F488774

General Info

Members Datasets Scaffolds Average Seq Length
1038 484 2076 251

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0028821|Ga0496122_0028821_1239_2069
Length 276
Sequence VGAPPQARHDTGRRAGPGGVIAMNAAVPGALTSSLLYLDGVSVSFDGFKAIRGLSLTIEPGEMRAIIGPNGAGKTTMMDIITGKTKPDVGTVMFGGSVDLTKLDEAAIANLGIGRKFQKPTVFDFHTIEDNILLALKSKRTVGRTLFWKTEEPQQKRIDDILGIVKLADKRDRLAGSLSHGQKQWLEIGMLLAQDPKLLLVDEPAAGMTDGETAQTAVLLKEIARDHSVIVVEHDMGFIRELGVKVTVLHEGSVLAEGPLDQVSANERVVEVYLGR

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
137 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
138 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
204 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
262 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
263 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
264 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
366 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
369 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
402 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
403 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
404 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
405 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
406 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
407 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
410 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
411 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
414 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
415 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
419 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
420 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
421 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
422 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
423 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
424 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
425 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
426 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
427 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
428 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
429 2643221651 Afipia sp. Root123D2 Isolate Unclassified
430 2643221733 Bosea sp. Root381 Isolate Unclassified
431 2643221734 Bosea sp. Root670 Isolate Unclassified
432 2643221736 Bosea sp. Root483D1 Isolate Unclassified
433 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
434 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
435 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
436 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
437 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
438 2818991467 Bosea vestrisii 3192 Isolate Unclassified
439 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
440 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
441 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
442 2841760612 Bosea sp. Tri-49 Isolate Nodule
443 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
444 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
445 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
446 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
447 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
448 2844104063 Bosea sp. Tri-39 Isolate Nodule
449 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
450 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
451 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
452 2851182111 Bosea sp. Tri-44 Isolate Nodule
453 2851246043 Bosea sp. Tri-54 Isolate Nodule
454 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
455 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
456 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
457 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
458 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
459 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
460 2904699407
461 2906610324
462 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
463 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
464 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
465 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
466 2909042592 Labrys sp. LIt4 Isolate Nodule
467 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
468 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
469 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
470 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
471 2922425934
472 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
473 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
474 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
475 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
476 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
477 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
478 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
479 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
480 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
481 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
482 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
483 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
484 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.91
Metatranscriptomes 0
Isolates 6.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.83
Nodule 3.18
Rhizoplane 7.51
Rhizosphere 72.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0028821 3300048925 Bacteria 4698
2 JGI25152J39213_1002271 3300002773 Bacteria 7414
3 JGI25150J39212_1000091 3300002774 Bacteria 52487
4 JGI25159J45721_1006205 3300002987 Bacteria 3615
5 JGI25159J45721_1029362 3300002987 Bacteria 906
6 JGI25151J46595_10000027 3300003187 Bacteria 208739
7 JGI25151J46595_10000079 3300003187 Bacteria 132415
8 JGI25151J46595_10000166 3300003187 Bacteria 85475
9 JGI25406J46586_10001744 3300003203 Bacteria 10229
10 JGI25406J46586_10099659 3300003203 Bacteria 868
11 JGI25153J46596_10023417 3300003215 Bacteria 2253
12 rootH1_10001360 3300003323 Bacteria 3136
13 JGI25160J50197_1008772 3300003354 Bacteria 3823
14 JGI25404J52841_10025863 3300003659 Bacteria 1264
15 Ga0055526_1001798 3300003771 Bacteria 14849
16 Ga0055526_1004200 3300003771 Bacteria 8750
17 Ga0055524_1000147 3300003775 Bacteria 83426
18 Ga0065165_1000359 3300005262 Bacteria 74914
19 Ga0065715_10409333 3300005293 Bacteria 872
20 Ga0070658_10250365 3300005327 Bacteria 1503
21 Ga0070676_10264661 3300005328 Bacteria 1153
22 Ga0070676_10361287 3300005328 Bacteria 1001
23 Ga0070683_100529884 3300005329 Bacteria 1126
24 Ga0070670_100000279 3300005331 Bacteria 44846
25 Ga0070670_100023610 3300005331 Bacteria 5293
26 Ga0070670_100084216 3300005331 Bacteria 2732
27 Ga0068869_100350047 3300005334 Bacteria 1204
28 Ga0070666_10208641 3300005335 Bacteria 1375
29 Ga0070680_100023161 3300005336 Bacteria 4951
30 Ga0070660_100435979 3300005339 Bacteria 1086
31 Ga0070689_100009551 3300005340 Bacteria 6879
32 Ga0070689_100122295 3300005340 Bacteria 2080
33 Ga0070689_100177604 3300005340 Bacteria 1728
34 Ga0070689_100243838 3300005340 Bacteria 1481
35 Ga0070689_100348901 3300005340 Bacteria 1241
36 Ga0070691_10005254 3300005341 Bacteria 5883
37 Ga0070691_10015821 3300005341 Bacteria 3467
38 Ga0070661_100080243 3300005344 Bacteria 2408
39 Ga0070692_10233535 3300005345 Bacteria 1093
40 Ga0070668_100085337 3300005347 Bacteria 2481
41 Ga0070668_100487865 3300005347 Bacteria 1065
42 Ga0070669_100461875 3300005353 Bacteria 1048
43 Ga0070675_100052858 3300005354 Bacteria 3341
44 Ga0070675_100181614 3300005354 Bacteria 1819
45 Ga0070675_100392747 3300005354 Bacteria 1236
46 Ga0070671_100018362 3300005355 Bacteria 5680
47 Ga0070671_100088490 3300005355 Bacteria 2592
48 Ga0070674_100017992 3300005356 Bacteria 4458
49 Ga0070674_100084622 3300005356 Bacteria 2274
50 Ga0070673_100027881 3300005364 Bacteria 4192
51 Ga0070673_100121720 3300005364 Bacteria 2178
52 Ga0070673_100159919 3300005364 Bacteria 1915
53 Ga0070673_100285515 3300005364 Bacteria 1449
54 Ga0070673_100404278 3300005364 Bacteria 1221
55 Ga0070688_100216810 3300005365 Bacteria 1347
56 Ga0070688_100323241 3300005365 Bacteria 1122
57 Ga0070667_100089336 3300005367 Bacteria 2646
58 Ga0070667_100100209 3300005367 Bacteria 2501
59 Ga0070667_100390358 3300005367 Bacteria 1266
60 Ga0070703_10015829 3300005406 Bacteria 2161
61 Ga0070709_10011341 3300005434 Bacteria 4963
62 Ga0070709_10068928 3300005434 Bacteria 2276
63 Ga0070714_100017392 3300005435 Bacteria 5824
64 Ga0070713_100007558 3300005436 Bacteria 7639
65 Ga0070713_100015955 3300005436 Bacteria 5636
66 Ga0070713_100078485 3300005436 Bacteria 2810
67 Ga0070713_100169172 3300005436 Bacteria 1957
68 Ga0070713_100236946 3300005436 Bacteria 1660
69 Ga0070713_100504704 3300005436 Bacteria 1142
70 Ga0070713_100636344 3300005436 Bacteria 1015
71 Ga0070710_10007309 3300005437 Bacteria 5343
72 Ga0070711_100041309 3300005439 Bacteria 3114
73 Ga0070711_100120718 3300005439 Bacteria 1938
74 Ga0070711_100243353 3300005439 Bacteria 1407
75 Ga0070705_100000010 3300005440 Bacteria 102079
76 Ga0070700_100012029 3300005441 Bacteria 4811
77 Ga0070700_100036015 3300005441 Bacteria 2999
78 Ga0070700_100100414 3300005441 Bacteria 1905
79 Ga0070694_100007490 3300005444 Bacteria 6658
80 Ga0070694_100301901 3300005444 Bacteria 1227
81 Ga0070708_100031895 3300005445 Bacteria 4565
82 Ga0070708_100319002 3300005445 Bacteria 1464
83 Ga0070708_100432891 3300005445 Bacteria 1241
84 Ga0070678_100139537 3300005456 Bacteria 1938
85 Ga0070678_100145528 3300005456 Bacteria 1902
86 Ga0070681_10037097 3300005458 Bacteria 4892
87 Ga0068867_100140308 3300005459 Bacteria 1888
88 Ga0068867_100370305 3300005459 Bacteria 1201
89 Ga0070706_100083039 3300005467 Bacteria 2968
90 Ga0070707_100008667 3300005468 Bacteria 9437
91 Ga0070707_100180491 3300005468 Bacteria 2058
92 Ga0070707_100473022 3300005468 Bacteria 1214
93 Ga0070698_100001583 3300005471 Bacteria 25310
94 Ga0070698_100081261 3300005471 Bacteria 3236
95 Ga0070698_100143789 3300005471 Bacteria 2335
96 Ga0070699_100001267 3300005518 Bacteria 23288
97 Ga0070699_100032052 3300005518 Bacteria 4538
98 Ga0070699_100097779 3300005518 Bacteria 2572
99 Ga0070699_100133004 3300005518 Bacteria 2193
100 Ga0070699_100156092 3300005518 Bacteria 2019
101 Ga0070679_100069394 3300005530 Bacteria 3515
102 Ga0070697_100019537 3300005536 Bacteria 5353
103 Ga0070697_100123050 3300005536 Bacteria 2171
104 Ga0070672_100080702 3300005543 Bacteria 2606
105 Ga0070672_100729529 3300005543 Bacteria 869
106 Ga0070686_100081658 3300005544 Bacteria 2142
107 Ga0070686_100206694 3300005544 Bacteria 1411
108 Ga0070695_100001386 3300005545 Bacteria 13460
109 Ga0070695_100015958 3300005545 Bacteria 4541
110 Ga0070696_100000088 3300005546 Bacteria 45502
111 Ga0070665_100164933 3300005548 Bacteria 2218
112 Ga0070665_100303739 3300005548 Bacteria 1599
113 Ga0070665_100424985 3300005548 Bacteria 1337
114 Ga0070704_100007022 3300005549 Bacteria 6679
115 Ga0070704_100174015 3300005549 Bacteria 1715
116 Ga0070704_100242386 3300005549 Bacteria 1476
117 Ga0068855_100014613 3300005563 Bacteria 9455
118 Ga0068855_100335274 3300005563 Bacteria 1669
119 Ga0070664_100091744 3300005564 Bacteria 2629
120 Ga0068857_100025585 3300005577 Bacteria 5196
121 Ga0068857_100085007 3300005577 Bacteria 2827
122 Ga0068854_100131782 3300005578 Bacteria 1909
123 Ga0068856_100874584 3300005614 Bacteria 918
124 Ga0068852_100164725 3300005616 Bacteria 2073
125 Ga0068859_100029774 3300005617 Bacteria 5478
126 Ga0068859_101024518 3300005617 Bacteria 907
127 Ga0068864_100393132 3300005618 Bacteria 1316
128 Ga0068864_100414815 3300005618 Bacteria 1282
129 Ga0068861_100086515 3300005719 Bacteria 2464
130 Ga0068861_100175826 3300005719 Bacteria 1778
131 Ga0068863_100108341 3300005841 Bacteria 2644
132 Ga0068858_100317367 3300005842 Bacteria 1489
133 Ga0068860_100023745 3300005843 Bacteria 5928
134 Ga0068860_100032520 3300005843 Bacteria 5012
135 Ga0068860_100090932 3300005843 Bacteria 2908
136 Ga0068862_100000484 3300005844 Bacteria 42509
137 Ga0068862_100145573 3300005844 Bacteria 2105
138 Ga0081455_10000142 3300005937 Bacteria 84680
139 Ga0081455_10003539 3300005937 Bacteria 17922
140 Ga0081455_10022523 3300005937 Bacteria 5888
141 Ga0081455_10028348 3300005937 Bacteria 5117
142 Ga0081455_10092343 3300005937 Bacteria 2449
143 Ga0081455_10107042 3300005937 Bacteria 2230
144 Ga0081455_10132533 3300005937 Bacteria 1947
145 Ga0081455_10206962 3300005937 Bacteria 1465
146 Ga0081455_10299363 3300005937 Bacteria 1155
147 Ga0081538_10019181 3300005981 Bacteria 5098
148 Ga0081538_10025164 3300005981 Bacteria 4209
149 Ga0081540_1006595 3300005983 Bacteria 8425
150 Ga0081540_1009132 3300005983 Bacteria 6843
151 Ga0081540_1012474 3300005983 Bacteria 5589
152 Ga0081540_1029277 3300005983 Bacteria 3071
153 Ga0081540_1030263 3300005983 Bacteria 3001
154 Ga0081539_10000598 3300005985 Bacteria 73470
155 Ga0081539_10003011 3300005985 Bacteria 21952
156 Ga0081539_10016306 3300005985 Bacteria 5319
157 Ga0081539_10016697 3300005985 Bacteria 5217
158 Ga0081539_10024885 3300005985 Bacteria 3870
159 Ga0081539_10036208 3300005985 Bacteria 2956
160 Ga0081539_10168260 3300005985 Bacteria 1039
161 Ga0070717_10006086 3300006028 Bacteria 8856
162 Ga0070717_10014983 3300006028 Bacteria 5972
163 Ga0070717_10037023 3300006028 Bacteria 3960
164 Ga0070717_10244127 3300006028 Bacteria 1584
165 Ga0075365_10164699 3300006038 Bacteria 1546
166 Ga0075368_10018439 3300006042 Bacteria 2622
167 Ga0075368_10120999 3300006042 Bacteria 1084
168 Ga0075363_100063912 3300006048 Bacteria 1988
169 Ga0075364_10162832 3300006051 Bacteria 1506
170 Ga0075364_10319755 3300006051 Bacteria 1057
171 Ga0075432_10023298 3300006058 Bacteria 2120
172 Ga0070715_10001945 3300006163 Bacteria 6220
173 Ga0070716_100003460 3300006173 Bacteria 7432
174 Ga0070712_100015104 3300006175 Bacteria 4964
175 Ga0070712_100133119 3300006175 Bacteria 1887
176 Ga0070712_100137693 3300006175 Bacteria 1859
177 Ga0070712_100264860 3300006175 Bacteria 1378
178 Ga0070712_100594810 3300006175 Bacteria 936
179 Ga0075362_10002893 3300006177 Bacteria 5879
180 Ga0075362_10009224 3300006177 Bacteria 3806
181 Ga0075362_10013500 3300006177 Bacteria 3271
182 Ga0075362_10031084 3300006177 Bacteria 2309
183 Ga0075362_10098682 3300006177 Bacteria 1363
184 Ga0075367_10002514 3300006178 Bacteria 8403
185 Ga0075367_10016000 3300006178 Bacteria 4090
186 Ga0075367_10153996 3300006178 Bacteria 1427
187 Ga0075367_10196933 3300006178 Bacteria 1258
188 Ga0075367_10229795 3300006178 Bacteria 1162
189 Ga0075369_10012084 3300006186 Bacteria 3406
190 Ga0075369_10041829 3300006186 Bacteria 1962
191 Ga0075369_10117757 3300006186 Bacteria 1201
192 Ga0075369_10202814 3300006186 Bacteria 915
193 Ga0075366_10086007 3300006195 Bacteria 1881
194 Ga0097621_100207379 3300006237 Bacteria 1703
195 Ga0075370_10100700 3300006353 Bacteria 1672
196 Ga0075370_10191072 3300006353 Bacteria 1207
197 Ga0075370_10208135 3300006353 Bacteria 1155
198 Ga0075370_10312911 3300006353 Bacteria 935
199 Ga0075428_100028809 3300006844 Bacteria 6145
200 Ga0075428_100105515 3300006844 Bacteria 3073
201 Ga0075428_100440420 3300006844 Bacteria 1396
202 Ga0075430_100296789 3300006846 Bacteria 1337
203 Ga0075431_100000021 3300006847 Bacteria 82774
204 Ga0075431_100004278 3300006847 Bacteria 13986
205 Ga0075431_100013599 3300006847 Bacteria 8223
206 Ga0075431_100157342 3300006847 Bacteria 2338
207 Ga0075431_100186346 3300006847 Bacteria 2128
208 Ga0075431_100225890 3300006847 Bacteria 1909
209 Ga0075431_100329007 3300006847 Bacteria 1539
210 Ga0075431_100627653 3300006847 Bacteria 1056
211 Ga0075433_10098961 3300006852 Bacteria 2582
212 Ga0075434_100003287 3300006871 Bacteria 14450
213 Ga0075434_100039117 3300006871 Bacteria 4699
214 Ga0075434_100041218 3300006871 Bacteria 4574
215 Ga0075434_100077231 3300006871 Bacteria 3325
216 Ga0075434_100361856 3300006871 Bacteria 1472
217 Ga0075429_100044422 3300006880 Bacteria 3865
218 Ga0075429_100382333 3300006880 Bacteria 1233
219 Ga0068865_100230699 3300006881 Bacteria 1452
220 Ga0075436_100151402 3300006914 Bacteria 1633
221 Ga0075436_100189908 3300006914 Bacteria 1453
222 Ga0097620_100029774 3300006931 Bacteria 5478
223 Ga0097620_101024563 3300006931 Bacteria 907
224 Ga0079104_1000015 3300006946 Bacteria 321803
225 Ga0075435_100005120 3300007076 Bacteria 9111
226 Ga0075435_100146468 3300007076 Bacteria 1984
227 Ga0099794_10013033 3300007265 Bacteria 3609
228 Ga0099795_10008633 3300007788 Bacteria 2916
229 Ga0099795_10019938 3300007788 Bacteria 2177
230 Ga0105240_10270653 3300009093 Bacteria 1956
231 Ga0111539_10000144 3300009094 Bacteria 81842
232 Ga0111539_10002369 3300009094 Bacteria 25039
233 Ga0111539_10031200 3300009094 Bacteria 6477
234 Ga0111539_10403564 3300009094 Bacteria 1592
235 Ga0111539_11073817 3300009094 Bacteria 936
236 Ga0105245_10125795 3300009098 Bacteria 2399
237 Ga0105245_10229000 3300009098 Bacteria 1797
238 Ga0105245_10380909 3300009098 Bacteria 1405
239 Ga0114129_10000068 3300009147 Bacteria 93579
240 Ga0114129_10021135 3300009147 Bacteria 9241
241 Ga0114129_10189744 3300009147 Bacteria 2792
242 Ga0114129_10414122 3300009147 Bacteria 1774
243 Ga0114129_10743083 3300009147 Bacteria 1257
244 Ga0114129_10872792 3300009147 Bacteria 1142
245 Ga0114129_10884235 3300009147 Bacteria 1133
246 Ga0114129_10902828 3300009147 Bacteria 1119
247 Ga0114129_10902838 3300009147 Bacteria 1119
248 Ga0105243_10376761 3300009148 Bacteria 1311
249 Ga0105243_10738458 3300009148 Bacteria 964
250 Ga0105241_10467356 3300009174 Bacteria 1119
251 Ga0105242_10093354 3300009176 Bacteria 2537
252 Ga0105242_10960898 3300009176 Bacteria 859
253 Ga0105248_10002224 3300009177 Bacteria 21448
254 Ga0105248_10044373 3300009177 Bacteria 4986
255 Ga0105248_10157928 3300009177 Bacteria 2559
256 Ga0105237_10069708 3300009545 Bacteria 3512
257 Ga0105238_10048111 3300009551 Bacteria 4299
258 Ga0105249_10229647 3300009553 Bacteria 1830
259 Ga0105249_10387069 3300009553 Bacteria 1426
260 Ga0105033_102692 3300009986 Bacteria 1473
261 Ga0099796_10022692 3300010159 Bacteria 1950
262 Ga0105239_10297453 3300010375 Bacteria 1818
263 Ga0105239_10471574 3300010375 Bacteria 1425
264 Ga0105246_10038956 3300011119 Bacteria 3199
265 Ga0105246_10095777 3300011119 Bacteria 2149
266 Ga0105246_10216201 3300011119 Bacteria 1499
267 Ga0157370_10077887 3300013104 Bacteria 3122
268 Ga0157370_10235815 3300013104 Bacteria 1693
269 Ga0171462_1033 3300013250 Bacteria 90238
270 Ga0157378_10483374 3300013297 Bacteria 1234
271 Ga0163162_10353761 3300013306 Bacteria 1601
272 Ga0163162_10681032 3300013306 Bacteria 1151
273 Ga0157372_10492060 3300013307 Bacteria 1430
274 Ga0157375_10826313 3300013308 Bacteria 1074
275 Ga0157375_10979236 3300013308 Bacteria 986
276 Ga0163163_10013174 3300014325 Bacteria 7556
277 Ga0163163_10054559 3300014325 Bacteria 3949
278 Ga0163163_10103655 3300014325 Bacteria 2869
279 Ga0157380_10013643 3300014326 Bacteria 5931
280 Ga0157380_10083652 3300014326 Bacteria 2615
281 Ga0182008_10240141 3300014497 Bacteria 932
282 Ga0157379_10255654 3300014968 Bacteria 1591
283 Ga0157376_10267225 3300014969 Bacteria 1605
284 Ga0157376_10544235 3300014969 Bacteria 1148
285 Ga0163161_10127281 3300017792 Bacteria 1919
286 Ga0213872_10022142 3300021361 Bacteria 2927
287 Ga0213874_10048881 3300021377 Bacteria 1291
288 Ga0213874_10102494 3300021377 Bacteria 953
289 Ga0213876_10069114 3300021384 Bacteria 1866
290 Ga0213875_10000003 3300021388 Bacteria 719367
291 Ga0213875_10024691 3300021388 Bacteria 2865
292 Ga0213871_10034354 3300021441 Bacteria 1336
293 Ga0224572_1002024 3300024225 Bacteria 3183
294 Ga0224572_1014579 3300024225 Bacteria 1503
295 Ga0228598_1000419 3300024227 Bacteria 8618
296 Ga0207425_1000043 3300025245 Bacteria 208791
297 Ga0209148_1000409 3300025254 Bacteria 49427
298 Ga0209129_1000072 3300025258 Bacteria 208805
299 Ga0209455_1003530 3300025272 Bacteria 5489
300 Ga0209673_1008478 3300025273 Bacteria 4568
301 Ga0209130_1000062 3300025284 Bacteria 200367
302 Ga0209130_1000709 3300025284 Bacteria 29714
303 Ga0209675_1001144 3300025291 Bacteria 16175
304 Ga0209025_1000014 3300025294 Bacteria 865448
305 Ga0209025_1000053 3300025294 Bacteria 317600
306 Ga0209025_1000120 3300025294 Bacteria 208791
307 Ga0209025_1001382 3300025294 Bacteria 32401
308 Ga0209025_1083642 3300025294 Bacteria 1073
309 Ga0209564_1000017 3300025295 Bacteria 594063
310 Ga0209564_1000179 3300025295 Bacteria 151032
311 Ga0209758_1000111 3300025297 Bacteria 208790
312 Ga0209758_1013103 3300025297 Bacteria 4558
313 Ga0209758_1033923 3300025297 Bacteria 2040
314 Ga0209256_1000055 3300025299 Bacteria 295530
315 Ga0209256_1000338 3300025299 Bacteria 78064
316 Ga0207426_1000198 3300025302 Bacteria 146241
317 Ga0207653_10000769 3300025885 Bacteria 10875
318 Ga0207653_10018899 3300025885 Bacteria 2170
319 Ga0207682_10005803 3300025893 Bacteria 5003
320 Ga0207692_10073342 3300025898 Bacteria 1811
321 Ga0207692_10087619 3300025898 Bacteria 1680
322 Ga0207680_10069321 3300025903 Bacteria 2179
323 Ga0207685_10023843 3300025905 Bacteria 2089
324 Ga0207699_10042426 3300025906 Bacteria 2635
325 Ga0207699_10060836 3300025906 Bacteria 2270
326 Ga0207645_10022003 3300025907 Bacteria 4152
327 Ga0207645_10023566 3300025907 Bacteria 4000
328 Ga0207645_10310123 3300025907 Bacteria 1051
329 Ga0207705_10073083 3300025909 Bacteria 2488
330 Ga0207684_10012764 3300025910 Bacteria 7286
331 Ga0207684_10064422 3300025910 Bacteria 3111
332 Ga0207684_10628330 3300025910 Bacteria 916
333 Ga0207654_10213948 3300025911 Bacteria 1275
334 Ga0207707_10028651 3300025912 Bacteria 4867
335 Ga0207707_10043901 3300025912 Bacteria 3898
336 Ga0207671_10463348 3300025914 Bacteria 1010
337 Ga0207693_10008787 3300025915 Bacteria 8257
338 Ga0207693_10011224 3300025915 Bacteria 7252
339 Ga0207693_10038993 3300025915 Bacteria 3740
340 Ga0207693_10051541 3300025915 Bacteria 3229
341 Ga0207663_10121066 3300025916 Bacteria 1792
342 Ga0207660_10067897 3300025917 Bacteria 2584
343 Ga0207660_10148505 3300025917 Bacteria 1799
344 Ga0207662_10030972 3300025918 Bacteria 3108
345 Ga0207662_10149530 3300025918 Bacteria 1484
346 Ga0207657_10426457 3300025919 Bacteria 1042
347 Ga0207652_10062321 3300025921 Bacteria 3222
348 Ga0207646_10080961 3300025922 Bacteria 2903
349 Ga0207646_10172631 3300025922 Bacteria 1952
350 Ga0207646_10277428 3300025922 Bacteria 1515
351 Ga0207694_10084760 3300025924 Bacteria 2493
352 Ga0207694_10162699 3300025924 Bacteria 1803
353 Ga0207650_10001249 3300025925 Bacteria 18464
354 Ga0207650_10014724 3300025925 Bacteria 5436
355 Ga0207650_10056311 3300025925 Bacteria 2921
356 Ga0207659_10141312 3300025926 Bacteria 1869
357 Ga0207659_10299453 3300025926 Bacteria 1320
358 Ga0207700_10295286 3300025928 Bacteria 1398
359 Ga0207700_10391472 3300025928 Bacteria 1217
360 Ga0207700_10615847 3300025928 Bacteria 967
361 Ga0207700_10712926 3300025928 Bacteria 896
362 Ga0207664_10053126 3300025929 Bacteria 3206
363 Ga0207664_10173182 3300025929 Bacteria 1848
364 Ga0207664_10214617 3300025929 Bacteria 1666
365 Ga0207644_10109029 3300025931 Bacteria 2091
366 Ga0207644_10141114 3300025931 Bacteria 1855
367 Ga0207644_10308945 3300025931 Bacteria 1276
368 Ga0207690_10416850 3300025932 Bacteria 1074
369 Ga0207706_10074009 3300025933 Bacteria 2995
370 Ga0207706_10113277 3300025933 Bacteria 2386
371 Ga0207686_10039863 3300025934 Bacteria 2852
372 Ga0207670_10007806 3300025936 Bacteria 6003
373 Ga0207670_10117725 3300025936 Bacteria 1926
374 Ga0207670_10243787 3300025936 Bacteria 1386
375 Ga0207669_10117172 3300025937 Bacteria 1799
376 Ga0207669_10312823 3300025937 Bacteria 1198
377 Ga0207704_10041999 3300025938 Bacteria 2688
378 Ga0207704_10086786 3300025938 Bacteria 2042
379 Ga0207665_10001158 3300025939 Bacteria 17723
380 Ga0207665_10282026 3300025939 Bacteria 1237
381 Ga0207691_10013601 3300025940 Bacteria 7779
382 Ga0207691_10429730 3300025940 Bacteria 1125
383 Ga0207711_10026007 3300025941 Bacteria 4909
384 Ga0207711_10353912 3300025941 Bacteria 1360
385 Ga0207689_10044976 3300025942 Bacteria 3651
386 Ga0207689_10099359 3300025942 Bacteria 2391
387 Ga0207661_10224689 3300025944 Bacteria 1661
388 Ga0207679_10085271 3300025945 Bacteria 2426
389 Ga0207679_10089941 3300025945 Bacteria 2371
390 Ga0207667_10031391 3300025949 Bacteria 5735
391 Ga0207667_10092398 3300025949 Bacteria 3125
392 Ga0207651_10169012 3300025960 Bacteria 1722
393 Ga0207651_10340736 3300025960 Bacteria 1259
394 Ga0207651_10386343 3300025960 Bacteria 1187
395 Ga0207712_10002216 3300025961 Bacteria 12663
396 Ga0207668_10190943 3300025972 Bacteria 1623
397 Ga0207640_10339542 3300025981 Bacteria 1203
398 Ga0207658_10435541 3300025986 Bacteria 1158
399 Ga0207678_10023593 3300026067 Bacteria 5380
400 Ga0207678_10439656 3300026067 Bacteria 1133
401 Ga0207708_10017542 3300026075 Bacteria 5388
402 Ga0207708_10048742 3300026075 Bacteria 3225
403 Ga0207641_10014731 3300026088 Bacteria 6411
404 Ga0207641_10204658 3300026088 Bacteria 1822
405 Ga0207648_10082512 3300026089 Bacteria 2803
406 Ga0207676_10027399 3300026095 Bacteria 4244
407 Ga0207676_10064821 3300026095 Bacteria 2907
408 Ga0207676_10178642 3300026095 Bacteria 1856
409 Ga0207676_10601388 3300026095 Bacteria 1056
410 Ga0207674_10030214 3300026116 Bacteria 5699
411 Ga0207674_10199602 3300026116 Bacteria 1950
412 Ga0207675_100007776 3300026118 Bacteria 10112
413 Ga0207675_100065357 3300026118 Bacteria 3400
414 Ga0207675_100344822 3300026118 Bacteria 1458
415 Ga0207683_10028550 3300026121 Bacteria 4824
416 Ga0207683_10175736 3300026121 Bacteria 1940
417 Ga0207698_10109983 3300026142 Bacteria 2307
418 Ga0209281_1000068 3300027111 Bacteria 280238
419 Ga0209813_10014359 3300027866 Bacteria 2132
420 Ga0207428_10017003 3300027907 Bacteria 6248
421 Ga0207428_10065916 3300027907 Bacteria 2854
422 Ga0207428_10105752 3300027907 Bacteria 2170
423 Ga0268266_10131354 3300028379 Bacteria 2240
424 Ga0268265_10002000 3300028380 Bacteria 16092
425 Ga0268264_10010737 3300028381 Bacteria 7568
426 Ga0268264_10139049 3300028381 Bacteria 2163
427 Ga0268264_10180670 3300028381 Bacteria 1916
428 Ga0268264_10333435 3300028381 Bacteria 1438
429 Ga0265334_10021574 3300028573 Bacteria 2630
430 Ga0265332_10007414 3300031238 Bacteria 4958
431 Ga0265325_10073043 3300031241 Bacteria 1718
432 Ga0265329_10012383 3300031242 Bacteria 3066
433 Ga0265340_10006482 3300031247 Bacteria 6439
434 Ga0265340_10046962 3300031247 Bacteria 2105
435 Ga0265340_10048202 3300031247 Bacteria 2072
436 Ga0265340_10074224 3300031247 Bacteria 1609
437 Ga0265340_10167322 3300031247 Bacteria 997
438 Ga0265339_10000228 3300031249 Bacteria 45435
439 Ga0265339_10000979 3300031249 Bacteria 21883
440 Ga0265316_10138840 3300031344 Bacteria 1827
441 Ga0307408_100091887 3300031548 Bacteria 2293
442 Ga0265313_10000203 3300031595 Bacteria 63977
443 Ga0265313_10065718 3300031595 Bacteria 1683
444 Ga0265314_10059523 3300031711 Bacteria 2613
445 Ga0265314_10085870 3300031711 Bacteria 2062
446 Ga0265342_10000031 3300031712 Bacteria 152577
447 Ga0265342_10052343 3300031712 Bacteria 2434
448 Ga0265342_10063046 3300031712 Bacteria 2180
449 Ga0265342_10149924 3300031712 Bacteria 1295
450 Ga0307405_10001622 3300031731 Bacteria 9573
451 Ga0307405_10139289 3300031731 Bacteria 1689
452 Ga0316577_10135820 3300031733 Bacteria 1385
453 Ga0307412_10811041 3300031911 Bacteria 813
454 Ga0307409_100126626 3300031995 Bacteria 2174
455 Ga0307409_100146055 3300031995 Bacteria 2046
456 Ga0307416_100586609 3300032002 Bacteria 1193
457 Ga0307416_100613816 3300032002 Bacteria 1169
458 Ga0307414_10578075 3300032004 Bacteria 1005
459 Ga0307411_10633182 3300032005 Bacteria 924
460 Ga0307510_10264577 3300033180 Bacteria 1199
461 Ga0373926_0072478 3300035083 Bacteria 1267
462 Ga0373926_0106287 3300035083 Bacteria 1052
463 Ga0373944_0002788 3300035089 Bacteria 4470
464 Ga0373923_0002956 3300035111 Bacteria 5356
465 Ga0373923_0075736 3300035111 Bacteria 1452
466 Ga0373932_0091684 3300035112 Bacteria 976
467 Ga0373936_0035197 3300035113 Bacteria 1993
468 Ga0373941_0007246 3300035115 Bacteria 2708
469 Ga0373941_0232525 3300035115 Bacteria 713
470 Ga0373945_0036567 3300035116 Bacteria 1759
471 Ga0373953_0001366 3300035117 Bacteria 7020
472 Ga0373953_0006528 3300035117 Bacteria 3850
473 Ga0373954_0002877 3300035118 Bacteria 7267
474 Ga0373954_0100018 3300035118 Bacteria 1398
475 Ga0373956_0040275 3300035119 Bacteria 2072
476 Ga0373956_0047793 3300035119 Bacteria 1915
477 Ga0373943_0047398 3300035170 Bacteria 2101
478 Ga0373943_0069017 3300035170 Bacteria 1786
479 Ga0373943_0096100 3300035170 Bacteria 1542
480 Ga0373946_0007164 3300035171 Bacteria 4073
481 Ga0373946_0127361 3300035171 Bacteria 1168
482 Ga0373955_0000220 3300035172 Bacteria 24057
483 Ga0373955_0118078 3300035172 Bacteria 1539
484 Ga0373924_0058990 3300035410 Bacteria 1602
485 Ga0373931_0113163 3300035691 Bacteria 1542
486 Ga0373931_0131277 3300035691 Bacteria 1442
487 Ga0373931_0449716 3300035691 Bacteria 824
488 Ga0373935_0000227 3300035692 Bacteria 27455
489 Ga0373935_0186763 3300035692 Bacteria 1425
490 Ga0373935_0203394 3300035692 Bacteria 1369
491 Ga0373927_0076509 3300035695 Bacteria 2167
492 Ga0373933_0005475 3300035724 Bacteria 6915
493 Ga0373947_0000216 3300035725 Bacteria 32290
494 Ga0373947_0090952 3300035725 Bacteria 1903
495 Ga0373947_0191222 3300035725 Bacteria 1336
496 Ga0373937_0000003 3300036401 Bacteria 235408
497 Ga0373937_0036084 3300036401 Bacteria 4504
498 Ga0373925_0000118 3300037068 Bacteria 85072
499 Ga0373925_0101412 3300037068 Bacteria 2213
500 Ga0373925_0109802 3300037068 Bacteria 2129
501 Ga0373925_0241631 3300037068 Bacteria 1446
502 Ga0395899_0050936 3300037312 Bacteria 3073
503 Ga0395900_0016637 3300037418 Bacteria 7501
504 Ga0395900_0109235 3300037418 Bacteria 2841
505 Ga0395900_0254397 3300037418 Bacteria 1756
506 Ga0395898_0009907 3300037466 Bacteria 9983
507 Ga0395898_0031164 3300037466 Bacteria 5331
508 Ga0436364_0023609 3300037853 Bacteria 2234
509 Ga0436364_0772610 3300037853 Bacteria 3196
510 Ga0436364_0935904 3300037853 Bacteria 1323
511 Ga0436364_0960990 3300037853 Bacteria 25250
512 Ga0436364_1074351 3300037853 Bacteria 12199
513 Ga0436364_1359778 3300037853 Bacteria 2689
514 Ga0436364_1363918 3300037853 Bacteria 7515
515 Ga0436364_1377062 3300037853 Bacteria 4584
516 Ga0436364_1406972 3300037853 Bacteria 1678
517 Ga0395901_0084030 3300038443 Bacteria 3327
518 Ga0395901_0114185 3300038443 Bacteria 2836
519 Ga0395901_0688391 3300038443 Bacteria 1021
520 Ga0436365_0699198 3300039437 Bacteria 2999
521 Ga0436365_0992290 3300039437 Bacteria 833
522 Ga0436365_1269647 3300039437 Bacteria 1201
523 Ga0436365_1438404 3300039437 Bacteria 5322
524 Ga0436365_1619444 3300039437 Bacteria 1413
525 Ga0436365_1620720 3300039437 Bacteria 959
526 Ga0436365_1753369 3300039437 Bacteria 1845
527 Ga0436365_1788190 3300039437 Bacteria 2119
528 Ga0436360_0309149 3300039438 Bacteria 981
529 Ga0436360_0413491 3300039438 Bacteria 1342
530 Ga0436360_1133561 3300039438 Bacteria 1766
531 Ga0436360_1234148 3300039438 Bacteria 2137
532 Ga0436361_0185672 3300039447 Bacteria 1420
533 Ga0436361_0914590 3300039447 Bacteria 1011
534 Ga0436361_1014188 3300039447 Bacteria 2081
535 Ga0436363_0578409 3300039450 Bacteria 1256
536 Ga0436363_0769764 3300039450 Bacteria 1595
537 Ga0436363_1140198 3300039450 Bacteria 1462
538 Ga0436363_1200244 3300039450 Bacteria 2773
539 Ga0436363_1623736 3300039450 Bacteria 1306
540 Ga0436362_0257423 3300039453 Bacteria 968
541 Ga0436362_0546702 3300039453 Bacteria 1122
542 Ga0436362_1178242 3300039453 Bacteria 1011
543 Ga0439453_0001364 3300041408 Bacteria 3115
544 Ga0439431_0017193 3300041997 Bacteria 1698
545 Ga0439441_019221 3300042001 Bacteria 1241
546 Ga0439445_0071863 3300042004 Bacteria 958
547 Ga0439459_0030659 3300042438 Bacteria 1092
548 Ga0439460_0057115 3300042461 Bacteria 1183
549 Ga0466966_0112780 3300044684 Bacteria 1675
550 Ga0466963_0007515 3300044694 Bacteria 6503
551 Ga0451576_0061854 3300045051 Bacteria 3904
552 Ga0451576_0097441 3300045051 Bacteria 3058
553 Ga0451576_0224973 3300045051 Bacteria 1959
554 Ga0495617_106859 3300046452 Bacteria 907
555 Ga0495592_0000215 3300046454 Bacteria 49510
556 Ga0495592_0079791 3300046454 Bacteria 2368
557 Ga0495629_0219132 3300046459 Bacteria 1313
558 Ga0495629_0221345 3300046459 Bacteria 1305
559 Ga0495638_0129382 3300046460 Bacteria 1484
560 Ga0495641_0054103 3300046461 Bacteria 1824
561 Ga0495651_0000583 3300046462 Bacteria 28302
562 Ga0495651_0022639 3300046462 Bacteria 4884
563 Ga0495653_0000039 3300046463 Bacteria 119840
564 Ga0495582_0112097 3300046473 Bacteria 1532
565 Ga0495582_0267745 3300046473 Bacteria 980
566 Ga0495605_0123897 3300046474 Bacteria 1170
567 Ga0495639_0061719 3300046475 Bacteria 1719
568 Ga0495639_0228782 3300046475 Bacteria 916
569 Ga0495639_0271074 3300046475 Bacteria 842
570 Ga0495662_0011969 3300046476 Bacteria 4240
571 Ga0495662_0028292 3300046476 Bacteria 2706
572 Ga0495664_0000015 3300046477 Bacteria 192569
573 Ga0495594_0187710 3300046499 Bacteria 1177
574 Ga0495606_0008343 3300046507 Bacteria 9021
575 Ga0495606_0178162 3300046507 Bacteria 1228
576 Ga0495608_0000025 3300046511 Bacteria 158132
577 Ga0495608_0147782 3300046511 Bacteria 1498
578 Ga0495618_0000040 3300046514 Bacteria 98012
579 Ga0495628_0000011 3300046516 Bacteria 225267
580 Ga0495628_0021104 3300046516 Bacteria 5363
581 Ga0495630_0004483 3300046517 Bacteria 9789
582 Ga0495630_0073286 3300046517 Bacteria 2579
583 Ga0495630_0233462 3300046517 Bacteria 1406
584 Ga0495630_0381058 3300046517 Bacteria 1080
585 Ga0495644_0017579 3300046523 Bacteria 2734
586 Ga0495666_0024276 3300046526 Bacteria 2996
587 Ga0495652_0000014 3300046529 Bacteria 225484
588 Ga0495652_0212140 3300046529 Bacteria 1461
589 Ga0495652_0335705 3300046529 Bacteria 1087
590 Ga0495654_0003262 3300046530 Bacteria 10009
591 Ga0495640_0000008 3300046533 Bacteria 220320
592 Ga0495640_0009352 3300046533 Bacteria 7632
593 Ga0495640_0092168 3300046533 Bacteria 1999
594 Ga0495640_0325577 3300046533 Bacteria 951
595 Ga0495587_0000015 3300046536 Bacteria 187415
596 Ga0495587_0015850 3300046536 Bacteria 4698
597 Ga0495598_0000520 3300046537 Bacteria 7141
598 Ga0495598_0022216 3300046537 Bacteria 1696
599 Ga0495609_0120191 3300046538 Bacteria 1130
600 Ga0495621_0008029 3300046539 Bacteria 3147
601 Ga0495621_0042198 3300046539 Bacteria 1605
602 Ga0495645_0000020 3300046543 Bacteria 143867
603 Ga0495622_0092691 3300046557 Bacteria 1387
604 Ga0495633_0098707 3300046558 Bacteria 1356
605 Ga0495667_0000013 3300046559 Bacteria 220294
606 Ga0495656_0039320 3300046615 Bacteria 1964
607 Ga0495668_0091139 3300046616 Bacteria 1670
608 Ga0495634_0000415 3300046642 Bacteria 42260
609 Ga0495634_0028352 3300046642 Bacteria 3887
610 Ga0495611_0096668 3300046648 Bacteria 1368
611 Ga0495635_0000012 3300046663 Bacteria 225271
612 Ga0495635_0134781 3300046663 Bacteria 1683
613 Ga0495657_0000815 3300046675 Bacteria 27667
614 Ga0495657_0146719 3300046675 Bacteria 1467
615 Ga0495599_0000008 3300046678 Bacteria 225534
616 Ga0495599_0078357 3300046678 Bacteria 2063
617 Ga0495623_0000002 3300046679 Bacteria 166669
618 Ga0495646_0000004 3300046680 Bacteria 268993
619 Ga0495646_0049482 3300046680 Bacteria 2551
620 Ga0495647_0086365 3300046681 Bacteria 1280
621 Ga0495658_0155499 3300046683 Bacteria 1407
622 Ga0495613_0048557 3300046689 Bacteria 3134
623 Ga0495613_0078769 3300046689 Bacteria 2397
624 Ga0495624_0104410 3300046690 Bacteria 1744
625 Ga0495589_0052547 3300046794 Bacteria 2013
626 Ga0495600_0000024 3300046809 Bacteria 92414
627 Ga0495600_0097235 3300046809 Bacteria 1919
628 Ga0495581_0039756 3300047315 Bacteria 2723
629 Ga0495604_0000001 3300047317 Bacteria 708627
630 Ga0495604_0154591 3300047317 Bacteria 1626
631 Ga0495674_0000023 3300047319 Bacteria 157443
632 Ga0495676_0065149 3300047321 Bacteria 2829
633 Ga0495680_0003698 3300047322 Bacteria 14944
634 Ga0495675_0000392 3300047444 Bacteria 30250
635 Ga0495685_048693 3300047447 Bacteria 1441
636 Ga0495684_0000007 3300047471 Bacteria 225614
637 Ga0495684_0012287 3300047471 Bacteria 6605
638 Ga0495684_0181351 3300047471 Bacteria 1560
639 Ga0495686_0008971 3300047472 Bacteria 7259
640 Ga0495686_0010433 3300047472 Bacteria 6609
641 Ga0495593_0001189 3300047673 Bacteria 15218
642 Ga0495602_0000045 3300048088 Bacteria 118132
643 Ga0495602_0095585 3300048088 Bacteria 2452
644 Ga0495602_0375550 3300048088 Bacteria 1020
645 Ga0495614_0101363 3300048089 Bacteria 1259
646 Ga0495615_0024701 3300048090 Bacteria 1389
647 Ga0496100_0001068 3300048903 Bacteria 13197
648 Ga0496100_0020431 3300048903 Bacteria 3970
649 Ga0496100_0048326 3300048903 Bacteria 2746
650 Ga0496100_0404162 3300048903 Bacteria 1041
651 Ga0496101_0023314 3300048904 Bacteria 4274
652 Ga0496101_0048287 3300048904 Bacteria 3058
653 Ga0496101_0071082 3300048904 Bacteria 2550
654 Ga0496101_0147205 3300048904 Bacteria 1799
655 Ga0496102_0004311 3300048905 Bacteria 12031
656 Ga0496102_0006570 3300048905 Bacteria 9931
657 Ga0496102_0013773 3300048905 Bacteria 7015
658 Ga0496102_0027078 3300048905 Bacteria 5119
659 Ga0496102_0412539 3300048905 Bacteria 1269
660 Ga0496103_0018475 3300048906 Bacteria 4181
661 Ga0496103_0090265 3300048906 Bacteria 1933
662 Ga0496104_0000661 3300048907 Bacteria 29545
663 Ga0496104_0046961 3300048907 Bacteria 4069
664 Ga0496104_0051105 3300048907 Bacteria 3900
665 Ga0496104_0122314 3300048907 Bacteria 2498
666 Ga0496104_0135135 3300048907 Bacteria 2369
667 Ga0496104_0261587 3300048907 Bacteria 1643
668 Ga0496104_0604805 3300048907 Bacteria 1006
669 Ga0496104_0786924 3300048907 Bacteria 857
670 Ga0496105_0019801 3300048908 Bacteria 5429
671 Ga0496105_0032101 3300048908 Bacteria 4307
672 Ga0496105_0062086 3300048908 Bacteria 3084
673 Ga0496105_0168858 3300048908 Bacteria 1794
674 Ga0496105_0389394 3300048908 Bacteria 1108
675 Ga0496106_0006097 3300048909 Bacteria 8917
676 Ga0496106_0027107 3300048909 Bacteria 4267
677 Ga0496106_0055368 3300048909 Bacteria 2998
678 Ga0496106_0286275 3300048909 Bacteria 1321
679 Ga0496106_0454912 3300048909 Bacteria 1028
680 Ga0496107_0001451 3300048910 Bacteria 14662
681 Ga0496107_0094639 3300048910 Bacteria 2185
682 Ga0496107_0149933 3300048910 Bacteria 1724
683 Ga0496108_0002614 3300048911 Bacteria 14425
684 Ga0496108_0005866 3300048911 Bacteria 9956
685 Ga0496108_0016291 3300048911 Bacteria 6062
686 Ga0496108_0018324 3300048911 Bacteria 5733
687 Ga0496108_0209676 3300048911 Bacteria 1691
688 Ga0496108_0403308 3300048911 Bacteria 1194
689 Ga0496109_0000402 3300048912 Bacteria 39063
690 Ga0496109_0000629 3300048912 Bacteria 29391
691 Ga0496109_0002222 3300048912 Bacteria 16104
692 Ga0496109_0010095 3300048912 Bacteria 8056
693 Ga0496109_0250342 3300048912 Bacteria 1668
694 Ga0496110_0002519 3300048913 Bacteria 13766
695 Ga0496110_0235985 3300048913 Bacteria 1664
696 Ga0496110_0358056 3300048913 Bacteria 1329
697 Ga0496110_0689514 3300048913 Bacteria 922
698 Ga0496111_0004762 3300048914 Bacteria 8612
699 Ga0496111_0006001 3300048914 Bacteria 7845
700 Ga0496111_0014388 3300048914 Bacteria 5403
701 Ga0496111_0022216 3300048914 Bacteria 4438
702 Ga0496111_0076489 3300048914 Bacteria 2440
703 Ga0496112_0009347 3300048915 Bacteria 8824
704 Ga0496112_0059114 3300048915 Bacteria 3777
705 Ga0496112_0159660 3300048915 Bacteria 2221
706 Ga0496112_0361917 3300048915 Bacteria 1392
707 Ga0496112_0470126 3300048915 Bacteria 1195
708 Ga0496113_0002450 3300048916 Bacteria 10802
709 Ga0496113_0010086 3300048916 Bacteria 6231
710 Ga0496113_0012160 3300048916 Bacteria 5776
711 Ga0496114_0033372 3300048917 Bacteria 4241
712 Ga0496114_0074669 3300048917 Bacteria 2854
713 Ga0496114_0096431 3300048917 Bacteria 2518
714 Ga0496115_0054392 3300048918 Bacteria 3214
715 Ga0496115_0076213 3300048918 Bacteria 2725
716 Ga0496115_0105507 3300048918 Bacteria 2313
717 Ga0496115_0185614 3300048918 Bacteria 1718
718 Ga0496115_0335641 3300048918 Bacteria 1234
719 Ga0496115_0343695 3300048918 Bacteria 1217
720 Ga0496115_0483745 3300048918 Bacteria 996
721 Ga0496115_0498829 3300048918 Bacteria 978
722 Ga0496116_0015598 3300048919 Bacteria 5999
723 Ga0496116_0044773 3300048919 Bacteria 3002
724 Ga0496117_0091104 3300048920 Bacteria 1962
725 Ga0496117_0191181 3300048920 Bacteria 1166
726 Ga0496119_0182568 3300048922 Bacteria 1099
727 Ga0496121_0007746 3300048924 Bacteria 12872
728 Ga0496121_0064321 3300048924 Bacteria 2991
729 Ga0496121_0180521 3300048924 Bacteria 1524
730 Ga0496121_0246921 3300048924 Bacteria 1240
731 Ga0496122_0000042 3300048925 Bacteria 280482
732 Ga0496122_0035502 3300048925 Bacteria 4053
733 Ga0496123_0000030 3300048926 Bacteria 291764
734 Ga0496123_0004716 3300048926 Bacteria 14106
735 Ga0496123_0061708 3300048926 Bacteria 2406
736 Ga0496123_0110070 3300048926 Bacteria 1577
737 Ga0496124_0006891 3300048927 Bacteria 12213
738 Ga0496124_0144274 3300048927 Bacteria 1875
739 Ga0496124_0202090 3300048927 Bacteria 1510
740 Ga0496125_0018305 3300048928 Bacteria 6656
741 Ga0496126_0198157 3300048929 Bacteria 1697
742 Ga0501032_0029001 3300049569 Bacteria 3800
743 Ga0501032_0070411 3300049569 Bacteria 2332
744 Ga0501032_0118701 3300049569 Bacteria 1749
745 Ga0501033_0047501 3300049570 Bacteria 3191
746 Ga0501033_0053683 3300049570 Bacteria 2984
747 Ga0501033_0067066 3300049570 Bacteria 2639
748 Ga0501033_0111625 3300049570 Bacteria 1989
749 Ga0501033_0302774 3300049570 Bacteria 1125
750 Ga0501033_0463084 3300049570 Bacteria 880
751 Ga0501034_0010534 3300049571 Bacteria 9626
752 Ga0501034_0019606 3300049571 Bacteria 6915
753 Ga0501034_0096730 3300049571 Bacteria 2948
754 Ga0501034_0308485 3300049571 Bacteria 1518
755 Ga0501034_0313185 3300049571 Bacteria 1503
756 Ga0501034_0386195 3300049571 Bacteria 1324
757 Ga0501034_0420347 3300049571 Bacteria 1258
758 Ga0501034_0581451 3300049571 Bacteria 1027
759 Ga0501036_0003133 3300049572 Bacteria 13193
760 Ga0501036_0089064 3300049572 Bacteria 2607
761 Ga0501036_0386004 3300049572 Bacteria 1169
762 Ga0501037_0123244 3300049573 Bacteria 1862
763 Ga0501037_0165182 3300049573 Bacteria 1576
764 Ga0501037_0171955 3300049573 Bacteria 1539
765 Ga0501037_0264759 3300049573 Bacteria 1201
766 Ga0501037_0342647 3300049573 Bacteria 1032
767 Ga0501038_0018550 3300049574 Bacteria 6283
768 Ga0501038_0084361 3300049574 Bacteria 2673
769 Ga0501038_0087949 3300049574 Bacteria 2608
770 Ga0501038_0140975 3300049574 Bacteria 1972
771 Ga0501039_0038499 3300049575 Bacteria 3693
772 Ga0501039_0097174 3300049575 Bacteria 2297
773 Ga0501039_0097449 3300049575 Bacteria 2293
774 Ga0501039_0222933 3300049575 Bacteria 1482
775 Ga0501039_0642138 3300049575 Bacteria 831
776 Ga0501041_0067566 3300049577 Bacteria 2191
777 Ga0501042_0214649 3300049578 Bacteria 1388
778 Ga0501043_0002174 3300049579 Bacteria 16722
779 Ga0501043_0102192 3300049579 Bacteria 2253
780 Ga0501043_0120873 3300049579 Bacteria 2054
781 Ga0501046_0016092 3300049580 Bacteria 6272
782 Ga0501046_0090574 3300049580 Bacteria 2353
783 Ga0501047_0003356 3300049581 Bacteria 15165
784 Ga0501047_0036939 3300049581 Bacteria 4721
785 Ga0501047_0083623 3300049581 Bacteria 3067
786 Ga0501047_0167765 3300049581 Bacteria 2065
787 Ga0501048_0029604 3300049582 Bacteria 3969
788 Ga0501048_0074327 3300049582 Bacteria 2398
789 Ga0501067_0356555 3300049583 Bacteria 815
790 Ga0501068_0166386 3300049584 Bacteria 1391
791 Ga0501069_0081524 3300049585 Bacteria 1822
792 Ga0501070_0021600 3300049586 Bacteria 5398
793 Ga0501070_0028481 3300049586 Bacteria 4685
794 Ga0501070_0035001 3300049586 Bacteria 4197
795 Ga0501070_0117977 3300049586 Bacteria 2192
796 Ga0501070_0119685 3300049586 Bacteria 2176
797 Ga0501071_0022628 3300049587 Bacteria 4383
798 Ga0501071_0167416 3300049587 Bacteria 1645
799 Ga0501072_0021583 3300049588 Bacteria 4995
800 Ga0501072_0061204 3300049588 Bacteria 2968
801 Ga0501072_0064161 3300049588 Bacteria 2897
802 Ga0501072_0100980 3300049588 Bacteria 2293
803 Ga0501072_0128656 3300049588 Bacteria 2018
804 Ga0501073_0004247 3300049589 Bacteria 10743
805 Ga0501073_0066245 3300049589 Bacteria 2518
806 Ga0501073_0066345 3300049589 Bacteria 2516
807 Ga0501073_0121744 3300049589 Bacteria 1808
808 Ga0501074_0074802 3300049590 Bacteria 2432
809 Ga0501074_0114296 3300049590 Bacteria 1931
810 Ga0501074_0275379 3300049590 Bacteria 1196
811 Ga0501075_0012911 3300049591 Bacteria 5950
812 Ga0501075_0019474 3300049591 Bacteria 4923
813 Ga0501075_0068181 3300049591 Bacteria 2687
814 Ga0501075_0153807 3300049591 Bacteria 1754
815 Ga0501075_0292397 3300049591 Bacteria 1241
816 Ga0501076_0007181 3300049592 Bacteria 8098
817 Ga0501076_0042884 3300049592 Bacteria 3564
818 Ga0501076_0190723 3300049592 Bacteria 1672
819 Ga0501076_0316375 3300049592 Bacteria 1280
820 Ga0501077_0005783 3300049593 Bacteria 7533
821 Ga0501077_0372365 3300049593 Bacteria 912
822 Ga0501079_0006499 3300049741 Bacteria 8781
823 Ga0501079_0098973 3300049741 Bacteria 2260
824 Ga0501079_0120829 3300049741 Bacteria 2037
825 Ga0501079_0122792 3300049741 Bacteria 2020
826 Ga0501079_0138006 3300049741 Bacteria 1899
827 Ga0501080_0015977 3300049742 Bacteria 6925
828 Ga0501080_0037519 3300049742 Bacteria 4527
829 Ga0501080_0147220 3300049742 Bacteria 2177
830 Ga0501080_0222919 3300049742 Bacteria 1725
831 Ga0501080_0241733 3300049742 Bacteria 1648
832 Ga0501080_0286991 3300049742 Bacteria 1495
833 Ga0501080_0401704 3300049742 Bacteria 1233
834 Ga0501081_0010912 3300049743 Bacteria 5938
835 Ga0501081_0063673 3300049743 Bacteria 2560
836 Ga0501081_0209760 3300049743 Bacteria 1414
837 Ga0501083_0041219 3300049744 Bacteria 3131
838 Ga0501083_0044636 3300049744 Bacteria 3000
839 Ga0501083_0056277 3300049744 Bacteria 2636
840 Ga0501083_0089133 3300049744 Bacteria 2039
841 Ga0501083_0121900 3300049744 Bacteria 1710
842 Ga0501083_0182695 3300049744 Bacteria 1369
843 Ga0501035_0018680 3300049822 Bacteria 6386
844 Ga0501035_0059223 3300049822 Bacteria 3410
845 Ga0501035_0096264 3300049822 Bacteria 2601
846 Ga0501044_0012550 3300049823 Bacteria 9177
847 Ga0501044_0026844 3300049823 Bacteria 6095
848 Ga0501044_0138273 3300049823 Bacteria 2425
849 Ga0501044_0186254 3300049823 Bacteria 2040
850 Ga0501044_0202811 3300049823 Bacteria 1941
851 Ga0501044_0231594 3300049823 Bacteria 1794
852 Ga0501044_0397934 3300049823 Bacteria 1290
853 Ga0501044_0466509 3300049823 Bacteria 1167
854 Ga0501045_0067577 3300049824 Bacteria 2625
855 Ga0501045_0482668 3300049824 Bacteria 921
856 nmdc:mga03683_230033_c1 3300050489 Bacteria 857
857 nmdc:mga03683_24008_c1 3300050489 Bacteria 2382
858 nmdc:mga03683_30505_c1 3300050489 Bacteria 2158
859 nmdc:mga03683_9239_c1 3300050489 Bacteria 3498
860 nmdc:mga00v17_164611_c1 3300050491 Bacteria 1429
861 nmdc:mga00v17_272282_c1 3300050491 Bacteria 1099
862 nmdc:mga00v17_499337_c1 3300050491 Bacteria 789
863 nmdc:mga00v17_73809_c1 3300050491 Bacteria 2119
864 nmdc:mga0k408_36688_c1 3300050493 Bacteria 2814
865 nmdc:mga06z11_193676_c1 3300050494 Bacteria 1178
866 nmdc:mga06z11_313107_c1 3300050494 Bacteria 935
867 nmdc:mga06z11_624_c1 3300050494 Bacteria 12880
868 nmdc:mga06z11_6651_c1 3300050494 Bacteria 4723
869 nmdc:mga07m45_112183_c1 3300050496 Bacteria 1571
870 nmdc:mga07m45_226293_c1 3300050496 Bacteria 1088
871 nmdc:mga05p37_138365_c1 3300050507 Bacteria 2984
872 nmdc:mga05p37_14344_c1 3300050507 Bacteria 9514
873 nmdc:mga05p37_236590_c1 3300050507 Bacteria 2198
874 nmdc:mga05p37_336128_c1 3300050507 Bacteria 1782
875 nmdc:mga05p37_464861_c1 3300050507 Bacteria 1461
876 nmdc:mga05p37_52_c1 3300050507 Bacteria 102932
877 nmdc:mga05p37_79819_c1 3300050507 Bacteria 4029
878 nmdc:mga09592_467986_c1 3300050508 Bacteria 1087
879 nmdc:mga09592_473848_c1 3300050508 Bacteria 1079
880 nmdc:mga09592_58183_c1 3300050508 Bacteria 3269
881 nmdc:mga0qj67_212290_c1 3300050509 Bacteria 1572
882 nmdc:mga0qj67_277289_c1 3300050509 Bacteria 1359
883 nmdc:mga0qj67_29384_c1 3300050509 Bacteria 4270
884 nmdc:mga0qj67_96526_c1 3300050509 Bacteria 2379
885 nmdc:mga06r32_128381_c1 3300050510 Bacteria 2505
886 nmdc:mga06r32_141034_c1 3300050510 Bacteria 2386
887 nmdc:mga06r32_19837_c1 3300050510 Bacteria 6178
888 nmdc:mga06r32_33635_c1 3300050510 Bacteria 4829
889 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
890 nmdc:mga06r32_53650_c1 3300050510 Bacteria 3863
891 nmdc:mga06r32_54301_c1 3300050510 Bacteria 3841
892 nmdc:mga06r32_70968_c1 3300050510 Bacteria 3370
893 nmdc:mga08y16_104210_c1 3300050511 Bacteria 2953
894 nmdc:mga08y16_12764_c1 3300050511 Bacteria 8840
895 nmdc:mga08y16_23571_c1 3300050511 Bacteria 6501
896 nmdc:mga08y16_343388_c2 3300050511 Bacteria 1239
897 nmdc:mga08y16_60153_c1 3300050511 Bacteria 3968
898 nmdc:mga08y16_822_c1 3300050511 Bacteria 29788
899 nmdc:mga0n895_159895_c1 3300050512 Bacteria 2284
900 nmdc:mga0n895_20493_c1 3300050512 Bacteria 6168
901 nmdc:mga0n895_374941_c1 3300050512 Bacteria 1440
902 nmdc:mga0n895_39420_c1 3300050512 Bacteria 4583
903 nmdc:mga0n895_479195_c1 3300050512 Bacteria 1255
904 nmdc:mga0n895_66950_c1 3300050512 Bacteria 3556
905 nmdc:mga0rr50_35335_c1 3300050513 Bacteria 3588
906 nmdc:mga0rr50_58880_c2 3300050513 Bacteria 2232
907 nmdc:mga0rr50_8215_c1 3300050513 Bacteria 6485
908 nmdc:mga08x19_7802_c1 3300050514 Bacteria 6358
909 nmdc:mga08x19_96665_c1 3300050514 Bacteria 1955
910 nmdc:mga0a205_100676_c1 3300050515 Bacteria 2788
911 nmdc:mga0a205_149514_c1 3300050515 Bacteria 2236
912 nmdc:mga0a205_423703_c1 3300050515 Bacteria 1193
913 nmdc:mga0sz30_111115_c1 3300050516 Bacteria 1201
914 nmdc:mga0sz30_1180_c1 3300050516 Bacteria 9356
915 nmdc:mga0sz30_15974_c1 3300050516 Bacteria 2972
916 Ga0495601_0000014 3300053077 Bacteria 220318
917 Ga0495601_0064093 3300053077 Bacteria 2336
918 Ga0495601_0093164 3300053077 Bacteria 1940
919 Ga0495601_0134966 3300053077 Bacteria 1608
920 Ga0495601_0225789 3300053077 Bacteria 1223
921 Ga0495612_0000014 3300053078 Bacteria 187444
922 Ga0495595_0000038 3300053084 Bacteria 70955
923 Ga0495595_0004030 3300053084 Bacteria 5878
924 Ga0495595_0010247 3300053084 Bacteria 3892
925 Ga0495595_0074538 3300053084 Bacteria 1609
926 Ga0495619_0000006 3300053085 Bacteria 384835
927 Ga0495619_0075710 3300053085 Bacteria 2259
928 Ga0495619_0077125 3300053085 Bacteria 2238
929 Ga0495619_0180958 3300053085 Bacteria 1458
930 Ga0495619_0231760 3300053085 Bacteria 1279
931 Ga0500643_010040 3300053087 Bacteria 3562
932 Ga0500644_0004361 3300053088 Bacteria 3538
933 Ga0500651_0066125 3300053093 Bacteria 2252
934 Ga0500566_0008714 3300053094 Bacteria 6001
935 Ga0500641_0001762 3300053096 Bacteria 7667
936 Ga0500641_0008450 3300053096 Bacteria 3674
937 Ga0500562_006316 3300053108 Bacteria 2989
938 Ga0500593_029191 3300053117 Bacteria 2464
939 Ga0500595_000029 3300053119 Bacteria 122318
940 Ga0500618_001534 3300053125 Bacteria 10130
941 Ga0500618_004196 3300053125 Bacteria 4687
942 Ga0500652_005799 3300053131 Bacteria 3924
943 Ga0500568_0037136 3300053139 Bacteria 1978
944 Ga0500568_0039564 3300053139 Bacteria 1903
945 Ga0500616_0000006 3300053153 Bacteria 944738
946 Ga0500616_0001264 3300053153 Bacteria 25261
947 Ga0500616_0005830 3300053153 Bacteria 8254
948 Ga0500616_0058602 3300053153 Bacteria 2003
949 Ga0500616_0061300 3300053153 Bacteria 1948
950 Ga0500622_0013242 3300053156 Bacteria 4451
951 Ga0500622_0039088 3300053156 Bacteria 2474
952 Ga0500627_0183364 3300053158 Bacteria 941
953 Ga0500645_000290 3300053730 Bacteria 36019
954 Ga0500645_030286 3300053730 Bacteria 1629
955 Ga0501084_0003507 3300054114 Bacteria 12748
956 Ga0501084_0074174 3300054114 Bacteria 2849
957 Ga0501084_0124559 3300054114 Bacteria 2168
958 Ga0501084_0196063 3300054114 Bacteria 1704
959 Ga0501084_0254920 3300054114 Bacteria 1481
960 Ga0501084_0285121 3300054114 Bacteria 1395
961 Ga0501084_0321559 3300054114 Bacteria 1307
962 Ga0501084_0758671 3300054114 Bacteria 817
963 Ga0501082_0017594 3300060353 Bacteria 6156
964 Ga0501082_0064266 3300060353 Bacteria 3161
965 Ga0501082_0087994 3300060353 Bacteria 2680
966 Ga0501082_0123907 3300060353 Bacteria 2241
967 Ga0501082_0195979 3300060353 Bacteria 1757
968 Ga0501082_0633011 3300060353 Bacteria 936
969 Ga0530510_0038632 3300061734 Bacteria 3446
970 Ga0530510_0073482 3300061734 Bacteria 2482
971 Ga0530510_0223769 3300061734 Bacteria 1399
972 Ga0530510_0451419 3300061734 Bacteria 972
973 2513657505 2513237096 Bacteria 8722461
974 2513861167 2513237137 Bacteria 9558895
975 2513916758 2513237145 Bacteria 8979722
976 2517889666 2517572143 Bacteria 9484767
977 2523468588 2523231067 Bacteria 5230452
978 2535518249 2534681796 Bacteria 7146037
979 2585259155 2582581304 Bacteria 5831370
980 2599105567 2597490356 Bacteria 7030811
981 2599722274 2599185236 Bacteria 6875203
982 2600373981 2600254933 Bacteria 4750527
983 2644290457 2643221651 Bacteria 4798932
984 2644729330 2643221733 Bacteria 5690728
985 2644737238 2643221734 Bacteria 5365412
986 2644747621 2643221736 Bacteria 6608466
987 2671119517 2667528175 Bacteria 7532676
988 2671695228 2671180139 Bacteria 4196045
989 2738944237 2738541317 Bacteria 5340176
990 2739352064 2738543031 Bacteria 5769731
991 2793070354 2791355197 Bacteria 8420563
992 2819718035 2818991467 Bacteria 5893227
993 2821125926 2821123053 Bacteria 7836056
994 2821444341 2821443989 Bacteria 7658172
995 2838737597 2838736955 Bacteria 5760694
996 2841761508 2841760612 Bacteria 6454112
997 2841842034 2841840854 Bacteria 5761912
998 2841913491 2841911363 Bacteria 6173697
999 2841919238 2841917233 Bacteria 6173500
1000 2842141813 2842140634 Bacteria 5759631
1001 2842314201 2842311132 Bacteria 6616990
1002 2844104533 2844104063 Bacteria 6440972
1003 2844538193 2844533157 Bacteria 7517899
1004 2846954747 2846952575 Bacteria 6587527
1005 2848858985 2848858292 Bacteria 7391279
1006 2851184567 2851182111 Bacteria 6047226
1007 2851247521 2851246043 Bacteria 6439203
1008 2857532488 2857531043 Bacteria 6754041
1009 2883354942 2883354860 Bacteria 5865246
1010 2885380853 2885374607 Bacteria 8927485
1011 2894773702 2894772417 Bacteria 5305674
1012 2903754701 2903748898 Bacteria 9972761
1013 2904692036 2904690495 Bacteria 9412302
1014 2904707577
1015 2906614643
1016 2906641948 2906635258 Bacteria 8601019
1017 2906660966 2906660503 Bacteria 8595048
1018 2908746534 2908739725 Bacteria 8628932
1019 2908757315 2908756301 Bacteria 8864324
1020 2909046292 2909042592 Bacteria 6499737
1021 2913308857 2913308742 Bacteria 5350706
1022 2917556169 2917554339 Bacteria 4987857
1023 2917700501 2917699015 Bacteria 7043791
1024 2920827904 2920822456 Bacteria 6897201
1025 2922426504
1026 2935632846 2935630451 Bacteria 8169952
1027 2939672806 2939669807 Bacteria 5028511
1028 2941508489 2941507105 Bacteria 8166816
1029 2941516320 2941515067 Bacteria 8166720
1030 2941524664 2941523033 Bacteria 8169134
1031 3005475847 3005474847 Bacteria 9259049
1032 8005549139 8005542996 Bacteria 7077758
1033 8006937164 8006933436 Bacteria 10410654
1034 8006977174 8006973647 Bacteria 10679141
1035 8019561494 8019555841 Bacteria 9642137
1036 8019571569 8019565922 Bacteria 9639779
1037 8056690782 8056689827 Bacteria 6712655
1038 8057530309 8057529695 Bacteria 6306553
1039 Ga0496122_0028821
1040 JGI25152J39213_1002271
1041 JGI25150J39212_1000091
1042 JGI25159J45721_1006205
1043 JGI25159J45721_1029362
1044 JGI25151J46595_10000027
1045 JGI25151J46595_10000079
1046 JGI25151J46595_10000166
1047 JGI25406J46586_10001744
1048 JGI25406J46586_10099659
1049 JGI25153J46596_10023417
1050 rootH1_10001360
1051 JGI25160J50197_1008772
1052 JGI25404J52841_10025863
1053 Ga0055526_1001798
1054 Ga0055526_1004200
1055 Ga0055524_1000147
1056 Ga0065165_1000359
1057 Ga0065715_10409333
1058 Ga0070658_10250365
1059 Ga0070676_10264661
1060 Ga0070676_10361287
1061 Ga0070683_100529884
1062 Ga0070670_100000279
1063 Ga0070670_100023610
1064 Ga0070670_100084216
1065 Ga0068869_100350047
1066 Ga0070666_10208641
1067 Ga0070680_100023161
1068 Ga0070660_100435979
1069 Ga0070689_100009551
1070 Ga0070689_100122295
1071 Ga0070689_100177604
1072 Ga0070689_100243838
1073 Ga0070689_100348901
1074 Ga0070691_10005254
1075 Ga0070691_10015821
1076 Ga0070661_100080243
1077 Ga0070692_10233535
1078 Ga0070668_100085337
1079 Ga0070668_100487865
1080 Ga0070669_100461875
1081 Ga0070675_100052858
1082 Ga0070675_100181614
1083 Ga0070675_100392747
1084 Ga0070671_100018362
1085 Ga0070671_100088490
1086 Ga0070674_100017992
1087 Ga0070674_100084622
1088 Ga0070673_100027881
1089 Ga0070673_100121720
1090 Ga0070673_100159919
1091 Ga0070673_100285515
1092 Ga0070673_100404278
1093 Ga0070688_100216810
1094 Ga0070688_100323241
1095 Ga0070667_100089336
1096 Ga0070667_100100209
1097 Ga0070667_100390358
1098 Ga0070703_10015829
1099 Ga0070709_10011341
1100 Ga0070709_10068928
1101 Ga0070714_100017392
1102 Ga0070713_100007558
1103 Ga0070713_100015955
1104 Ga0070713_100078485
1105 Ga0070713_100169172
1106 Ga0070713_100236946
1107 Ga0070713_100504704
1108 Ga0070713_100636344
1109 Ga0070710_10007309
1110 Ga0070711_100041309
1111 Ga0070711_100120718
1112 Ga0070711_100243353
1113 Ga0070705_100000010
1114 Ga0070700_100012029
1115 Ga0070700_100036015
1116 Ga0070700_100100414
1117 Ga0070694_100007490
1118 Ga0070694_100301901
1119 Ga0070708_100031895
1120 Ga0070708_100319002
1121 Ga0070708_100432891
1122 Ga0070678_100139537
1123 Ga0070678_100145528
1124 Ga0070681_10037097
1125 Ga0068867_100140308
1126 Ga0068867_100370305
1127 Ga0070706_100083039
1128 Ga0070707_100008667
1129 Ga0070707_100180491
1130 Ga0070707_100473022
1131 Ga0070698_100001583
1132 Ga0070698_100081261
1133 Ga0070698_100143789
1134 Ga0070699_100001267
1135 Ga0070699_100032052
1136 Ga0070699_100097779
1137 Ga0070699_100133004
1138 Ga0070699_100156092
1139 Ga0070679_100069394
1140 Ga0070697_100019537
1141 Ga0070697_100123050
1142 Ga0070672_100080702
1143 Ga0070672_100729529
1144 Ga0070686_100081658
1145 Ga0070686_100206694
1146 Ga0070695_100001386
1147 Ga0070695_100015958
1148 Ga0070696_100000088
1149 Ga0070665_100164933
1150 Ga0070665_100303739
1151 Ga0070665_100424985
1152 Ga0070704_100007022
1153 Ga0070704_100174015
1154 Ga0070704_100242386
1155 Ga0068855_100014613
1156 Ga0068855_100335274
1157 Ga0070664_100091744
1158 Ga0068857_100025585
1159 Ga0068857_100085007
1160 Ga0068854_100131782
1161 Ga0068856_100874584
1162 Ga0068852_100164725
1163 Ga0068859_100029774
1164 Ga0068859_101024518
1165 Ga0068864_100393132
1166 Ga0068864_100414815
1167 Ga0068861_100086515
1168 Ga0068861_100175826
1169 Ga0068863_100108341
1170 Ga0068858_100317367
1171 Ga0068860_100023745
1172 Ga0068860_100032520
1173 Ga0068860_100090932
1174 Ga0068862_100000484
1175 Ga0068862_100145573
1176 Ga0081455_10000142
1177 Ga0081455_10003539
1178 Ga0081455_10022523
1179 Ga0081455_10028348
1180 Ga0081455_10092343
1181 Ga0081455_10107042
1182 Ga0081455_10132533
1183 Ga0081455_10206962
1184 Ga0081455_10299363
1185 Ga0081538_10019181
1186 Ga0081538_10025164
1187 Ga0081540_1006595
1188 Ga0081540_1009132
1189 Ga0081540_1012474
1190 Ga0081540_1029277
1191 Ga0081540_1030263
1192 Ga0081539_10000598
1193 Ga0081539_10003011
1194 Ga0081539_10016306
1195 Ga0081539_10016697
1196 Ga0081539_10024885
1197 Ga0081539_10036208
1198 Ga0081539_10168260
1199 Ga0070717_10006086
1200 Ga0070717_10014983
1201 Ga0070717_10037023
1202 Ga0070717_10244127
1203 Ga0075365_10164699
1204 Ga0075368_10018439
1205 Ga0075368_10120999
1206 Ga0075363_100063912
1207 Ga0075364_10162832
1208 Ga0075364_10319755
1209 Ga0075432_10023298
1210 Ga0070715_10001945
1211 Ga0070716_100003460
1212 Ga0070712_100015104
1213 Ga0070712_100133119
1214 Ga0070712_100137693
1215 Ga0070712_100264860
1216 Ga0070712_100594810
1217 Ga0075362_10002893
1218 Ga0075362_10009224
1219 Ga0075362_10013500
1220 Ga0075362_10031084
1221 Ga0075362_10098682
1222 Ga0075367_10002514
1223 Ga0075367_10016000
1224 Ga0075367_10153996
1225 Ga0075367_10196933
1226 Ga0075367_10229795
1227 Ga0075369_10012084
1228 Ga0075369_10041829
1229 Ga0075369_10117757
1230 Ga0075369_10202814
1231 Ga0075366_10086007
1232 Ga0097621_100207379
1233 Ga0075370_10100700
1234 Ga0075370_10191072
1235 Ga0075370_10208135
1236 Ga0075370_10312911
1237 Ga0075428_100028809
1238 Ga0075428_100105515
1239 Ga0075428_100440420
1240 Ga0075430_100296789
1241 Ga0075431_100000021
1242 Ga0075431_100004278
1243 Ga0075431_100013599
1244 Ga0075431_100157342
1245 Ga0075431_100186346
1246 Ga0075431_100225890
1247 Ga0075431_100329007
1248 Ga0075431_100627653
1249 Ga0075433_10098961
1250 Ga0075434_100003287
1251 Ga0075434_100039117
1252 Ga0075434_100041218
1253 Ga0075434_100077231
1254 Ga0075434_100361856
1255 Ga0075429_100044422
1256 Ga0075429_100382333
1257 Ga0068865_100230699
1258 Ga0075436_100151402
1259 Ga0075436_100189908
1260 Ga0097620_100029774
1261 Ga0097620_101024563
1262 Ga0079104_1000015
1263 Ga0075435_100005120
1264 Ga0075435_100146468
1265 Ga0099794_10013033
1266 Ga0099795_10008633
1267 Ga0099795_10019938
1268 Ga0105240_10270653
1269 Ga0111539_10000144
1270 Ga0111539_10002369
1271 Ga0111539_10031200
1272 Ga0111539_10403564
1273 Ga0111539_11073817
1274 Ga0105245_10125795
1275 Ga0105245_10229000
1276 Ga0105245_10380909
1277 Ga0114129_10000068
1278 Ga0114129_10021135
1279 Ga0114129_10189744
1280 Ga0114129_10414122
1281 Ga0114129_10743083
1282 Ga0114129_10872792
1283 Ga0114129_10884235
1284 Ga0114129_10902828
1285 Ga0114129_10902838
1286 Ga0105243_10376761
1287 Ga0105243_10738458
1288 Ga0105241_10467356
1289 Ga0105242_10093354
1290 Ga0105242_10960898
1291 Ga0105248_10002224
1292 Ga0105248_10044373
1293 Ga0105248_10157928
1294 Ga0105237_10069708
1295 Ga0105238_10048111
1296 Ga0105249_10229647
1297 Ga0105249_10387069
1298 Ga0105033_102692
1299 Ga0099796_10022692
1300 Ga0105239_10297453
1301 Ga0105239_10471574
1302 Ga0105246_10038956
1303 Ga0105246_10095777
1304 Ga0105246_10216201
1305 Ga0157370_10077887
1306 Ga0157370_10235815
1307 Ga0171462_1033
1308 Ga0157378_10483374
1309 Ga0163162_10353761
1310 Ga0163162_10681032
1311 Ga0157372_10492060
1312 Ga0157375_10826313
1313 Ga0157375_10979236
1314 Ga0163163_10013174
1315 Ga0163163_10054559
1316 Ga0163163_10103655
1317 Ga0157380_10013643
1318 Ga0157380_10083652
1319 Ga0182008_10240141
1320 Ga0157379_10255654
1321 Ga0157376_10267225
1322 Ga0157376_10544235
1323 Ga0163161_10127281
1324 Ga0213872_10022142
1325 Ga0213874_10048881
1326 Ga0213874_10102494
1327 Ga0213876_10069114
1328 Ga0213875_10000003
1329 Ga0213875_10024691
1330 Ga0213871_10034354
1331 Ga0224572_1002024
1332 Ga0224572_1014579
1333 Ga0228598_1000419
1334 Ga0207425_1000043
1335 Ga0209148_1000409
1336 Ga0209129_1000072
1337 Ga0209455_1003530
1338 Ga0209673_1008478
1339 Ga0209130_1000062
1340 Ga0209130_1000709
1341 Ga0209675_1001144
1342 Ga0209025_1000014
1343 Ga0209025_1000053
1344 Ga0209025_1000120
1345 Ga0209025_1001382
1346 Ga0209025_1083642
1347 Ga0209564_1000017
1348 Ga0209564_1000179
1349 Ga0209758_1000111
1350 Ga0209758_1013103
1351 Ga0209758_1033923
1352 Ga0209256_1000055
1353 Ga0209256_1000338
1354 Ga0207426_1000198
1355 Ga0207653_10000769
1356 Ga0207653_10018899
1357 Ga0207682_10005803
1358 Ga0207692_10073342
1359 Ga0207692_10087619
1360 Ga0207680_10069321
1361 Ga0207685_10023843
1362 Ga0207699_10042426
1363 Ga0207699_10060836
1364 Ga0207645_10022003
1365 Ga0207645_10023566
1366 Ga0207645_10310123
1367 Ga0207705_10073083
1368 Ga0207684_10012764
1369 Ga0207684_10064422
1370 Ga0207684_10628330
1371 Ga0207654_10213948
1372 Ga0207707_10028651
1373 Ga0207707_10043901
1374 Ga0207671_10463348
1375 Ga0207693_10008787
1376 Ga0207693_10011224
1377 Ga0207693_10038993
1378 Ga0207693_10051541
1379 Ga0207663_10121066
1380 Ga0207660_10067897
1381 Ga0207660_10148505
1382 Ga0207662_10030972
1383 Ga0207662_10149530
1384 Ga0207657_10426457
1385 Ga0207652_10062321
1386 Ga0207646_10080961
1387 Ga0207646_10172631
1388 Ga0207646_10277428
1389 Ga0207694_10084760
1390 Ga0207694_10162699
1391 Ga0207650_10001249
1392 Ga0207650_10014724
1393 Ga0207650_10056311
1394 Ga0207659_10141312
1395 Ga0207659_10299453
1396 Ga0207700_10295286
1397 Ga0207700_10391472
1398 Ga0207700_10615847
1399 Ga0207700_10712926
1400 Ga0207664_10053126
1401 Ga0207664_10173182
1402 Ga0207664_10214617
1403 Ga0207644_10109029
1404 Ga0207644_10141114
1405 Ga0207644_10308945
1406 Ga0207690_10416850
1407 Ga0207706_10074009
1408 Ga0207706_10113277
1409 Ga0207686_10039863
1410 Ga0207670_10007806
1411 Ga0207670_10117725
1412 Ga0207670_10243787
1413 Ga0207669_10117172
1414 Ga0207669_10312823
1415 Ga0207704_10041999
1416 Ga0207704_10086786
1417 Ga0207665_10001158
1418 Ga0207665_10282026
1419 Ga0207691_10013601
1420 Ga0207691_10429730
1421 Ga0207711_10026007
1422 Ga0207711_10353912
1423 Ga0207689_10044976
1424 Ga0207689_10099359
1425 Ga0207661_10224689
1426 Ga0207679_10085271
1427 Ga0207679_10089941
1428 Ga0207667_10031391
1429 Ga0207667_10092398
1430 Ga0207651_10169012
1431 Ga0207651_10340736
1432 Ga0207651_10386343
1433 Ga0207712_10002216
1434 Ga0207668_10190943
1435 Ga0207640_10339542
1436 Ga0207658_10435541
1437 Ga0207678_10023593
1438 Ga0207678_10439656
1439 Ga0207708_10017542
1440 Ga0207708_10048742
1441 Ga0207641_10014731
1442 Ga0207641_10204658
1443 Ga0207648_10082512
1444 Ga0207676_10027399
1445 Ga0207676_10064821
1446 Ga0207676_10178642
1447 Ga0207676_10601388
1448 Ga0207674_10030214
1449 Ga0207674_10199602
1450 Ga0207675_100007776
1451 Ga0207675_100065357
1452 Ga0207675_100344822
1453 Ga0207683_10028550
1454 Ga0207683_10175736
1455 Ga0207698_10109983
1456 Ga0209281_1000068
1457 Ga0209813_10014359
1458 Ga0207428_10017003
1459 Ga0207428_10065916
1460 Ga0207428_10105752
1461 Ga0268266_10131354
1462 Ga0268265_10002000
1463 Ga0268264_10010737
1464 Ga0268264_10139049
1465 Ga0268264_10180670
1466 Ga0268264_10333435
1467 Ga0265334_10021574
1468 Ga0265332_10007414
1469 Ga0265325_10073043
1470 Ga0265329_10012383
1471 Ga0265340_10006482
1472 Ga0265340_10046962
1473 Ga0265340_10048202
1474 Ga0265340_10074224
1475 Ga0265340_10167322
1476 Ga0265339_10000228
1477 Ga0265339_10000979
1478 Ga0265316_10138840
1479 Ga0307408_100091887
1480 Ga0265313_10000203
1481 Ga0265313_10065718
1482 Ga0265314_10059523
1483 Ga0265314_10085870
1484 Ga0265342_10000031
1485 Ga0265342_10052343
1486 Ga0265342_10063046
1487 Ga0265342_10149924
1488 Ga0307405_10001622
1489 Ga0307405_10139289
1490 Ga0316577_10135820
1491 Ga0307412_10811041
1492 Ga0307409_100126626
1493 Ga0307409_100146055
1494 Ga0307416_100586609
1495 Ga0307416_100613816
1496 Ga0307414_10578075
1497 Ga0307411_10633182
1498 Ga0307510_10264577
1499 Ga0373926_0072478
1500 Ga0373926_0106287
1501 Ga0373944_0002788
1502 Ga0373923_0002956
1503 Ga0373923_0075736
1504 Ga0373932_0091684
1505 Ga0373936_0035197
1506 Ga0373941_0007246
1507 Ga0373941_0232525
1508 Ga0373945_0036567
1509 Ga0373953_0001366
1510 Ga0373953_0006528
1511 Ga0373954_0002877
1512 Ga0373954_0100018
1513 Ga0373956_0040275
1514 Ga0373956_0047793
1515 Ga0373943_0047398
1516 Ga0373943_0069017
1517 Ga0373943_0096100
1518 Ga0373946_0007164
1519 Ga0373946_0127361
1520 Ga0373955_0000220
1521 Ga0373955_0118078
1522 Ga0373924_0058990
1523 Ga0373931_0113163
1524 Ga0373931_0131277
1525 Ga0373931_0449716
1526 Ga0373935_0000227
1527 Ga0373935_0186763
1528 Ga0373935_0203394
1529 Ga0373927_0076509
1530 Ga0373933_0005475
1531 Ga0373947_0000216
1532 Ga0373947_0090952
1533 Ga0373947_0191222
1534 Ga0373937_0000003
1535 Ga0373937_0036084
1536 Ga0373925_0000118
1537 Ga0373925_0101412
1538 Ga0373925_0109802
1539 Ga0373925_0241631
1540 Ga0395899_0050936
1541 Ga0395900_0016637
1542 Ga0395900_0109235
1543 Ga0395900_0254397
1544 Ga0395898_0009907
1545 Ga0395898_0031164
1546 Ga0436364_0023609
1547 Ga0436364_0772610
1548 Ga0436364_0935904
1549 Ga0436364_0960990
1550 Ga0436364_1074351
1551 Ga0436364_1359778
1552 Ga0436364_1363918
1553 Ga0436364_1377062
1554 Ga0436364_1406972
1555 Ga0395901_0084030
1556 Ga0395901_0114185
1557 Ga0395901_0688391
1558 Ga0436365_0699198
1559 Ga0436365_0992290
1560 Ga0436365_1269647
1561 Ga0436365_1438404
1562 Ga0436365_1619444
1563 Ga0436365_1620720
1564 Ga0436365_1753369
1565 Ga0436365_1788190
1566 Ga0436360_0309149
1567 Ga0436360_0413491
1568 Ga0436360_1133561
1569 Ga0436360_1234148
1570 Ga0436361_0185672
1571 Ga0436361_0914590
1572 Ga0436361_1014188
1573 Ga0436363_0578409
1574 Ga0436363_0769764
1575 Ga0436363_1140198
1576 Ga0436363_1200244
1577 Ga0436363_1623736
1578 Ga0436362_0257423
1579 Ga0436362_0546702
1580 Ga0436362_1178242
1581 Ga0439453_0001364
1582 Ga0439431_0017193
1583 Ga0439441_019221
1584 Ga0439445_0071863
1585 Ga0439459_0030659
1586 Ga0439460_0057115
1587 Ga0466966_0112780
1588 Ga0466963_0007515
1589 Ga0451576_0061854
1590 Ga0451576_0097441
1591 Ga0451576_0224973
1592 Ga0495617_106859
1593 Ga0495592_0000215
1594 Ga0495592_0079791
1595 Ga0495629_0219132
1596 Ga0495629_0221345
1597 Ga0495638_0129382
1598 Ga0495641_0054103
1599 Ga0495651_0000583
1600 Ga0495651_0022639
1601 Ga0495653_0000039
1602 Ga0495582_0112097
1603 Ga0495582_0267745
1604 Ga0495605_0123897
1605 Ga0495639_0061719
1606 Ga0495639_0228782
1607 Ga0495639_0271074
1608 Ga0495662_0011969
1609 Ga0495662_0028292
1610 Ga0495664_0000015
1611 Ga0495594_0187710
1612 Ga0495606_0008343
1613 Ga0495606_0178162
1614 Ga0495608_0000025
1615 Ga0495608_0147782
1616 Ga0495618_0000040
1617 Ga0495628_0000011
1618 Ga0495628_0021104
1619 Ga0495630_0004483
1620 Ga0495630_0073286
1621 Ga0495630_0233462
1622 Ga0495630_0381058
1623 Ga0495644_0017579
1624 Ga0495666_0024276
1625 Ga0495652_0000014
1626 Ga0495652_0212140
1627 Ga0495652_0335705
1628 Ga0495654_0003262
1629 Ga0495640_0000008
1630 Ga0495640_0009352
1631 Ga0495640_0092168
1632 Ga0495640_0325577
1633 Ga0495587_0000015
1634 Ga0495587_0015850
1635 Ga0495598_0000520
1636 Ga0495598_0022216
1637 Ga0495609_0120191
1638 Ga0495621_0008029
1639 Ga0495621_0042198
1640 Ga0495645_0000020
1641 Ga0495622_0092691
1642 Ga0495633_0098707
1643 Ga0495667_0000013
1644 Ga0495656_0039320
1645 Ga0495668_0091139
1646 Ga0495634_0000415
1647 Ga0495634_0028352
1648 Ga0495611_0096668
1649 Ga0495635_0000012
1650 Ga0495635_0134781
1651 Ga0495657_0000815
1652 Ga0495657_0146719
1653 Ga0495599_0000008
1654 Ga0495599_0078357
1655 Ga0495623_0000002
1656 Ga0495646_0000004
1657 Ga0495646_0049482
1658 Ga0495647_0086365
1659 Ga0495658_0155499
1660 Ga0495613_0048557
1661 Ga0495613_0078769
1662 Ga0495624_0104410
1663 Ga0495589_0052547
1664 Ga0495600_0000024
1665 Ga0495600_0097235
1666 Ga0495581_0039756
1667 Ga0495604_0000001
1668 Ga0495604_0154591
1669 Ga0495674_0000023
1670 Ga0495676_0065149
1671 Ga0495680_0003698
1672 Ga0495675_0000392
1673 Ga0495685_048693
1674 Ga0495684_0000007
1675 Ga0495684_0012287
1676 Ga0495684_0181351
1677 Ga0495686_0008971
1678 Ga0495686_0010433
1679 Ga0495593_0001189
1680 Ga0495602_0000045
1681 Ga0495602_0095585
1682 Ga0495602_0375550
1683 Ga0495614_0101363
1684 Ga0495615_0024701
1685 Ga0496100_0001068
1686 Ga0496100_0020431
1687 Ga0496100_0048326
1688 Ga0496100_0404162
1689 Ga0496101_0023314
1690 Ga0496101_0048287
1691 Ga0496101_0071082
1692 Ga0496101_0147205
1693 Ga0496102_0004311
1694 Ga0496102_0006570
1695 Ga0496102_0013773
1696 Ga0496102_0027078
1697 Ga0496102_0412539
1698 Ga0496103_0018475
1699 Ga0496103_0090265
1700 Ga0496104_0000661
1701 Ga0496104_0046961
1702 Ga0496104_0051105
1703 Ga0496104_0122314
1704 Ga0496104_0135135
1705 Ga0496104_0261587
1706 Ga0496104_0604805
1707 Ga0496104_0786924
1708 Ga0496105_0019801
1709 Ga0496105_0032101
1710 Ga0496105_0062086
1711 Ga0496105_0168858
1712 Ga0496105_0389394
1713 Ga0496106_0006097
1714 Ga0496106_0027107
1715 Ga0496106_0055368
1716 Ga0496106_0286275
1717 Ga0496106_0454912
1718 Ga0496107_0001451
1719 Ga0496107_0094639
1720 Ga0496107_0149933
1721 Ga0496108_0002614
1722 Ga0496108_0005866
1723 Ga0496108_0016291
1724 Ga0496108_0018324
1725 Ga0496108_0209676
1726 Ga0496108_0403308
1727 Ga0496109_0000402
1728 Ga0496109_0000629
1729 Ga0496109_0002222
1730 Ga0496109_0010095
1731 Ga0496109_0250342
1732 Ga0496110_0002519
1733 Ga0496110_0235985
1734 Ga0496110_0358056
1735 Ga0496110_0689514
1736 Ga0496111_0004762
1737 Ga0496111_0006001
1738 Ga0496111_0014388
1739 Ga0496111_0022216
1740 Ga0496111_0076489
1741 Ga0496112_0009347
1742 Ga0496112_0059114
1743 Ga0496112_0159660
1744 Ga0496112_0361917
1745 Ga0496112_0470126
1746 Ga0496113_0002450
1747 Ga0496113_0010086
1748 Ga0496113_0012160
1749 Ga0496114_0033372
1750 Ga0496114_0074669
1751 Ga0496114_0096431
1752 Ga0496115_0054392
1753 Ga0496115_0076213
1754 Ga0496115_0105507
1755 Ga0496115_0185614
1756 Ga0496115_0335641
1757 Ga0496115_0343695
1758 Ga0496115_0483745
1759 Ga0496115_0498829
1760 Ga0496116_0015598
1761 Ga0496116_0044773
1762 Ga0496117_0091104
1763 Ga0496117_0191181
1764 Ga0496119_0182568
1765 Ga0496121_0007746
1766 Ga0496121_0064321
1767 Ga0496121_0180521
1768 Ga0496121_0246921
1769 Ga0496122_0000042
1770 Ga0496122_0035502
1771 Ga0496123_0000030
1772 Ga0496123_0004716
1773 Ga0496123_0061708
1774 Ga0496123_0110070
1775 Ga0496124_0006891
1776 Ga0496124_0144274
1777 Ga0496124_0202090
1778 Ga0496125_0018305
1779 Ga0496126_0198157
1780 Ga0501032_0029001
1781 Ga0501032_0070411
1782 Ga0501032_0118701
1783 Ga0501033_0047501
1784 Ga0501033_0053683
1785 Ga0501033_0067066
1786 Ga0501033_0111625
1787 Ga0501033_0302774
1788 Ga0501033_0463084
1789 Ga0501034_0010534
1790 Ga0501034_0019606
1791 Ga0501034_0096730
1792 Ga0501034_0308485
1793 Ga0501034_0313185
1794 Ga0501034_0386195
1795 Ga0501034_0420347
1796 Ga0501034_0581451
1797 Ga0501036_0003133
1798 Ga0501036_0089064
1799 Ga0501036_0386004
1800 Ga0501037_0123244
1801 Ga0501037_0165182
1802 Ga0501037_0171955
1803 Ga0501037_0264759
1804 Ga0501037_0342647
1805 Ga0501038_0018550
1806 Ga0501038_0084361
1807 Ga0501038_0087949
1808 Ga0501038_0140975
1809 Ga0501039_0038499
1810 Ga0501039_0097174
1811 Ga0501039_0097449
1812 Ga0501039_0222933
1813 Ga0501039_0642138
1814 Ga0501041_0067566
1815 Ga0501042_0214649
1816 Ga0501043_0002174
1817 Ga0501043_0102192
1818 Ga0501043_0120873
1819 Ga0501046_0016092
1820 Ga0501046_0090574
1821 Ga0501047_0003356
1822 Ga0501047_0036939
1823 Ga0501047_0083623
1824 Ga0501047_0167765
1825 Ga0501048_0029604
1826 Ga0501048_0074327
1827 Ga0501067_0356555
1828 Ga0501068_0166386
1829 Ga0501069_0081524
1830 Ga0501070_0021600
1831 Ga0501070_0028481
1832 Ga0501070_0035001
1833 Ga0501070_0117977
1834 Ga0501070_0119685
1835 Ga0501071_0022628
1836 Ga0501071_0167416
1837 Ga0501072_0021583
1838 Ga0501072_0061204
1839 Ga0501072_0064161
1840 Ga0501072_0100980
1841 Ga0501072_0128656
1842 Ga0501073_0004247
1843 Ga0501073_0066245
1844 Ga0501073_0066345
1845 Ga0501073_0121744
1846 Ga0501074_0074802
1847 Ga0501074_0114296
1848 Ga0501074_0275379
1849 Ga0501075_0012911
1850 Ga0501075_0019474
1851 Ga0501075_0068181
1852 Ga0501075_0153807
1853 Ga0501075_0292397
1854 Ga0501076_0007181
1855 Ga0501076_0042884
1856 Ga0501076_0190723
1857 Ga0501076_0316375
1858 Ga0501077_0005783
1859 Ga0501077_0372365
1860 Ga0501079_0006499
1861 Ga0501079_0098973
1862 Ga0501079_0120829
1863 Ga0501079_0122792
1864 Ga0501079_0138006
1865 Ga0501080_0015977
1866 Ga0501080_0037519
1867 Ga0501080_0147220
1868 Ga0501080_0222919
1869 Ga0501080_0241733
1870 Ga0501080_0286991
1871 Ga0501080_0401704
1872 Ga0501081_0010912
1873 Ga0501081_0063673
1874 Ga0501081_0209760
1875 Ga0501083_0041219
1876 Ga0501083_0044636
1877 Ga0501083_0056277
1878 Ga0501083_0089133
1879 Ga0501083_0121900
1880 Ga0501083_0182695
1881 Ga0501035_0018680
1882 Ga0501035_0059223
1883 Ga0501035_0096264
1884 Ga0501044_0012550
1885 Ga0501044_0026844
1886 Ga0501044_0138273
1887 Ga0501044_0186254
1888 Ga0501044_0202811
1889 Ga0501044_0231594
1890 Ga0501044_0397934
1891 Ga0501044_0466509
1892 Ga0501045_0067577
1893 Ga0501045_0482668
1894 nmdc:mga03683_230033_c1
1895 nmdc:mga03683_24008_c1
1896 nmdc:mga03683_30505_c1
1897 nmdc:mga03683_9239_c1
1898 nmdc:mga00v17_164611_c1
1899 nmdc:mga00v17_272282_c1
1900 nmdc:mga00v17_499337_c1
1901 nmdc:mga00v17_73809_c1
1902 nmdc:mga0k408_36688_c1
1903 nmdc:mga06z11_193676_c1
1904 nmdc:mga06z11_313107_c1
1905 nmdc:mga06z11_624_c1
1906 nmdc:mga06z11_6651_c1
1907 nmdc:mga07m45_112183_c1
1908 nmdc:mga07m45_226293_c1
1909 nmdc:mga05p37_138365_c1
1910 nmdc:mga05p37_14344_c1
1911 nmdc:mga05p37_236590_c1
1912 nmdc:mga05p37_336128_c1
1913 nmdc:mga05p37_464861_c1
1914 nmdc:mga05p37_52_c1
1915 nmdc:mga05p37_79819_c1
1916 nmdc:mga09592_467986_c1
1917 nmdc:mga09592_473848_c1
1918 nmdc:mga09592_58183_c1
1919 nmdc:mga0qj67_212290_c1
1920 nmdc:mga0qj67_277289_c1
1921 nmdc:mga0qj67_29384_c1
1922 nmdc:mga0qj67_96526_c1
1923 nmdc:mga06r32_128381_c1
1924 nmdc:mga06r32_141034_c1
1925 nmdc:mga06r32_19837_c1
1926 nmdc:mga06r32_33635_c1
1927 nmdc:mga06r32_4_c1
1928 nmdc:mga06r32_53650_c1
1929 nmdc:mga06r32_54301_c1
1930 nmdc:mga06r32_70968_c1
1931 nmdc:mga08y16_104210_c1
1932 nmdc:mga08y16_12764_c1
1933 nmdc:mga08y16_23571_c1
1934 nmdc:mga08y16_343388_c2
1935 nmdc:mga08y16_60153_c1
1936 nmdc:mga08y16_822_c1
1937 nmdc:mga0n895_159895_c1
1938 nmdc:mga0n895_20493_c1
1939 nmdc:mga0n895_374941_c1
1940 nmdc:mga0n895_39420_c1
1941 nmdc:mga0n895_479195_c1
1942 nmdc:mga0n895_66950_c1
1943 nmdc:mga0rr50_35335_c1
1944 nmdc:mga0rr50_58880_c2
1945 nmdc:mga0rr50_8215_c1
1946 nmdc:mga08x19_7802_c1
1947 nmdc:mga08x19_96665_c1
1948 nmdc:mga0a205_100676_c1
1949 nmdc:mga0a205_149514_c1
1950 nmdc:mga0a205_423703_c1
1951 nmdc:mga0sz30_111115_c1
1952 nmdc:mga0sz30_1180_c1
1953 nmdc:mga0sz30_15974_c1
1954 Ga0495601_0000014
1955 Ga0495601_0064093
1956 Ga0495601_0093164
1957 Ga0495601_0134966
1958 Ga0495601_0225789
1959 Ga0495612_0000014
1960 Ga0495595_0000038
1961 Ga0495595_0004030
1962 Ga0495595_0010247
1963 Ga0495595_0074538
1964 Ga0495619_0000006
1965 Ga0495619_0075710
1966 Ga0495619_0077125
1967 Ga0495619_0180958
1968 Ga0495619_0231760
1969 Ga0500643_010040
1970 Ga0500644_0004361
1971 Ga0500651_0066125
1972 Ga0500566_0008714
1973 Ga0500641_0001762
1974 Ga0500641_0008450
1975 Ga0500562_006316
1976 Ga0500593_029191
1977 Ga0500595_000029
1978 Ga0500618_001534
1979 Ga0500618_004196
1980 Ga0500652_005799
1981 Ga0500568_0037136
1982 Ga0500568_0039564
1983 Ga0500616_0000006
1984 Ga0500616_0001264
1985 Ga0500616_0005830
1986 Ga0500616_0058602
1987 Ga0500616_0061300
1988 Ga0500622_0013242
1989 Ga0500622_0039088
1990 Ga0500627_0183364
1991 Ga0500645_000290
1992 Ga0500645_030286
1993 Ga0501084_0003507
1994 Ga0501084_0074174
1995 Ga0501084_0124559
1996 Ga0501084_0196063
1997 Ga0501084_0254920
1998 Ga0501084_0285121
1999 Ga0501084_0321559
2000 Ga0501084_0758671
2001 Ga0501082_0017594
2002 Ga0501082_0064266
2003 Ga0501082_0087994
2004 Ga0501082_0123907
2005 Ga0501082_0195979
2006 Ga0501082_0633011
2007 Ga0530510_0038632
2008 Ga0530510_0073482
2009 Ga0530510_0223769
2010 Ga0530510_0451419
2011 2513657505
2012 2513861167
2013 2513916758
2014 2517889666
2015 2523468588
2016 2535518249
2017 2585259155
2018 2599105567
2019 2599722274
2020 2600373981
2021 2644290457
2022 2644729330
2023 2644737238
2024 2644747621
2025 2671119517
2026 2671695228
2027 2738944237
2028 2739352064
2029 2793070354
2030 2819718035
2031 2821125926
2032 2821444341
2033 2838737597
2034 2841761508
2035 2841842034
2036 2841913491
2037 2841919238
2038 2842141813
2039 2842314201
2040 2844104533
2041 2844538193
2042 2846954747
2043 2848858985
2044 2851184567
2045 2851247521
2046 2857532488
2047 2883354942
2048 2885380853
2049 2894773702
2050 2903754701
2051 2904692036
2052 2904707577
2053 2906614643
2054 2906641948
2055 2906660966
2056 2908746534
2057 2908757315
2058 2909046292
2059 2913308857
2060 2917556169
2061 2917700501
2062 2920827904
2063 2922426504
2064 2935632846
2065 2939672806
2066 2941508489
2067 2941516320
2068 2941524664
2069 3005475847
2070 8005549139
2071 8006937164
2072 8006977174
2073 8019561494
2074 8019571569
2075 8056690782
2076 8057530309

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

206

0.96

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

253

276

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9034 11 238
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9004 9 235
5x5y-assembly1.cif.gz_A a membrane protein complex 0.8955 11 250
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.895 9 235
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.8938 9 249
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.923 10 251 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9096 11 233 3.40.50.300
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8975 9 247 3.40.50.300
2awnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8938 11 233 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8936 6 74 3.40.50.300
ID Description Score Start End GO Terms
AF-U7UQ99-F1-model_v4 Branched-chain amino acid ABC transporter 0.9211 8 250 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A8A6JF79-F1-model_v4 deleted 0.9172 52 217
AF-A0A3N6MLS5-F1-model_v4 ABC transporter ATP-binding protein 0.916 9 250 GO:0005524
GO:0005886
GO:0016887
AF-A0A377GXA8-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB (EC 3.6.3.-) 0.9156 8 250 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A1I2K4U1-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB 0.9107 8 251 GO:0005524
GO:0005737
GO:0016887
GO:0043190
GO:0055085

Map