047317 | Bacteria | 6601 |
| 690 | Ga0495604_0022597 | 3300047317 | Bacteria | 5021 |
| 691 | Ga0495604_0028575 | 3300047317 | Bacteria | 4437 |
| 692 | Ga0495636_0181638 | 3300047318 | Bacteria | 955 |
| 693 | Ga0495674_0054151 | 3300047319 | Bacteria | 3524 |
| 694 | Ga0495674_0080679 | 3300047319 | Bacteria | 2791 |
| 695 | Ga0495674_0267069 | 3300047319 | Bacteria | 1405 |
| 696 | Ga0495674_0279016 | 3300047319 | Bacteria | 1369 |
| 697 | Ga0495674_0343696 | 3300047319 | Bacteria | 1212 |
| 698 | Ga0495672_0052538 | 3300047320 | Bacteria | 2393 |
| 699 | Ga0495672_0156235 | 3300047320 | Bacteria | 1178 |
| 700 | Ga0495676_0168770 | 3300047321 | Bacteria | 1542 |
| 701 | Ga0495680_0021609 | 3300047322 | Bacteria | 5384 |
| 702 | Ga0495680_0032842 | 3300047322 | Bacteria | 4208 |
| 703 | Ga0495680_0034725 | 3300047322 | Bacteria | 4068 |
| 704 | Ga0495675_0000147 | 3300047444 | Bacteria | 49274 |
| 705 | Ga0495675_0070541 | 3300047444 | Bacteria | 2206 |
| 706 | Ga0495679_013420 | 3300047446 | Bacteria | 3078 |
| 707 | Ga0495684_0003553 | 3300047471 | Bacteria | 12176 |
| 708 | Ga0495593_0035621 | 3300047673 | Bacteria | 2701 |
| 709 | Ga0495593_0124882 | 3300047673 | Bacteria | 1308 |
| 710 | Ga0495602_0012962 | 3300048088 | Bacteria | 8533 |
| 711 | Ga0495602_0052878 | 3300048088 | Bacteria | 3603 |
| 712 | Ga0495615_0013185 | 3300048090 | Bacteria | 1722 |
| 713 | Ga0496100_0003759 | 3300048903 | Bacteria | 7951 |
| 714 | Ga0496100_0013884 | 3300048903 | Bacteria | 4661 |
| 715 | Ga0496100_0037629 | 3300048903 | Bacteria | 3060 |
| 716 | Ga0496100_0250870 | 3300048903 | Bacteria | 1309 |
| 717 | Ga0496101_0003453 | 3300048904 | Bacteria | 9856 |
| 718 | Ga0496101_0024079 | 3300048904 | Bacteria | 4211 |
| 719 | Ga0496101_0047314 | 3300048904 | Bacteria | 3087 |
| 720 | Ga0496101_0104185 | 3300048904 | Bacteria | 2127 |
| 721 | Ga0496101_0325032 | 3300048904 | Bacteria | 1207 |
| 722 | Ga0496102_0013309 | 3300048905 | Bacteria | 7126 |
| 723 | Ga0496102_0079880 | 3300048905 | Bacteria | 3012 |
| 724 | Ga0496102_0099145 | 3300048905 | Bacteria | 2704 |
| 725 | Ga0496102_0106943 | 3300048905 | Bacteria | 2604 |
| 726 | Ga0496102_0142887 | 3300048905 | Bacteria | 2245 |
| 727 | Ga0496103_0001040 | 3300048906 | Bacteria | 19437 |
| 728 | Ga0496103_0030239 | 3300048906 | Bacteria | 3295 |
| 729 | Ga0496103_0036770 | 3300048906 | Bacteria | 2999 |
| 730 | Ga0496104_0000203 | 3300048907 | Bacteria | 53173 |
| 731 | Ga0496104_0001141 | 3300048907 | Bacteria | 22750 |
| 732 | Ga0496104_0004850 | 3300048907 | Bacteria | 11721 |
| 733 | Ga0496104_0007178 | 3300048907 | Bacteria | 9823 |
| 734 | Ga0496104_0018039 | 3300048907 | Bacteria | 6434 |
| 735 | Ga0496104_0055262 | 3300048907 | Bacteria | 3754 |
| 736 | Ga0496104_0084786 | 3300048907 | Bacteria | 3023 |
| 737 | Ga0496104_0089160 | 3300048907 | Bacteria | 2946 |
| 738 | Ga0496104_0102425 | 3300048907 | Bacteria | 2742 |
| 739 | Ga0496104_0184064 | 3300048907 | Bacteria | 1999 |
| 740 | Ga0496105_0001053 | 3300048908 | Bacteria | 19140 |
| 741 | Ga0496105_0004734 | 3300048908 | Bacteria | 10269 |
| 742 | Ga0496105_0014042 | 3300048908 | Bacteria | 6372 |
| 743 | Ga0496105_0014497 | 3300048908 | Bacteria | 6275 |
| 744 | Ga0496105_0032630 | 3300048908 | Bacteria | 4274 |
| 745 | Ga0496105_0348788 | 3300048908 | Bacteria | 1183 |
| 746 | Ga0496106_0007594 | 3300048909 | Bacteria | 8019 |
| 747 | Ga0496106_0011758 | 3300048909 | Bacteria | 6462 |
| 748 | Ga0496106_0036001 | 3300048909 | Bacteria | 3702 |
| 749 | Ga0496106_0108749 | 3300048909 | Bacteria | 2156 |
| 750 | Ga0496106_0300817 | 3300048909 | Bacteria | 1286 |
| 751 | Ga0496107_0002528 | 3300048910 | Bacteria | 11905 |
| 752 | Ga0496107_0011416 | 3300048910 | Bacteria | 6187 |
| 753 | Ga0496107_0035459 | 3300048910 | Bacteria | 3576 |
| 754 | Ga0496107_0112745 | 3300048910 | Bacteria | 1999 |
| 755 | Ga0496108_0006373 | 3300048911 | Bacteria | 9564 |
| 756 | Ga0496108_0015010 | 3300048911 | Bacteria | 6323 |
| 757 | Ga0496108_0030339 | 3300048911 | Bacteria | 4480 |
| 758 | Ga0496108_0039148 | 3300048911 | Bacteria | 3952 |
| 759 | Ga0496108_0039865 | 3300048911 | Bacteria | 3915 |
| 760 | Ga0496108_0069283 | 3300048911 | Bacteria | 2976 |
| 761 | Ga0496108_0071934 | 3300048911 | Bacteria | 2918 |
| 762 | Ga0496108_0077469 | 3300048911 | Bacteria | 2812 |
| 763 | Ga0496108_0396619 | 3300048911 | Bacteria | 1205 |
| 764 | Ga0496108_0570689 | 3300048911 | Bacteria | 986 |
| 765 | Ga0496109_0000819 | 3300048912 | Bacteria | 25931 |
| 766 | Ga0496109_0003308 | 3300048912 | Bacteria | 13459 |
| 767 | Ga0496109_0013089 | 3300048912 | Bacteria | 7176 |
| 768 | Ga0496109_0029424 | 3300048912 | Bacteria | 4919 |
| 769 | Ga0496109_0141115 | 3300048912 | Bacteria | 2252 |
| 770 | Ga0496109_0198623 | 3300048912 | Bacteria | 1885 |
| 771 | Ga0496109_0251515 | 3300048912 | Bacteria | 1664 |
| 772 | Ga0496110_0001476 | 3300048913 | Bacteria | 17045 |
| 773 | Ga0496110_0002110 | 3300048913 | Bacteria | 14838 |
| 774 | Ga0496110_0014163 | 3300048913 | Bacteria | 6615 |
| 775 | Ga0496110_0016537 | 3300048913 | Bacteria | 6160 |
| 776 | Ga0496110_0128680 | 3300048913 | Bacteria | 2285 |
| 777 | Ga0496111_0005856 | 3300048914 | Bacteria | 7928 |
| 778 | Ga0496111_0006277 | 3300048914 | Bacteria | 7707 |
| 779 | Ga0496111_0011618 | 3300048914 | Bacteria | 5939 |
| 780 | Ga0496111_0058949 | 3300048914 | Bacteria | 2780 |
| 781 | Ga0496111_0065999 | 3300048914 | Bacteria | 2627 |
| 782 | Ga0496111_0105369 | 3300048914 | Bacteria | 2075 |
| 783 | Ga0496111_0258398 | 3300048914 | Bacteria | 1292 |
| 784 | Ga0496112_0001431 | 3300048915 | Bacteria | 18303 |
| 785 | Ga0496112_0010158 | 3300048915 | Bacteria | 8529 |
| 786 | Ga0496112_0023925 | 3300048915 | Bacteria | 5843 |
| 787 | Ga0496112_0139208 | 3300048915 | Bacteria | 2396 |
| 788 | Ga0496112_0155605 | 3300048915 | Bacteria | 2252 |
| 789 | Ga0496112_0498529 | 3300048915 | Bacteria | 1153 |
| 790 | Ga0496112_0507843 | 3300048915 | Bacteria | 1140 |
| 791 | Ga0496113_0000831 | 3300048916 | Bacteria | 16131 |
| 792 | Ga0496113_0003183 | 3300048916 | Bacteria | 9776 |
| 793 | Ga0496113_0004545 | 3300048916 | Bacteria | 8547 |
| 794 | Ga0496113_0022669 | 3300048916 | Bacteria | 4445 |
| 795 | Ga0496113_0036250 | 3300048916 | Bacteria | 3612 |
| 796 | Ga0496114_0016604 | 3300048917 | Bacteria | 5935 |
| 797 | Ga0496114_0017767 | 3300048917 | Bacteria | 5747 |
| 798 | Ga0496114_0023817 | 3300048917 | Bacteria | 4996 |
| 799 | Ga0496114_0067300 | 3300048917 | Bacteria | 3005 |
| 800 | Ga0496114_0226868 | 3300048917 | Bacteria | 1640 |
| 801 | Ga0496115_0003245 | 3300048918 | Bacteria | 11674 |
| 802 | Ga0496115_0011659 | 3300048918 | Bacteria | 6597 |
| 803 | Ga0496115_0015517 | 3300048918 | Bacteria | 5781 |
| 804 | Ga0496115_0029988 | 3300048918 | Bacteria | 4276 |
| 805 | Ga0496115_0107109 | 3300048918 | Bacteria | 2295 |
| 806 | Ga0496115_0119480 | 3300048918 | Bacteria | 2168 |
| 807 | Ga0496115_0121171 | 3300048918 | Bacteria | 2152 |
| 808 | Ga0496115_0467569 | 3300048918 | Bacteria | 1017 |
| 809 | Ga0501031_0049266 | 3300049568 | Bacteria | 2745 |
| 810 | Ga0501031_0076744 | 3300049568 | Bacteria | 2176 |
| 811 | Ga0501031_0084289 | 3300049568 | Bacteria | 2072 |
| 812 | Ga0501031_0159822 | 3300049568 | Bacteria | 1473 |
| 813 | Ga0501032_0020441 | 3300049569 | Bacteria | 4611 |
| 814 | Ga0501032_0039811 | 3300049569 | Bacteria | 3195 |
| 815 | Ga0501032_0077295 | 3300049569 | Bacteria | 2216 |
| 816 | Ga0501032_0109620 | 3300049569 | Bacteria | 1827 |
| 817 | Ga0501032_0172994 | 3300049569 | Bacteria | 1415 |
| 818 | Ga0501033_0000205 | 3300049570 | Bacteria | 56697 |
| 819 | Ga0501033_0050745 | 3300049570 | Bacteria | 3076 |
| 820 | Ga0501033_0053674 | 3300049570 | Bacteria | 2984 |
| 821 | Ga0501034_0000089 | 3300049571 | Bacteria | 165644 |
| 822 | Ga0501034_0000828 | 3300049571 | Bacteria | 46000 |
| 823 | Ga0501034_0016809 | 3300049571 | Bacteria | 7501 |
| 824 | Ga0501034_0028203 | 3300049571 | Bacteria | 5712 |
| 825 | Ga0501034_0055549 | 3300049571 | Bacteria | 3984 |
| 826 | Ga0501034_0060017 | 3300049571 | Bacteria | 3820 |
| 827 | Ga0501034_0093074 | 3300049571 | Bacteria | 3010 |
| 828 | Ga0501034_0122758 | 3300049571 | Bacteria | 2583 |
| 829 | Ga0501034_0147038 | 3300049571 | Bacteria | 2333 |
| 830 | Ga0501034_0205496 | 3300049571 | Bacteria | 1926 |
| 831 | Ga0501034_0381990 | 3300049571 | Bacteria | 1333 |
| 832 | Ga0501034_0400359 | 3300049571 | Bacteria | 1295 |
| 833 | Ga0501034_0474667 | 3300049571 | Bacteria | 1166 |
| 834 | Ga0501036_0003296 | 3300049572 | Bacteria | 12882 |
| 835 | Ga0501036_0036192 | 3300049572 | Bacteria | 4176 |
| 836 | Ga0501036_0037691 | 3300049572 | Bacteria | 4089 |
| 837 | Ga0501036_0065929 | 3300049572 | Bacteria | 3063 |
| 838 | Ga0501036_0073027 | 3300049572 | Bacteria | 2900 |
| 839 | Ga0501036_0119271 | 3300049572 | Bacteria | 2228 |
| 840 | Ga0501037_0001134 | 3300049573 | Bacteria | 19732 |
| 841 | Ga0501037_0034782 | 3300049573 | Bacteria | 3717 |
| 842 | Ga0501037_0046116 | 3300049573 | Bacteria | 3197 |
| 843 | Ga0501037_0076029 | 3300049573 | Bacteria | 2438 |
| 844 | Ga0501037_0090194 | 3300049573 | Bacteria | 2218 |
| 845 | Ga0501037_0363002 | 3300049573 | Bacteria | 997 |
| 846 | Ga0501038_0025178 | 3300049574 | Bacteria | 5305 |
| 847 | Ga0501038_0040154 | 3300049574 | Bacteria | 4089 |
| 848 | Ga0501038_0118995 | 3300049574 | Bacteria | 2180 |
| 849 | Ga0501038_0134084 | 3300049574 | Bacteria | 2030 |
| 850 | Ga0501038_0211440 | 3300049574 | Bacteria | 1551 |
| 851 | Ga0501039_0005007 | 3300049575 | Bacteria | 10055 |
| 852 | Ga0501039_0009424 | 3300049575 | Bacteria | 7443 |
| 853 | Ga0501039_0017181 | 3300049575 | Bacteria | 5548 |
| 854 | Ga0501039_0055186 | 3300049575 | Bacteria | 3076 |
| 855 | Ga0501039_0091225 | 3300049575 | Bacteria | 2374 |
| 856 | Ga0501039_0150036 | 3300049575 | Bacteria | 1831 |
| 857 | Ga0501039_0181062 | 3300049575 | Bacteria | 1657 |
| 858 | Ga0501040_0029541 | 3300049576 | Bacteria | 3701 |
| 859 | Ga0501040_0132608 | 3300049576 | Bacteria | 1752 |
| 860 | Ga0501041_0278284 | 3300049577 | Bacteria | 1053 |
| 861 | Ga0501042_0074535 | 3300049578 | Bacteria | 2429 |
| 862 | Ga0501042_0075473 | 3300049578 | Bacteria | 2412 |
| 863 | Ga0501043_0008773 | 3300049579 | Bacteria | 7960 |
| 864 | Ga0501043_0012746 | 3300049579 | Bacteria | 6571 |
| 865 | Ga0501043_0018709 | 3300049579 | Bacteria | 5435 |
| 866 | Ga0501043_0032279 | 3300049579 | Bacteria | 4116 |
| 867 | Ga0501043_0101227 | 3300049579 | Bacteria | 2264 |
| 868 | Ga0501043_0230754 | 3300049579 | Bacteria | 1429 |
| 869 | Ga0501043_0351234 | 3300049579 | Bacteria | 1120 |
| 870 | Ga0501046_0007077 | 3300049580 | Bacteria | 9875 |
| 871 | Ga0501046_0025197 | 3300049580 | Bacteria | 4870 |
| 872 | Ga0501046_0062417 | 3300049580 | Bacteria | 2911 |
| 873 | Ga0501046_0126229 | 3300049580 | Bacteria | 1943 |
| 874 | Ga0501046_0127178 | 3300049580 | Bacteria | 1935 |
| 875 | Ga0501047_0000108 | 3300049581 | Bacteria | 101252 |
| 876 | Ga0501047_0025734 | 3300049581 | Bacteria | 5659 |
| 877 | Ga0501047_0066866 | 3300049581 | Bacteria | 3464 |
| 878 | Ga0501047_0098858 | 3300049581 | Bacteria | 2796 |
| 879 | Ga0501047_0207127 | 3300049581 | Bacteria | 1820 |
| 880 | Ga0501047_0244362 | 3300049581 | Bacteria | 1644 |
| 881 | Ga0501047_0346106 | 3300049581 | Bacteria | 1323 |
| 882 | Ga0501048_0000209 | 3300049582 | Bacteria | 38555 |
| 883 | Ga0501048_0013650 | 3300049582 | Bacteria | 6027 |
| 884 | Ga0501048_0014157 | 3300049582 | Bacteria | 5911 |
| 885 | Ga0501048_0020341 | 3300049582 | Bacteria | 4865 |
| 886 | Ga0501048_0136290 | 3300049582 | Bacteria | 1735 |
| 887 | Ga0501048_0196700 | 3300049582 | Bacteria | 1429 |
| 888 | Ga0501048_0268188 | 3300049582 | Bacteria | 1213 |
| 889 | Ga0501067_0003360 | 3300049583 | Bacteria | 8799 |
| 890 | Ga0501067_0040871 | 3300049583 | Bacteria | 2575 |
| 891 | Ga0501068_0021781 | 3300049584 | Bacteria | 3745 |
| 892 | Ga0501068_0041329 | 3300049584 | Bacteria | 2770 |
| 893 | Ga0501068_0072882 | 3300049584 | Bacteria | 2098 |
| 894 | Ga0501068_0152987 | 3300049584 | Bacteria | 1450 |
| 895 | Ga0501068_0226877 | 3300049584 | Bacteria | 1187 |
| 896 | Ga0501069_0001133 | 3300049585 | Bacteria | 12866 |
| 897 | Ga0501069_0071030 | 3300049585 | Bacteria | 1951 |
| 898 | Ga0501070_0001648 | 3300049586 | Bacteria | 19797 |
| 899 | Ga0501070_0027316 | 3300049586 | Bacteria | 4787 |
| 900 | Ga0501070_0036412 | 3300049586 | Bacteria | 4109 |
| 901 | Ga0501070_0078329 | 3300049586 | Bacteria | 2735 |
| 902 | Ga0501071_0022908 | 3300049587 | Bacteria | 4357 |
| 903 | Ga0501071_0178376 | 3300049587 | Bacteria | 1591 |
| 904 | Ga0501072_0158783 | 3300049588 | Bacteria | 1804 |
| 905 | Ga0501072_0232290 | 3300049588 | Bacteria | 1469 |
| 906 | Ga0501072_0264315 | 3300049588 | Bacteria | 1369 |
| 907 | Ga0501072_0356080 | 3300049588 | Bacteria | 1162 |
| 908 | Ga0501073_0005256 | 3300049589 | Bacteria | 9707 |
| 909 | Ga0501073_0025526 | 3300049589 | Bacteria | 4236 |
| 910 | Ga0501073_0041841 | 3300049589 | Bacteria | 3236 |
| 911 | Ga0501073_0082350 | 3300049589 | Bacteria | 2238 |
| 912 | Ga0501073_0157332 | 3300049589 | Bacteria | 1574 |
| 913 | Ga0501073_0164699 | 3300049589 | Bacteria | 1535 |
| 914 | Ga0501073_0253293 | 3300049589 | Bacteria | 1215 |
| 915 | Ga0501073_0292601 | 3300049589 | Bacteria | 1124 |
| 916 | Ga0501074_0019566 | 3300049590 | Bacteria | 4913 |
| 917 | Ga0501074_0024646 | 3300049590 | Bacteria | 4370 |
| 918 | Ga0501074_0039416 | 3300049590 | Bacteria | 3422 |
| 919 | Ga0501074_0043986 | 3300049590 | Bacteria | 3233 |
| 920 | Ga0501074_0053083 | 3300049590 | Bacteria | 2925 |
| 921 | Ga0501075_0225914 | 3300049591 | Bacteria | 1428 |
| 922 | Ga0501075_0282252 | 3300049591 | Bacteria | 1265 |
| 923 | Ga0501076_0053956 | 3300049592 | Bacteria | 3186 |
| 924 | Ga0501077_0014142 | 3300049593 | Bacteria | 5008 |
| 925 | Ga0501077_0164431 | 3300049593 | Bacteria | 1409 |
| 926 | Ga0501079_0002509 | 3300049741 | Bacteria | 13339 |
| 927 | Ga0501079_0228550 | 3300049741 | Bacteria | 1453 |
| 928 | Ga0501080_0000045 | 3300049742 | Bacteria | 79211 |
| 929 | Ga0501080_0030296 | 3300049742 | Bacteria | 5040 |
| 930 | Ga0501080_0078320 | 3300049742 | Bacteria | 3074 |
| 931 | Ga0501080_0163414 | 3300049742 | Bacteria | 2055 |
| 932 | Ga0501080_0233749 | 3300049742 | Bacteria | 1680 |
| 933 | Ga0501080_0375296 | 3300049742 | Bacteria | 1282 |
| 934 | Ga0501083_0014871 | 3300049744 | Bacteria | 5442 |
| 935 | Ga0501083_0017767 | 3300049744 | Bacteria | 4961 |
| 936 | Ga0501083_0027396 | 3300049744 | Bacteria | 3932 |
| 937 | Ga0501083_0114833 | 3300049744 | Bacteria | 1768 |
| 938 | Ga0501083_0188396 | 3300049744 | Bacteria | 1346 |
| 939 | Ga0501035_0003025 | 3300049822 | Bacteria | 16120 |
| 940 | Ga0501035_0005998 | 3300049822 | Bacteria | 11444 |
| 941 | Ga0501035_0012678 | 3300049822 | Bacteria | 7789 |
| 942 | Ga0501035_0060405 | 3300049822 | Bacteria | 3374 |
| 943 | Ga0501035_0068273 | 3300049822 | Bacteria | 3152 |
| 944 | Ga0501035_0082150 | 3300049822 | Bacteria | 2843 |
| 945 | Ga0501035_0302350 | 3300049822 | Bacteria | 1348 |
| 946 | Ga0501044_0005118 | 3300049823 | Bacteria | 14626 |
| 947 | Ga0501044_0012466 | 3300049823 | Bacteria | 9206 |
| 948 | Ga0501044_0015931 | 3300049823 | Bacteria | 8089 |
| 949 | Ga0501044_0023596 | 3300049823 | Bacteria | 6541 |
| 950 | Ga0501044_0045373 | 3300049823 | Bacteria | 4553 |
| 951 | Ga0501044_0196868 | 3300049823 | Bacteria | 1974 |
| 952 | Ga0501044_0220219 | 3300049823 | Bacteria | 1848 |
| 953 | Ga0501044_0243947 | 3300049823 | Bacteria | 1739 |
| 954 | Ga0501044_0247838 | 3300049823 | Bacteria | 1723 |
| 955 | Ga0501044_0284397 | 3300049823 | Bacteria | 1586 |
| 956 | Ga0501044_0333355 | 3300049823 | Bacteria | 1439 |
| 957 | Ga0501045_0113595 | 3300049824 | Bacteria | 2008 |
| 958 | Ga0501045_0400828 | 3300049824 | Bacteria | 1021 |
| 959 | nmdc:mga03683_50418_c1 | 3300050489 | Bacteria | 1735 |
| 960 | nmdc:mga00v17_128202_c1 | 3300050491 | Bacteria | 1620 |
| 961 | nmdc:mga0yw44_1015_c1 | 3300050492 | Bacteria | 10740 |
| 962 | nmdc:mga0yw44_141419_c1 | 3300050492 | Bacteria | 1564 |
| 963 | nmdc:mga0yw44_99323_c1 | 3300050492 | Bacteria | 1852 |
| 964 | nmdc:mga0k408_208406_c1 | 3300050493 | Bacteria | 1167 |
| 965 | nmdc:mga06z11_108092_c1 | 3300050494 | Bacteria | 1536 |
| 966 | nmdc:mga07m45_114167_c1 | 3300050496 | Bacteria | 1557 |
| 967 | nmdc:mga05p37_111_c1 | 3300050507 | Bacteria | 32778 |
| 968 | nmdc:mga05p37_140770_c1 | 3300050507 | Bacteria | 2956 |
| 969 | nmdc:mga05p37_22003_c1 | 3300050507 | Bacteria | 7725 |
| 970 | nmdc:mga05p37_3667_c1 | 3300050507 | Bacteria | 17948 |
| 971 | nmdc:mga05p37_528767_c1 | 3300050507 | Bacteria | 1347 |
| 972 | nmdc:mga05p37_685461_c1 | 3300050507 | Bacteria | 1141 |
| 973 | nmdc:mga05p37_696488_c1 | 3300050507 | Bacteria | 1129 |
| 974 | nmdc:mga05p37_905_c1 | 3300050507 | Bacteria | 33475 |
| 975 | nmdc:mga09592_123766_c1 | 3300050508 | Bacteria | 2222 |
| 976 | nmdc:mga09592_137_c1 | 3300050508 | Bacteria | 48140 |
| 977 | nmdc:mga09592_175777_c1 | 3300050508 | Bacteria | 1852 |
| 978 | nmdc:mga09592_197663_c1 | 3300050508 | Bacteria | 1741 |
| 979 | nmdc:mga09592_26246_c2 | 3300050508 | Bacteria | 3450 |
| 980 | nmdc:mga09592_769_c1 | 3300050508 | Bacteria | 24725 |
| 981 | nmdc:mga0qj67_102490_c1 | 3300050509 | Bacteria | 2308 |
| 982 | nmdc:mga0qj67_136575_c1 | 3300050509 | Bacteria | 1987 |
| 983 | nmdc:mga0qj67_18_c1 | 3300050509 | Bacteria | 120268 |
| 984 | nmdc:mga0qj67_2255_c1 | 3300050509 | Bacteria | 13705 |
| 985 | nmdc:mga0qj67_310602_c1 | 3300050509 | Bacteria | 1277 |
| 986 | nmdc:mga0qj67_315750_c1 | 3300050509 | Bacteria | 1265 |
| 987 | nmdc:mga0qj67_57131_c1 | 3300050509 | Bacteria | 3093 |
| 988 | nmdc:mga0qj67_85222_c1 | 3300050509 | Bacteria | 2534 |
| 989 | nmdc:mga06r32_106084_c1 | 3300050510 | Bacteria | 2760 |
| 990 | nmdc:mga06r32_1166_c1 | 3300050510 | Bacteria | 23655 |
| 991 | nmdc:mga06r32_124629_c1 | 3300050510 | Bacteria | 2544 |
| 992 | nmdc:mga06r32_132079_c1 | 3300050510 | Bacteria | 2469 |
| 993 | nmdc:mga06r32_15348_c1 | 3300050510 | Bacteria | 6959 |
| 994 | nmdc:mga06r32_269065_c1 | 3300050510 | Bacteria | 1692 |
| 995 | nmdc:mga06r32_28514_c1 | 3300050510 | Bacteria | 5226 |
| 996 | nmdc:mga06r32_3187_c1 | 3300050510 | Bacteria | 14693 |
| 997 | nmdc:mga08y16_119_c1 | 3300050511 | Bacteria | 67766 |
| 998 | nmdc:mga08y16_126926_c1 | 3300050511 | Bacteria | 2653 |
| 999 | nmdc:mga08y16_417044_c1 | 3300050511 | Bacteria | 1372 |
| 1000 | nmdc:mga08y16_61898_c1 | 3300050511 | Bacteria | 3908 |
| 1001 | nmdc:mga08y16_8169_c1 | 3300050511 | Bacteria | 10952 |
| 1002 | nmdc:mga08y16_98318_c1 | 3300050511 | Bacteria | 3048 |
| 1003 | nmdc:mga0n895_16484_c1 | 3300050512 | Bacteria | 6782 |
| 1004 | nmdc:mga0n895_269046_c1 | 3300050512 | Bacteria | 1729 |
| 1005 | nmdc:mga0n895_269343_c1 | 3300050512 | Bacteria | 1728 |
| 1006 | nmdc:mga0n895_3491_c1 | 3300050512 | Bacteria | 12694 |
| 1007 | nmdc:mga0n895_417874_c1 | 3300050512 | Bacteria | 1356 |
| 1008 | nmdc:mga0n895_72196_c1 | 3300050512 | Bacteria | 3424 |
| 1009 | nmdc:mga0n895_99926_c1 | 3300050512 | Bacteria | 2910 |
| 1010 | nmdc:mga0rr50_1368_c2 | 3300050513 | Bacteria | 8989 |
| 1011 | nmdc:mga0rr50_209624_c1 | 3300050513 | Bacteria | 1605 |
| 1012 | nmdc:mga0rr50_280126_c1 | 3300050513 | Bacteria | 1391 |
| 1013 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 1014 | nmdc:mga08x19_89938_c1 | 3300050514 | Bacteria | 2025 |
| 1015 | nmdc:mga0a205_129109_c1 | 3300050515 | Bacteria | 2428 |
| 1016 | nmdc:mga0a205_247854_c1 | 3300050515 | Bacteria | 1661 |
| 1017 | nmdc:mga0a205_50_c1 | 3300050515 | Bacteria | 64126 |
| 1018 | Ga0495601_0163218 | 3300053077 | Bacteria | 1456 |
| 1019 | Ga0495612_0003129 | 3300053078 | Bacteria | 6858 |
| 1020 | Ga0495612_0095721 | 3300053078 | Bacteria | 1261 |
| 1021 | Ga0495595_0000783 | 3300053084 | Bacteria | 12063 |
| 1022 | Ga0495595_0012401 | 3300053084 | Bacteria | 3582 |
| 1023 | Ga0495595_0016992 | 3300053084 | Bacteria | 3122 |
| 1024 | Ga0495595_0047139 | 3300053084 | Bacteria | 1987 |
| 1025 | Ga0495619_0000178 | 3300053085 | Bacteria | 46773 |
| 1026 | Ga0495619_0015464 | 3300053085 | Bacteria | 4828 |
| 1027 | Ga0495619_0086847 | 3300053085 | Bacteria | 2114 |
| 1028 | Ga0495619_0107922 | 3300053085 | Bacteria | 1899 |
| 1029 | Ga0495619_0299923 | 3300053085 | Bacteria | 1113 |
| 1030 | Ga0501084_0050571 | 3300054114 | Bacteria | 3478 |
| 1031 | Ga0501084_0055974 | 3300054114 | Bacteria | 3300 |
| 1032 | Ga0501082_0095217 | 3300060353 | Bacteria | 2573 |
| 1033 | Ga0501082_0328492 | 3300060353 | Bacteria | 1332 |
| 1034 | Ga0501082_0356028 | 3300060353 | Bacteria | 1276 |
| 1035 | Ga0530510_0017985 | 3300061734 | Bacteria | 5011 |
| 1036 | Ga0530510_0252573 | 3300061734 | Bacteria | 1314 |
| 1037 | 8045868705 | 8045864390 | Bacteria | 5043873 |
| 1038 | Ga0496109_0076431 | |||
| 1039 | SwRhRL2b_contig_2457651 | |||
| 1040 | 2214750779 | |||
| 1041 | ARSoilYngRDRAFT_c00001 | |||
| 1042 | ARcpr5yngRDRAFT_c000001 | |||
| 1043 | ARSoilOldRDRAFT_c000001 | |||
| 1044 | ARCol0oldRDRAFT_c00115 | |||
| 1045 | ARCol0yngRDRAFT_1000040 | |||
| 1046 | JGI24752J21851_1013074 | |||
| 1047 | JGI24737J22298_10000431 | |||
| 1048 | JGI24737J22298_10017937 | |||
| 1049 | JGI24750J21931_1000799 | |||
| 1050 | JGI24738J21930_10005986 | |||
| 1051 | JGI24749J21850_1001616 | |||
| 1052 | JGI24744J21845_10001498 | |||
| 1053 | JGI24033J26618_1002186 | |||
| 1054 | JGI24034J26672_10002342 | |||
| 1055 | JGI24742J22300_10009051 | |||
| 1056 | JGI25405J52794_10000676 | |||
| 1057 | JGI25405J52794_10009351 | |||
| 1058 | Ga0065717_1002101 | |||
| 1059 | Ga0065704_10073572 | |||
| 1060 | Ga0065712_10000310 | |||
| 1061 | Ga0065715_10001068 | |||
| 1062 | Ga0065715_10237603 | |||
| 1063 | Ga0065707_10136390 | |||
| 1064 | Ga0070676_10092683 | |||
| 1065 | Ga0070683_100288918 | |||
| 1066 | Ga0070690_100015471 | |||
| 1067 | Ga0070690_100065577 | |||
| 1068 | Ga0068869_100132477 | |||
| 1069 | Ga0070666_10000987 | |||
| 1070 | Ga0070666_10048740 | |||
| 1071 | Ga0070680_100022299 | |||
| 1072 | Ga0070682_100003298 | |||
| 1073 | Ga0070682_100086238 | |||
| 1074 | Ga0070682_100091931 | |||
| 1075 | Ga0070682_100096294 | |||
| 1076 | Ga0070682_100165192 | |||
| 1077 | Ga0068868_100005947 | |||
| 1078 | Ga0070660_100030705 | |||
| 1079 | Ga0070660_100137038 | |||
| 1080 | Ga0070689_100007857 | |||
| 1081 | Ga0070689_100102372 | |||
| 1082 | Ga0070689_100258580 | |||
| 1083 | Ga0070691_10020730 | |||
| 1084 | Ga0070687_100005090 | |||
| 1085 | Ga0070661_100215911 | |||
| 1086 | Ga0070668_100049976 | |||
| 1087 | Ga0070668_100146341 | |||
| 1088 | Ga0070669_100014859 | |||
| 1089 | Ga0070669_100110258 | |||
| 1090 | Ga0070675_100016243 | |||
| 1091 | Ga0070675_100047554 | |||
| 1092 | Ga0070675_100109398 | |||
| 1093 | Ga0070671_100003533 | |||
| 1094 | Ga0070671_100015553 | |||
| 1095 | Ga0070671_100018478 | |||
| 1096 | Ga0070671_100126796 | |||
| 1097 | Ga0070674_100018513 | |||
| 1098 | Ga0070674_100070823 | |||
| 1099 | Ga0070674_100435637 | |||
| 1100 | Ga0070688_100012356 | |||
| 1101 | Ga0070688_100018378 | |||
| 1102 | Ga0070688_100064253 | |||
| 1103 | Ga0070688_100185102 | |||
| 1104 | Ga0070688_100230461 | |||
| 1105 | Ga0070659_100009166 | |||
| 1106 | Ga0070659_100013043 | |||
| 1107 | Ga0070667_100003900 | |||
| 1108 | Ga0070667_100012179 | |||
| 1109 | Ga0070667_100031879 | |||
| 1110 | Ga0070667_100081105 | |||
| 1111 | Ga0070667_100412403 | |||
| 1112 | Ga0070703_10010430 | |||
| 1113 | Ga0070709_10022545 | |||
| 1114 | Ga0070713_100003508 | |||
| 1115 | Ga0070713_100019553 | |||
| 1116 | Ga0070713_100150662 | |||
| 1117 | Ga0070713_100198471 | |||
| 1118 | Ga0070713_100348984 | |||
| 1119 | Ga0070713_100606813 | |||
| 1120 | Ga0070710_10004640 | |||
| 1121 | Ga0070710_10009621 | |||
| 1122 | Ga0070710_10122989 | |||
| 1123 | Ga0070701_10007644 | |||
| 1124 | Ga0070701_10010004 | |||
| 1125 | Ga0070711_100019594 | |||
| 1126 | Ga0070711_100021848 | |||
| 1127 | Ga0070711_100146280 | |||
| 1128 | Ga0070711_100153910 | |||
| 1129 | Ga0070711_100407715 | |||
| 1130 | Ga0070705_100033862 | |||
| 1131 | Ga0070705_100266538 | |||
| 1132 | Ga0070705_100282957 | |||
| 1133 | Ga0070700_100056506 | |||
| 1134 | Ga0070700_100299182 | |||
| 1135 | Ga0070694_100018911 | |||
| 1136 | Ga0070694_100080003 | |||
| 1137 | Ga0070708_100548049 | |||
| 1138 | Ga0070663_100007188 | |||
| 1139 | Ga0070663_100037779 | |||
| 1140 | Ga0070663_100126330 | |||
| 1141 | Ga0070678_100002775 | |||
| 1142 | Ga0070662_100135528 | |||
| 1143 | Ga0070681_10016483 | |||
| 1144 | Ga0070681_10240286 | |||
| 1145 | Ga0070681_10470782 | |||
| 1146 | Ga0068867_100006959 | |||
| 1147 | Ga0070685_10003351 | |||
| 1148 | Ga0070685_10005997 | |||
| 1149 | Ga0070706_100145229 | |||
| 1150 | Ga0070707_100325122 | |||
| 1151 | Ga0070698_100264289 | |||
| 1152 | Ga0070699_100047726 | |||
| 1153 | Ga0070679_100010613 | |||
| 1154 | Ga0070679_100020939 | |||
| 1155 | Ga0070679_100073164 | |||
| 1156 | Ga0070679_100268442 | |||
| 1157 | Ga0070684_100062981 | |||
| 1158 | Ga0070684_100218719 | |||
| 1159 | Ga0070684_100362047 | |||
| 1160 | Ga0070697_100036801 | |||
| 1161 | Ga0068853_100001612 | |||
| 1162 | Ga0068853_100037570 | |||
| 1163 | Ga0068853_100170164 | |||
| 1164 | Ga0070672_100112940 | |||
| 1165 | Ga0070686_100009112 | |||
| 1166 | Ga0070686_100038090 | |||
| 1167 | Ga0070686_100083245 | |||
| 1168 | Ga0070695_100009133 | |||
| 1169 | Ga0070695_100182952 | |||
| 1170 | Ga0070696_100012792 | |||
| 1171 | Ga0070696_100296167 | |||
| 1172 | Ga0070693_100009642 | |||
| 1173 | Ga0070693_100307326 | |||
| 1174 | Ga0070665_100063128 | |||
| 1175 | Ga0070704_100033966 | |||
| 1176 | Ga0070704_100110356 | |||
| 1177 | Ga0070704_100216295 | |||
| 1178 | Ga0068855_100003400 | |||
| 1179 | Ga0068855_100198202 | |||
| 1180 | Ga0070664_100088888 | |||
| 1181 | Ga0070664_100126324 | |||
| 1182 | Ga0070664_100147384 | |||
| 1183 | Ga0068856_100100020 | |||
| 1184 | Ga0068856_100626857 | |||
| 1185 | Ga0068856_100810199 | |||
| 1186 | Ga0070702_100020075 | |||
| 1187 | Ga0068852_100013654 | |||
| 1188 | Ga0068852_100093625 | |||
| 1189 | Ga0068859_100028474 | |||
| 1190 | Ga0068859_100076343 | |||
| 1191 | Ga0068859_100196995 | |||
| 1192 | Ga0068864_100004952 | |||
| 1193 | Ga0068864_100122537 | |||
| 1194 | Ga0068861_100026741 | |||
| 1195 | Ga0068870_10002588 | |||
| 1196 | Ga0068870_10244661 | |||
| 1197 | Ga0068863_100066888 | |||
| 1198 | Ga0068858_100045358 | |||
| 1199 | Ga0068858_100065195 | |||
| 1200 | Ga0068860_100009906 | |||
| 1201 | Ga0068860_100011216 | |||
| 1202 | Ga0068862_100160968 | |||
| 1203 | Ga0081455_10000002 | |||
| 1204 | Ga0081455_10004932 | |||
| 1205 | Ga0081455_10008420 | |||
| 1206 | Ga0081455_10057181 | |||
| 1207 | Ga0081538_10002583 | |||
| 1208 | Ga0081538_10030812 | |||
| 1209 | Ga0081540_1001340 | |||
| 1210 | Ga0081540_1008163 | |||
| 1211 | Ga0081540_1010314 | |||
| 1212 | Ga0081540_1011704 | |||
| 1213 | Ga0081539_10005816 | |||
| 1214 | Ga0070717_10005088 | |||
| 1215 | Ga0070717_10024817 | |||
| 1216 | Ga0070717_10062327 | |||
| 1217 | Ga0070717_10407040 | |||
| 1218 | Ga0070717_10567076 | |||
| 1219 | Ga0075365_10001115 | |||
| 1220 | Ga0075365_10026232 | |||
| 1221 | Ga0075365_10043276 | |||
| 1222 | Ga0075363_100056248 | |||
| 1223 | Ga0075364_10151566 | |||
| 1224 | Ga0075432_10010346 | |||
| 1225 | Ga0070715_10000228 | |||
| 1226 | Ga0070716_100002514 | |||
| 1227 | Ga0070716_100002657 | |||
| 1228 | Ga0070716_100174166 | |||
| 1229 | Ga0070716_100298995 | |||
| 1230 | Ga0070712_100004899 | |||
| 1231 | Ga0070712_100113137 | |||
| 1232 | Ga0070712_100474563 | |||
| 1233 | Ga0075362_10031006 | |||
| 1234 | Ga0075367_10109833 | |||
| 1235 | Ga0075427_10000177 | |||
| 1236 | Ga0075366_10109470 | |||
| 1237 | Ga0097621_100003454 | |||
| 1238 | Ga0097621_100031649 | |||
| 1239 | Ga0097621_100064409 | |||
| 1240 | Ga0075370_10172860 | |||
| 1241 | Ga0068871_100013353 | |||
| 1242 | Ga0068871_100100007 | |||
| 1243 | Ga0068871_100144782 | |||
| 1244 | Ga0075428_100002731 | |||
| 1245 | Ga0075428_100005626 | |||
| 1246 | Ga0075428_100019585 | |||
| 1247 | Ga0075428_100098453 | |||
| 1248 | Ga0075428_100324037 | |||
| 1249 | Ga0075430_100000129 | |||
| 1250 | Ga0075430_100000671 | |||
| 1251 | Ga0075430_100056451 | |||
| 1252 | Ga0075430_100216879 | |||
| 1253 | Ga0075431_100000191 | |||
| 1254 | Ga0075431_100000234 | |||
| 1255 | Ga0075431_100000703 | |||
| 1256 | Ga0075431_100003687 | |||
| 1257 | Ga0075431_100046187 | |||
| 1258 | Ga0075431_100106202 | |||
| 1259 | Ga0075431_100144285 | |||
| 1260 | Ga0075431_100165170 | |||
| 1261 | Ga0075433_10011581 | |||
| 1262 | Ga0075433_10330572 | |||
| 1263 | Ga0075433_10379553 | |||
| 1264 | Ga0075434_100046515 | |||
| 1265 | Ga0075434_100046619 | |||
| 1266 | Ga0075434_100085048 | |||
| 1267 | Ga0075434_100099822 | |||
| 1268 | Ga0075434_100232570 | |||
| 1269 | Ga0075434_100343167 | |||
| 1270 | Ga0075434_100540324 | |||
| 1271 | Ga0075429_100000278 | |||
| 1272 | Ga0075429_100009144 | |||
| 1273 | Ga0075429_100047607 | |||
| 1274 | Ga0075429_100058753 | |||
| 1275 | Ga0075429_100138422 | |||
| 1276 | Ga0075429_100390275 | |||
| 1277 | Ga0068865_100019549 | |||
| 1278 | Ga0068865_100058808 | |||
| 1279 | Ga0068865_100129872 | |||
| 1280 | Ga0075436_100001205 | |||
| 1281 | Ga0075436_100020207 | |||
| 1282 | Ga0075436_100104141 | |||
| 1283 | Ga0097620_100028474 | |||
| 1284 | Ga0097620_100076345 | |||
| 1285 | Ga0097620_100197006 | |||
| 1286 | Ga0075435_100029132 | |||
| 1287 | Ga0075435_100034779 | |||
| 1288 | Ga0075435_100265873 | |||
| 1289 | Ga0099794_10009640 | |||
| 1290 | Ga0099795_10000463 | |||
| 1291 | Ga0099795_10106889 | |||
| 1292 | Ga0105240_10190345 | |||
| 1293 | Ga0111539_10000066 | |||
| 1294 | Ga0111539_10004252 | |||
| 1295 | Ga0111539_10008250 | |||
| 1296 | Ga0111539_10068014 | |||
| 1297 | Ga0111539_10071300 | |||
| 1298 | Ga0111539_10337243 | |||
| 1299 | Ga0105245_10161914 | |||
| 1300 | Ga0105245_10790899 | |||
| 1301 | Ga0105247_10034720 | |||
| 1302 | Ga0114129_10000159 | |||
| 1303 | Ga0114129_10005628 | |||
| 1304 | Ga0114129_10020936 | |||
| 1305 | Ga0114129_10032307 | |||
| 1306 | Ga0114129_10052787 | |||
| 1307 | Ga0114129_10393469 | |||
| 1308 | Ga0114129_10424624 | |||
| 1309 | Ga0114129_10874470 | |||
| 1310 | Ga0105243_10008817 | |||
| 1311 | Ga0105243_10016875 | |||
| 1312 | Ga0105243_10222074 | |||
| 1313 | Ga0105243_10234648 | |||
| 1314 | Ga0105241_10203927 | |||
| 1315 | Ga0105241_10276665 | |||
| 1316 | Ga0105241_10282906 | |||
| 1317 | Ga0105242_10005175 | |||
| 1318 | Ga0105242_10170653 | |||
| 1319 | Ga0105242_10531143 | |||
| 1320 | Ga0105248_10046436 | |||
| 1321 | Ga0105248_10066169 | |||
| 1322 | Ga0105248_10206376 | |||
| 1323 | Ga0105248_10212420 | |||
| 1324 | Ga0105237_10039779 | |||
| 1325 | Ga0105237_10041447 | |||
| 1326 | Ga0105237_10279330 | |||
| 1327 | Ga0105238_10013836 | |||
| 1328 | Ga0105238_10286565 | |||
| 1329 | Ga0105249_10000366 | |||
| 1330 | Ga0105249_10003074 | |||
| 1331 | Ga0105249_10079232 | |||
| 1332 | Ga0105249_10205085 | |||
| 1333 | Ga0105239_10085574 | |||
| 1334 | Ga0105239_10131244 | |||
| 1335 | Ga0105239_10145325 | |||
| 1336 | Ga0105246_10016740 | |||
| 1337 | Ga0157336_1001638 | |||
| 1338 | Ga0157342_1000661 | |||
| 1339 | Ga0157373_10008032 | |||
| 1340 | Ga0157373_10187468 | |||
| 1341 | Ga0157370_10024903 | |||
| 1342 | Ga0157374_10029029 | |||
| 1343 | Ga0157378_10109940 | |||
| 1344 | Ga0157378_10156184 | |||
| 1345 | Ga0163162_10025888 | |||
| 1346 | Ga0163162_10047764 | |||
| 1347 | Ga0163162_10084159 | |||
| 1348 | Ga0157372_10001212 | |||
| 1349 | Ga0157372_10753631 | |||
| 1350 | Ga0157375_10038644 | |||
| 1351 | Ga0157375_10304817 | |||
| 1352 | Ga0157375_10460645 | |||
| 1353 | Ga0163163_10047970 | |||
| 1354 | Ga0163163_10050783 | |||
| 1355 | Ga0163163_10215299 | |||
| 1356 | Ga0157379_10020496 | |||
| 1357 | Ga0157379_10083289 | |||
| 1358 | Ga0157379_10226809 | |||
| 1359 | Ga0157376_10157187 | |||
| 1360 | Ga0163161_10044263 | |||
| 1361 | Ga0213873_10054702 | |||
| 1362 | Ga0213874_10010798 | |||
| 1363 | Ga0213876_10061744 | |||
| 1364 | Ga0207666_1000399 | |||
| 1365 | Ga0207697_10005455 | |||
| 1366 | Ga0207653_10059001 | |||
| 1367 | Ga0207710_10004947 | |||
| 1368 | Ga0207710_10013340 | |||
| 1369 | Ga0207710_10136909 | |||
| 1370 | Ga0207688_10003803 | |||
| 1371 | Ga0207680_10153963 | |||
| 1372 | Ga0207647_10003487 | |||
| 1373 | Ga0207685_10002351 | |||
| 1374 | Ga0207699_10000830 | |||
| 1375 | Ga0207645_10005911 | |||
| 1376 | Ga0207645_10036276 | |||
| 1377 | Ga0207643_10000282 | |||
| 1378 | Ga0207684_10021548 | |||
| 1379 | Ga0207707_10038275 | |||
| 1380 | Ga0207707_10384521 | |||
| 1381 | Ga0207695_10348618 | |||
| 1382 | Ga0207671_10094413 | |||
| 1383 | Ga0207671_10325879 | |||
| 1384 | Ga0207693_10000825 | |||
| 1385 | Ga0207693_10004231 | |||
| 1386 | Ga0207693_10076550 | |||
| 1387 | Ga0207693_10169314 | |||
| 1388 | Ga0207693_10274725 | |||
| 1389 | Ga0207663_10072167 | |||
| 1390 | Ga0207663_10192564 | |||
| 1391 | Ga0207660_10293819 | |||
| 1392 | Ga0207662_10002641 | |||
| 1393 | Ga0207662_10012407 | |||
| 1394 | Ga0207657_10013369 | |||
| 1395 | Ga0207657_10035991 | |||
| 1396 | Ga0207649_10006266 | |||
| 1397 | Ga0207652_10045297 | |||
| 1398 | Ga0207652_10160650 | |||
| 1399 | Ga0207652_10341636 | |||
| 1400 | Ga0207681_10037999 | |||
| 1401 | Ga0207681_10426771 | |||
| 1402 | Ga0207650_10012239 | |||
| 1403 | Ga0207650_10018124 | |||
| 1404 | Ga0207650_10023849 | |||
| 1405 | Ga0207659_10053434 | |||
| 1406 | Ga0207659_10293924 | |||
| 1407 | Ga0207687_10011618 | |||
| 1408 | Ga0207687_10012335 | |||
| 1409 | Ga0207687_10306746 | |||
| 1410 | Ga0207700_10000357 | |||
| 1411 | Ga0207700_10010421 | |||
| 1412 | Ga0207700_10254170 | |||
| 1413 | Ga0207700_10336327 | |||
| 1414 | Ga0207664_10030512 | |||
| 1415 | Ga0207644_10004870 | |||
| 1416 | Ga0207644_10012722 | |||
| 1417 | Ga0207644_10077830 | |||
| 1418 | Ga0207644_10178457 | |||
| 1419 | Ga0207690_10033218 | |||
| 1420 | Ga0207690_10074626 | |||
| 1421 | Ga0207690_10229164 | |||
| 1422 | Ga0207706_10009306 | |||
| 1423 | Ga0207706_10010708 | |||
| 1424 | Ga0207706_10108972 | |||
| 1425 | Ga0207706_10121426 | |||
| 1426 | Ga0207686_10039044 | |||
| 1427 | Ga0207686_10039415 | |||
| 1428 | Ga0207709_10009063 | |||
| 1429 | Ga0207709_10127906 | |||
| 1430 | Ga0207709_10254369 | |||
| 1431 | Ga0207670_10027178 | |||
| 1432 | Ga0207670_10067009 | |||
| 1433 | Ga0207670_10359697 | |||
| 1434 | Ga0207669_10128172 | |||
| 1435 | Ga0207669_10226770 | |||
| 1436 | Ga0207704_10004523 | |||
| 1437 | Ga0207665_10000350 | |||
| 1438 | Ga0207665_10000712 | |||
| 1439 | Ga0207665_10103635 | |||
| 1440 | Ga0207665_10136920 | |||
| 1441 | Ga0207691_10000635 | |||
| 1442 | Ga0207691_10108638 | |||
| 1443 | Ga0207711_10007270 | |||
| 1444 | Ga0207711_10045572 | |||
| 1445 | Ga0207711_10315950 | |||
| 1446 | Ga0207689_10100015 | |||
| 1447 | Ga0207689_10137901 | |||
| 1448 | Ga0207661_10015887 | |||
| 1449 | Ga0207679_10064114 | |||
| 1450 | Ga0207679_10120030 | |||
| 1451 | Ga0207667_10057070 | |||
| 1452 | Ga0207667_10256301 | |||
| 1453 | Ga0207651_10014878 | |||
| 1454 | Ga0207712_10012436 | |||
| 1455 | Ga0207712_10137123 | |||
| 1456 | Ga0207712_10199182 | |||
| 1457 | Ga0207668_10312578 | |||
| 1458 | Ga0207640_10180727 | |||
| 1459 | Ga0207658_10005792 | |||
| 1460 | Ga0207658_10008239 | |||
| 1461 | Ga0207658_10090914 | |||
| 1462 | Ga0207658_10184023 | |||
| 1463 | Ga0207658_10408818 | |||
| 1464 | Ga0207677_10010752 | |||
| 1465 | Ga0207703_10001597 | |||
| 1466 | Ga0207703_10020521 | |||
| 1467 | Ga0207639_10021130 | |||
| 1468 | Ga0207678_10017565 | |||
| 1469 | Ga0207678_10076502 | |||
| 1470 | Ga0207708_10006680 | |||
| 1471 | Ga0207708_10017203 | |||
| 1472 | Ga0207708_10252927 | |||
| 1473 | Ga0207708_10258272 | |||
| 1474 | Ga0207702_10088399 | |||
| 1475 | Ga0207702_10315817 | |||
| 1476 | Ga0207641_10001852 | |||
| 1477 | Ga0207641_10113107 | |||
| 1478 | Ga0207648_10001759 | |||
| 1479 | Ga0207648_10033362 | |||
| 1480 | Ga0207676_10003928 | |||
| 1481 | Ga0207676_10119625 | |||
| 1482 | Ga0207674_10333038 | |||
| 1483 | Ga0207674_10398844 | |||
| 1484 | Ga0207675_100001019 | |||
| 1485 | Ga0207675_100077629 | |||
| 1486 | Ga0207675_100242677 | |||
| 1487 | Ga0207683_10005171 | |||
| 1488 | Ga0207683_10008774 | |||
| 1489 | Ga0207683_10069231 | |||
| 1490 | Ga0207698_10131826 | |||
| 1491 | Ga0209179_1016087 | |||
| 1492 | Ga0209588_1003054 | |||
| 1493 | Ga0209998_10001514 | |||
| 1494 | Ga0209813_10029850 | |||
| 1495 | Ga0207428_10000146 | |||
| 1496 | Ga0207428_10000590 | |||
| 1497 | Ga0207428_10001295 | |||
| 1498 | Ga0268266_10005025 | |||
| 1499 | Ga0268266_10033266 | |||
| 1500 | Ga0268265_10007254 | |||
| 1501 | Ga0268265_10278131 | |||
| 1502 | Ga0268265_10818198 | |||
| 1503 | Ga0268264_10043442 | |||
| 1504 | Ga0268264_10062146 | |||
| 1505 | Ga0265337_1004366 | |||
| 1506 | Ga0265332_10000775 | |||
| 1507 | Ga0265328_10009992 | |||
| 1508 | Ga0265325_10001890 | |||
| 1509 | Ga0265325_10005723 | |||
| 1510 | Ga0265340_10025379 | |||
| 1511 | Ga0265340_10044107 | |||
| 1512 | Ga0265339_10000776 | |||
| 1513 | Ga0265339_10006606 | |||
| 1514 | Ga0265331_10001173 | |||
| 1515 | Ga0265331_10024213 | |||
| 1516 | Ga0265327_10009646 | |||
| 1517 | Ga0265316_10015840 | |||
| 1518 | Ga0265316_10177401 | |||
| 1519 | Ga0265316_10275577 | |||
| 1520 | Ga0265313_10000175 | |||
| 1521 | Ga0265313_10000682 | |||
| 1522 | Ga0265314_10057024 | |||
| 1523 | Ga0265342_10000364 | |||
| 1524 | Ga0373930_0000005 | |||
| 1525 | Ga0373948_0000195 | |||
| 1526 | Ga0373948_0002757 | |||
| 1527 | Ga0373950_0000295 | |||
| 1528 | Ga0373958_0001568 | |||
| 1529 | Ga0373938_0000414 | |||
| 1530 | Ga0373926_0005849 | |||
| 1531 | Ga0373926_0076268 | |||
| 1532 | Ga0373928_0003138 | |||
| 1533 | Ga0373928_0019371 | |||
| 1534 | Ga0373934_0015528 | |||
| 1535 | Ga0373940_0000260 | |||
| 1536 | Ga0373944_0002022 | |||
| 1537 | Ga0373944_0046082 | |||
| 1538 | Ga0373949_0000302 | |||
| 1539 | Ga0373951_0009014 | |||
| 1540 | Ga0373951_0012124 | |||
| 1541 | Ga0373952_0001165 | |||
| 1542 | Ga0373952_0001199 | |||
| 1543 | Ga0373923_0055315 | |||
| 1544 | Ga0373932_0002389 | |||
| 1545 | Ga0373932_0002551 | |||
| 1546 | Ga0373932_0045324 | |||
| 1547 | Ga0373936_0050698 | |||
| 1548 | Ga0373936_0059402 | |||
| 1549 | Ga0373936_0082148 | |||
| 1550 | Ga0373941_0000116 | |||
| 1551 | Ga0373945_0001576 | |||
| 1552 | Ga0373953_0062577 | |||
| 1553 | Ga0373954_0006555 | |||
| 1554 | Ga0373954_0100900 | |||
| 1555 | Ga0373956_0049573 | |||
| 1556 | Ga0373956_0076367 | |||
| 1557 | Ga0373956_0128184 | |||
| 1558 | Ga0373956_0144854 | |||
| 1559 | Ga0373957_0064067 | |||
| 1560 | Ga0373960_0002193 | |||
| 1561 | Ga0373960_0012058 | |||
| 1562 | Ga0373943_0005783 | |||
| 1563 | Ga0373943_0126881 | |||
| 1564 | Ga0373946_0013805 | |||
| 1565 | Ga0373946_0038608 | |||
| 1566 | Ga0373946_0194450 | |||
| 1567 | Ga0373955_0004149 | |||
| 1568 | Ga0373955_0025797 | |||
| 1569 | Ga0373955_0044493 | |||
| 1570 | Ga0373955_0057905 | |||
| 1571 | Ga0373942_0005527 | |||
| 1572 | Ga0373961_0000828 | |||
| 1573 | Ga0373962_0000650 | |||
| 1574 | Ga0373962_0005168 | |||
| 1575 | Ga0316574_0001939 | |||
| 1576 | Ga0373924_0002029 | |||
| 1577 | Ga0373931_0111992 | |||
| 1578 | Ga0373931_0127272 | |||
| 1579 | Ga0373935_0002255 | |||
| 1580 | Ga0373935_0008678 | |||
| 1581 | Ga0373935_0338881 | |||
| 1582 | Ga0373927_0006726 | |||
| 1583 | Ga0373927_0012770 | |||
| 1584 | Ga0373927_0035269 | |||
| 1585 | Ga0373927_0047612 | |||
| 1586 | Ga0373933_0001165 | |||
| 1587 | Ga0373933_0020208 | |||
| 1588 | Ga0373933_0081410 | |||
| 1589 | Ga0373933_0169185 | |||
| 1590 | Ga0373947_0019847 | |||
| 1591 | Ga0373947_0058836 | |||
| 1592 | Ga0373947_0096798 | |||
| 1593 | Ga0373937_0000421 | |||
| 1594 | Ga0373937_0006973 | |||
| 1595 | Ga0373937_0036698 | |||
| 1596 | Ga0373937_0078334 | |||
| 1597 | Ga0316584_0041862 | |||
| 1598 | Ga0373925_0001412 | |||
| 1599 | Ga0373925_0018265 | |||
| 1600 | Ga0373925_0090465 | |||
| 1601 | Ga0373925_0209854 | |||
| 1602 | Ga0395900_0003909 | |||
| 1603 | Ga0395898_0003084 | |||
| 1604 | Ga0395898_0069133 | |||
| 1605 | Ga0395898_0567244 | |||
| 1606 | Ga0395905_0051391 | |||
| 1607 | Ga0395901_0290348 | |||
| 1608 | Ga0395901_0394512 | |||
| 1609 | Ga0436365_0349290 | |||
| 1610 | Ga0436365_0399377 | |||
| 1611 | Ga0436365_0783605 | |||
| 1612 | Ga0436360_0949241 | |||
| 1613 | Ga0436361_0314414 | |||
| 1614 | Ga0436361_0346331 | |||
| 1615 | Ga0436363_1326955 | |||
| 1616 | Ga0451853_0003971 | |||
| 1617 | Ga0439460_0061488 | |||
| 1618 | Ga0451577_0089937 | |||
| 1619 | Ga0466966_0116766 | |||
| 1620 | Ga0466961_0133414 | |||
| 1621 | Ga0466963_0228567 | |||
| 1622 | Ga0453684_0296980 | |||
| 1623 | Ga0495603_0007476 | |||
| 1624 | Ga0495603_0036789 | |||
| 1625 | Ga0495629_0000909 | |||
| 1626 | Ga0495629_0061542 | |||
| 1627 | Ga0495629_0125578 | |||
| 1628 | Ga0495629_0153262 | |||
| 1629 | Ga0495638_0064672 | |||
| 1630 | Ga0495641_0020796 | |||
| 1631 | Ga0495651_0003409 | |||
| 1632 | Ga0495651_0111824 | |||
| 1633 | Ga0495651_0134781 | |||
| 1634 | Ga0495653_0015806 | |||
| 1635 | Ga0495653_0055494 | |||
| 1636 | Ga0495653_0091973 | |||
| 1637 | Ga0495580_0014461 | |||
| 1638 | Ga0495580_0031835 | |||
| 1639 | Ga0495580_0077208 | |||
| 1640 | Ga0495582_0003962 | |||
| 1641 | Ga0495582_0020491 | |||
| 1642 | Ga0495582_0049117 | |||
| 1643 | Ga0495582_0184184 | |||
| 1644 | Ga0495605_0182790 | |||
| 1645 | Ga0495639_0052696 | |||
| 1646 | Ga0495639_0092073 | |||
| 1647 | Ga0495639_0144124 | |||
| 1648 | Ga0495664_0021709 | |||
| 1649 | Ga0495584_0005371 | |||
| 1650 | Ga0495584_0035946 | |||
| 1651 | Ga0495584_0036313 | |||
| 1652 | Ga0495585_0002497 | |||
| 1653 | Ga0495585_0004211 | |||
| 1654 | Ga0495594_0012627 | |||
| 1655 | Ga0495607_0001563 | |||
| 1656 | Ga0495607_0035657 | |||
| 1657 | Ga0495608_0035888 | |||
| 1658 | Ga0495608_0036295 | |||
| 1659 | Ga0495616_0130505 | |||
| 1660 | Ga0495618_0017389 | |||
| 1661 | Ga0495618_0049854 | |||
| 1662 | Ga0495618_0326349 | |||
| 1663 | Ga0495628_0055747 | |||
| 1664 | Ga0495630_0050210 | |||
| 1665 | Ga0495630_0056532 | |||
| 1666 | Ga0495630_0407556 | |||
| 1667 | Ga0495644_0002018 | |||
| 1668 | Ga0495666_0049082 | |||
| 1669 | Ga0495642_0075532 | |||
| 1670 | Ga0495652_0078500 | |||
| 1671 | Ga0495652_0101406 | |||
| 1672 | Ga0495665_0020984 | |||
| 1673 | Ga0495640_0020265 | |||
| 1674 | Ga0495640_0024328 | |||
| 1675 | Ga0495640_0066127 | |||
| 1676 | Ga0495586_0007988 | |||
| 1677 | Ga0495587_0001462 | |||
| 1678 | Ga0495587_0005579 | |||
| 1679 | Ga0495598_0000136 | |||
| 1680 | Ga0495645_0024716 | |||
| 1681 | Ga0495645_0033675 | |||
| 1682 | Ga0495645_0177222 | |||
| 1683 | Ga0495633_0000645 | |||
| 1684 | Ga0495633_0076441 | |||
| 1685 | Ga0495667_0003889 | |||
| 1686 | Ga0495667_0006572 | |||
| 1687 | Ga0495656_0000157 | |||
| 1688 | Ga0495656_0011926 | |||
| 1689 | Ga0495634_0223214 | |||
| 1690 | Ga0495634_0289790 | |||
| 1691 | Ga0495611_0002887 | |||
| 1692 | Ga0495635_0014721 | |||
| 1693 | Ga0495635_0024328 | |||
| 1694 | Ga0495635_0138766 | |||
| 1695 | Ga0495635_0274592 | |||
| 1696 | Ga0495659_0000479 | |||
| 1697 | Ga0495659_0006252 | |||
| 1698 | Ga0495659_0054341 | |||
| 1699 | Ga0495661_0058137 | |||
| 1700 | Ga0495588_0003988 | |||
| 1701 | Ga0495657_0023233 | |||
| 1702 | Ga0495599_0004437 | |||
| 1703 | Ga0495599_0014742 | |||
| 1704 | Ga0495623_0004691 | |||
| 1705 | Ga0495623_0008559 | |||
| 1706 | Ga0495646_0054629 | |||
| 1707 | Ga0495647_0003000 | |||
| 1708 | Ga0495647_0028699 | |||
| 1709 | Ga0495658_0008890 | |||
| 1710 | Ga0495658_0014487 | |||
| 1711 | Ga0495658_0017954 | |||
| 1712 | Ga0495658_0047342 | |||
| 1713 | Ga0495613_0041365 | |||
| 1714 | Ga0495613_0058462 | |||
| 1715 | Ga0495624_0049293 | |||
| 1716 | Ga0495624_0079950 | |||
| 1717 | Ga0495670_0000299 | |||
| 1718 | Ga0495670_0021379 | |||
| 1719 | Ga0495649_0155445 | |||
| 1720 | Ga0495589_0018300 | |||
| 1721 | Ga0495600_0020831 | |||
| 1722 | Ga0495600_0022028 | |||
| 1723 | Ga0495581_0012984 | |||
| 1724 | Ga0495581_0177565 | |||
| 1725 | Ga0495581_0317975 | |||
| 1726 | Ga0495604_0013118 | |||
| 1727 | Ga0495604_0022597 | |||
| 1728 | Ga0495604_0028575 | |||
| 1729 | Ga0495636_0181638 | |||
| 1730 | Ga0495674_0054151 | |||
| 1731 | Ga0495674_0080679 | |||
| 1732 | Ga0495674_0267069 | |||
| 1733 | Ga0495674_0279016 | |||
| 1734 | Ga0495674_0343696 | |||
| 1735 | Ga0495672_0052538 | |||
| 1736 | Ga0495672_0156235 | |||
| 1737 | Ga0495676_0168770 | |||
| 1738 | Ga0495680_0021609 | |||
| 1739 | Ga0495680_0032842 | |||
| 1740 | Ga0495680_0034725 | |||
| 1741 | Ga0495675_0000147 | |||
| 1742 | Ga0495675_0070541 | |||
| 1743 | Ga0495679_013420 | |||
| 1744 | Ga0495684_0003553 | |||
| 1745 | Ga0495593_0035621 | |||
| 1746 | Ga0495593_0124882 | |||
| 1747 | Ga0495602_0012962 | |||
| 1748 | Ga0495602_0052878 | |||
| 1749 | Ga0495615_0013185 | |||
| 1750 | Ga0496100_0003759 | |||
| 1751 | Ga0496100_0013884 | |||
| 1752 | Ga0496100_0037629 | |||
| 1753 | Ga0496100_0250870 | |||
| 1754 | Ga0496101_0003453 | |||
| 1755 | Ga0496101_0024079 | |||
| 1756 | Ga0496101_0047314 | |||
| 1757 | Ga0496101_0104185 | |||
| 1758 | Ga0496101_0325032 | |||
| 1759 | Ga0496102_0013309 | |||
| 1760 | Ga0496102_0079880 | |||
| 1761 | Ga0496102_0099145 | |||
| 1762 | Ga0496102_0106943 | |||
| 1763 | Ga0496102_0142887 | |||
| 1764 | Ga0496103_0001040 | |||
| 1765 | Ga0496103_0030239 | |||
| 1766 | Ga0496103_0036770 | |||
| 1767 | Ga0496104_0000203 | |||
| 1768 | Ga0496104_0001141 | |||
| 1769 | Ga0496104_0004850 | |||
| 1770 | Ga0496104_0007178 | |||
| 1771 | Ga0496104_0018039 | |||
| 1772 | Ga0496104_0055262 | |||
| 1773 | Ga0496104_0084786 | |||
| 1774 | Ga0496104_0089160 | |||
| 1775 | Ga0496104_0102425 | |||
| 1776 | Ga0496104_0184064 | |||
| 1777 | Ga0496105_0001053 | |||
| 1778 | Ga0496105_0004734 | |||
| 1779 | Ga0496105_0014042 | |||
| 1780 | Ga0496105_0014497 | |||
| 1781 | Ga0496105_0032630 | |||
| 1782 | Ga0496105_0348788 | |||
| 1783 | Ga0496106_0007594 | |||
| 1784 | Ga0496106_0011758 | |||
| 1785 | Ga0496106_0036001 | |||
| 1786 | Ga0496106_0108749 | |||
| 1787 | Ga0496106_0300817 | |||
| 1788 | Ga0496107_0002528 | |||
| 1789 | Ga0496107_0011416 | |||
| 1790 | Ga0496107_0035459 | |||
| 1791 | Ga0496107_0112745 | |||
| 1792 | Ga0496108_0006373 | |||
| 1793 | Ga0496108_0015010 | |||
| 1794 | Ga0496108_0030339 | |||
| 1795 | Ga0496108_0039148 | |||
| 1796 | Ga0496108_0039865 | |||
| 1797 | Ga0496108_0069283 | |||
| 1798 | Ga0496108_0071934 | |||
| 1799 | Ga0496108_0077469 | |||
| 1800 | Ga0496108_0396619 | |||
| 1801 | Ga0496108_0570689 | |||
| 1802 | Ga0496109_0000819 | |||
| 1803 | Ga0496109_0003308 | |||
| 1804 | Ga0496109_0013089 | |||
| 1805 | Ga0496109_0029424 | |||
| 1806 | Ga0496109_0141115 | |||
| 1807 | Ga0496109_0198623 | |||
| 1808 | Ga0496109_0251515 | |||
| 1809 | Ga0496110_0001476 | |||
| 1810 | Ga0496110_0002110 | |||
| 1811 | Ga0496110_0014163 | |||
| 1812 | Ga0496110_0016537 | |||
| 1813 | Ga0496110_0128680 | |||
| 1814 | Ga0496111_0005856 | |||
| 1815 | Ga0496111_0006277 | |||
| 1816 | Ga0496111_0011618 | |||
| 1817 | Ga0496111_0058949 | |||
| 1818 | Ga0496111_0065999 | |||
| 1819 | Ga0496111_0105369 | |||
| 1820 | Ga0496111_0258398 | |||
| 1821 | Ga0496112_0001431 | |||
| 1822 | Ga0496112_0010158 | |||
| 1823 | Ga0496112_0023925 | |||
| 1824 | Ga0496112_0139208 | |||
| 1825 | Ga0496112_0155605 | |||
| 1826 | Ga0496112_0498529 | |||
| 1827 | Ga0496112_0507843 | |||
| 1828 | Ga0496113_0000831 | |||
| 1829 | Ga0496113_0003183 | |||
| 1830 | Ga0496113_0004545 | |||
| 1831 | Ga0496113_0022669 | |||
| 1832 | Ga0496113_0036250 | |||
| 1833 | Ga0496114_0016604 | |||
| 1834 | Ga0496114_0017767 | |||
| 1835 | Ga0496114_0023817 | |||
| 1836 | Ga0496114_0067300 | |||
| 1837 | Ga0496114_0226868 | |||
| 1838 | Ga0496115_0003245 | |||
| 1839 | Ga0496115_0011659 | |||
| 1840 | Ga0496115_0015517 | |||
| 1841 | Ga0496115_0029988 | |||
| 1842 | Ga0496115_0107109 | |||
| 1843 | Ga0496115_0119480 | |||
| 1844 | Ga0496115_0121171 | |||
| 1845 | Ga0496115_0467569 | |||
| 1846 | Ga0501031_0049266 | |||
| 1847 | Ga0501031_0076744 | |||
| 1848 | Ga0501031_0084289 | |||
| 1849 | Ga0501031_0159822 | |||
| 1850 | Ga0501032_0020441 | |||
| 1851 | Ga0501032_0039811 | |||
| 1852 | Ga0501032_0077295 | |||
| 1853 | Ga0501032_0109620 | |||
| 1854 | Ga0501032_0172994 | |||
| 1855 | Ga0501033_0000205 | |||
| 1856 | Ga0501033_0050745 | |||
| 1857 | Ga0501033_0053674 | |||
| 1858 | Ga0501034_0000089 | |||
| 1859 | Ga0501034_0000828 | |||
| 1860 | Ga0501034_0016809 | |||
| 1861 | Ga0501034_0028203 | |||
| 1862 | Ga0501034_0055549 | |||
| 1863 | Ga0501034_0060017 | |||
| 1864 | Ga0501034_0093074 | |||
| 1865 | Ga0501034_0122758 | |||
| 1866 | Ga0501034_0147038 | |||
| 1867 | Ga0501034_0205496 | |||
| 1868 | Ga0501034_0381990 | |||
| 1869 | Ga0501034_0400359 | |||
| 1870 | Ga0501034_0474667 | |||
| 1871 | Ga0501036_0003296 | |||
| 1872 | Ga0501036_0036192 | |||
| 1873 | Ga0501036_0037691 | |||
| 1874 | Ga0501036_0065929 | |||
| 1875 | Ga0501036_0073027 | |||
| 1876 | Ga0501036_0119271 | |||
| 1877 | Ga0501037_0001134 | |||
| 1878 | Ga0501037_0034782 | |||
| 1879 | Ga0501037_0046116 | |||
| 1880 | Ga0501037_0076029 | |||
| 1881 | Ga0501037_0090194 | |||
| 1882 | Ga0501037_0363002 | |||
| 1883 | Ga0501038_0025178 | |||
| 1884 | Ga0501038_0040154 | |||
| 1885 | Ga0501038_0118995 | |||
| 1886 | Ga0501038_0134084 | |||
| 1887 | Ga0501038_0211440 | |||
| 1888 | Ga0501039_0005007 | |||
| 1889 | Ga0501039_0009424 | |||
| 1890 | Ga0501039_0017181 | |||
| 1891 | Ga0501039_0055186 | |||
| 1892 | Ga0501039_0091225 | |||
| 1893 | Ga0501039_0150036 | |||
| 1894 | Ga0501039_0181062 | |||
| 1895 | Ga0501040_0029541 | |||
| 1896 | Ga0501040_0132608 | |||
| 1897 | Ga0501041_0278284 | |||
| 1898 | Ga0501042_0074535 | |||
| 1899 | Ga0501042_0075473 | |||
| 1900 | Ga0501043_0008773 | |||
| 1901 | Ga0501043_0012746 | |||
| 1902 | Ga0501043_0018709 | |||
| 1903 | Ga0501043_0032279 | |||
| 1904 | Ga0501043_0101227 | |||
| 1905 | Ga0501043_0230754 | |||
| 1906 | Ga0501043_0351234 | |||
| 1907 | Ga0501046_0007077 | |||
| 1908 | Ga0501046_0025197 | |||
| 1909 | Ga0501046_0062417 | |||
| 1910 | Ga0501046_0126229 | |||
| 1911 | Ga0501046_0127178 | |||
| 1912 | Ga0501047_0000108 | |||
| 1913 | Ga0501047_0025734 | |||
| 1914 | Ga0501047_0066866 | |||
| 1915 | Ga0501047_0098858 | |||
| 1916 | Ga0501047_0207127 | |||
| 1917 | Ga0501047_0244362 | |||
| 1918 | Ga0501047_0346106 | |||
| 1919 | Ga0501048_0000209 | |||
| 1920 | Ga0501048_0013650 | |||
| 1921 | Ga0501048_0014157 | |||
| 1922 | Ga0501048_0020341 | |||
| 1923 | Ga0501048_0136290 | |||
| 1924 | Ga0501048_0196700 | |||
| 1925 | Ga0501048_0268188 | |||
| 1926 | Ga0501067_0003360 | |||
| 1927 | Ga0501067_0040871 | |||
| 1928 | Ga0501068_0021781 | |||
| 1929 | Ga0501068_0041329 | |||
| 1930 | Ga0501068_0072882 | |||
| 1931 | Ga0501068_0152987 | |||
| 1932 | Ga0501068_0226877 | |||
| 1933 | Ga0501069_0001133 | |||
| 1934 | Ga0501069_0071030 | |||
| 1935 | Ga0501070_0001648 | |||
| 1936 | Ga0501070_0027316 | |||
| 1937 | Ga0501070_0036412 | |||
| 1938 | Ga0501070_0078329 | |||
| 1939 | Ga0501071_0022908 | |||
| 1940 | Ga0501071_0178376 | |||
| 1941 | Ga0501072_0158783 | |||
| 1942 | Ga0501072_0232290 | |||
| 1943 | Ga0501072_0264315 | |||
| 1944 | Ga0501072_0356080 | |||
| 1945 | Ga0501073_0005256 | |||
| 1946 | Ga0501073_0025526 | |||
| 1947 | Ga0501073_0041841 | |||
| 1948 | Ga0501073_0082350 | |||
| 1949 | Ga0501073_0157332 | |||
| 1950 | Ga0501073_0164699 | |||
| 1951 | Ga0501073_0253293 | |||
| 1952 | Ga0501073_0292601 | |||
| 1953 | Ga0501074_0019566 | |||
| 1954 | Ga0501074_0024646 | |||
| 1955 | Ga0501074_0039416 | |||
| 1956 | Ga0501074_0043986 | |||
| 1957 | Ga0501074_0053083 | |||
| 1958 | Ga0501075_0225914 | |||
| 1959 | Ga0501075_0282252 | |||
| 1960 | Ga0501076_0053956 | |||
| 1961 | Ga0501077_0014142 | |||
| 1962 | Ga0501077_0164431 | |||
| 1963 | Ga0501079_0002509 | |||
| 1964 | Ga0501079_0228550 | |||
| 1965 | Ga0501080_0000045 | |||
| 1966 | Ga0501080_0030296 | |||
| 1967 | Ga0501080_0078320 | |||
| 1968 | Ga0501080_0163414 | |||
| 1969 | Ga0501080_0233749 | |||
| 1970 | Ga0501080_0375296 | |||
| 1971 | Ga0501083_0014871 | |||
| 1972 | Ga0501083_0017767 | |||
| 1973 | Ga0501083_0027396 | |||
| 1974 | Ga0501083_0114833 | |||
| 1975 | Ga0501083_0188396 | |||
| 1976 | Ga0501035_0003025 | |||
| 1977 | Ga0501035_0005998 | |||
| 1978 | Ga0501035_0012678 | |||
| 1979 | Ga0501035_0060405 | |||
| 1980 | Ga0501035_0068273 | |||
| 1981 | Ga0501035_0082150 | |||
| 1982 | Ga0501035_0302350 | |||
| 1983 | Ga0501044_0005118 | |||
| 1984 | Ga0501044_0012466 | |||
| 1985 | Ga0501044_0015931 | |||
| 1986 | Ga0501044_0023596 | |||
| 1987 | Ga0501044_0045373 | |||
| 1988 | Ga0501044_0196868 | |||
| 1989 | Ga0501044_0220219 | |||
| 1990 | Ga0501044_0243947 | |||
| 1991 | Ga0501044_0247838 | |||
| 1992 | Ga0501044_0284397 | |||
| 1993 | Ga0501044_0333355 | |||
| 1994 | Ga0501045_0113595 | |||
| 1995 | Ga0501045_0400828 | |||
| 1996 | nmdc:mga03683_50418_c1 | |||
| 1997 | nmdc:mga00v17_128202_c1 | |||
| 1998 | nmdc:mga0yw44_1015_c1 | |||
| 1999 | nmdc:mga0yw44_141419_c1 | |||
| 2000 | nmdc:mga0yw44_99323_c1 | |||
| 2001 | nmdc:mga0k408_208406_c1 | |||
| 2002 | nmdc:mga06z11_108092_c1 | |||
| 2003 | nmdc:mga07m45_114167_c1 | |||
| 2004 | nmdc:mga05p37_111_c1 | |||
| 2005 | nmdc:mga05p37_140770_c1 | |||
| 2006 | nmdc:mga05p37_22003_c1 | |||
| 2007 | nmdc:mga05p37_3667_c1 | |||
| 2008 | nmdc:mga05p37_528767_c1 | |||
| 2009 | nmdc:mga05p37_685461_c1 | |||
| 2010 | nmdc:mga05p37_696488_c1 | |||
| 2011 | nmdc:mga05p37_905_c1 | |||
| 2012 | nmdc:mga09592_123766_c1 | |||
| 2013 | nmdc:mga09592_137_c1 | |||
| 2014 | nmdc:mga09592_175777_c1 | |||
| 2015 | nmdc:mga09592_197663_c1 | |||
| 2016 | nmdc:mga09592_26246_c2 | |||
| 2017 | nmdc:mga09592_769_c1 | |||
| 2018 | nmdc:mga0qj67_102490_c1 | |||
| 2019 | nmdc:mga0qj67_136575_c1 | |||
| 2020 | nmdc:mga0qj67_18_c1 | |||
| 2021 | nmdc:mga0qj67_2255_c1 | |||
| 2022 | nmdc:mga0qj67_310602_c1 | |||
| 2023 | nmdc:mga0qj67_315750_c1 | |||
| 2024 | nmdc:mga0qj67_57131_c1 | |||
| 2025 | nmdc:mga0qj67_85222_c1 | |||
| 2026 | nmdc:mga06r32_106084_c1 | |||
| 2027 | nmdc:mga06r32_1166_c1 | |||
| 2028 | nmdc:mga06r32_124629_c1 | |||
| 2029 | nmdc:mga06r32_132079_c1 | |||
| 2030 | nmdc:mga06r32_15348_c1 | |||
| 2031 | nmdc:mga06r32_269065_c1 | |||
| 2032 | nmdc:mga06r32_28514_c1 | |||
| 2033 | nmdc:mga06r32_3187_c1 | |||
| 2034 | nmdc:mga08y16_119_c1 | |||
| 2035 | nmdc:mga08y16_126926_c1 | |||
| 2036 | nmdc:mga08y16_417044_c1 | |||
| 2037 | nmdc:mga08y16_61898_c1 | |||
| 2038 | nmdc:mga08y16_8169_c1 | |||
| 2039 | nmdc:mga08y16_98318_c1 | |||
| 2040 | nmdc:mga0n895_16484_c1 | |||
| 2041 | nmdc:mga0n895_269046_c1 | |||
| 2042 | nmdc:mga0n895_269343_c1 | |||
| 2043 | nmdc:mga0n895_3491_c1 | |||
| 2044 | nmdc:mga0n895_417874_c1 | |||
| 2045 | nmdc:mga0n895_72196_c1 | |||
| 2046 | nmdc:mga0n895_99926_c1 | |||
| 2047 | nmdc:mga0rr50_1368_c2 | |||
| 2048 | nmdc:mga0rr50_209624_c1 | |||
| 2049 | nmdc:mga0rr50_280126_c1 | |||
| 2050 | nmdc:mga08x19_18_c1 | |||
| 2051 | nmdc:mga08x19_89938_c1 | |||
| 2052 | nmdc:mga0a205_129109_c1 | |||
| 2053 | nmdc:mga0a205_247854_c1 | |||
| 2054 | nmdc:mga0a205_50_c1 | |||
| 2055 | Ga0495601_0163218 | |||
| 2056 | Ga0495612_0003129 | |||
| 2057 | Ga0495612_0095721 | |||
| 2058 | Ga0495595_0000783 | |||
| 2059 | Ga0495595_0012401 | |||
| 2060 | Ga0495595_0016992 | |||
| 2061 | Ga0495595_0047139 | |||
| 2062 | Ga0495619_0000178 | |||
| 2063 | Ga0495619_0015464 | |||
| 2064 | Ga0495619_0086847 | |||
| 2065 | Ga0495619_0107922 | |||
| 2066 | Ga0495619_0299923 | |||
| 2067 | Ga0501084_0050571 | |||
| 2068 | Ga0501084_0055974 | |||
| 2069 | Ga0501082_0095217 | |||
| 2070 | Ga0501082_0328492 | |||
| 2071 | Ga0501082_0356028 | |||
| 2072 | Ga0530510_0017985 | |||
| 2073 | Ga0530510_0252573 | |||
| 2074 | 8045868705 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eit-assembly2.cif.gz_E-2 | crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae | 0.9622 | 11 | 262 |
| 4eit-assembly1.cif.gz_A | crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae | 0.9599 | 11 | 262 |
| 2yw9-assembly2.cif.gz_H | crystal structure of tt0143 from thermus thermophilus hb8 | 0.9576 | 10 | 261 |
| 3k31-assembly1.cif.gz_B | crystal structure of eonyl-(acyl-carrier-protein) reductase from anaplasma phagocytophilum in complex with nad at 1.9a resolution | 0.9566 | 10 | 262 |
| 2yw9-assembly1.cif.gz_D | crystal structure of tt0143 from thermus thermophilus hb8 | 0.9565 | 10 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9549 | 11 | 264 | 3.40.50.720 |
| 3grkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9512 | 11 | 264 | 3.40.50.720 |
| 2p91C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9455 | 13 | 262 | 3.40.50.720 |
| 2wyuB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9444 | 13 | 264 | 3.40.50.720 |
| af_P0AEK4_1_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9434 | 11 | 265 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524HVT7-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9912 | 13 | 140 |
GO:0004318
GO:0006633 |
| AF-A0A431MZJ8-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.991 | 13 | 146 |
GO:0004318
GO:0006633 |
| AF-A0A7V8QNA4-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9888 | 11 | 154 |
GO:0004318
GO:0006633 |
| AF-A0A3S2B571-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9867 | 10 | 134 |
GO:0004318
GO:0006633 |
| AF-A0A357X796-F1-model_v4 | deleted | 0.9841 | 10 | 196 |
|