F488752
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1037 | 511 | 2074 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300053133|Ga0500655_028009|Ga0500655_028009_422_1060 |
| Length | 169 |
| Sequence | LAAAFGQGAGRLARVKLLLVAVGQRQPAWAETAYDDFAKRFPPEMRLELKAVKAETRGSRTAEQMMAAEAARIEAALPKGVRRVVLDERGDRLTSVQLAARMKAWLPDGRDVAFVIGGPDGLDAGLKRSADETMRLSDLTLPHAFARVLLAEALYRAWTLTVNHPYHRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 208 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 209 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 210 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 211 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 212 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 213 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 237 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 239 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 256 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 257 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 258 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 259 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 265 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 266 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 269 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 270 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 271 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 272 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 273 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 274 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 275 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 276 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 277 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 278 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 279 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 280 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 281 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 282 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 283 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 284 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 285 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 286 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 287 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 288 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 289 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 290 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 291 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 292 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 293 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 294 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 295 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 296 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 297 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 298 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 299 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 300 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 301 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 302 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 303 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 304 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 305 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 306 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 309 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 310 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 313 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 314 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 315 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 316 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 317 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 318 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 322 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 381 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 382 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 385 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 386 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 387 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 393 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 394 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 406 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 409 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 411 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 412 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 414 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 417 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 420 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 421 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 425 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 429 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 430 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 431 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 435 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 436 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 440 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 442 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 443 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 444 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 445 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 446 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 447 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 448 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 449 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 450 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 451 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 452 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 453 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 454 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 455 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 456 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 457 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 458 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 459 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 460 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 461 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 462 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 463 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 464 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 465 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 466 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 467 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 468 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 469 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 470 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 471 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 472 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 473 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 474 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 475 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 476 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 477 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 478 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 479 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 480 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 481 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 482 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 483 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 484 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 485 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 486 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 487 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 488 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 489 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 490 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 491 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 492 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 493 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 494 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 495 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 496 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 497 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 498 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 499 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 500 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 501 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 502 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 503 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 504 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 505 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 506 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 507 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 508 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 509 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 510 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 511 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.77 |
| Metatranscriptomes | 0.58 |
| Isolates | 6.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.69 |
| Nodule | 0.68 |
| Rhizoplane | 2.31 |
| Rhizosphere | 60.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500655_028009 | 3300053133 | Bacteria | 1077 |
| 2 | JGI24740J21852_10001987 | 3300001979 | Bacteria | 9350 |
| 3 | JGI24740J21852_10022496 | 3300001979 | Bacteria | 2169 |
| 4 | JGI24739J22299_10064426 | 3300001989 | Bacteria | 1152 |
| 5 | JGI25152J39213_1003563 | 3300002773 | Bacteria | 5269 |
| 6 | JGI25152J39213_1004322 | 3300002773 | Bacteria | 4519 |
| 7 | JGI25150J39212_1000611 | 3300002774 | Bacteria | 13763 |
| 8 | JGI25159J45721_1004613 | 3300002987 | Bacteria | 4520 |
| 9 | JGI25159J45721_1005744 | 3300002987 | Bacteria | 3840 |
| 10 | JGI25151J46595_10001037 | 3300003187 | Bacteria | 20781 |
| 11 | JGI25151J46595_10002554 | 3300003187 | Bacteria | 10797 |
| 12 | JGI25151J46595_10009062 | 3300003187 | Bacteria | 4742 |
| 13 | JGI25151J46595_10042257 | 3300003187 | Bacteria | 1644 |
| 14 | JGI25153J46596_10005629 | 3300003215 | Bacteria | 6547 |
| 15 | JGI25153J46596_10008890 | 3300003215 | Bacteria | 4742 |
| 16 | JGI25153J46596_10016584 | 3300003215 | Bacteria | 2941 |
| 17 | JGI25153J46596_10034724 | 3300003215 | Bacteria | 1644 |
| 18 | rootH1_10053737 | 3300003316 | Bacteria | 2438 |
| 19 | rootH2_10216731 | 3300003320 | Bacteria | 1662 |
| 20 | rootL2_10006742 | 3300003322 | Bacteria | 1816 |
| 21 | rootL2_10326548 | 3300003322 | Bacteria | 1322 |
| 22 | rootH1_10008734 | 3300003323 | Bacteria | 3606 |
| 23 | JGI25160J50197_1008977 | 3300003354 | Bacteria | 3752 |
| 24 | JGI25161J50226_1003069 | 3300003374 | Bacteria | 3993 |
| 25 | Ga0006562J51391_1072998 | 3300003578 | Bacteria | 5510 |
| 26 | Ga0006562J51391_1072999 | 3300003578 | Bacteria | 4080 |
| 27 | Ga0006562J51391_1109357 | 3300003578 | Bacteria | 4810 |
| 28 | Ga0006562J51391_1109361 | 3300003578 | Bacteria | 3100 |
| 29 | Ga0055527_1008925 | 3300003760 | Bacteria | 1187 |
| 30 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 31 | Ga0055526_1005340 | 3300003771 | Bacteria | 7422 |
| 32 | Ga0055526_1009890 | 3300003771 | Bacteria | 4520 |
| 33 | Ga0055526_1009910 | 3300003771 | Bacteria | 4514 |
| 34 | Ga0055537_1000296 | 3300003773 | Bacteria | 35117 |
| 35 | Ga0055537_1003601 | 3300003773 | Bacteria | 4718 |
| 36 | Ga0055537_1004830 | 3300003773 | Bacteria | 3746 |
| 37 | Ga0055524_1000302 | 3300003775 | Bacteria | 47410 |
| 38 | Ga0055524_1005397 | 3300003775 | Bacteria | 5716 |
| 39 | Ga0055524_1007817 | 3300003775 | Bacteria | 4507 |
| 40 | Ga0055536_1002464 | 3300003781 | Bacteria | 10393 |
| 41 | Ga0055536_1025110 | 3300003781 | Bacteria | 1707 |
| 42 | Ga0055536_1035294 | 3300003781 | Bacteria | 1253 |
| 43 | Ga0055534_1000092 | 3300003784 | Bacteria | 70082 |
| 44 | Ga0055534_1000506 | 3300003784 | Bacteria | 21227 |
| 45 | Ga0055534_1003706 | 3300003784 | Bacteria | 4718 |
| 46 | Ga0055534_1003774 | 3300003784 | Bacteria | 4660 |
| 47 | Ga0055528_1000190 | 3300003790 | Bacteria | 52365 |
| 48 | Ga0055528_1007713 | 3300003790 | Bacteria | 4718 |
| 49 | Ga0055528_1011213 | 3300003790 | Bacteria | 3580 |
| 50 | Ga0055530_10000214 | 3300003791 | Bacteria | 52165 |
| 51 | Ga0055530_10046040 | 3300003791 | Bacteria | 1038 |
| 52 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 53 | Ga0055540_1000035 | 3300003792 | Bacteria | 166843 |
| 54 | Ga0055540_1006272 | 3300003792 | Bacteria | 4758 |
| 55 | Ga0055540_1010662 | 3300003792 | Bacteria | 3037 |
| 56 | Ga0055531_10000317 | 3300003794 | Bacteria | 47389 |
| 57 | Ga0055531_10000612 | 3300003794 | Bacteria | 30958 |
| 58 | Ga0055531_10010027 | 3300003794 | Bacteria | 4764 |
| 59 | Ga0055531_10010039 | 3300003794 | Bacteria | 4758 |
| 60 | Ga0055531_10013011 | 3300003794 | Bacteria | 3869 |
| 61 | Ga0055543_1003575 | 3300004625 | Bacteria | 4503 |
| 62 | Ga0055543_1005529 | 3300004625 | Bacteria | 3207 |
| 63 | Ga0065165_1001409 | 3300005262 | Bacteria | 26197 |
| 64 | Ga0065165_1006920 | 3300005262 | Bacteria | 5754 |
| 65 | Ga0065165_1019442 | 3300005262 | Bacteria | 2425 |
| 66 | Ga0065165_1021156 | 3300005262 | Bacteria | 2267 |
| 67 | Ga0065714_10071185 | 3300005288 | Bacteria | 3641 |
| 68 | Ga0065714_10162009 | 3300005288 | Bacteria | 1047 |
| 69 | Ga0070658_10153664 | 3300005327 | Bacteria | 1928 |
| 70 | Ga0070676_10041207 | 3300005328 | Bacteria | 2677 |
| 71 | Ga0070676_10245308 | 3300005328 | Bacteria | 1193 |
| 72 | Ga0070690_100004296 | 3300005330 | Bacteria | 7896 |
| 73 | Ga0070670_100425081 | 3300005331 | Bacteria | 1175 |
| 74 | Ga0070670_100500835 | 3300005331 | Bacteria | 1080 |
| 75 | Ga0070670_100522989 | 3300005331 | Bacteria | 1056 |
| 76 | Ga0070677_10274327 | 3300005333 | Bacteria | 847 |
| 77 | Ga0068869_100028112 | 3300005334 | Bacteria | 3926 |
| 78 | Ga0068869_100324339 | 3300005334 | Bacteria | 1250 |
| 79 | Ga0070666_10002227 | 3300005335 | Bacteria | 11730 |
| 80 | Ga0070680_100180066 | 3300005336 | Bacteria | 1780 |
| 81 | Ga0070682_100051931 | 3300005337 | Bacteria | 2564 |
| 82 | Ga0068868_100000526 | 3300005338 | Bacteria | 25605 |
| 83 | Ga0068868_100203916 | 3300005338 | Bacteria | 1650 |
| 84 | Ga0068868_100349216 | 3300005338 | Bacteria | 1266 |
| 85 | Ga0070660_100106598 | 3300005339 | Bacteria | 2226 |
| 86 | Ga0070689_100268559 | 3300005340 | Bacteria | 1412 |
| 87 | Ga0070668_100077914 | 3300005347 | Bacteria | 2591 |
| 88 | Ga0070669_100012794 | 3300005353 | Bacteria | 5958 |
| 89 | Ga0070669_100150344 | 3300005353 | Bacteria | 1802 |
| 90 | Ga0070669_100366576 | 3300005353 | Bacteria | 1172 |
| 91 | Ga0070675_100001257 | 3300005354 | Bacteria | 18531 |
| 92 | Ga0070675_100907041 | 3300005354 | Bacteria | 808 |
| 93 | Ga0070671_100125518 | 3300005355 | Bacteria | 2160 |
| 94 | Ga0070671_100305998 | 3300005355 | Bacteria | 1353 |
| 95 | Ga0070671_100375628 | 3300005355 | Bacteria | 1214 |
| 96 | Ga0070671_100827308 | 3300005355 | Bacteria | 807 |
| 97 | Ga0070674_100349044 | 3300005356 | Bacteria | 1194 |
| 98 | Ga0070674_100532809 | 3300005356 | Bacteria | 983 |
| 99 | Ga0070673_100003204 | 3300005364 | Bacteria | 10140 |
| 100 | Ga0070673_100258085 | 3300005364 | Bacteria | 1521 |
| 101 | Ga0070673_100767072 | 3300005364 | Bacteria | 889 |
| 102 | Ga0070673_100778093 | 3300005364 | Bacteria | 883 |
| 103 | Ga0070688_100077097 | 3300005365 | Bacteria | 2147 |
| 104 | Ga0070688_100471911 | 3300005365 | Bacteria | 942 |
| 105 | Ga0070659_100000481 | 3300005366 | Bacteria | 29333 |
| 106 | Ga0070659_101011499 | 3300005366 | Bacteria | 730 |
| 107 | Ga0070667_100080720 | 3300005367 | Bacteria | 2782 |
| 108 | Ga0070700_100327988 | 3300005441 | Bacteria | 1127 |
| 109 | Ga0070663_100163635 | 3300005455 | Bacteria | 1714 |
| 110 | Ga0070663_100199411 | 3300005455 | Bacteria | 1561 |
| 111 | Ga0070663_100227984 | 3300005455 | Bacteria | 1466 |
| 112 | Ga0070663_100374548 | 3300005455 | Bacteria | 1158 |
| 113 | Ga0070663_101122346 | 3300005455 | Bacteria | 688 |
| 114 | Ga0070678_100025493 | 3300005456 | Bacteria | 3979 |
| 115 | Ga0070678_100113725 | 3300005456 | Bacteria | 2122 |
| 116 | Ga0070678_100224620 | 3300005456 | Bacteria | 1562 |
| 117 | Ga0070678_101879349 | 3300005456 | Bacteria | 565 |
| 118 | Ga0070662_100031047 | 3300005457 | Bacteria | 3746 |
| 119 | Ga0070662_100046139 | 3300005457 | Bacteria | 3130 |
| 120 | Ga0070662_100116974 | 3300005457 | Bacteria | 2038 |
| 121 | Ga0070662_100174632 | 3300005457 | Bacteria | 1690 |
| 122 | Ga0070662_100176844 | 3300005457 | Bacteria | 1680 |
| 123 | Ga0070662_100436768 | 3300005457 | Bacteria | 1085 |
| 124 | Ga0070681_10361019 | 3300005458 | Bacteria | 1363 |
| 125 | Ga0068867_100000005 | 3300005459 | Bacteria | 174097 |
| 126 | Ga0068867_100062751 | 3300005459 | Bacteria | 2761 |
| 127 | Ga0068867_100097766 | 3300005459 | Bacteria | 2237 |
| 128 | Ga0068867_100112722 | 3300005459 | Bacteria | 2091 |
| 129 | Ga0068867_101148495 | 3300005459 | Bacteria | 711 |
| 130 | Ga0070685_10250691 | 3300005466 | Bacteria | 1173 |
| 131 | Ga0070706_100001719 | 3300005467 | Bacteria | 22759 |
| 132 | Ga0070707_101368383 | 3300005468 | Bacteria | 674 |
| 133 | Ga0070679_100064787 | 3300005530 | Bacteria | 3642 |
| 134 | Ga0070679_100094911 | 3300005530 | Bacteria | 2970 |
| 135 | Ga0068853_100051725 | 3300005539 | Bacteria | 3537 |
| 136 | Ga0068853_100240813 | 3300005539 | Bacteria | 1658 |
| 137 | Ga0068853_100376107 | 3300005539 | Bacteria | 1326 |
| 138 | Ga0070672_100108731 | 3300005543 | Bacteria | 2258 |
| 139 | Ga0070672_100276294 | 3300005543 | Bacteria | 1419 |
| 140 | Ga0070672_100639082 | 3300005543 | Bacteria | 929 |
| 141 | Ga0070672_101355628 | 3300005543 | Bacteria | 636 |
| 142 | Ga0070665_100557805 | 3300005548 | Bacteria | 1158 |
| 143 | Ga0070704_100621411 | 3300005549 | Bacteria | 951 |
| 144 | Ga0068855_100014182 | 3300005563 | Bacteria | 9602 |
| 145 | Ga0068855_100025134 | 3300005563 | Bacteria | 7130 |
| 146 | Ga0068855_100813039 | 3300005563 | Bacteria | 993 |
| 147 | Ga0070664_100118860 | 3300005564 | Bacteria | 2312 |
| 148 | Ga0070664_100556684 | 3300005564 | Bacteria | 1061 |
| 149 | Ga0070664_100561635 | 3300005564 | Bacteria | 1056 |
| 150 | Ga0068857_100596251 | 3300005577 | Bacteria | 1044 |
| 151 | Ga0068854_100183933 | 3300005578 | Bacteria | 1634 |
| 152 | Ga0068854_100483848 | 3300005578 | Bacteria | 1040 |
| 153 | Ga0068854_100518381 | 3300005578 | Bacteria | 1006 |
| 154 | Ga0068854_100635519 | 3300005578 | Bacteria | 915 |
| 155 | Ga0068856_100036361 | 3300005614 | Bacteria | 4829 |
| 156 | Ga0068856_100341872 | 3300005614 | Bacteria | 1515 |
| 157 | Ga0068852_100002367 | 3300005616 | Bacteria | 12987 |
| 158 | Ga0068852_100123976 | 3300005616 | Bacteria | 2370 |
| 159 | Ga0068852_100383670 | 3300005616 | Bacteria | 1379 |
| 160 | Ga0068852_101481327 | 3300005616 | Bacteria | 701 |
| 161 | Ga0068859_100010093 | 3300005617 | Bacteria | 9518 |
| 162 | Ga0068859_100923527 | 3300005617 | Bacteria | 957 |
| 163 | Ga0068864_100000511 | 3300005618 | Bacteria | 33486 |
| 164 | Ga0068861_100144813 | 3300005719 | Bacteria | 1943 |
| 165 | Ga0068861_101090679 | 3300005719 | Bacteria | 767 |
| 166 | Ga0068851_10004317 | 3300005834 | Bacteria | 6400 |
| 167 | Ga0068851_10037551 | 3300005834 | Bacteria | 2429 |
| 168 | Ga0068870_10450785 | 3300005840 | Bacteria | 848 |
| 169 | Ga0068863_100007397 | 3300005841 | Bacteria | 10748 |
| 170 | Ga0068858_100000359 | 3300005842 | Bacteria | 48114 |
| 171 | Ga0068860_100072237 | 3300005843 | Bacteria | 3279 |
| 172 | Ga0075365_10013252 | 3300006038 | Bacteria | 4920 |
| 173 | Ga0075365_10915880 | 3300006038 | Bacteria | 618 |
| 174 | Ga0075363_100070021 | 3300006048 | Bacteria | 1904 |
| 175 | Ga0075363_100084488 | 3300006048 | Bacteria | 1740 |
| 176 | Ga0075363_100171471 | 3300006048 | Bacteria | 1232 |
| 177 | Ga0075364_10054684 | 3300006051 | Bacteria | 2611 |
| 178 | Ga0075364_10238777 | 3300006051 | Bacteria | 1234 |
| 179 | Ga0075364_10271956 | 3300006051 | Bacteria | 1152 |
| 180 | Ga0075432_10008843 | 3300006058 | Bacteria | 3437 |
| 181 | Ga0075432_10024139 | 3300006058 | Bacteria | 2083 |
| 182 | Ga0075362_10003584 | 3300006177 | Bacteria | 5455 |
| 183 | Ga0075362_10039489 | 3300006177 | Bacteria | 2075 |
| 184 | Ga0075362_10131550 | 3300006177 | Bacteria | 1191 |
| 185 | Ga0075362_10317351 | 3300006177 | Bacteria | 776 |
| 186 | Ga0075367_10147513 | 3300006178 | Bacteria | 1459 |
| 187 | Ga0075367_10362599 | 3300006178 | Bacteria | 915 |
| 188 | Ga0075369_10032362 | 3300006186 | Bacteria | 2212 |
| 189 | Ga0075369_10199483 | 3300006186 | Bacteria | 923 |
| 190 | Ga0075366_10002649 | 3300006195 | Bacteria | 9220 |
| 191 | Ga0075366_10006970 | 3300006195 | Bacteria | 6223 |
| 192 | Ga0075366_10009720 | 3300006195 | Bacteria | 5377 |
| 193 | Ga0075366_10013620 | 3300006195 | Bacteria | 4635 |
| 194 | Ga0075366_10033567 | 3300006195 | Bacteria | 3023 |
| 195 | Ga0075366_10145745 | 3300006195 | Bacteria | 1433 |
| 196 | Ga0075366_10172756 | 3300006195 | Bacteria | 1311 |
| 197 | Ga0075366_10623891 | 3300006195 | Bacteria | 669 |
| 198 | Ga0097621_100057282 | 3300006237 | Bacteria | 3186 |
| 199 | Ga0097621_100831982 | 3300006237 | Bacteria | 857 |
| 200 | Ga0075370_10000556 | 3300006353 | Bacteria | 14286 |
| 201 | Ga0075370_10014562 | 3300006353 | Bacteria | 4198 |
| 202 | Ga0075370_10016632 | 3300006353 | Bacteria | 3959 |
| 203 | Ga0075370_10022291 | 3300006353 | Bacteria | 3477 |
| 204 | Ga0075370_10023906 | 3300006353 | Bacteria | 3370 |
| 205 | Ga0075370_10034046 | 3300006353 | Bacteria | 2855 |
| 206 | Ga0075370_10048286 | 3300006353 | Bacteria | 2411 |
| 207 | Ga0075370_10183655 | 3300006353 | Bacteria | 1231 |
| 208 | Ga0075370_10351501 | 3300006353 | Bacteria | 881 |
| 209 | Ga0068871_100064447 | 3300006358 | Bacteria | 3000 |
| 210 | Ga0068865_100087270 | 3300006881 | Bacteria | 2254 |
| 211 | Ga0068865_100209277 | 3300006881 | Bacteria | 1518 |
| 212 | Ga0068865_100409664 | 3300006881 | Bacteria | 1112 |
| 213 | Ga0097620_100010093 | 3300006931 | Bacteria | 9518 |
| 214 | Ga0097620_100923533 | 3300006931 | Bacteria | 957 |
| 215 | Ga0079104_1000024 | 3300006946 | Bacteria | 219543 |
| 216 | Ga0099826_10000115 | 3300006948 | Bacteria | 36769 |
| 217 | Ga0099826_10159610 | 3300006948 | Bacteria | 1279 |
| 218 | Ga0105250_10034781 | 3300009092 | Bacteria | 2021 |
| 219 | Ga0105240_10003642 | 3300009093 | Bacteria | 23871 |
| 220 | Ga0105240_10625342 | 3300009093 | Bacteria | 1183 |
| 221 | Ga0111539_12743599 | 3300009094 | Bacteria | 571 |
| 222 | Ga0105245_10008806 | 3300009098 | Bacteria | 8802 |
| 223 | Ga0105245_10251226 | 3300009098 | Bacteria | 1718 |
| 224 | Ga0105245_10668587 | 3300009098 | Bacteria | 1070 |
| 225 | Ga0105245_11621319 | 3300009098 | Bacteria | 699 |
| 226 | Ga0105243_10000515 | 3300009148 | Bacteria | 39435 |
| 227 | Ga0105243_10001515 | 3300009148 | Bacteria | 20296 |
| 228 | Ga0105243_10003542 | 3300009148 | Bacteria | 12617 |
| 229 | Ga0105243_10132451 | 3300009148 | Bacteria | 2117 |
| 230 | Ga0105243_10134204 | 3300009148 | Bacteria | 2104 |
| 231 | Ga0105243_10340324 | 3300009148 | Bacteria | 1374 |
| 232 | Ga0105243_10427224 | 3300009148 | Bacteria | 1237 |
| 233 | Ga0105241_10143886 | 3300009174 | Bacteria | 1944 |
| 234 | Ga0105242_10004129 | 3300009176 | Bacteria | 11304 |
| 235 | Ga0105242_10908655 | 3300009176 | Bacteria | 881 |
| 236 | Ga0105248_10161343 | 3300009177 | Bacteria | 2528 |
| 237 | Ga0105248_10531646 | 3300009177 | Bacteria | 1326 |
| 238 | Ga0105237_10034393 | 3300009545 | Bacteria | 5132 |
| 239 | Ga0105237_10037398 | 3300009545 | Bacteria | 4906 |
| 240 | Ga0105238_10006811 | 3300009551 | Bacteria | 11412 |
| 241 | Ga0105238_10027040 | 3300009551 | Bacteria | 5847 |
| 242 | Ga0105238_11315528 | 3300009551 | Bacteria | 749 |
| 243 | Ga0105249_10467555 | 3300009553 | Bacteria | 1302 |
| 244 | Ga0105239_10216054 | 3300010375 | Bacteria | 2150 |
| 245 | Ga0105239_11519189 | 3300010375 | Bacteria | 774 |
| 246 | Ga0105246_10131195 | 3300011119 | Bacteria | 1872 |
| 247 | Ga0157373_10029757 | 3300013100 | Bacteria | 3931 |
| 248 | Ga0157371_10133807 | 3300013102 | Bacteria | 1765 |
| 249 | Ga0157370_10065472 | 3300013104 | Bacteria | 3438 |
| 250 | Ga0157369_10043021 | 3300013105 | Bacteria | 4925 |
| 251 | Ga0157378_10528330 | 3300013297 | Bacteria | 1182 |
| 252 | Ga0157378_11042396 | 3300013297 | Bacteria | 853 |
| 253 | Ga0163162_10123599 | 3300013306 | Bacteria | 2693 |
| 254 | Ga0163162_10239243 | 3300013306 | Bacteria | 1946 |
| 255 | Ga0163162_10284627 | 3300013306 | Bacteria | 1785 |
| 256 | Ga0163162_10973410 | 3300013306 | Bacteria | 959 |
| 257 | Ga0157372_10806654 | 3300013307 | Bacteria | 1090 |
| 258 | Ga0157375_10169716 | 3300013308 | Bacteria | 2329 |
| 259 | Ga0157375_11715030 | 3300013308 | Bacteria | 744 |
| 260 | Ga0163163_10010941 | 3300014325 | Bacteria | 8198 |
| 261 | Ga0163163_12441689 | 3300014325 | Bacteria | 581 |
| 262 | Ga0157380_10119485 | 3300014326 | Bacteria | 2230 |
| 263 | Ga0157380_10283257 | 3300014326 | Bacteria | 1518 |
| 264 | Ga0157380_10948435 | 3300014326 | Bacteria | 890 |
| 265 | Ga0157380_10961539 | 3300014326 | Bacteria | 885 |
| 266 | Ga0182008_10009236 | 3300014497 | Bacteria | 5331 |
| 267 | Ga0182008_10011067 | 3300014497 | Bacteria | 4812 |
| 268 | Ga0182008_10057326 | 3300014497 | Bacteria | 1923 |
| 269 | Ga0182008_10122108 | 3300014497 | Bacteria | 1295 |
| 270 | Ga0157377_10000022 | 3300014745 | Bacteria | 146702 |
| 271 | Ga0157377_10138874 | 3300014745 | Bacteria | 1491 |
| 272 | Ga0157379_10092454 | 3300014968 | Bacteria | 2714 |
| 273 | Ga0157379_10523405 | 3300014968 | Bacteria | 1101 |
| 274 | Ga0157376_10145094 | 3300014969 | Bacteria | 2134 |
| 275 | Ga0157376_10796496 | 3300014969 | Bacteria | 957 |
| 276 | Ga0182007_10000472 | 3300015262 | Bacteria | 24301 |
| 277 | Ga0182007_10053924 | 3300015262 | Bacteria | 1323 |
| 278 | Ga0182005_1042245 | 3300015265 | Bacteria | 1239 |
| 279 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 280 | Ga0163161_10001036 | 3300017792 | Bacteria | 21172 |
| 281 | Ga0163161_10031016 | 3300017792 | Bacteria | 3807 |
| 282 | Ga0163161_10051910 | 3300017792 | Bacteria | 2972 |
| 283 | Ga0163161_10503808 | 3300017792 | Bacteria | 986 |
| 284 | Ga0209436_108139 | 3300025208 | Bacteria | 2120 |
| 285 | Ga0209672_101250 | 3300025228 | Bacteria | 10173 |
| 286 | Ga0209147_102210 | 3300025229 | Bacteria | 5234 |
| 287 | Ga0209258_100099 | 3300025242 | Bacteria | 214924 |
| 288 | Ga0207425_1000239 | 3300025245 | Bacteria | 42732 |
| 289 | Ga0207425_1001642 | 3300025245 | Bacteria | 9004 |
| 290 | Ga0207425_1004428 | 3300025245 | Bacteria | 4215 |
| 291 | Ga0209148_1000103 | 3300025254 | Bacteria | 215356 |
| 292 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 293 | Ga0209129_1000144 | 3300025258 | Bacteria | 115999 |
| 294 | Ga0209129_1001130 | 3300025258 | Bacteria | 15446 |
| 295 | Ga0209129_1004500 | 3300025258 | Bacteria | 5411 |
| 296 | Ga0209565_1000073 | 3300025263 | Bacteria | 164695 |
| 297 | Ga0209565_1000199 | 3300025263 | Bacteria | 71613 |
| 298 | Ga0209565_1003122 | 3300025263 | Bacteria | 5556 |
| 299 | Ga0209673_1000127 | 3300025273 | Bacteria | 164695 |
| 300 | Ga0209673_1000128 | 3300025273 | Bacteria | 164482 |
| 301 | Ga0209673_1001078 | 3300025273 | Bacteria | 30774 |
| 302 | Ga0209673_1001619 | 3300025273 | Bacteria | 19616 |
| 303 | Ga0209673_1003135 | 3300025273 | Bacteria | 10101 |
| 304 | Ga0209673_1013295 | 3300025273 | Bacteria | 3256 |
| 305 | Ga0209130_1000471 | 3300025284 | Bacteria | 41439 |
| 306 | Ga0209130_1000898 | 3300025284 | Bacteria | 24052 |
| 307 | Ga0209130_1000914 | 3300025284 | Bacteria | 23751 |
| 308 | Ga0209130_1002188 | 3300025284 | Bacteria | 10305 |
| 309 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 310 | Ga0209675_1000114 | 3300025291 | Bacteria | 112118 |
| 311 | Ga0209675_1000723 | 3300025291 | Bacteria | 22450 |
| 312 | Ga0209675_1000976 | 3300025291 | Bacteria | 18068 |
| 313 | Ga0209675_1002630 | 3300025291 | Bacteria | 9079 |
| 314 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 315 | Ga0209676_1000301 | 3300025292 | Bacteria | 99952 |
| 316 | Ga0209676_1002710 | 3300025292 | Bacteria | 11948 |
| 317 | Ga0209676_1003298 | 3300025292 | Bacteria | 10107 |
| 318 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 319 | Ga0209025_1000248 | 3300025294 | Bacteria | 126818 |
| 320 | Ga0209025_1000491 | 3300025294 | Bacteria | 75913 |
| 321 | Ga0209025_1006463 | 3300025294 | Bacteria | 9087 |
| 322 | Ga0209025_1026508 | 3300025294 | Bacteria | 2907 |
| 323 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 324 | Ga0209564_1000360 | 3300025295 | Bacteria | 84454 |
| 325 | Ga0209564_1001537 | 3300025295 | Bacteria | 22864 |
| 326 | Ga0209564_1042300 | 3300025295 | Bacteria | 1211 |
| 327 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 328 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 329 | Ga0209758_1000434 | 3300025297 | Bacteria | 70561 |
| 330 | Ga0209050_1000197 | 3300025298 | Bacteria | 135303 |
| 331 | Ga0209050_1000433 | 3300025298 | Bacteria | 76499 |
| 332 | Ga0209050_1000488 | 3300025298 | Bacteria | 68812 |
| 333 | Ga0209050_1007621 | 3300025298 | Bacteria | 6010 |
| 334 | Ga0209050_1007861 | 3300025298 | Bacteria | 5856 |
| 335 | Ga0209050_1011027 | 3300025298 | Bacteria | 4355 |
| 336 | Ga0209050_1042750 | 3300025298 | Bacteria | 1233 |
| 337 | Ga0209050_1042975 | 3300025298 | Bacteria | 1227 |
| 338 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 339 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 340 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 341 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 342 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 343 | Ga0207426_1001556 | 3300025302 | Bacteria | 18611 |
| 344 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 345 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 346 | Ga0209051_1000542 | 3300025303 | Bacteria | 46577 |
| 347 | Ga0209051_1001159 | 3300025303 | Bacteria | 23972 |
| 348 | Ga0209051_1002010 | 3300025303 | Bacteria | 15519 |
| 349 | Ga0209051_1004650 | 3300025303 | Bacteria | 8360 |
| 350 | Ga0209051_1007504 | 3300025303 | Bacteria | 5950 |
| 351 | Ga0209051_1023776 | 3300025303 | Bacteria | 2539 |
| 352 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 353 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 354 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 355 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 356 | Ga0209257_1006647 | 3300025304 | Bacteria | 7347 |
| 357 | Ga0209257_1007736 | 3300025304 | Bacteria | 6401 |
| 358 | Ga0207656_10052949 | 3300025321 | Bacteria | 1759 |
| 359 | Ga0207656_10060956 | 3300025321 | Bacteria | 1655 |
| 360 | Ga0207696_1036136 | 3300025711 | Bacteria | 1467 |
| 361 | Ga0207682_10075079 | 3300025893 | Bacteria | 1438 |
| 362 | Ga0207682_10167125 | 3300025893 | Bacteria | 999 |
| 363 | Ga0207680_10005639 | 3300025903 | Bacteria | 5989 |
| 364 | Ga0207680_10263764 | 3300025903 | Bacteria | 1193 |
| 365 | Ga0207645_10018276 | 3300025907 | Bacteria | 4617 |
| 366 | Ga0207645_10035636 | 3300025907 | Bacteria | 3194 |
| 367 | Ga0207645_10100201 | 3300025907 | Bacteria | 1869 |
| 368 | Ga0207645_10532092 | 3300025907 | Bacteria | 797 |
| 369 | Ga0207705_10141578 | 3300025909 | Bacteria | 1797 |
| 370 | Ga0207684_10001654 | 3300025910 | Bacteria | 23687 |
| 371 | Ga0207654_10111296 | 3300025911 | Bacteria | 1704 |
| 372 | Ga0207707_10310318 | 3300025912 | Bacteria | 1363 |
| 373 | Ga0207695_10347517 | 3300025913 | Bacteria | 1371 |
| 374 | Ga0207695_11112823 | 3300025913 | Bacteria | 670 |
| 375 | Ga0207671_10071283 | 3300025914 | Bacteria | 2592 |
| 376 | Ga0207671_11036626 | 3300025914 | Bacteria | 646 |
| 377 | Ga0207660_10138485 | 3300025917 | Bacteria | 1859 |
| 378 | Ga0207657_10016829 | 3300025919 | Bacteria | 7039 |
| 379 | Ga0207657_10625583 | 3300025919 | Bacteria | 839 |
| 380 | Ga0207657_11079679 | 3300025919 | Bacteria | 614 |
| 381 | Ga0207649_10006892 | 3300025920 | Bacteria | 6174 |
| 382 | Ga0207649_11137242 | 3300025920 | Bacteria | 616 |
| 383 | Ga0207652_10032924 | 3300025921 | Bacteria | 4362 |
| 384 | Ga0207646_10085820 | 3300025922 | Bacteria | 2816 |
| 385 | Ga0207681_10343261 | 3300025923 | Bacteria | 1193 |
| 386 | Ga0207681_10603020 | 3300025923 | Bacteria | 907 |
| 387 | Ga0207694_10043334 | 3300025924 | Bacteria | 3473 |
| 388 | Ga0207694_10103673 | 3300025924 | Bacteria | 2256 |
| 389 | Ga0207694_11257370 | 3300025924 | Bacteria | 626 |
| 390 | Ga0207650_10356242 | 3300025925 | Bacteria | 1205 |
| 391 | Ga0207650_10565955 | 3300025925 | Bacteria | 954 |
| 392 | Ga0207650_10948396 | 3300025925 | Bacteria | 731 |
| 393 | Ga0207659_10003030 | 3300025926 | Bacteria | 10024 |
| 394 | Ga0207659_10258615 | 3300025926 | Bacteria | 1415 |
| 395 | Ga0207659_10295076 | 3300025926 | Bacteria | 1329 |
| 396 | Ga0207659_10479979 | 3300025926 | Bacteria | 1050 |
| 397 | Ga0207687_10034029 | 3300025927 | Bacteria | 3458 |
| 398 | Ga0207687_10481755 | 3300025927 | Bacteria | 1033 |
| 399 | Ga0207687_10783030 | 3300025927 | Bacteria | 813 |
| 400 | Ga0207644_10105561 | 3300025931 | Bacteria | 2122 |
| 401 | Ga0207644_10120978 | 3300025931 | Bacteria | 1993 |
| 402 | Ga0207644_10154722 | 3300025931 | Bacteria | 1777 |
| 403 | Ga0207690_10000428 | 3300025932 | Bacteria | 27395 |
| 404 | Ga0207690_10722352 | 3300025932 | Bacteria | 820 |
| 405 | Ga0207706_10039894 | 3300025933 | Bacteria | 4162 |
| 406 | Ga0207706_10098221 | 3300025933 | Bacteria | 2575 |
| 407 | Ga0207706_10192746 | 3300025933 | Bacteria | 1788 |
| 408 | Ga0207706_10211544 | 3300025933 | Bacteria | 1700 |
| 409 | Ga0207706_10452262 | 3300025933 | Bacteria | 1111 |
| 410 | Ga0207686_10007355 | 3300025934 | Bacteria | 5927 |
| 411 | Ga0207709_10000245 | 3300025935 | Bacteria | 66704 |
| 412 | Ga0207709_10000522 | 3300025935 | Bacteria | 33464 |
| 413 | Ga0207709_10001057 | 3300025935 | Bacteria | 20345 |
| 414 | Ga0207709_10578054 | 3300025935 | Bacteria | 887 |
| 415 | Ga0207670_10290321 | 3300025936 | Bacteria | 1277 |
| 416 | Ga0207669_10767268 | 3300025937 | Bacteria | 797 |
| 417 | Ga0207704_10265032 | 3300025938 | Bacteria | 1297 |
| 418 | Ga0207691_10193218 | 3300025940 | Bacteria | 1774 |
| 419 | Ga0207691_10228240 | 3300025940 | Bacteria | 1613 |
| 420 | Ga0207691_10355654 | 3300025940 | Bacteria | 1253 |
| 421 | Ga0207711_10199470 | 3300025941 | Bacteria | 1826 |
| 422 | Ga0207711_10509761 | 3300025941 | Bacteria | 1121 |
| 423 | Ga0207689_10040791 | 3300025942 | Bacteria | 3841 |
| 424 | Ga0207689_10079678 | 3300025942 | Bacteria | 2691 |
| 425 | Ga0207679_10023501 | 3300025945 | Bacteria | 4217 |
| 426 | Ga0207679_10026952 | 3300025945 | Bacteria | 3968 |
| 427 | Ga0207679_10358199 | 3300025945 | Bacteria | 1273 |
| 428 | Ga0207667_10089432 | 3300025949 | Bacteria | 3183 |
| 429 | Ga0207667_11139411 | 3300025949 | Bacteria | 762 |
| 430 | Ga0207651_10001269 | 3300025960 | Bacteria | 11360 |
| 431 | Ga0207651_10115784 | 3300025960 | Bacteria | 2022 |
| 432 | Ga0207651_10182500 | 3300025960 | Bacteria | 1666 |
| 433 | Ga0207651_10238065 | 3300025960 | Bacteria | 1482 |
| 434 | Ga0207651_10396106 | 3300025960 | Bacteria | 1173 |
| 435 | Ga0207712_10033531 | 3300025961 | Bacteria | 3472 |
| 436 | Ga0207668_10151952 | 3300025972 | Bacteria | 1793 |
| 437 | Ga0207668_11011088 | 3300025972 | Bacteria | 743 |
| 438 | Ga0207640_10121792 | 3300025981 | Bacteria | 1870 |
| 439 | Ga0207640_10154690 | 3300025981 | Bacteria | 1689 |
| 440 | Ga0207640_10384754 | 3300025981 | Bacteria | 1138 |
| 441 | Ga0207658_10088021 | 3300025986 | Bacteria | 2399 |
| 442 | Ga0207658_10097808 | 3300025986 | Bacteria | 2292 |
| 443 | Ga0207677_10008077 | 3300026023 | Bacteria | 5857 |
| 444 | Ga0207677_10012869 | 3300026023 | Bacteria | 4830 |
| 445 | Ga0207677_10420136 | 3300026023 | Bacteria | 1139 |
| 446 | Ga0207703_10002190 | 3300026035 | Bacteria | 17149 |
| 447 | Ga0207703_10716627 | 3300026035 | Bacteria | 952 |
| 448 | Ga0207639_10070642 | 3300026041 | Bacteria | 2728 |
| 449 | Ga0207639_10165441 | 3300026041 | Bacteria | 1868 |
| 450 | Ga0207639_10339936 | 3300026041 | Bacteria | 1338 |
| 451 | Ga0207678_10059926 | 3300026067 | Bacteria | 3275 |
| 452 | Ga0207678_10086891 | 3300026067 | Bacteria | 2672 |
| 453 | Ga0207678_10385440 | 3300026067 | Bacteria | 1212 |
| 454 | Ga0207678_10386594 | 3300026067 | Bacteria | 1210 |
| 455 | Ga0207708_10156192 | 3300026075 | Bacteria | 1799 |
| 456 | Ga0207702_10046176 | 3300026078 | Bacteria | 3666 |
| 457 | Ga0207702_11078602 | 3300026078 | Bacteria | 797 |
| 458 | Ga0207702_11107518 | 3300026078 | Bacteria | 786 |
| 459 | Ga0207641_10001726 | 3300026088 | Bacteria | 21102 |
| 460 | Ga0207648_10000032 | 3300026089 | Bacteria | 128009 |
| 461 | Ga0207648_10017579 | 3300026089 | Bacteria | 6497 |
| 462 | Ga0207648_10032114 | 3300026089 | Bacteria | 4638 |
| 463 | Ga0207648_10205864 | 3300026089 | Bacteria | 1746 |
| 464 | Ga0207648_10368277 | 3300026089 | Bacteria | 1297 |
| 465 | Ga0207648_10583581 | 3300026089 | Bacteria | 1029 |
| 466 | Ga0207648_10696885 | 3300026089 | Bacteria | 941 |
| 467 | Ga0207676_10003149 | 3300026095 | Bacteria | 11781 |
| 468 | Ga0207674_10349962 | 3300026116 | Bacteria | 1428 |
| 469 | Ga0207674_10540395 | 3300026116 | Bacteria | 1126 |
| 470 | Ga0207674_11276771 | 3300026116 | Bacteria | 704 |
| 471 | Ga0207675_100109629 | 3300026118 | Bacteria | 2605 |
| 472 | Ga0207683_10010783 | 3300026121 | Bacteria | 7793 |
| 473 | Ga0207683_10030115 | 3300026121 | Bacteria | 4702 |
| 474 | Ga0207683_10032771 | 3300026121 | Bacteria | 4513 |
| 475 | Ga0207683_10558013 | 3300026121 | Bacteria | 1059 |
| 476 | Ga0207698_10004168 | 3300026142 | Bacteria | 8790 |
| 477 | Ga0207698_10022533 | 3300026142 | Bacteria | 4380 |
| 478 | Ga0207698_10024501 | 3300026142 | Bacteria | 4237 |
| 479 | Ga0207698_10060126 | 3300026142 | Bacteria | 2953 |
| 480 | Ga0207698_10329259 | 3300026142 | Bacteria | 1434 |
| 481 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 482 | Ga0209281_1000104 | 3300027111 | Bacteria | 221056 |
| 483 | Ga0209983_1051536 | 3300027665 | Bacteria | 901 |
| 484 | Ga0209282_1000109 | 3300027666 | Bacteria | 53813 |
| 485 | Ga0209974_10005579 | 3300027876 | Bacteria | 4421 |
| 486 | Ga0209974_10091046 | 3300027876 | Bacteria | 1058 |
| 487 | Ga0209974_10146591 | 3300027876 | Bacteria | 850 |
| 488 | Ga0207428_10102987 | 3300027907 | Bacteria | 2204 |
| 489 | Ga0268266_10107424 | 3300028379 | Bacteria | 2468 |
| 490 | Ga0268266_11581600 | 3300028379 | Bacteria | 631 |
| 491 | Ga0268265_10029913 | 3300028380 | Bacteria | 3918 |
| 492 | Ga0268265_10204653 | 3300028380 | Bacteria | 1715 |
| 493 | Ga0268265_11174997 | 3300028380 | Bacteria | 764 |
| 494 | Ga0268264_10065396 | 3300028381 | Bacteria | 3064 |
| 495 | Ga0268264_10195084 | 3300028381 | Bacteria | 1848 |
| 496 | Ga0307515_10000842 | 3300028794 | Bacteria | 70481 |
| 497 | Ga0307515_10001088 | 3300028794 | Bacteria | 62228 |
| 498 | Ga0307515_10001640 | 3300028794 | Bacteria | 49762 |
| 499 | Ga0307515_10020481 | 3300028794 | Bacteria | 11796 |
| 500 | Ga0307515_10064179 | 3300028794 | Bacteria | 5138 |
| 501 | Ga0307515_10109248 | 3300028794 | Bacteria | 3250 |
| 502 | Ga0307515_10127705 | 3300028794 | Bacteria | 2826 |
| 503 | Ga0307515_10166309 | 3300028794 | Bacteria | 2221 |
| 504 | Ga0307515_10233339 | 3300028794 | Bacteria | 1627 |
| 505 | Ga0307512_10045218 | 3300030522 | Bacteria | 3609 |
| 506 | Ga0307512_10065075 | 3300030522 | Bacteria | 2769 |
| 507 | Ga0316177_1071860 | 3300030731 | Bacteria | 4227 |
| 508 | Ga0316177_1155855 | 3300030731 | Bacteria | 3185 |
| 509 | Ga0316176_1148086 | 3300030732 | Bacteria | 2630 |
| 510 | Ga0314311_1122598 | 3300030733 | Bacteria | 1910 |
| 511 | Ga0316178_1138608 | 3300030735 | Bacteria | 6199 |
| 512 | Ga0316180_1073464 | 3300030736 | Bacteria | 1165 |
| 513 | Ga0316183_1020296 | 3300030742 | Bacteria | 4775 |
| 514 | Ga0316181_1106329 | 3300030744 | Bacteria | 3528 |
| 515 | Ga0265332_10008074 | 3300031238 | Bacteria | 4735 |
| 516 | Ga0265332_10291341 | 3300031238 | Bacteria | 674 |
| 517 | Ga0265329_10036582 | 3300031242 | Bacteria | 1582 |
| 518 | Ga0265331_10058291 | 3300031250 | Bacteria | 1829 |
| 519 | Ga0265327_10000814 | 3300031251 | Bacteria | 47176 |
| 520 | Ga0265327_10006291 | 3300031251 | Bacteria | 9563 |
| 521 | Ga0307513_10000019 | 3300031456 | Bacteria | 231194 |
| 522 | Ga0307513_10000051 | 3300031456 | Bacteria | 149733 |
| 523 | Ga0307513_10003449 | 3300031456 | Bacteria | 21402 |
| 524 | Ga0307513_10026043 | 3300031456 | Bacteria | 6753 |
| 525 | Ga0307513_10217505 | 3300031456 | Bacteria | 1735 |
| 526 | Ga0307513_10438385 | 3300031456 | Bacteria | 1033 |
| 527 | Ga0307513_10467479 | 3300031456 | Bacteria | 983 |
| 528 | Ga0307509_10094623 | 3300031507 | Bacteria | 3046 |
| 529 | Ga0307408_100000099 | 3300031548 | Bacteria | 95526 |
| 530 | Ga0307408_100000193 | 3300031548 | Bacteria | 65882 |
| 531 | Ga0307408_100019885 | 3300031548 | Bacteria | 4523 |
| 532 | Ga0307408_100028902 | 3300031548 | Bacteria | 3835 |
| 533 | Ga0307408_100040951 | 3300031548 | Bacteria | 3282 |
| 534 | Ga0307408_100318652 | 3300031548 | Bacteria | 1309 |
| 535 | Ga0307408_100430099 | 3300031548 | Bacteria | 1140 |
| 536 | Ga0307408_100544456 | 3300031548 | Bacteria | 1023 |
| 537 | Ga0307508_10002774 | 3300031616 | Bacteria | 18247 |
| 538 | Ga0307514_10002956 | 3300031649 | Bacteria | 16887 |
| 539 | Ga0307514_10013325 | 3300031649 | Bacteria | 6822 |
| 540 | Ga0265314_10013361 | 3300031711 | Bacteria | 6636 |
| 541 | Ga0265314_10049626 | 3300031711 | Bacteria | 2937 |
| 542 | Ga0307516_10004540 | 3300031730 | Bacteria | 17080 |
| 543 | Ga0307516_10006152 | 3300031730 | Bacteria | 14142 |
| 544 | Ga0307516_10222875 | 3300031730 | Bacteria | 1594 |
| 545 | Ga0307516_10266001 | 3300031730 | Bacteria | 1403 |
| 546 | Ga0307516_10271164 | 3300031730 | Bacteria | 1383 |
| 547 | Ga0307405_10314292 | 3300031731 | Bacteria | 1194 |
| 548 | Ga0307405_11084002 | 3300031731 | Bacteria | 688 |
| 549 | Ga0307413_11076597 | 3300031824 | Bacteria | 693 |
| 550 | Ga0307410_10741619 | 3300031852 | Bacteria | 831 |
| 551 | Ga0307406_10009579 | 3300031901 | Bacteria | 5441 |
| 552 | Ga0307406_10016378 | 3300031901 | Bacteria | 4307 |
| 553 | Ga0307406_10188553 | 3300031901 | Bacteria | 1508 |
| 554 | Ga0307406_10514283 | 3300031901 | Bacteria | 973 |
| 555 | Ga0307406_10822053 | 3300031901 | Bacteria | 786 |
| 556 | Ga0307407_10047314 | 3300031903 | Bacteria | 2440 |
| 557 | Ga0307407_10426950 | 3300031903 | Bacteria | 957 |
| 558 | Ga0307412_10037116 | 3300031911 | Bacteria | 3128 |
| 559 | Ga0307412_10057816 | 3300031911 | Bacteria | 2590 |
| 560 | Ga0307412_10065081 | 3300031911 | Bacteria | 2465 |
| 561 | Ga0307412_10480906 | 3300031911 | Bacteria | 1030 |
| 562 | Ga0307412_11115782 | 3300031911 | Bacteria | 703 |
| 563 | Ga0307409_100183715 | 3300031995 | Bacteria | 1854 |
| 564 | Ga0307409_101749225 | 3300031995 | Bacteria | 651 |
| 565 | Ga0307416_100023015 | 3300032002 | Bacteria | 4512 |
| 566 | Ga0307416_100068689 | 3300032002 | Bacteria | 2929 |
| 567 | Ga0307416_100312658 | 3300032002 | Bacteria | 1568 |
| 568 | Ga0307414_10008085 | 3300032004 | Bacteria | 5943 |
| 569 | Ga0307414_10321315 | 3300032004 | Bacteria | 1317 |
| 570 | Ga0307414_10482254 | 3300032004 | Bacteria | 1094 |
| 571 | Ga0307414_10968353 | 3300032004 | Bacteria | 782 |
| 572 | Ga0307414_11013262 | 3300032004 | Bacteria | 765 |
| 573 | Ga0307411_10000548 | 3300032005 | Bacteria | 13322 |
| 574 | Ga0307411_10077498 | 3300032005 | Bacteria | 2275 |
| 575 | Ga0307411_10232700 | 3300032005 | Bacteria | 1437 |
| 576 | Ga0307411_10262288 | 3300032005 | Bacteria | 1365 |
| 577 | Ga0307411_10421808 | 3300032005 | Bacteria | 1108 |
| 578 | Ga0307415_101103417 | 3300032126 | Bacteria | 743 |
| 579 | Ga0316583_10017125 | 3300032133 | Bacteria | 2606 |
| 580 | Ga0316593_10009836 | 3300032168 | Bacteria | 2718 |
| 581 | Ga0307510_10000311 | 3300033180 | Bacteria | 44908 |
| 582 | Ga0373950_0003412 | 3300034818 | Bacteria | 2264 |
| 583 | Ga0373959_0058069 | 3300034820 | Bacteria | 850 |
| 584 | Ga0373944_0058770 | 3300035089 | Bacteria | 1229 |
| 585 | Ga0373951_0029584 | 3300035091 | Bacteria | 1287 |
| 586 | Ga0373939_0000006 | 3300035114 | Bacteria | 78721 |
| 587 | Ga0373960_0000041 | 3300035121 | Bacteria | 16652 |
| 588 | Ga0373946_0107776 | 3300035171 | Bacteria | 1257 |
| 589 | Ga0373931_0000514 | 3300035691 | Bacteria | 15835 |
| 590 | Ga0373937_0265951 | 3300036401 | Bacteria | 1618 |
| 591 | Ga0395899_0003079 | 3300037312 | Bacteria | 13283 |
| 592 | Ga0395899_0008624 | 3300037312 | Bacteria | 7843 |
| 593 | Ga0395899_0111358 | 3300037312 | Bacteria | 1968 |
| 594 | Ga0395899_0260826 | 3300037312 | Bacteria | 1185 |
| 595 | Ga0395900_0000054 | 3300037418 | Bacteria | 220487 |
| 596 | Ga0395900_0026485 | 3300037418 | Bacteria | 5937 |
| 597 | Ga0395900_0064720 | 3300037418 | Bacteria | 3757 |
| 598 | Ga0395900_0111316 | 3300037418 | Bacteria | 2812 |
| 599 | Ga0395900_0411167 | 3300037418 | Bacteria | 1315 |
| 600 | Ga0395900_0572708 | 3300037418 | Bacteria | 1072 |
| 601 | Ga0395898_0000798 | 3300037466 | Bacteria | 53358 |
| 602 | Ga0395898_0425136 | 3300037466 | Bacteria | 1266 |
| 603 | Ga0395898_0472253 | 3300037466 | Bacteria | 1193 |
| 604 | Ga0395905_0000148 | 3300037471 | Bacteria | 116301 |
| 605 | Ga0395905_0001062 | 3300037471 | Bacteria | 34652 |
| 606 | Ga0395905_0002549 | 3300037471 | Bacteria | 20091 |
| 607 | Ga0395905_0003187 | 3300037471 | Bacteria | 17661 |
| 608 | Ga0395905_0016333 | 3300037471 | Bacteria | 7053 |
| 609 | Ga0395905_0030153 | 3300037471 | Bacteria | 5112 |
| 610 | Ga0395905_0049497 | 3300037471 | Bacteria | 3938 |
| 611 | Ga0395905_0049955 | 3300037471 | Bacteria | 3919 |
| 612 | Ga0395905_0101793 | 3300037471 | Bacteria | 2696 |
| 613 | Ga0395905_0323338 | 3300037471 | Bacteria | 1432 |
| 614 | Ga0395905_0388293 | 3300037471 | Bacteria | 1290 |
| 615 | Ga0395905_0695531 | 3300037471 | Bacteria | 919 |
| 616 | Ga0395905_1294698 | 3300037471 | Bacteria | 633 |
| 617 | Ga0395901_0012708 | 3300038443 | Bacteria | 8540 |
| 618 | Ga0395901_0085741 | 3300038443 | Bacteria | 3292 |
| 619 | Ga0395901_0119190 | 3300038443 | Bacteria | 2773 |
| 620 | Ga0395901_0121303 | 3300038443 | Bacteria | 2747 |
| 621 | Ga0395901_0173517 | 3300038443 | Bacteria | 2262 |
| 622 | Ga0395901_0176105 | 3300038443 | Bacteria | 2244 |
| 623 | Ga0395901_0187430 | 3300038443 | Bacteria | 2170 |
| 624 | Ga0395901_0266367 | 3300038443 | Bacteria | 1783 |
| 625 | Ga0395901_0311735 | 3300038443 | Bacteria | 1629 |
| 626 | Ga0400483_098478 | 3300039062 | Bacteria | 11916 |
| 627 | Ga0436365_0161847 | 3300039437 | Bacteria | 516 |
| 628 | Ga0436365_0872657 | 3300039437 | Bacteria | 673 |
| 629 | Ga0439436_0000392 | 3300041404 | Bacteria | 10907 |
| 630 | Ga0439436_0002953 | 3300041404 | Bacteria | 5159 |
| 631 | Ga0439436_0013763 | 3300041404 | Bacteria | 2446 |
| 632 | Ga0439439_0013953 | 3300041406 | Bacteria | 1952 |
| 633 | Ga0439439_0051148 | 3300041406 | Bacteria | 1083 |
| 634 | Ga0439439_0114708 | 3300041406 | Bacteria | 749 |
| 635 | Ga0439439_0138768 | 3300041406 | Bacteria | 685 |
| 636 | Ga0439447_009228 | 3300041407 | Bacteria | 3004 |
| 637 | Ga0439447_032624 | 3300041407 | Bacteria | 1301 |
| 638 | Ga0439461_0001378 | 3300041410 | Bacteria | 3750 |
| 639 | Ga0439461_0007060 | 3300041410 | Bacteria | 1977 |
| 640 | Ga0439466_0008881 | 3300041411 | Bacteria | 3779 |
| 641 | Ga0439466_0015610 | 3300041411 | Bacteria | 2758 |
| 642 | Ga0439465_0000387 | 3300041413 | Bacteria | 12738 |
| 643 | Ga0439465_0094931 | 3300041413 | Bacteria | 1024 |
| 644 | Ga0451791_1261760 | 3300041451 | Bacteria | 724 |
| 645 | Ga0451802_0405913 | 3300041460 | Bacteria | 537 |
| 646 | Ga0451804_0865208 | 3300041463 | Bacteria | 624 |
| 647 | Ga0451833_1215784 | 3300041491 | Bacteria | 1154 |
| 648 | Ga0451833_1425945 | 3300041491 | Bacteria | 1012 |
| 649 | Ga0451841_0537712 | 3300041498 | Bacteria | 756 |
| 650 | Ga0451841_0963024 | 3300041498 | Bacteria | 575 |
| 651 | Ga0451855_0271653 | 3300041511 | Bacteria | 769 |
| 652 | Ga0451853_1667522 | 3300041512 | Bacteria | 595 |
| 653 | Ga0439431_0001219 | 3300041997 | Bacteria | 5622 |
| 654 | Ga0439433_0000473 | 3300041999 | Bacteria | 7421 |
| 655 | Ga0439437_005415 | 3300042000 | Bacteria | 1404 |
| 656 | Ga0439437_019870 | 3300042000 | Bacteria | 809 |
| 657 | Ga0439442_004083 | 3300042002 | Bacteria | 2896 |
| 658 | Ga0439443_032008 | 3300042003 | Bacteria | 870 |
| 659 | Ga0439445_0000712 | 3300042004 | Bacteria | 6928 |
| 660 | Ga0439445_0027176 | 3300042004 | Bacteria | 1469 |
| 661 | Ga0439445_0047170 | 3300042004 | Bacteria | 1156 |
| 662 | Ga0439432_002602 | 3300042006 | Bacteria | 6790 |
| 663 | Ga0439432_019440 | 3300042006 | Bacteria | 2262 |
| 664 | Ga0439449_0002379 | 3300042007 | Bacteria | 7363 |
| 665 | Ga0439449_0003757 | 3300042007 | Bacteria | 5880 |
| 666 | Ga0439449_0005865 | 3300042007 | Bacteria | 4695 |
| 667 | Ga0439449_0006097 | 3300042007 | Bacteria | 4607 |
| 668 | Ga0439449_0010161 | 3300042007 | Bacteria | 3559 |
| 669 | Ga0439449_0049957 | 3300042007 | Bacteria | 1547 |
| 670 | Ga0439452_000611 | 3300042010 | Bacteria | 18092 |
| 671 | Ga0439452_062410 | 3300042010 | Bacteria | 832 |
| 672 | Ga0439454_068024 | 3300042011 | Bacteria | 628 |
| 673 | Ga0439457_002909 | 3300042014 | Bacteria | 4772 |
| 674 | Ga0439457_013201 | 3300042014 | Bacteria | 1857 |
| 675 | Ga0439462_0004945 | 3300042015 | Bacteria | 3270 |
| 676 | Ga0439462_0123858 | 3300042015 | Bacteria | 720 |
| 677 | Ga0450912_024875 | 3300042116 | Bacteria | 597 |
| 678 | Ga0450913_001575 | 3300042117 | Bacteria | 1279 |
| 679 | Ga0450919_000992 | 3300042121 | Bacteria | 3676 |
| 680 | Ga0450920_009242 | 3300042122 | Bacteria | 1811 |
| 681 | Ga0450920_025575 | 3300042122 | Bacteria | 1150 |
| 682 | Ga0450921_000320 | 3300042123 | Bacteria | 2143 |
| 683 | Ga0450923_001819 | 3300042125 | Bacteria | 2925 |
| 684 | Ga0450888_000719 | 3300042126 | Bacteria | 3153 |
| 685 | Ga0450890_006388 | 3300042127 | Bacteria | 1508 |
| 686 | Ga0450890_019152 | 3300042127 | Bacteria | 920 |
| 687 | Ga0450891_000123 | 3300042129 | Bacteria | 6931 |
| 688 | Ga0450892_001446 | 3300042130 | Bacteria | 2312 |
| 689 | Ga0450895_021983 | 3300042132 | Bacteria | 595 |
| 690 | Ga0450896_008927 | 3300042133 | Bacteria | 1393 |
| 691 | Ga0450896_012842 | 3300042133 | Bacteria | 1187 |
| 692 | Ga0450898_004928 | 3300042134 | Bacteria | 1995 |
| 693 | Ga0450902_008791 | 3300042137 | Bacteria | 1582 |
| 694 | Ga0450889_000176 | 3300042144 | Bacteria | 6865 |
| 695 | Ga0450906_007423 | 3300042145 | Bacteria | 2166 |
| 696 | Ga0450906_009590 | 3300042145 | Bacteria | 1843 |
| 697 | Ga0450907_014618 | 3300042146 | Bacteria | 1310 |
| 698 | Ga0450910_005526 | 3300042147 | Bacteria | 1726 |
| 699 | Ga0439446_0029700 | 3300042156 | Bacteria | 1577 |
| 700 | Ga0450908_004328 | 3300042184 | Bacteria | 2737 |
| 701 | Ga0450908_004926 | 3300042184 | Bacteria | 2564 |
| 702 | Ga0450909_004479 | 3300042185 | Bacteria | 1994 |
| 703 | Ga0439434_0003045 | 3300042435 | Bacteria | 4916 |
| 704 | Ga0439434_0004381 | 3300042435 | Bacteria | 4128 |
| 705 | Ga0439434_0038955 | 3300042435 | Bacteria | 1457 |
| 706 | Ga0439435_0124557 | 3300042436 | Bacteria | 810 |
| 707 | Ga0439464_0010780 | 3300042439 | Bacteria | 2416 |
| 708 | Ga0450916_067619 | 3300042530 | Bacteria | 591 |
| 709 | Ga0450918_000264 | 3300042531 | Bacteria | 11804 |
| 710 | Ga0450918_001423 | 3300042531 | Bacteria | 4755 |
| 711 | Ga0450893_0010771 | 3300042532 | Bacteria | 1506 |
| 712 | Ga0450893_0020353 | 3300042532 | Bacteria | 1139 |
| 713 | Ga0451577_0019186 | 3300042876 | Bacteria | 6289 |
| 714 | Ga0451577_0144388 | 3300042876 | Bacteria | 2139 |
| 715 | Ga0451577_0191062 | 3300042876 | Bacteria | 1847 |
| 716 | Ga0466969_0000054 | 3300044656 | Bacteria | 59867 |
| 717 | Ga0466969_0010663 | 3300044656 | Bacteria | 4869 |
| 718 | Ga0453683_0002845 | 3300044673 | Bacteria | 13126 |
| 719 | Ga0466965_0088633 | 3300044683 | Bacteria | 1571 |
| 720 | Ga0466965_0094149 | 3300044683 | Bacteria | 1526 |
| 721 | Ga0466965_0405699 | 3300044683 | Bacteria | 753 |
| 722 | Ga0466966_0002469 | 3300044684 | Bacteria | 12104 |
| 723 | Ga0466966_0011535 | 3300044684 | Bacteria | 5863 |
| 724 | Ga0466961_0059317 | 3300044693 | Bacteria | 2433 |
| 725 | Ga0466961_0226434 | 3300044693 | Bacteria | 1151 |
| 726 | Ga0466964_0005457 | 3300044706 | Bacteria | 4721 |
| 727 | Ga0453684_0361044 | 3300044712 | Bacteria | 1635 |
| 728 | Ga0453684_0370975 | 3300044712 | Bacteria | 1609 |
| 729 | Ga0453684_1601680 | 3300044712 | Bacteria | 668 |
| 730 | Ga0466971_0007746 | 3300044719 | Bacteria | 4679 |
| 731 | Ga0466971_0326792 | 3300044719 | Bacteria | 740 |
| 732 | Ga0466970_0009993 | 3300044765 | Bacteria | 4806 |
| 733 | Ga0466970_0047180 | 3300044765 | Bacteria | 2295 |
| 734 | Ga0466957_0099067 | 3300044842 | Bacteria | 1835 |
| 735 | Ga0466957_0184812 | 3300044842 | Bacteria | 1363 |
| 736 | Ga0466957_0668137 | 3300044842 | Bacteria | 731 |
| 737 | Ga0466960_0028787 | 3300044901 | Bacteria | 2544 |
| 738 | Ga0466960_0239453 | 3300044901 | Bacteria | 1004 |
| 739 | Ga0466959_0000528 | 3300045049 | Bacteria | 22186 |
| 740 | Ga0466959_0104843 | 3300045049 | Bacteria | 2022 |
| 741 | Ga0451576_0072525 | 3300045051 | Bacteria | 3583 |
| 742 | Ga0451576_0099477 | 3300045051 | Bacteria | 3026 |
| 743 | Ga0451576_0146107 | 3300045051 | Bacteria | 2465 |
| 744 | Ga0451576_0269778 | 3300045051 | Bacteria | 1779 |
| 745 | Ga0451576_1148854 | 3300045051 | Bacteria | 812 |
| 746 | Ga0466967_0627724 | 3300045976 | Bacteria | 1061 |
| 747 | Ga0466967_2472295 | 3300045976 | Bacteria | 514 |
| 748 | Ga0495627_007791 | 3300046453 | Bacteria | 4077 |
| 749 | Ga0495627_020910 | 3300046453 | Bacteria | 2174 |
| 750 | Ga0495629_0104012 | 3300046459 | Bacteria | 1981 |
| 751 | Ga0495629_0717846 | 3300046459 | Bacteria | 663 |
| 752 | Ga0495638_0043532 | 3300046460 | Bacteria | 2832 |
| 753 | Ga0495638_0063325 | 3300046460 | Bacteria | 2280 |
| 754 | Ga0495651_0070658 | 3300046462 | Bacteria | 2656 |
| 755 | Ga0495653_0133775 | 3300046463 | Bacteria | 1752 |
| 756 | Ga0495639_0122426 | 3300046475 | Bacteria | 1241 |
| 757 | Ga0495610_0010849 | 3300046512 | Bacteria | 5626 |
| 758 | Ga0495610_0020359 | 3300046512 | Bacteria | 3685 |
| 759 | Ga0495610_0085259 | 3300046512 | Bacteria | 1442 |
| 760 | Ga0495610_0392893 | 3300046512 | Bacteria | 513 |
| 761 | Ga0495616_0000722 | 3300046513 | Bacteria | 24406 |
| 762 | Ga0495618_0138797 | 3300046514 | Bacteria | 1555 |
| 763 | Ga0495618_0345519 | 3300046514 | Bacteria | 918 |
| 764 | Ga0495620_0021122 | 3300046515 | Bacteria | 3166 |
| 765 | Ga0495628_1035681 | 3300046516 | Bacteria | 563 |
| 766 | Ga0495631_0000446 | 3300046518 | Bacteria | 28333 |
| 767 | Ga0495632_0117942 | 3300046519 | Bacteria | 1242 |
| 768 | Ga0495637_0028290 | 3300046520 | Bacteria | 2504 |
| 769 | Ga0495643_0064789 | 3300046522 | Bacteria | 1930 |
| 770 | Ga0495663_0095586 | 3300046525 | Bacteria | 973 |
| 771 | Ga0495663_0099688 | 3300046525 | Bacteria | 955 |
| 772 | Ga0495642_0038373 | 3300046528 | Bacteria | 1941 |
| 773 | Ga0495654_0014862 | 3300046530 | Bacteria | 4136 |
| 774 | Ga0495654_0016539 | 3300046530 | Bacteria | 3896 |
| 775 | Ga0495609_0248669 | 3300046538 | Bacteria | 732 |
| 776 | Ga0495621_0009160 | 3300046539 | Bacteria | 2996 |
| 777 | Ga0495621_0100588 | 3300046539 | Bacteria | 1100 |
| 778 | Ga0495621_0109254 | 3300046539 | Bacteria | 1059 |
| 779 | Ga0495621_0346171 | 3300046539 | Bacteria | 623 |
| 780 | Ga0495597_0001135 | 3300046542 | Bacteria | 20086 |
| 781 | Ga0495622_0232948 | 3300046557 | Bacteria | 813 |
| 782 | Ga0495633_0002529 | 3300046558 | Bacteria | 12851 |
| 783 | Ga0495633_0157967 | 3300046558 | Bacteria | 1046 |
| 784 | Ga0495656_0001008 | 3300046615 | Bacteria | 9110 |
| 785 | Ga0495656_0021519 | 3300046615 | Bacteria | 2512 |
| 786 | Ga0495634_0352510 | 3300046642 | Bacteria | 881 |
| 787 | Ga0495625_0000396 | 3300046660 | Bacteria | 66627 |
| 788 | Ga0495625_0020614 | 3300046660 | Bacteria | 5085 |
| 789 | Ga0495635_0230945 | 3300046663 | Bacteria | 1250 |
| 790 | Ga0495661_0101423 | 3300046665 | Bacteria | 1619 |
| 791 | Ga0495588_0008771 | 3300046674 | Bacteria | 4646 |
| 792 | Ga0495588_0017519 | 3300046674 | Bacteria | 3481 |
| 793 | Ga0495588_0022794 | 3300046674 | Bacteria | 3096 |
| 794 | Ga0495599_0210546 | 3300046678 | Bacteria | 1192 |
| 795 | Ga0495658_0097627 | 3300046683 | Bacteria | 1749 |
| 796 | Ga0495658_0263080 | 3300046683 | Bacteria | 1086 |
| 797 | Ga0495670_0069830 | 3300046691 | Bacteria | 1777 |
| 798 | Ga0495671_0006709 | 3300046692 | Bacteria | 6631 |
| 799 | Ga0495600_0115925 | 3300046809 | Bacteria | 1744 |
| 800 | Ga0495600_0207404 | 3300046809 | Bacteria | 1257 |
| 801 | Ga0495600_0622530 | 3300046809 | Bacteria | 654 |
| 802 | Ga0495660_0044178 | 3300046810 | Bacteria | 2453 |
| 803 | Ga0495581_0296453 | 3300047315 | Bacteria | 945 |
| 804 | Ga0495676_0050590 | 3300047321 | Bacteria | 3331 |
| 805 | Ga0495687_203076 | 3300047443 | Bacteria | 628 |
| 806 | Ga0495681_0113426 | 3300047470 | Bacteria | 1171 |
| 807 | Ga0495686_0005856 | 3300047472 | Bacteria | 9583 |
| 808 | Ga0495593_0005694 | 3300047673 | Bacteria | 7351 |
| 809 | Ga0495593_0098558 | 3300047673 | Bacteria | 1501 |
| 810 | Ga0495593_0631470 | 3300047673 | Bacteria | 538 |
| 811 | Ga0495602_0459912 | 3300048088 | Bacteria | 897 |
| 812 | Ga0495614_0008498 | 3300048089 | Bacteria | 4565 |
| 813 | Ga0495615_0023364 | 3300048090 | Bacteria | 1416 |
| 814 | Ga0495615_0172772 | 3300048090 | Bacteria | 655 |
| 815 | Ga0496100_0078272 | 3300048903 | Bacteria | 2225 |
| 816 | Ga0496100_1402725 | 3300048903 | Bacteria | 551 |
| 817 | Ga0496101_0042961 | 3300048904 | Bacteria | 3228 |
| 818 | Ga0496102_0032292 | 3300048905 | Bacteria | 4703 |
| 819 | Ga0496102_0032877 | 3300048905 | Bacteria | 4662 |
| 820 | Ga0496102_0036331 | 3300048905 | Bacteria | 4437 |
| 821 | Ga0496103_0211580 | 3300048906 | Bacteria | 1247 |
| 822 | Ga0496104_0464865 | 3300048907 | Bacteria | 1177 |
| 823 | Ga0496105_0028533 | 3300048908 | Bacteria | 4563 |
| 824 | Ga0496105_0197976 | 3300048908 | Bacteria | 1640 |
| 825 | Ga0496106_0047925 | 3300048909 | Bacteria | 3217 |
| 826 | Ga0496107_0248541 | 3300048910 | Bacteria | 1323 |
| 827 | Ga0496112_0345553 | 3300048915 | Bacteria | 1431 |
| 828 | Ga0496113_1385750 | 3300048916 | Bacteria | 545 |
| 829 | Ga0496113_1591987 | 3300048916 | Bacteria | 503 |
| 830 | Ga0496114_0056546 | 3300048917 | Bacteria | 3275 |
| 831 | Ga0496114_0368850 | 3300048917 | Bacteria | 1270 |
| 832 | Ga0496114_0472552 | 3300048917 | Bacteria | 1109 |
| 833 | Ga0496116_0025554 | 3300048919 | Bacteria | 4340 |
| 834 | Ga0496117_0044176 | 3300048920 | Bacteria | 3230 |
| 835 | Ga0496117_0045056 | 3300048920 | Bacteria | 3190 |
| 836 | Ga0496118_0050037 | 3300048921 | Bacteria | 3211 |
| 837 | Ga0496118_0325976 | 3300048921 | Bacteria | 831 |
| 838 | Ga0496121_0022936 | 3300048924 | Bacteria | 6032 |
| 839 | Ga0496121_0244409 | 3300048924 | Bacteria | 1248 |
| 840 | Ga0496122_0000688 | 3300048925 | Bacteria | 67392 |
| 841 | Ga0496122_0069209 | 3300048925 | Bacteria | 2529 |
| 842 | Ga0496122_0101496 | 3300048925 | Bacteria | 1922 |
| 843 | Ga0496122_0110935 | 3300048925 | Bacteria | 1800 |
| 844 | Ga0496122_0293218 | 3300048925 | Bacteria | 882 |
| 845 | Ga0496122_0371799 | 3300048925 | Bacteria | 737 |
| 846 | Ga0496123_0001158 | 3300048926 | Bacteria | 39125 |
| 847 | Ga0496123_0038770 | 3300048926 | Bacteria | 3343 |
| 848 | Ga0496123_0057248 | 3300048926 | Bacteria | 2539 |
| 849 | Ga0496123_0131922 | 3300048926 | Bacteria | 1382 |
| 850 | Ga0496123_0161827 | 3300048926 | Bacteria | 1192 |
| 851 | Ga0496124_0052228 | 3300048927 | Bacteria | 3473 |
| 852 | Ga0496124_0059351 | 3300048927 | Bacteria | 3214 |
| 853 | Ga0496124_0077403 | 3300048927 | Bacteria | 2743 |
| 854 | Ga0496124_0196762 | 3300048927 | Bacteria | 1537 |
| 855 | Ga0496125_0006625 | 3300048928 | Bacteria | 12466 |
| 856 | Ga0496125_0017065 | 3300048928 | Bacteria | 6937 |
| 857 | Ga0496125_0290512 | 3300048928 | Bacteria | 1007 |
| 858 | Ga0496125_0341143 | 3300048928 | Bacteria | 899 |
| 859 | Ga0496125_0510420 | 3300048928 | Bacteria | 674 |
| 860 | Ga0496126_0035110 | 3300048929 | Bacteria | 4702 |
| 861 | Ga0496126_0234437 | 3300048929 | Bacteria | 1536 |
| 862 | Ga0496126_0932713 | 3300048929 | Bacteria | 656 |
| 863 | Ga0501301_010670 | 3300049524 | Bacteria | 756 |
| 864 | Ga0501315_019643 | 3300049531 | Bacteria | 901 |
| 865 | Ga0501034_0247677 | 3300049571 | Bacteria | 1727 |
| 866 | Ga0501037_0244588 | 3300049573 | Bacteria | 1257 |
| 867 | Ga0501038_0606296 | 3300049574 | Bacteria | 828 |
| 868 | Ga0501043_0641387 | 3300049579 | Bacteria | 781 |
| 869 | Ga0501198_000044 | 3300049649 | Bacteria | 43232 |
| 870 | Ga0501222_000017 | 3300049662 | Bacteria | 75770 |
| 871 | Ga0501253_003212 | 3300049683 | Bacteria | 1935 |
| 872 | Ga0501035_0048271 | 3300049822 | Bacteria | 3818 |
| 873 | Ga0501044_0278341 | 3300049823 | Bacteria | 1607 |
| 874 | nmdc:mga03683_132966_c1 | 3300050489 | Bacteria | 1114 |
| 875 | nmdc:mga03683_252889_c1 | 3300050489 | Bacteria | 819 |
| 876 | nmdc:mga03683_32250_c1 | 3300050489 | Bacteria | 2107 |
| 877 | nmdc:mga03683_60337_c1 | 3300050489 | Bacteria | 1602 |
| 878 | nmdc:mga03n38_139021_c1 | 3300050490 | Bacteria | 1211 |
| 879 | nmdc:mga03n38_850629_c1 | 3300050490 | Bacteria | 533 |
| 880 | nmdc:mga03n38_90616_c1 | 3300050490 | Bacteria | 1455 |
| 881 | nmdc:mga00v17_10018_c1 | 3300050491 | Bacteria | 5158 |
| 882 | nmdc:mga00v17_665279_c1 | 3300050491 | Bacteria | 669 |
| 883 | nmdc:mga00v17_99525_c1 | 3300050491 | Bacteria | 1834 |
| 884 | nmdc:mga0yw44_14269_c1 | 3300050492 | Bacteria | 4214 |
| 885 | nmdc:mga0yw44_309247_c1 | 3300050492 | Bacteria | 1060 |
| 886 | nmdc:mga0k408_14275_c2 | 3300050493 | Bacteria | 1995 |
| 887 | nmdc:mga0k408_157357_c1 | 3300050493 | Bacteria | 1353 |
| 888 | nmdc:mga0k408_23067_c1 | 3300050493 | Bacteria | 3507 |
| 889 | nmdc:mga0k408_28627_c1 | 3300050493 | Bacteria | 3168 |
| 890 | nmdc:mga0k408_351820_c1 | 3300050493 | Bacteria | 878 |
| 891 | nmdc:mga0k408_36399_c1 | 3300050493 | Bacteria | 2825 |
| 892 | nmdc:mga0k408_38912_c1 | 3300050493 | Bacteria | 2731 |
| 893 | nmdc:mga0k408_445271_c1 | 3300050493 | Bacteria | 769 |
| 894 | nmdc:mga06z11_295078_c1 | 3300050494 | Bacteria | 963 |
| 895 | nmdc:mga06z11_556810_c1 | 3300050494 | Bacteria | 696 |
| 896 | nmdc:mga06z11_581398_c1 | 3300050494 | Bacteria | 681 |
| 897 | nmdc:mga07m45_11241_c1 | 3300050496 | Bacteria | 4700 |
| 898 | nmdc:mga07m45_13172_c1 | 3300050496 | Bacteria | 4381 |
| 899 | nmdc:mga07m45_21825_c1 | 3300050496 | Bacteria | 3490 |
| 900 | nmdc:mga07m45_249894_c1 | 3300050496 | Bacteria | 1032 |
| 901 | nmdc:mga07m45_27154_c1 | 3300050496 | Bacteria | 3151 |
| 902 | nmdc:mga07m45_312083_c1 | 3300050496 | Bacteria | 914 |
| 903 | nmdc:mga07m45_533_c1 | 3300050496 | Bacteria | 16098 |
| 904 | nmdc:mga07m45_58332_c1 | 3300050496 | Bacteria | 2184 |
| 905 | nmdc:mga07m45_9770_c1 | 3300050496 | Bacteria | 4990 |
| 906 | Ga0500610_0005849 | 3300053079 | Bacteria | 5088 |
| 907 | Ga0500610_0007392 | 3300053079 | Bacteria | 4702 |
| 908 | Ga0500578_0000926 | 3300053086 | Bacteria | 32927 |
| 909 | Ga0500643_010390 | 3300053087 | Bacteria | 3468 |
| 910 | Ga0500644_0004370 | 3300053088 | Bacteria | 3534 |
| 911 | Ga0500644_0008346 | 3300053088 | Bacteria | 2732 |
| 912 | Ga0500644_0215805 | 3300053088 | Bacteria | 798 |
| 913 | Ga0500646_0022004 | 3300053090 | Bacteria | 1702 |
| 914 | Ga0500647_0069700 | 3300053091 | Bacteria | 1691 |
| 915 | Ga0500651_0000063 | 3300053093 | Bacteria | 70772 |
| 916 | Ga0500651_0037817 | 3300053093 | Bacteria | 3042 |
| 917 | Ga0500641_0082765 | 3300053096 | Bacteria | 1364 |
| 918 | Ga0500641_0167280 | 3300053096 | Bacteria | 947 |
| 919 | Ga0500650_0037746 | 3300053098 | Bacteria | 2221 |
| 920 | Ga0500562_027216 | 3300053108 | Bacteria | 1500 |
| 921 | Ga0500562_049118 | 3300053108 | Bacteria | 1127 |
| 922 | Ga0500571_008126 | 3300053110 | Bacteria | 5741 |
| 923 | Ga0500592_009925 | 3300053116 | Bacteria | 1515 |
| 924 | Ga0500593_000487 | 3300053117 | Bacteria | 15665 |
| 925 | Ga0500593_001737 | 3300053117 | Bacteria | 7855 |
| 926 | Ga0500593_004766 | 3300053117 | Bacteria | 5281 |
| 927 | Ga0500594_0000905 | 3300053118 | Bacteria | 6359 |
| 928 | Ga0500597_113615 | 3300053120 | Bacteria | 1175 |
| 929 | Ga0500607_001614 | 3300053121 | Bacteria | 19910 |
| 930 | Ga0500607_095498 | 3300053121 | Bacteria | 1487 |
| 931 | Ga0500608_008503 | 3300053122 | Bacteria | 4320 |
| 932 | Ga0500608_083300 | 3300053122 | Bacteria | 1506 |
| 933 | Ga0500618_035370 | 3300053125 | Bacteria | 1160 |
| 934 | Ga0500618_045103 | 3300053125 | Bacteria | 1006 |
| 935 | Ga0500626_105204 | 3300053128 | Bacteria | 1225 |
| 936 | Ga0500642_0013135 | 3300053130 | Bacteria | 3032 |
| 937 | Ga0500652_004429 | 3300053131 | Bacteria | 4350 |
| 938 | Ga0500652_031259 | 3300053131 | Bacteria | 2087 |
| 939 | Ga0500658_0002954 | 3300053134 | Bacteria | 6529 |
| 940 | Ga0500658_0002955 | 3300053134 | Bacteria | 6529 |
| 941 | Ga0500559_0000260 | 3300053136 | Bacteria | 41596 |
| 942 | Ga0500559_0006663 | 3300053136 | Bacteria | 5193 |
| 943 | Ga0500559_0008325 | 3300053136 | Bacteria | 4555 |
| 944 | Ga0500559_0023456 | 3300053136 | Bacteria | 2619 |
| 945 | Ga0500568_0003245 | 3300053139 | Bacteria | 9191 |
| 946 | Ga0500568_0145526 | 3300053139 | Bacteria | 878 |
| 947 | Ga0500574_031804 | 3300053141 | Bacteria | 1424 |
| 948 | Ga0500577_0073196 | 3300053142 | Bacteria | 1348 |
| 949 | Ga0500590_034903 | 3300053148 | Bacteria | 2603 |
| 950 | Ga0500604_0021837 | 3300053151 | Bacteria | 1812 |
| 951 | Ga0500604_0055885 | 3300053151 | Bacteria | 1228 |
| 952 | Ga0500604_0248720 | 3300053151 | Bacteria | 615 |
| 953 | Ga0500616_0025494 | 3300053153 | Bacteria | 3279 |
| 954 | Ga0500619_000059 | 3300053154 | Bacteria | 33814 |
| 955 | Ga0500619_113521 | 3300053154 | Bacteria | 923 |
| 956 | Ga0500622_0001479 | 3300053156 | Bacteria | 18702 |
| 957 | Ga0500622_0004445 | 3300053156 | Bacteria | 8803 |
| 958 | Ga0500633_0032144 | 3300053160 | Bacteria | 1702 |
| 959 | Ga0500634_0038376 | 3300053161 | Bacteria | 2604 |
| 960 | Ga0500638_029064 | 3300053162 | Bacteria | 2658 |
| 961 | Ga0500636_0165370 | 3300053177 | Bacteria | 1202 |
| 962 | Ga0500570_083918 | 3300053724 | Bacteria | 1420 |
| 963 | Ga0500645_000198 | 3300053730 | Bacteria | 46701 |
| 964 | Ga0500645_004925 | 3300053730 | Bacteria | 5019 |
| 965 | Ga0500645_015380 | 3300053730 | Bacteria | 2424 |
| 966 | Ga0500587_000969 | 3300053739 | Bacteria | 3862 |
| 967 | Ga0500587_006774 | 3300053739 | Bacteria | 1509 |
| 968 | Ga0466962_0407838 | 3300061719 | Bacteria | 681 |
| 969 | 2548497415 | 2547132374 | Bacteria | 5530232 |
| 970 | 2587726267 | 2585428057 | Bacteria | 6737412 |
| 971 | 2587734438 | 2585428058 | Bacteria | 6853932 |
| 972 | 2587756326 | 2585428062 | Bacteria | 6842168 |
| 973 | 2588293853 | 2588253510 | Bacteria | 6901809 |
| 974 | 2599623674 | 2599185214 | Bacteria | 8209958 |
| 975 | 2599671707 | 2599185226 | Bacteria | 8233575 |
| 976 | 2599681280 | 2599185227 | Bacteria | 8246414 |
| 977 | 2599693317 | 2599185229 | Bacteria | 8216126 |
| 978 | 2643746347 | 2643221544 | Bacteria | 5886209 |
| 979 | 2643866551 | 2643221570 | Bacteria | 5103772 |
| 980 | 2643933180 | 2643221585 | Bacteria | 5812563 |
| 981 | 2643970942 | 2643221592 | Bacteria | 6608788 |
| 982 | 2643993303 | 2643221596 | Bacteria | 5006805 |
| 983 | 2644138803 | 2643221625 | Bacteria | 6512927 |
| 984 | 2644159608 | 2643221628 | Bacteria | 5745828 |
| 985 | 2644243609 | 2643221644 | Bacteria | 6865017 |
| 986 | 2644258899 | 2643221646 | Bacteria | 6433402 |
| 987 | 2644273961 | 2643221648 | Bacteria | 6521465 |
| 988 | 2644294092 | 2643221652 | Bacteria | 5140275 |
| 989 | 2644314429 | 2643221656 | Bacteria | 5809961 |
| 990 | 2644327631 | 2643221658 | Bacteria | 6064537 |
| 991 | 2644468176 | 2643221683 | Bacteria | 5749203 |
| 992 | 2644646095 | 2643221717 | Bacteria | 5676132 |
| 993 | 2722883941 | 2721755523 | Bacteria | 6430384 |
| 994 | 2738717743 | 2738541277 | Bacteria | 7458140 |
| 995 | 2738879354 | 2738541307 | Bacteria | 8606193 |
| 996 | 2739055646 | 2738541337 | Bacteria | 6183410 |
| 997 | 2739242693 | 2738543012 | Bacteria | 7115078 |
| 998 | 2739250710 | 2738543013 | Bacteria | 5618633 |
| 999 | 2739278429 | 2738543019 | Bacteria | 7459457 |
| 1000 | 2816472990 | 2816332133 | Bacteria | 7249298 |
| 1001 | 2819597227 | 2818991446 | Bacteria | 7757362 |
| 1002 | 2831266352 | 2831265667 | Bacteria | 7184833 |
| 1003 | 2838057536 | 2838054893 | Bacteria | 7451788 |
| 1004 | 2839140286 | 2839138175 | Bacteria | 6549354 |
| 1005 | 2842679865 | 2842677519 | Bacteria | 5615038 |
| 1006 | 2842719553 | 2842718218 | Bacteria | 4560148 |
| 1007 | 2842736780 | 2842733646 | Bacteria | 5716726 |
| 1008 | 2842747851 | 2842747753 | Bacteria | 5578255 |
| 1009 | 2881101844 | 2881101125 | Bacteria | 4590519 |
| 1010 | 2885192687 | 2885192300 | Bacteria | 5882526 |
| 1011 | 2885204476 | 2885198086 | Bacteria | 7212419 |
| 1012 | 2885218129 | 2885211737 | Bacteria | 7212420 |
| 1013 | 2899924731 | 2899924645 | Bacteria | 7487985 |
| 1014 | 2904454420 | 2904449895 | Bacteria | 6927402 |
| 1015 | 2904461137 | 2904456579 | Bacteria | 6819253 |
| 1016 | 2904548182 | 2904541872 | Bacteria | 8915136 |
| 1017 | 2916180132 | 2916178963 | Bacteria | 5265078 |
| 1018 | 2919466014 | 2919462493 | Bacteria | 5817112 |
| 1019 | 2919704600 | 2919704043 | Bacteria | 5560311 |
| 1020 | 2928039142 | 2928037797 | Bacteria | 7273642 |
| 1021 | 2928045253 | 2928044640 | Bacteria | 7271509 |
| 1022 | 2928053058 | 2928051484 | Bacteria | 7773759 |
| 1023 | 2928064270 | 2928064002 | Bacteria | 7419480 |
| 1024 | 2928071707 | 2928070936 | Bacteria | 8062541 |
| 1025 | 2928084348 | 2928084124 | Bacteria | 7159212 |
| 1026 | 2928118544 | 2928115317 | Bacteria | 6477646 |
| 1027 | 2929163111 | 2929160207 | Bacteria | 9075316 |
| 1028 | 2929527019 | 2929520902 | Bacteria | 6765052 |
| 1029 | 2932425891 | 2932422444 | Bacteria | 4678430 |
| 1030 | 2945911615 | 2945909444 | Bacteria | 7065066 |
| 1031 | 2945948177 | 2945945610 | Bacteria | 5951079 |
| 1032 | 2945977178 | 2945972063 | Bacteria | 6086495 |
| 1033 | 2945986043 | 2945984333 | Bacteria | 7358892 |
| 1034 | 2954772295 | 2954767861 | Bacteria | 5535784 |
| 1035 | 2974323387 | 2974320154 | Bacteria | 4571377 |
| 1036 | 2990712263 | 2990710928 | Bacteria | 5002431 |
| 1037 | 8054359813 | 8054357960 | Bacteria | 2867777 |
| 1038 | Ga0500655_028009 | |||
| 1039 | JGI24740J21852_10001987 | |||
| 1040 | JGI24740J21852_10022496 | |||
| 1041 | JGI24739J22299_10064426 | |||
| 1042 | JGI25152J39213_1003563 | |||
| 1043 | JGI25152J39213_1004322 | |||
| 1044 | JGI25150J39212_1000611 | |||
| 1045 | JGI25159J45721_1004613 | |||
| 1046 | JGI25159J45721_1005744 | |||
| 1047 | JGI25151J46595_10001037 | |||
| 1048 | JGI25151J46595_10002554 | |||
| 1049 | JGI25151J46595_10009062 | |||
| 1050 | JGI25151J46595_10042257 | |||
| 1051 | JGI25153J46596_10005629 | |||
| 1052 | JGI25153J46596_10008890 | |||
| 1053 | JGI25153J46596_10016584 | |||
| 1054 | JGI25153J46596_10034724 | |||
| 1055 | rootH1_10053737 | |||
| 1056 | rootH2_10216731 | |||
| 1057 | rootL2_10006742 | |||
| 1058 | rootL2_10326548 | |||
| 1059 | rootH1_10008734 | |||
| 1060 | JGI25160J50197_1008977 | |||
| 1061 | JGI25161J50226_1003069 | |||
| 1062 | Ga0006562J51391_1072998 | |||
| 1063 | Ga0006562J51391_1072999 | |||
| 1064 | Ga0006562J51391_1109357 | |||
| 1065 | Ga0006562J51391_1109361 | |||
| 1066 | Ga0055527_1008925 | |||
| 1067 | Ga0055542_1000039 | |||
| 1068 | Ga0055526_1005340 | |||
| 1069 | Ga0055526_1009890 | |||
| 1070 | Ga0055526_1009910 | |||
| 1071 | Ga0055537_1000296 | |||
| 1072 | Ga0055537_1003601 | |||
| 1073 | Ga0055537_1004830 | |||
| 1074 | Ga0055524_1000302 | |||
| 1075 | Ga0055524_1005397 | |||
| 1076 | Ga0055524_1007817 | |||
| 1077 | Ga0055536_1002464 | |||
| 1078 | Ga0055536_1025110 | |||
| 1079 | Ga0055536_1035294 | |||
| 1080 | Ga0055534_1000092 | |||
| 1081 | Ga0055534_1000506 | |||
| 1082 | Ga0055534_1003706 | |||
| 1083 | Ga0055534_1003774 | |||
| 1084 | Ga0055528_1000190 | |||
| 1085 | Ga0055528_1007713 | |||
| 1086 | Ga0055528_1011213 | |||
| 1087 | Ga0055530_10000214 | |||
| 1088 | Ga0055530_10046040 | |||
| 1089 | Ga0055540_1000004 | |||
| 1090 | Ga0055540_1000035 | |||
| 1091 | Ga0055540_1006272 | |||
| 1092 | Ga0055540_1010662 | |||
| 1093 | Ga0055531_10000317 | |||
| 1094 | Ga0055531_10000612 | |||
| 1095 | Ga0055531_10010027 | |||
| 1096 | Ga0055531_10010039 | |||
| 1097 | Ga0055531_10013011 | |||
| 1098 | Ga0055543_1003575 | |||
| 1099 | Ga0055543_1005529 | |||
| 1100 | Ga0065165_1001409 | |||
| 1101 | Ga0065165_1006920 | |||
| 1102 | Ga0065165_1019442 | |||
| 1103 | Ga0065165_1021156 | |||
| 1104 | Ga0065714_10071185 | |||
| 1105 | Ga0065714_10162009 | |||
| 1106 | Ga0070658_10153664 | |||
| 1107 | Ga0070676_10041207 | |||
| 1108 | Ga0070676_10245308 | |||
| 1109 | Ga0070690_100004296 | |||
| 1110 | Ga0070670_100425081 | |||
| 1111 | Ga0070670_100500835 | |||
| 1112 | Ga0070670_100522989 | |||
| 1113 | Ga0070677_10274327 | |||
| 1114 | Ga0068869_100028112 | |||
| 1115 | Ga0068869_100324339 | |||
| 1116 | Ga0070666_10002227 | |||
| 1117 | Ga0070680_100180066 | |||
| 1118 | Ga0070682_100051931 | |||
| 1119 | Ga0068868_100000526 | |||
| 1120 | Ga0068868_100203916 | |||
| 1121 | Ga0068868_100349216 | |||
| 1122 | Ga0070660_100106598 | |||
| 1123 | Ga0070689_100268559 | |||
| 1124 | Ga0070668_100077914 | |||
| 1125 | Ga0070669_100012794 | |||
| 1126 | Ga0070669_100150344 | |||
| 1127 | Ga0070669_100366576 | |||
| 1128 | Ga0070675_100001257 | |||
| 1129 | Ga0070675_100907041 | |||
| 1130 | Ga0070671_100125518 | |||
| 1131 | Ga0070671_100305998 | |||
| 1132 | Ga0070671_100375628 | |||
| 1133 | Ga0070671_100827308 | |||
| 1134 | Ga0070674_100349044 | |||
| 1135 | Ga0070674_100532809 | |||
| 1136 | Ga0070673_100003204 | |||
| 1137 | Ga0070673_100258085 | |||
| 1138 | Ga0070673_100767072 | |||
| 1139 | Ga0070673_100778093 | |||
| 1140 | Ga0070688_100077097 | |||
| 1141 | Ga0070688_100471911 | |||
| 1142 | Ga0070659_100000481 | |||
| 1143 | Ga0070659_101011499 | |||
| 1144 | Ga0070667_100080720 | |||
| 1145 | Ga0070700_100327988 | |||
| 1146 | Ga0070663_100163635 | |||
| 1147 | Ga0070663_100199411 | |||
| 1148 | Ga0070663_100227984 | |||
| 1149 | Ga0070663_100374548 | |||
| 1150 | Ga0070663_101122346 | |||
| 1151 | Ga0070678_100025493 | |||
| 1152 | Ga0070678_100113725 | |||
| 1153 | Ga0070678_100224620 | |||
| 1154 | Ga0070678_101879349 | |||
| 1155 | Ga0070662_100031047 | |||
| 1156 | Ga0070662_100046139 | |||
| 1157 | Ga0070662_100116974 | |||
| 1158 | Ga0070662_100174632 | |||
| 1159 | Ga0070662_100176844 | |||
| 1160 | Ga0070662_100436768 | |||
| 1161 | Ga0070681_10361019 | |||
| 1162 | Ga0068867_100000005 | |||
| 1163 | Ga0068867_100062751 | |||
| 1164 | Ga0068867_100097766 | |||
| 1165 | Ga0068867_100112722 | |||
| 1166 | Ga0068867_101148495 | |||
| 1167 | Ga0070685_10250691 | |||
| 1168 | Ga0070706_100001719 | |||
| 1169 | Ga0070707_101368383 | |||
| 1170 | Ga0070679_100064787 | |||
| 1171 | Ga0070679_100094911 | |||
| 1172 | Ga0068853_100051725 | |||
| 1173 | Ga0068853_100240813 | |||
| 1174 | Ga0068853_100376107 | |||
| 1175 | Ga0070672_100108731 | |||
| 1176 | Ga0070672_100276294 | |||
| 1177 | Ga0070672_100639082 | |||
| 1178 | Ga0070672_101355628 | |||
| 1179 | Ga0070665_100557805 | |||
| 1180 | Ga0070704_100621411 | |||
| 1181 | Ga0068855_100014182 | |||
| 1182 | Ga0068855_100025134 | |||
| 1183 | Ga0068855_100813039 | |||
| 1184 | Ga0070664_100118860 | |||
| 1185 | Ga0070664_100556684 | |||
| 1186 | Ga0070664_100561635 | |||
| 1187 | Ga0068857_100596251 | |||
| 1188 | Ga0068854_100183933 | |||
| 1189 | Ga0068854_100483848 | |||
| 1190 | Ga0068854_100518381 | |||
| 1191 | Ga0068854_100635519 | |||
| 1192 | Ga0068856_100036361 | |||
| 1193 | Ga0068856_100341872 | |||
| 1194 | Ga0068852_100002367 | |||
| 1195 | Ga0068852_100123976 | |||
| 1196 | Ga0068852_100383670 | |||
| 1197 | Ga0068852_101481327 | |||
| 1198 | Ga0068859_100010093 | |||
| 1199 | Ga0068859_100923527 | |||
| 1200 | Ga0068864_100000511 | |||
| 1201 | Ga0068861_100144813 | |||
| 1202 | Ga0068861_101090679 | |||
| 1203 | Ga0068851_10004317 | |||
| 1204 | Ga0068851_10037551 | |||
| 1205 | Ga0068870_10450785 | |||
| 1206 | Ga0068863_100007397 | |||
| 1207 | Ga0068858_100000359 | |||
| 1208 | Ga0068860_100072237 | |||
| 1209 | Ga0075365_10013252 | |||
| 1210 | Ga0075365_10915880 | |||
| 1211 | Ga0075363_100070021 | |||
| 1212 | Ga0075363_100084488 | |||
| 1213 | Ga0075363_100171471 | |||
| 1214 | Ga0075364_10054684 | |||
| 1215 | Ga0075364_10238777 | |||
| 1216 | Ga0075364_10271956 | |||
| 1217 | Ga0075432_10008843 | |||
| 1218 | Ga0075432_10024139 | |||
| 1219 | Ga0075362_10003584 | |||
| 1220 | Ga0075362_10039489 | |||
| 1221 | Ga0075362_10131550 | |||
| 1222 | Ga0075362_10317351 | |||
| 1223 | Ga0075367_10147513 | |||
| 1224 | Ga0075367_10362599 | |||
| 1225 | Ga0075369_10032362 | |||
| 1226 | Ga0075369_10199483 | |||
| 1227 | Ga0075366_10002649 | |||
| 1228 | Ga0075366_10006970 | |||
| 1229 | Ga0075366_10009720 | |||
| 1230 | Ga0075366_10013620 | |||
| 1231 | Ga0075366_10033567 | |||
| 1232 | Ga0075366_10145745 | |||
| 1233 | Ga0075366_10172756 | |||
| 1234 | Ga0075366_10623891 | |||
| 1235 | Ga0097621_100057282 | |||
| 1236 | Ga0097621_100831982 | |||
| 1237 | Ga0075370_10000556 | |||
| 1238 | Ga0075370_10014562 | |||
| 1239 | Ga0075370_10016632 | |||
| 1240 | Ga0075370_10022291 | |||
| 1241 | Ga0075370_10023906 | |||
| 1242 | Ga0075370_10034046 | |||
| 1243 | Ga0075370_10048286 | |||
| 1244 | Ga0075370_10183655 | |||
| 1245 | Ga0075370_10351501 | |||
| 1246 | Ga0068871_100064447 | |||
| 1247 | Ga0068865_100087270 | |||
| 1248 | Ga0068865_100209277 | |||
| 1249 | Ga0068865_100409664 | |||
| 1250 | Ga0097620_100010093 | |||
| 1251 | Ga0097620_100923533 | |||
| 1252 | Ga0079104_1000024 | |||
| 1253 | Ga0099826_10000115 | |||
| 1254 | Ga0099826_10159610 | |||
| 1255 | Ga0105250_10034781 | |||
| 1256 | Ga0105240_10003642 | |||
| 1257 | Ga0105240_10625342 | |||
| 1258 | Ga0111539_12743599 | |||
| 1259 | Ga0105245_10008806 | |||
| 1260 | Ga0105245_10251226 | |||
| 1261 | Ga0105245_10668587 | |||
| 1262 | Ga0105245_11621319 | |||
| 1263 | Ga0105243_10000515 | |||
| 1264 | Ga0105243_10001515 | |||
| 1265 | Ga0105243_10003542 | |||
| 1266 | Ga0105243_10132451 | |||
| 1267 | Ga0105243_10134204 | |||
| 1268 | Ga0105243_10340324 | |||
| 1269 | Ga0105243_10427224 | |||
| 1270 | Ga0105241_10143886 | |||
| 1271 | Ga0105242_10004129 | |||
| 1272 | Ga0105242_10908655 | |||
| 1273 | Ga0105248_10161343 | |||
| 1274 | Ga0105248_10531646 | |||
| 1275 | Ga0105237_10034393 | |||
| 1276 | Ga0105237_10037398 | |||
| 1277 | Ga0105238_10006811 | |||
| 1278 | Ga0105238_10027040 | |||
| 1279 | Ga0105238_11315528 | |||
| 1280 | Ga0105249_10467555 | |||
| 1281 | Ga0105239_10216054 | |||
| 1282 | Ga0105239_11519189 | |||
| 1283 | Ga0105246_10131195 | |||
| 1284 | Ga0157373_10029757 | |||
| 1285 | Ga0157371_10133807 | |||
| 1286 | Ga0157370_10065472 | |||
| 1287 | Ga0157369_10043021 | |||
| 1288 | Ga0157378_10528330 | |||
| 1289 | Ga0157378_11042396 | |||
| 1290 | Ga0163162_10123599 | |||
| 1291 | Ga0163162_10239243 | |||
| 1292 | Ga0163162_10284627 | |||
| 1293 | Ga0163162_10973410 | |||
| 1294 | Ga0157372_10806654 | |||
| 1295 | Ga0157375_10169716 | |||
| 1296 | Ga0157375_11715030 | |||
| 1297 | Ga0163163_10010941 | |||
| 1298 | Ga0163163_12441689 | |||
| 1299 | Ga0157380_10119485 | |||
| 1300 | Ga0157380_10283257 | |||
| 1301 | Ga0157380_10948435 | |||
| 1302 | Ga0157380_10961539 | |||
| 1303 | Ga0182008_10009236 | |||
| 1304 | Ga0182008_10011067 | |||
| 1305 | Ga0182008_10057326 | |||
| 1306 | Ga0182008_10122108 | |||
| 1307 | Ga0157377_10000022 | |||
| 1308 | Ga0157377_10138874 | |||
| 1309 | Ga0157379_10092454 | |||
| 1310 | Ga0157379_10523405 | |||
| 1311 | Ga0157376_10145094 | |||
| 1312 | Ga0157376_10796496 | |||
| 1313 | Ga0182007_10000472 | |||
| 1314 | Ga0182007_10053924 | |||
| 1315 | Ga0182005_1042245 | |||
| 1316 | Ga0183362_10001 | |||
| 1317 | Ga0163161_10001036 | |||
| 1318 | Ga0163161_10031016 | |||
| 1319 | Ga0163161_10051910 | |||
| 1320 | Ga0163161_10503808 | |||
| 1321 | Ga0209436_108139 | |||
| 1322 | Ga0209672_101250 | |||
| 1323 | Ga0209147_102210 | |||
| 1324 | Ga0209258_100099 | |||
| 1325 | Ga0207425_1000239 | |||
| 1326 | Ga0207425_1001642 | |||
| 1327 | Ga0207425_1004428 | |||
| 1328 | Ga0209148_1000103 | |||
| 1329 | Ga0209129_1000007 | |||
| 1330 | Ga0209129_1000144 | |||
| 1331 | Ga0209129_1001130 | |||
| 1332 | Ga0209129_1004500 | |||
| 1333 | Ga0209565_1000073 | |||
| 1334 | Ga0209565_1000199 | |||
| 1335 | Ga0209565_1003122 | |||
| 1336 | Ga0209673_1000127 | |||
| 1337 | Ga0209673_1000128 | |||
| 1338 | Ga0209673_1001078 | |||
| 1339 | Ga0209673_1001619 | |||
| 1340 | Ga0209673_1003135 | |||
| 1341 | Ga0209673_1013295 | |||
| 1342 | Ga0209130_1000471 | |||
| 1343 | Ga0209130_1000898 | |||
| 1344 | Ga0209130_1000914 | |||
| 1345 | Ga0209130_1002188 | |||
| 1346 | Ga0209675_1000029 | |||
| 1347 | Ga0209675_1000114 | |||
| 1348 | Ga0209675_1000723 | |||
| 1349 | Ga0209675_1000976 | |||
| 1350 | Ga0209675_1002630 | |||
| 1351 | Ga0209676_1000122 | |||
| 1352 | Ga0209676_1000301 | |||
| 1353 | Ga0209676_1002710 | |||
| 1354 | Ga0209676_1003298 | |||
| 1355 | Ga0209025_1000073 | |||
| 1356 | Ga0209025_1000248 | |||
| 1357 | Ga0209025_1000491 | |||
| 1358 | Ga0209025_1006463 | |||
| 1359 | Ga0209025_1026508 | |||
| 1360 | Ga0209564_1000029 | |||
| 1361 | Ga0209564_1000360 | |||
| 1362 | Ga0209564_1001537 | |||
| 1363 | Ga0209564_1042300 | |||
| 1364 | Ga0209758_1000025 | |||
| 1365 | Ga0209758_1000043 | |||
| 1366 | Ga0209758_1000434 | |||
| 1367 | Ga0209050_1000197 | |||
| 1368 | Ga0209050_1000433 | |||
| 1369 | Ga0209050_1000488 | |||
| 1370 | Ga0209050_1007621 | |||
| 1371 | Ga0209050_1007861 | |||
| 1372 | Ga0209050_1011027 | |||
| 1373 | Ga0209050_1042750 | |||
| 1374 | Ga0209050_1042975 | |||
| 1375 | Ga0209256_1000011 | |||
| 1376 | Ga0209256_1000050 | |||
| 1377 | Ga0209256_1000063 | |||
| 1378 | Ga0207426_1000001 | |||
| 1379 | Ga0207426_1000028 | |||
| 1380 | Ga0207426_1001556 | |||
| 1381 | Ga0209051_1000002 | |||
| 1382 | Ga0209051_1000016 | |||
| 1383 | Ga0209051_1000542 | |||
| 1384 | Ga0209051_1001159 | |||
| 1385 | Ga0209051_1002010 | |||
| 1386 | Ga0209051_1004650 | |||
| 1387 | Ga0209051_1007504 | |||
| 1388 | Ga0209051_1023776 | |||
| 1389 | Ga0209257_1000002 | |||
| 1390 | Ga0209257_1000012 | |||
| 1391 | Ga0209257_1000021 | |||
| 1392 | Ga0209257_1000102 | |||
| 1393 | Ga0209257_1006647 | |||
| 1394 | Ga0209257_1007736 | |||
| 1395 | Ga0207656_10052949 | |||
| 1396 | Ga0207656_10060956 | |||
| 1397 | Ga0207696_1036136 | |||
| 1398 | Ga0207682_10075079 | |||
| 1399 | Ga0207682_10167125 | |||
| 1400 | Ga0207680_10005639 | |||
| 1401 | Ga0207680_10263764 | |||
| 1402 | Ga0207645_10018276 | |||
| 1403 | Ga0207645_10035636 | |||
| 1404 | Ga0207645_10100201 | |||
| 1405 | Ga0207645_10532092 | |||
| 1406 | Ga0207705_10141578 | |||
| 1407 | Ga0207684_10001654 | |||
| 1408 | Ga0207654_10111296 | |||
| 1409 | Ga0207707_10310318 | |||
| 1410 | Ga0207695_10347517 | |||
| 1411 | Ga0207695_11112823 | |||
| 1412 | Ga0207671_10071283 | |||
| 1413 | Ga0207671_11036626 | |||
| 1414 | Ga0207660_10138485 | |||
| 1415 | Ga0207657_10016829 | |||
| 1416 | Ga0207657_10625583 | |||
| 1417 | Ga0207657_11079679 | |||
| 1418 | Ga0207649_10006892 | |||
| 1419 | Ga0207649_11137242 | |||
| 1420 | Ga0207652_10032924 | |||
| 1421 | Ga0207646_10085820 | |||
| 1422 | Ga0207681_10343261 | |||
| 1423 | Ga0207681_10603020 | |||
| 1424 | Ga0207694_10043334 | |||
| 1425 | Ga0207694_10103673 | |||
| 1426 | Ga0207694_11257370 | |||
| 1427 | Ga0207650_10356242 | |||
| 1428 | Ga0207650_10565955 | |||
| 1429 | Ga0207650_10948396 | |||
| 1430 | Ga0207659_10003030 | |||
| 1431 | Ga0207659_10258615 | |||
| 1432 | Ga0207659_10295076 | |||
| 1433 | Ga0207659_10479979 | |||
| 1434 | Ga0207687_10034029 | |||
| 1435 | Ga0207687_10481755 | |||
| 1436 | Ga0207687_10783030 | |||
| 1437 | Ga0207644_10105561 | |||
| 1438 | Ga0207644_10120978 | |||
| 1439 | Ga0207644_10154722 | |||
| 1440 | Ga0207690_10000428 | |||
| 1441 | Ga0207690_10722352 | |||
| 1442 | Ga0207706_10039894 | |||
| 1443 | Ga0207706_10098221 | |||
| 1444 | Ga0207706_10192746 | |||
| 1445 | Ga0207706_10211544 | |||
| 1446 | Ga0207706_10452262 | |||
| 1447 | Ga0207686_10007355 | |||
| 1448 | Ga0207709_10000245 | |||
| 1449 | Ga0207709_10000522 | |||
| 1450 | Ga0207709_10001057 | |||
| 1451 | Ga0207709_10578054 | |||
| 1452 | Ga0207670_10290321 | |||
| 1453 | Ga0207669_10767268 | |||
| 1454 | Ga0207704_10265032 | |||
| 1455 | Ga0207691_10193218 | |||
| 1456 | Ga0207691_10228240 | |||
| 1457 | Ga0207691_10355654 | |||
| 1458 | Ga0207711_10199470 | |||
| 1459 | Ga0207711_10509761 | |||
| 1460 | Ga0207689_10040791 | |||
| 1461 | Ga0207689_10079678 | |||
| 1462 | Ga0207679_10023501 | |||
| 1463 | Ga0207679_10026952 | |||
| 1464 | Ga0207679_10358199 | |||
| 1465 | Ga0207667_10089432 | |||
| 1466 | Ga0207667_11139411 | |||
| 1467 | Ga0207651_10001269 | |||
| 1468 | Ga0207651_10115784 | |||
| 1469 | Ga0207651_10182500 | |||
| 1470 | Ga0207651_10238065 | |||
| 1471 | Ga0207651_10396106 | |||
| 1472 | Ga0207712_10033531 | |||
| 1473 | Ga0207668_10151952 | |||
| 1474 | Ga0207668_11011088 | |||
| 1475 | Ga0207640_10121792 | |||
| 1476 | Ga0207640_10154690 | |||
| 1477 | Ga0207640_10384754 | |||
| 1478 | Ga0207658_10088021 | |||
| 1479 | Ga0207658_10097808 | |||
| 1480 | Ga0207677_10008077 | |||
| 1481 | Ga0207677_10012869 | |||
| 1482 | Ga0207677_10420136 | |||
| 1483 | Ga0207703_10002190 | |||
| 1484 | Ga0207703_10716627 | |||
| 1485 | Ga0207639_10070642 | |||
| 1486 | Ga0207639_10165441 | |||
| 1487 | Ga0207639_10339936 | |||
| 1488 | Ga0207678_10059926 | |||
| 1489 | Ga0207678_10086891 | |||
| 1490 | Ga0207678_10385440 | |||
| 1491 | Ga0207678_10386594 | |||
| 1492 | Ga0207708_10156192 | |||
| 1493 | Ga0207702_10046176 | |||
| 1494 | Ga0207702_11078602 | |||
| 1495 | Ga0207702_11107518 | |||
| 1496 | Ga0207641_10001726 | |||
| 1497 | Ga0207648_10000032 | |||
| 1498 | Ga0207648_10017579 | |||
| 1499 | Ga0207648_10032114 | |||
| 1500 | Ga0207648_10205864 | |||
| 1501 | Ga0207648_10368277 | |||
| 1502 | Ga0207648_10583581 | |||
| 1503 | Ga0207648_10696885 | |||
| 1504 | Ga0207676_10003149 | |||
| 1505 | Ga0207674_10349962 | |||
| 1506 | Ga0207674_10540395 | |||
| 1507 | Ga0207674_11276771 | |||
| 1508 | Ga0207675_100109629 | |||
| 1509 | Ga0207683_10010783 | |||
| 1510 | Ga0207683_10030115 | |||
| 1511 | Ga0207683_10032771 | |||
| 1512 | Ga0207683_10558013 | |||
| 1513 | Ga0207698_10004168 | |||
| 1514 | Ga0207698_10022533 | |||
| 1515 | Ga0207698_10024501 | |||
| 1516 | Ga0207698_10060126 | |||
| 1517 | Ga0207698_10329259 | |||
| 1518 | Ga0209281_1000005 | |||
| 1519 | Ga0209281_1000104 | |||
| 1520 | Ga0209983_1051536 | |||
| 1521 | Ga0209282_1000109 | |||
| 1522 | Ga0209974_10005579 | |||
| 1523 | Ga0209974_10091046 | |||
| 1524 | Ga0209974_10146591 | |||
| 1525 | Ga0207428_10102987 | |||
| 1526 | Ga0268266_10107424 | |||
| 1527 | Ga0268266_11581600 | |||
| 1528 | Ga0268265_10029913 | |||
| 1529 | Ga0268265_10204653 | |||
| 1530 | Ga0268265_11174997 | |||
| 1531 | Ga0268264_10065396 | |||
| 1532 | Ga0268264_10195084 | |||
| 1533 | Ga0307515_10000842 | |||
| 1534 | Ga0307515_10001088 | |||
| 1535 | Ga0307515_10001640 | |||
| 1536 | Ga0307515_10020481 | |||
| 1537 | Ga0307515_10064179 | |||
| 1538 | Ga0307515_10109248 | |||
| 1539 | Ga0307515_10127705 | |||
| 1540 | Ga0307515_10166309 | |||
| 1541 | Ga0307515_10233339 | |||
| 1542 | Ga0307512_10045218 | |||
| 1543 | Ga0307512_10065075 | |||
| 1544 | Ga0316177_1071860 | |||
| 1545 | Ga0316177_1155855 | |||
| 1546 | Ga0316176_1148086 | |||
| 1547 | Ga0314311_1122598 | |||
| 1548 | Ga0316178_1138608 | |||
| 1549 | Ga0316180_1073464 | |||
| 1550 | Ga0316183_1020296 | |||
| 1551 | Ga0316181_1106329 | |||
| 1552 | Ga0265332_10008074 | |||
| 1553 | Ga0265332_10291341 | |||
| 1554 | Ga0265329_10036582 | |||
| 1555 | Ga0265331_10058291 | |||
| 1556 | Ga0265327_10000814 | |||
| 1557 | Ga0265327_10006291 | |||
| 1558 | Ga0307513_10000019 | |||
| 1559 | Ga0307513_10000051 | |||
| 1560 | Ga0307513_10003449 | |||
| 1561 | Ga0307513_10026043 | |||
| 1562 | Ga0307513_10217505 | |||
| 1563 | Ga0307513_10438385 | |||
| 1564 | Ga0307513_10467479 | |||
| 1565 | Ga0307509_10094623 | |||
| 1566 | Ga0307408_100000099 | |||
| 1567 | Ga0307408_100000193 | |||
| 1568 | Ga0307408_100019885 | |||
| 1569 | Ga0307408_100028902 | |||
| 1570 | Ga0307408_100040951 | |||
| 1571 | Ga0307408_100318652 | |||
| 1572 | Ga0307408_100430099 | |||
| 1573 | Ga0307408_100544456 | |||
| 1574 | Ga0307508_10002774 | |||
| 1575 | Ga0307514_10002956 | |||
| 1576 | Ga0307514_10013325 | |||
| 1577 | Ga0265314_10013361 | |||
| 1578 | Ga0265314_10049626 | |||
| 1579 | Ga0307516_10004540 | |||
| 1580 | Ga0307516_10006152 | |||
| 1581 | Ga0307516_10222875 | |||
| 1582 | Ga0307516_10266001 | |||
| 1583 | Ga0307516_10271164 | |||
| 1584 | Ga0307405_10314292 | |||
| 1585 | Ga0307405_11084002 | |||
| 1586 | Ga0307413_11076597 | |||
| 1587 | Ga0307410_10741619 | |||
| 1588 | Ga0307406_10009579 | |||
| 1589 | Ga0307406_10016378 | |||
| 1590 | Ga0307406_10188553 | |||
| 1591 | Ga0307406_10514283 | |||
| 1592 | Ga0307406_10822053 | |||
| 1593 | Ga0307407_10047314 | |||
| 1594 | Ga0307407_10426950 | |||
| 1595 | Ga0307412_10037116 | |||
| 1596 | Ga0307412_10057816 | |||
| 1597 | Ga0307412_10065081 | |||
| 1598 | Ga0307412_10480906 | |||
| 1599 | Ga0307412_11115782 | |||
| 1600 | Ga0307409_100183715 | |||
| 1601 | Ga0307409_101749225 | |||
| 1602 | Ga0307416_100023015 | |||
| 1603 | Ga0307416_100068689 | |||
| 1604 | Ga0307416_100312658 | |||
| 1605 | Ga0307414_10008085 | |||
| 1606 | Ga0307414_10321315 | |||
| 1607 | Ga0307414_10482254 | |||
| 1608 | Ga0307414_10968353 | |||
| 1609 | Ga0307414_11013262 | |||
| 1610 | Ga0307411_10000548 | |||
| 1611 | Ga0307411_10077498 | |||
| 1612 | Ga0307411_10232700 | |||
| 1613 | Ga0307411_10262288 | |||
| 1614 | Ga0307411_10421808 | |||
| 1615 | Ga0307415_101103417 | |||
| 1616 | Ga0316583_10017125 | |||
| 1617 | Ga0316593_10009836 | |||
| 1618 | Ga0307510_10000311 | |||
| 1619 | Ga0373950_0003412 | |||
| 1620 | Ga0373959_0058069 | |||
| 1621 | Ga0373944_0058770 | |||
| 1622 | Ga0373951_0029584 | |||
| 1623 | Ga0373939_0000006 | |||
| 1624 | Ga0373960_0000041 | |||
| 1625 | Ga0373946_0107776 | |||
| 1626 | Ga0373931_0000514 | |||
| 1627 | Ga0373937_0265951 | |||
| 1628 | Ga0395899_0003079 | |||
| 1629 | Ga0395899_0008624 | |||
| 1630 | Ga0395899_0111358 | |||
| 1631 | Ga0395899_0260826 | |||
| 1632 | Ga0395900_0000054 | |||
| 1633 | Ga0395900_0026485 | |||
| 1634 | Ga0395900_0064720 | |||
| 1635 | Ga0395900_0111316 | |||
| 1636 | Ga0395900_0411167 | |||
| 1637 | Ga0395900_0572708 | |||
| 1638 | Ga0395898_0000798 | |||
| 1639 | Ga0395898_0425136 | |||
| 1640 | Ga0395898_0472253 | |||
| 1641 | Ga0395905_0000148 | |||
| 1642 | Ga0395905_0001062 | |||
| 1643 | Ga0395905_0002549 | |||
| 1644 | Ga0395905_0003187 | |||
| 1645 | Ga0395905_0016333 | |||
| 1646 | Ga0395905_0030153 | |||
| 1647 | Ga0395905_0049497 | |||
| 1648 | Ga0395905_0049955 | |||
| 1649 | Ga0395905_0101793 | |||
| 1650 | Ga0395905_0323338 | |||
| 1651 | Ga0395905_0388293 | |||
| 1652 | Ga0395905_0695531 | |||
| 1653 | Ga0395905_1294698 | |||
| 1654 | Ga0395901_0012708 | |||
| 1655 | Ga0395901_0085741 | |||
| 1656 | Ga0395901_0119190 | |||
| 1657 | Ga0395901_0121303 | |||
| 1658 | Ga0395901_0173517 | |||
| 1659 | Ga0395901_0176105 | |||
| 1660 | Ga0395901_0187430 | |||
| 1661 | Ga0395901_0266367 | |||
| 1662 | Ga0395901_0311735 | |||
| 1663 | Ga0400483_098478 | |||
| 1664 | Ga0436365_0161847 | |||
| 1665 | Ga0436365_0872657 | |||
| 1666 | Ga0439436_0000392 | |||
| 1667 | Ga0439436_0002953 | |||
| 1668 | Ga0439436_0013763 | |||
| 1669 | Ga0439439_0013953 | |||
| 1670 | Ga0439439_0051148 | |||
| 1671 | Ga0439439_0114708 | |||
| 1672 | Ga0439439_0138768 | |||
| 1673 | Ga0439447_009228 | |||
| 1674 | Ga0439447_032624 | |||
| 1675 | Ga0439461_0001378 | |||
| 1676 | Ga0439461_0007060 | |||
| 1677 | Ga0439466_0008881 | |||
| 1678 | Ga0439466_0015610 | |||
| 1679 | Ga0439465_0000387 | |||
| 1680 | Ga0439465_0094931 | |||
| 1681 | Ga0451791_1261760 | |||
| 1682 | Ga0451802_0405913 | |||
| 1683 | Ga0451804_0865208 | |||
| 1684 | Ga0451833_1215784 | |||
| 1685 | Ga0451833_1425945 | |||
| 1686 | Ga0451841_0537712 | |||
| 1687 | Ga0451841_0963024 | |||
| 1688 | Ga0451855_0271653 | |||
| 1689 | Ga0451853_1667522 | |||
| 1690 | Ga0439431_0001219 | |||
| 1691 | Ga0439433_0000473 | |||
| 1692 | Ga0439437_005415 | |||
| 1693 | Ga0439437_019870 | |||
| 1694 | Ga0439442_004083 | |||
| 1695 | Ga0439443_032008 | |||
| 1696 | Ga0439445_0000712 | |||
| 1697 | Ga0439445_0027176 | |||
| 1698 | Ga0439445_0047170 | |||
| 1699 | Ga0439432_002602 | |||
| 1700 | Ga0439432_019440 | |||
| 1701 | Ga0439449_0002379 | |||
| 1702 | Ga0439449_0003757 | |||
| 1703 | Ga0439449_0005865 | |||
| 1704 | Ga0439449_0006097 | |||
| 1705 | Ga0439449_0010161 | |||
| 1706 | Ga0439449_0049957 | |||
| 1707 | Ga0439452_000611 | |||
| 1708 | Ga0439452_062410 | |||
| 1709 | Ga0439454_068024 | |||
| 1710 | Ga0439457_002909 | |||
| 1711 | Ga0439457_013201 | |||
| 1712 | Ga0439462_0004945 | |||
| 1713 | Ga0439462_0123858 | |||
| 1714 | Ga0450912_024875 | |||
| 1715 | Ga0450913_001575 | |||
| 1716 | Ga0450919_000992 | |||
| 1717 | Ga0450920_009242 | |||
| 1718 | Ga0450920_025575 | |||
| 1719 | Ga0450921_000320 | |||
| 1720 | Ga0450923_001819 | |||
| 1721 | Ga0450888_000719 | |||
| 1722 | Ga0450890_006388 | |||
| 1723 | Ga0450890_019152 | |||
| 1724 | Ga0450891_000123 | |||
| 1725 | Ga0450892_001446 | |||
| 1726 | Ga0450895_021983 | |||
| 1727 | Ga0450896_008927 | |||
| 1728 | Ga0450896_012842 | |||
| 1729 | Ga0450898_004928 | |||
| 1730 | Ga0450902_008791 | |||
| 1731 | Ga0450889_000176 | |||
| 1732 | Ga0450906_007423 | |||
| 1733 | Ga0450906_009590 | |||
| 1734 | Ga0450907_014618 | |||
| 1735 | Ga0450910_005526 | |||
| 1736 | Ga0439446_0029700 | |||
| 1737 | Ga0450908_004328 | |||
| 1738 | Ga0450908_004926 | |||
| 1739 | Ga0450909_004479 | |||
| 1740 | Ga0439434_0003045 | |||
| 1741 | Ga0439434_0004381 | |||
| 1742 | Ga0439434_0038955 | |||
| 1743 | Ga0439435_0124557 | |||
| 1744 | Ga0439464_0010780 | |||
| 1745 | Ga0450916_067619 | |||
| 1746 | Ga0450918_000264 | |||
| 1747 | Ga0450918_001423 | |||
| 1748 | Ga0450893_0010771 | |||
| 1749 | Ga0450893_0020353 | |||
| 1750 | Ga0451577_0019186 | |||
| 1751 | Ga0451577_0144388 | |||
| 1752 | Ga0451577_0191062 | |||
| 1753 | Ga0466969_0000054 | |||
| 1754 | Ga0466969_0010663 | |||
| 1755 | Ga0453683_0002845 | |||
| 1756 | Ga0466965_0088633 | |||
| 1757 | Ga0466965_0094149 | |||
| 1758 | Ga0466965_0405699 | |||
| 1759 | Ga0466966_0002469 | |||
| 1760 | Ga0466966_0011535 | |||
| 1761 | Ga0466961_0059317 | |||
| 1762 | Ga0466961_0226434 | |||
| 1763 | Ga0466964_0005457 | |||
| 1764 | Ga0453684_0361044 | |||
| 1765 | Ga0453684_0370975 | |||
| 1766 | Ga0453684_1601680 | |||
| 1767 | Ga0466971_0007746 | |||
| 1768 | Ga0466971_0326792 | |||
| 1769 | Ga0466970_0009993 | |||
| 1770 | Ga0466970_0047180 | |||
| 1771 | Ga0466957_0099067 | |||
| 1772 | Ga0466957_0184812 | |||
| 1773 | Ga0466957_0668137 | |||
| 1774 | Ga0466960_0028787 | |||
| 1775 | Ga0466960_0239453 | |||
| 1776 | Ga0466959_0000528 | |||
| 1777 | Ga0466959_0104843 | |||
| 1778 | Ga0451576_0072525 | |||
| 1779 | Ga0451576_0099477 | |||
| 1780 | Ga0451576_0146107 | |||
| 1781 | Ga0451576_0269778 | |||
| 1782 | Ga0451576_1148854 | |||
| 1783 | Ga0466967_0627724 | |||
| 1784 | Ga0466967_2472295 | |||
| 1785 | Ga0495627_007791 | |||
| 1786 | Ga0495627_020910 | |||
| 1787 | Ga0495629_0104012 | |||
| 1788 | Ga0495629_0717846 | |||
| 1789 | Ga0495638_0043532 | |||
| 1790 | Ga0495638_0063325 | |||
| 1791 | Ga0495651_0070658 | |||
| 1792 | Ga0495653_0133775 | |||
| 1793 | Ga0495639_0122426 | |||
| 1794 | Ga0495610_0010849 | |||
| 1795 | Ga0495610_0020359 | |||
| 1796 | Ga0495610_0085259 | |||
| 1797 | Ga0495610_0392893 | |||
| 1798 | Ga0495616_0000722 | |||
| 1799 | Ga0495618_0138797 | |||
| 1800 | Ga0495618_0345519 | |||
| 1801 | Ga0495620_0021122 | |||
| 1802 | Ga0495628_1035681 | |||
| 1803 | Ga0495631_0000446 | |||
| 1804 | Ga0495632_0117942 | |||
| 1805 | Ga0495637_0028290 | |||
| 1806 | Ga0495643_0064789 | |||
| 1807 | Ga0495663_0095586 | |||
| 1808 | Ga0495663_0099688 | |||
| 1809 | Ga0495642_0038373 | |||
| 1810 | Ga0495654_0014862 | |||
| 1811 | Ga0495654_0016539 | |||
| 1812 | Ga0495609_0248669 | |||
| 1813 | Ga0495621_0009160 | |||
| 1814 | Ga0495621_0100588 | |||
| 1815 | Ga0495621_0109254 | |||
| 1816 | Ga0495621_0346171 | |||
| 1817 | Ga0495597_0001135 | |||
| 1818 | Ga0495622_0232948 | |||
| 1819 | Ga0495633_0002529 | |||
| 1820 | Ga0495633_0157967 | |||
| 1821 | Ga0495656_0001008 | |||
| 1822 | Ga0495656_0021519 | |||
| 1823 | Ga0495634_0352510 | |||
| 1824 | Ga0495625_0000396 | |||
| 1825 | Ga0495625_0020614 | |||
| 1826 | Ga0495635_0230945 | |||
| 1827 | Ga0495661_0101423 | |||
| 1828 | Ga0495588_0008771 | |||
| 1829 | Ga0495588_0017519 | |||
| 1830 | Ga0495588_0022794 | |||
| 1831 | Ga0495599_0210546 | |||
| 1832 | Ga0495658_0097627 | |||
| 1833 | Ga0495658_0263080 | |||
| 1834 | Ga0495670_0069830 | |||
| 1835 | Ga0495671_0006709 | |||
| 1836 | Ga0495600_0115925 | |||
| 1837 | Ga0495600_0207404 | |||
| 1838 | Ga0495600_0622530 | |||
| 1839 | Ga0495660_0044178 | |||
| 1840 | Ga0495581_0296453 | |||
| 1841 | Ga0495676_0050590 | |||
| 1842 | Ga0495687_203076 | |||
| 1843 | Ga0495681_0113426 | |||
| 1844 | Ga0495686_0005856 | |||
| 1845 | Ga0495593_0005694 | |||
| 1846 | Ga0495593_0098558 | |||
| 1847 | Ga0495593_0631470 | |||
| 1848 | Ga0495602_0459912 | |||
| 1849 | Ga0495614_0008498 | |||
| 1850 | Ga0495615_0023364 | |||
| 1851 | Ga0495615_0172772 | |||
| 1852 | Ga0496100_0078272 | |||
| 1853 | Ga0496100_1402725 | |||
| 1854 | Ga0496101_0042961 | |||
| 1855 | Ga0496102_0032292 | |||
| 1856 | Ga0496102_0032877 | |||
| 1857 | Ga0496102_0036331 | |||
| 1858 | Ga0496103_0211580 | |||
| 1859 | Ga0496104_0464865 | |||
| 1860 | Ga0496105_0028533 | |||
| 1861 | Ga0496105_0197976 | |||
| 1862 | Ga0496106_0047925 | |||
| 1863 | Ga0496107_0248541 | |||
| 1864 | Ga0496112_0345553 | |||
| 1865 | Ga0496113_1385750 | |||
| 1866 | Ga0496113_1591987 | |||
| 1867 | Ga0496114_0056546 | |||
| 1868 | Ga0496114_0368850 | |||
| 1869 | Ga0496114_0472552 | |||
| 1870 | Ga0496116_0025554 | |||
| 1871 | Ga0496117_0044176 | |||
| 1872 | Ga0496117_0045056 | |||
| 1873 | Ga0496118_0050037 | |||
| 1874 | Ga0496118_0325976 | |||
| 1875 | Ga0496121_0022936 | |||
| 1876 | Ga0496121_0244409 | |||
| 1877 | Ga0496122_0000688 | |||
| 1878 | Ga0496122_0069209 | |||
| 1879 | Ga0496122_0101496 | |||
| 1880 | Ga0496122_0110935 | |||
| 1881 | Ga0496122_0293218 | |||
| 1882 | Ga0496122_0371799 | |||
| 1883 | Ga0496123_0001158 | |||
| 1884 | Ga0496123_0038770 | |||
| 1885 | Ga0496123_0057248 | |||
| 1886 | Ga0496123_0131922 | |||
| 1887 | Ga0496123_0161827 | |||
| 1888 | Ga0496124_0052228 | |||
| 1889 | Ga0496124_0059351 | |||
| 1890 | Ga0496124_0077403 | |||
| 1891 | Ga0496124_0196762 | |||
| 1892 | Ga0496125_0006625 | |||
| 1893 | Ga0496125_0017065 | |||
| 1894 | Ga0496125_0290512 | |||
| 1895 | Ga0496125_0341143 | |||
| 1896 | Ga0496125_0510420 | |||
| 1897 | Ga0496126_0035110 | |||
| 1898 | Ga0496126_0234437 | |||
| 1899 | Ga0496126_0932713 | |||
| 1900 | Ga0501301_010670 | |||
| 1901 | Ga0501315_019643 | |||
| 1902 | Ga0501034_0247677 | |||
| 1903 | Ga0501037_0244588 | |||
| 1904 | Ga0501038_0606296 | |||
| 1905 | Ga0501043_0641387 | |||
| 1906 | Ga0501198_000044 | |||
| 1907 | Ga0501222_000017 | |||
| 1908 | Ga0501253_003212 | |||
| 1909 | Ga0501035_0048271 | |||
| 1910 | Ga0501044_0278341 | |||
| 1911 | nmdc:mga03683_132966_c1 | |||
| 1912 | nmdc:mga03683_252889_c1 | |||
| 1913 | nmdc:mga03683_32250_c1 | |||
| 1914 | nmdc:mga03683_60337_c1 | |||
| 1915 | nmdc:mga03n38_139021_c1 | |||
| 1916 | nmdc:mga03n38_850629_c1 | |||
| 1917 | nmdc:mga03n38_90616_c1 | |||
| 1918 | nmdc:mga00v17_10018_c1 | |||
| 1919 | nmdc:mga00v17_665279_c1 | |||
| 1920 | nmdc:mga00v17_99525_c1 | |||
| 1921 | nmdc:mga0yw44_14269_c1 | |||
| 1922 | nmdc:mga0yw44_309247_c1 | |||
| 1923 | nmdc:mga0k408_14275_c2 | |||
| 1924 | nmdc:mga0k408_157357_c1 | |||
| 1925 | nmdc:mga0k408_23067_c1 | |||
| 1926 | nmdc:mga0k408_28627_c1 | |||
| 1927 | nmdc:mga0k408_351820_c1 | |||
| 1928 | nmdc:mga0k408_36399_c1 | |||
| 1929 | nmdc:mga0k408_38912_c1 | |||
| 1930 | nmdc:mga0k408_445271_c1 | |||
| 1931 | nmdc:mga06z11_295078_c1 | |||
| 1932 | nmdc:mga06z11_556810_c1 | |||
| 1933 | nmdc:mga06z11_581398_c1 | |||
| 1934 | nmdc:mga07m45_11241_c1 | |||
| 1935 | nmdc:mga07m45_13172_c1 | |||
| 1936 | nmdc:mga07m45_21825_c1 | |||
| 1937 | nmdc:mga07m45_249894_c1 | |||
| 1938 | nmdc:mga07m45_27154_c1 | |||
| 1939 | nmdc:mga07m45_312083_c1 | |||
| 1940 | nmdc:mga07m45_533_c1 | |||
| 1941 | nmdc:mga07m45_58332_c1 | |||
| 1942 | nmdc:mga07m45_9770_c1 | |||
| 1943 | Ga0500610_0005849 | |||
| 1944 | Ga0500610_0007392 | |||
| 1945 | Ga0500578_0000926 | |||
| 1946 | Ga0500643_010390 | |||
| 1947 | Ga0500644_0004370 | |||
| 1948 | Ga0500644_0008346 | |||
| 1949 | Ga0500644_0215805 | |||
| 1950 | Ga0500646_0022004 | |||
| 1951 | Ga0500647_0069700 | |||
| 1952 | Ga0500651_0000063 | |||
| 1953 | Ga0500651_0037817 | |||
| 1954 | Ga0500641_0082765 | |||
| 1955 | Ga0500641_0167280 | |||
| 1956 | Ga0500650_0037746 | |||
| 1957 | Ga0500562_027216 | |||
| 1958 | Ga0500562_049118 | |||
| 1959 | Ga0500571_008126 | |||
| 1960 | Ga0500592_009925 | |||
| 1961 | Ga0500593_000487 | |||
| 1962 | Ga0500593_001737 | |||
| 1963 | Ga0500593_004766 | |||
| 1964 | Ga0500594_0000905 | |||
| 1965 | Ga0500597_113615 | |||
| 1966 | Ga0500607_001614 | |||
| 1967 | Ga0500607_095498 | |||
| 1968 | Ga0500608_008503 | |||
| 1969 | Ga0500608_083300 | |||
| 1970 | Ga0500618_035370 | |||
| 1971 | Ga0500618_045103 | |||
| 1972 | Ga0500626_105204 | |||
| 1973 | Ga0500642_0013135 | |||
| 1974 | Ga0500652_004429 | |||
| 1975 | Ga0500652_031259 | |||
| 1976 | Ga0500658_0002954 | |||
| 1977 | Ga0500658_0002955 | |||
| 1978 | Ga0500559_0000260 | |||
| 1979 | Ga0500559_0006663 | |||
| 1980 | Ga0500559_0008325 | |||
| 1981 | Ga0500559_0023456 | |||
| 1982 | Ga0500568_0003245 | |||
| 1983 | Ga0500568_0145526 | |||
| 1984 | Ga0500574_031804 | |||
| 1985 | Ga0500577_0073196 | |||
| 1986 | Ga0500590_034903 | |||
| 1987 | Ga0500604_0021837 | |||
| 1988 | Ga0500604_0055885 | |||
| 1989 | Ga0500604_0248720 | |||
| 1990 | Ga0500616_0025494 | |||
| 1991 | Ga0500619_000059 | |||
| 1992 | Ga0500619_113521 | |||
| 1993 | Ga0500622_0001479 | |||
| 1994 | Ga0500622_0004445 | |||
| 1995 | Ga0500633_0032144 | |||
| 1996 | Ga0500634_0038376 | |||
| 1997 | Ga0500638_029064 | |||
| 1998 | Ga0500636_0165370 | |||
| 1999 | Ga0500570_083918 | |||
| 2000 | Ga0500645_000198 | |||
| 2001 | Ga0500645_004925 | |||
| 2002 | Ga0500645_015380 | |||
| 2003 | Ga0500587_000969 | |||
| 2004 | Ga0500587_006774 | |||
| 2005 | Ga0466962_0407838 | |||
| 2006 | 2548497415 | |||
| 2007 | 2587726267 | |||
| 2008 | 2587734438 | |||
| 2009 | 2587756326 | |||
| 2010 | 2588293853 | |||
| 2011 | 2599623674 | |||
| 2012 | 2599671707 | |||
| 2013 | 2599681280 | |||
| 2014 | 2599693317 | |||
| 2015 | 2643746347 | |||
| 2016 | 2643866551 | |||
| 2017 | 2643933180 | |||
| 2018 | 2643970942 | |||
| 2019 | 2643993303 | |||
| 2020 | 2644138803 | |||
| 2021 | 2644159608 | |||
| 2022 | 2644243609 | |||
| 2023 | 2644258899 | |||
| 2024 | 2644273961 | |||
| 2025 | 2644294092 | |||
| 2026 | 2644314429 | |||
| 2027 | 2644327631 | |||
| 2028 | 2644468176 | |||
| 2029 | 2644646095 | |||
| 2030 | 2722883941 | |||
| 2031 | 2738717743 | |||
| 2032 | 2738879354 | |||
| 2033 | 2739055646 | |||
| 2034 | 2739242693 | |||
| 2035 | 2739250710 | |||
| 2036 | 2739278429 | |||
| 2037 | 2816472990 | |||
| 2038 | 2819597227 | |||
| 2039 | 2831266352 | |||
| 2040 | 2838057536 | |||
| 2041 | 2839140286 | |||
| 2042 | 2842679865 | |||
| 2043 | 2842719553 | |||
| 2044 | 2842736780 | |||
| 2045 | 2842747851 | |||
| 2046 | 2881101844 | |||
| 2047 | 2885192687 | |||
| 2048 | 2885204476 | |||
| 2049 | 2885218129 | |||
| 2050 | 2899924731 | |||
| 2051 | 2904454420 | |||
| 2052 | 2904461137 | |||
| 2053 | 2904548182 | |||
| 2054 | 2916180132 | |||
| 2055 | 2919466014 | |||
| 2056 | 2919704600 | |||
| 2057 | 2928039142 | |||
| 2058 | 2928045253 | |||
| 2059 | 2928053058 | |||
| 2060 | 2928064270 | |||
| 2061 | 2928071707 | |||
| 2062 | 2928084348 | |||
| 2063 | 2928118544 | |||
| 2064 | 2929163111 | |||
| 2065 | 2929527019 | |||
| 2066 | 2932425891 | |||
| 2067 | 2945911615 | |||
| 2068 | 2945948177 | |||
| 2069 | 2945977178 | |||
| 2070 | 2945986043 | |||
| 2071 | 2954772295 | |||
| 2072 | 2974323387 | |||
| 2073 | 2990712263 | |||
| 2074 | 8054359813 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ns5-assembly1.cif.gz_A | x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 | 0.9644 | 1 | 153 |
| 5twj-assembly2.cif.gz_A | crystal structure of rlmh in complex with s-adenosylmethionine | 0.9582 | 2 | 155 |
| 1ns5-assembly1.cif.gz_A | x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 | 0.9582 | 1 | 153 |
| 5twj-assembly2.cif.gz_A | crystal structure of rlmh in complex with s-adenosylmethionine | 0.9462 | 2 | 155 |
| 1to0-assembly4.cif.gz_G | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9429 | 1 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ns5A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9567 | 3 | 153 | 3.40.1280.10 |
| 1ns5A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9443 | 3 | 153 | 3.40.1280.10 |
| 1to0F00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9272 | 3 | 147 | 3.40.1280.10 |
| af_I1M9Q9_28_183_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9226 | 1 | 154 | 3.40.1280.10 |
| 1o6dA00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9125 | 1 | 150 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7RW46-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9829 | 1 | 155 |
GO:0005737
GO:0070038 |
| AF-A0A5C7JE22-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9821 | 1 | 155 |
GO:0005737
GO:0070038 |
| AF-A0A7J6JSI1-F1-model_v4 | deleted | 0.9813 | 27 | 147 |
|
| AF-A0A7W8HHK5-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9802 | 1 | 155 |
GO:0005737
GO:0070038 |
| AF-A0A2E2R6H6-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9779 | 1 | 155 |
GO:0005737
GO:0070038 |