F488776

General Info

Members Datasets Scaffolds Average Seq Length
1038 545 2076 195

Family's Representative Sequence

Representative Sequence 3300053142|Ga0500577_0001713|Ga0500577_0001713_3315_3884
Length 189
Sequence MSTTVAPKRRWVMALPLLGFAIMAALFWFKLGAGDPAKLPSALIGRPAPQTALPALEGLTGIPGLDPAAFQGRVSVVNVWASWCVPCHEEAPLFTTLAQDKRIQIVGINYKDSPDNARRFLGRYGNPFGMVGVDGNGRAAIEWGVYGVPETFIVGRDGRISYKLVGGVTPENFDSVLKVEIEKALKAGS

Samples

Sample ID Description Type Environment
1 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
127 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
248 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
249 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
250 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
329 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
332 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
391 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
392 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
401 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
402 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
403 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
404 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
405 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
406 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
412 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
413 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
416 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
417 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
418 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
419 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
420 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
421 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
422 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
423 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
426 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
427 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
428 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
429 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
430 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
431 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
432 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
433 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
434 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
435 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
436 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
437 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
438 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
439 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
440 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
441 2643221651 Afipia sp. Root123D2 Isolate Unclassified
442 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
443 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
444 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
445 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
446 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
447 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
448 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
449 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
450 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
451 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
452 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
453 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
454 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
455 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
456 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
457 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
458 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
459 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
460 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
461 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
462 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
463 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
464 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
465 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
466 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
467 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
468 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
469 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
470 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
471 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
472 2922368715
473 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
474 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
475 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
476 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
477 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
478 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
479 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
480 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
481 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
482 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
483 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
484 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
485 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
486 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
487 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
488 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
489 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
490 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
491 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
492 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
493 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
494 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
495 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
496 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
497 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
498 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
499 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
500 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
501 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
502 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
503 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
504 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
505 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
506 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
507 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
508 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
509 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
510 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
511 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
512 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
513 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
514 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
515 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
516 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
517 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
518 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
519 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
520 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
521 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
522 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
523 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
524 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
525 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
526 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
527 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
528 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
529 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
530 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
531 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
532 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
533 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
534 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
535 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
536 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
537 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
538 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
539 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
540 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
541 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
542 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
543 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
544 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
545 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.43
Metatranscriptomes 0.39
Isolates 11.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.13
Nodule 9.34
Rhizoplane 5.3
Rhizosphere 73.7
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500577_0001713 3300053142 Bacteria 5614
2 JGI24748J21848_1015566 3300002074 Bacteria 905
3 JGI24744J21845_10029693 3300002077 Bacteria 1050
4 JGI24034J26672_10001856 3300002239 Bacteria 2850
5 JGI25406J46586_10001038 3300003203 Bacteria 12982
6 JGI25165J46597_1006459 3300003214 Bacteria 2077
7 JGI25160J50197_1024431 3300003354 Bacteria 1714
8 JGI25404J52841_10019750 3300003659 Bacteria 1460
9 Ga0070676_10056764 3300005328 Bacteria 2315
10 Ga0070676_10622566 3300005328 Bacteria 781
11 Ga0070683_100020477 3300005329 Bacteria 5887
12 Ga0070683_100623998 3300005329 Bacteria 1032
13 Ga0070690_100213100 3300005330 Bacteria 1350
14 Ga0070670_100010392 3300005331 Bacteria 7943
15 Ga0070670_100028895 3300005331 Bacteria 4772
16 Ga0068869_100053668 3300005334 Bacteria 2931
17 Ga0068869_100064712 3300005334 Bacteria 2690
18 Ga0068869_100118320 3300005334 Bacteria 2023
19 Ga0070666_10068506 3300005335 Bacteria 2412
20 Ga0070682_100084056 3300005337 Bacteria 2067
21 Ga0068868_100007925 3300005338 Bacteria 7588
22 Ga0070660_100057694 3300005339 Bacteria 3009
23 Ga0070660_100057834 3300005339 Bacteria 3005
24 Ga0070660_100323095 3300005339 Bacteria 1268
25 Ga0070689_100088421 3300005340 Bacteria 2438
26 Ga0070689_100138358 3300005340 Bacteria 1956
27 Ga0070691_10006615 3300005341 Bacteria 5306
28 Ga0070687_100003213 3300005343 Bacteria 6312
29 Ga0070661_100030649 3300005344 Bacteria 3886
30 Ga0070692_10177695 3300005345 Bacteria 1232
31 Ga0070668_100039652 3300005347 Bacteria 3601
32 Ga0070668_100295771 3300005347 Bacteria 1356
33 Ga0070668_100813431 3300005347 Bacteria 831
34 Ga0070668_101030464 3300005347 Bacteria 740
35 Ga0070669_100432359 3300005353 Bacteria 1082
36 Ga0070675_100023243 3300005354 Bacteria 4954
37 Ga0070671_100062961 3300005355 Bacteria 3088
38 Ga0070671_100112638 3300005355 Bacteria 2285
39 Ga0070671_100157830 3300005355 Bacteria 1917
40 Ga0070671_100275964 3300005355 Bacteria 1429
41 Ga0070671_100339358 3300005355 Bacteria 1281
42 Ga0070671_100463907 3300005355 Bacteria 1087
43 Ga0070674_100030585 3300005356 Bacteria 3560
44 Ga0070674_100113963 3300005356 Bacteria 1990
45 Ga0070673_100373110 3300005364 Bacteria 1270
46 Ga0070673_100942078 3300005364 Bacteria 802
47 Ga0070688_100019458 3300005365 Bacteria 3933
48 Ga0070688_100516109 3300005365 Bacteria 904
49 Ga0070659_100120020 3300005366 Bacteria 2128
50 Ga0070714_100172604 3300005435 Bacteria 1963
51 Ga0070714_100204994 3300005435 Bacteria 1806
52 Ga0070714_100329444 3300005435 Bacteria 1430
53 Ga0070714_100490107 3300005435 Bacteria 1171
54 Ga0070713_100022398 3300005436 Bacteria 4883
55 Ga0070710_10205902 3300005437 Bacteria 1244
56 Ga0070710_10289417 3300005437 Bacteria 1066
57 Ga0070710_10653984 3300005437 Bacteria 737
58 Ga0070711_100027826 3300005439 Bacteria 3715
59 Ga0070705_100093111 3300005440 Bacteria 1883
60 Ga0070705_100115636 3300005440 Bacteria 1723
61 Ga0070700_100003506 3300005441 Bacteria 8091
62 Ga0070700_100709663 3300005441 Bacteria 800
63 Ga0070694_100248261 3300005444 Bacteria 1345
64 Ga0070663_100034543 3300005455 Bacteria 3502
65 Ga0070663_100077506 3300005455 Bacteria 2433
66 Ga0070663_100306136 3300005455 Bacteria 1273
67 Ga0070663_100399998 3300005455 Bacteria 1122
68 Ga0070678_100118683 3300005456 Bacteria 2082
69 Ga0070678_100302100 3300005456 Bacteria 1360
70 Ga0070678_100411880 3300005456 Bacteria 1176
71 Ga0070678_100895577 3300005456 Bacteria 811
72 Ga0070662_100037362 3300005457 Bacteria 3443
73 Ga0070662_100104780 3300005457 Bacteria 2146
74 Ga0070662_100251296 3300005457 Bacteria 1421
75 Ga0070662_100689437 3300005457 Bacteria 863
76 Ga0070681_10001077 3300005458 Bacteria 23275
77 Ga0068867_100047596 3300005459 Bacteria 3152
78 Ga0070706_100301548 3300005467 Bacteria 1495
79 Ga0070706_100587753 3300005467 Bacteria 1035
80 Ga0070698_100112123 3300005471 Bacteria 2692
81 Ga0070699_100389715 3300005518 Bacteria 1259
82 Ga0070679_100074727 3300005530 Bacteria 3379
83 Ga0070679_100236261 3300005530 Bacteria 1786
84 Ga0070679_100414616 3300005530 Bacteria 1292
85 Ga0070684_100014169 3300005535 Bacteria 6449
86 Ga0070684_100337678 3300005535 Bacteria 1385
87 Ga0070684_100503733 3300005535 Bacteria 1121
88 Ga0070697_100017648 3300005536 Bacteria 5621
89 Ga0070697_100103441 3300005536 Bacteria 2367
90 Ga0070697_100898578 3300005536 Bacteria 786
91 Ga0068853_100076989 3300005539 Bacteria 2913
92 Ga0068853_100173008 3300005539 Bacteria 1954
93 Ga0068853_100508823 3300005539 Bacteria 1137
94 Ga0068853_100601593 3300005539 Bacteria 1044
95 Ga0068853_100673696 3300005539 Bacteria 985
96 Ga0070672_100228804 3300005543 Bacteria 1562
97 Ga0070686_100025193 3300005544 Bacteria 3576
98 Ga0070686_100375672 3300005544 Bacteria 1074
99 Ga0070695_100033091 3300005545 Bacteria 3234
100 Ga0070695_100214825 3300005545 Bacteria 1382
101 Ga0070696_100279755 3300005546 Bacteria 1272
102 Ga0070696_100354646 3300005546 Bacteria 1137
103 Ga0070693_100155781 3300005547 Bacteria 1451
104 Ga0070693_100512607 3300005547 Bacteria 852
105 Ga0070665_100112414 3300005548 Bacteria 2726
106 Ga0070665_100316202 3300005548 Bacteria 1565
107 Ga0070665_100881387 3300005548 Bacteria 908
108 Ga0070704_100129559 3300005549 Bacteria 1953
109 Ga0070704_100264046 3300005549 Bacteria 1419
110 Ga0068855_100114024 3300005563 Bacteria 3100
111 Ga0068855_100204516 3300005563 Bacteria 2222
112 Ga0068855_100627042 3300005563 Bacteria 1157
113 Ga0068855_100748238 3300005563 Bacteria 1042
114 Ga0070664_100337346 3300005564 Bacteria 1368
115 Ga0070664_100576173 3300005564 Bacteria 1042
116 Ga0070664_100784140 3300005564 Bacteria 890
117 Ga0068857_100278299 3300005577 Bacteria 1539
118 Ga0068857_100484269 3300005577 Bacteria 1160
119 Ga0068854_100160519 3300005578 Bacteria 1740
120 Ga0068854_100174960 3300005578 Bacteria 1672
121 Ga0068854_100738504 3300005578 Bacteria 853
122 Ga0068856_100125157 3300005614 Bacteria 2573
123 Ga0068852_100174137 3300005616 Bacteria 2019
124 Ga0068859_100847664 3300005617 Bacteria 1000
125 Ga0068864_100194607 3300005618 Bacteria 1860
126 Ga0068864_100229416 3300005618 Bacteria 1717
127 Ga0068864_100864787 3300005618 Bacteria 891
128 Ga0068866_10080314 3300005718 Bacteria 1749
129 Ga0068866_10446678 3300005718 Bacteria 844
130 Ga0068861_100068282 3300005719 Bacteria 2746
131 Ga0068861_100211907 3300005719 Bacteria 1632
132 Ga0068861_100240542 3300005719 Bacteria 1539
133 Ga0068861_100639319 3300005719 Bacteria 981
134 Ga0068851_10177294 3300005834 Bacteria 1179
135 Ga0068870_10046750 3300005840 Bacteria 2272
136 Ga0068863_100040383 3300005841 Bacteria 4436
137 Ga0068863_100074859 3300005841 Bacteria 3203
138 Ga0068858_100082321 3300005842 Bacteria 2992
139 Ga0068858_100499880 3300005842 Bacteria 1175
140 Ga0068860_100153938 3300005843 Bacteria 2215
141 Ga0068860_100180429 3300005843 Bacteria 2040
142 Ga0068860_100457375 3300005843 Bacteria 1270
143 Ga0068862_100024856 3300005844 Bacteria 5026
144 Ga0068862_100132689 3300005844 Bacteria 2204
145 Ga0068862_100684986 3300005844 Bacteria 992
146 Ga0081455_10012728 3300005937 Bacteria 8371
147 Ga0081538_10039257 3300005981 Bacteria 3039
148 Ga0081538_10054534 3300005981 Bacteria 2363
149 Ga0081540_1005580 3300005983 Bacteria 9369
150 Ga0081540_1011553 3300005983 Bacteria 5898
151 Ga0081540_1030748 3300005983 Bacteria 2969
152 Ga0081539_10003753 3300005985 Bacteria 18030
153 Ga0070717_10053860 3300006028 Bacteria 3317
154 Ga0070717_10097051 3300006028 Bacteria 2497
155 Ga0070717_10184325 3300006028 Bacteria 1821
156 Ga0075365_10017305 3300006038 Bacteria 4407
157 Ga0075365_10053169 3300006038 Bacteria 2681
158 Ga0075365_10088470 3300006038 Bacteria 2107
159 Ga0075365_10132189 3300006038 Bacteria 1728
160 Ga0075365_10153342 3300006038 Bacteria 1603
161 Ga0075365_10411198 3300006038 Bacteria 955
162 Ga0075365_10521979 3300006038 Bacteria 840
163 Ga0075368_10064064 3300006042 Bacteria 1475
164 Ga0075368_10163385 3300006042 Bacteria 934
165 Ga0075368_10193756 3300006042 Bacteria 859
166 Ga0075363_100007350 3300006048 Bacteria 5056
167 Ga0075363_100020186 3300006048 Bacteria 3340
168 Ga0075363_100050348 3300006048 Bacteria 2219
169 Ga0075363_100114480 3300006048 Bacteria 1501
170 Ga0075364_10119152 3300006051 Bacteria 1766
171 Ga0075364_10301488 3300006051 Bacteria 1091
172 Ga0075432_10243891 3300006058 Bacteria 727
173 Ga0070716_100189041 3300006173 Bacteria 1359
174 Ga0070712_100073352 3300006175 Bacteria 2455
175 Ga0070712_100416949 3300006175 Bacteria 1112
176 Ga0075362_10076051 3300006177 Bacteria 1541
177 Ga0075362_10328986 3300006177 Bacteria 762
178 Ga0075367_10383067 3300006178 Bacteria 889
179 Ga0075369_10055303 3300006186 Bacteria 1724
180 Ga0075366_10078725 3300006195 Bacteria 1967
181 Ga0097621_100608306 3300006237 Bacteria 1000
182 Ga0075370_10011007 3300006353 Bacteria 4744
183 Ga0075370_10141709 3300006353 Bacteria 1405
184 Ga0075370_10380472 3300006353 Bacteria 846
185 Ga0068871_100133308 3300006358 Bacteria 2108
186 Ga0068871_100275435 3300006358 Bacteria 1471
187 Ga0068871_100535863 3300006358 Bacteria 1059
188 Ga0075428_100067213 3300006844 Bacteria 3924
189 Ga0075428_100082208 3300006844 Bacteria 3515
190 Ga0075428_100279196 3300006844 Bacteria 1797
191 Ga0075428_100968415 3300006844 Bacteria 901
192 Ga0075434_100074886 3300006871 Bacteria 3379
193 Ga0075434_100106463 3300006871 Bacteria 2814
194 Ga0075429_100020262 3300006880 Bacteria 5767
195 Ga0097620_100847644 3300006931 Bacteria 1000
196 Ga0075435_100066208 3300007076 Bacteria 2939
197 Ga0075435_100108578 3300007076 Bacteria 2305
198 Ga0075435_100151663 3300007076 Bacteria 1949
199 Ga0099795_10256232 3300007788 Bacteria 756
200 Ga0105240_10082975 3300009093 Bacteria 3935
201 Ga0105240_10197980 3300009093 Bacteria 2357
202 Ga0105240_10225649 3300009093 Bacteria 2180
203 Ga0111539_10061009 3300009094 Bacteria 4468
204 Ga0111539_10246353 3300009094 Bacteria 2081
205 Ga0111539_10514348 3300009094 Bacteria 1394
206 Ga0105245_10004490 3300009098 Bacteria 12337
207 Ga0105245_10747765 3300009098 Bacteria 1013
208 Ga0105247_10009526 3300009101 Bacteria 5893
209 Ga0105247_10319158 3300009101 Bacteria 1083
210 Ga0114129_10052932 3300009147 Bacteria 5696
211 Ga0114129_10106009 3300009147 Bacteria 3883
212 Ga0114129_10188583 3300009147 Bacteria 2801
213 Ga0114129_10245258 3300009147 Bacteria 2407
214 Ga0114129_10329128 3300009147 Bacteria 2029
215 Ga0114129_11481406 3300009147 Bacteria 835
216 Ga0105243_10038961 3300009148 Bacteria 3704
217 Ga0105241_10209378 3300009174 Bacteria 1633
218 Ga0105242_10071965 3300009176 Bacteria 2871
219 Ga0105242_10282440 3300009176 Bacteria 1508
220 Ga0105248_10043760 3300009177 Bacteria 5022
221 Ga0105248_10047926 3300009177 Bacteria 4793
222 Ga0105248_11158480 3300009177 Bacteria 874
223 Ga0105237_10066600 3300009545 Bacteria 3597
224 Ga0105237_10224102 3300009545 Bacteria 1880
225 Ga0105237_10383874 3300009545 Bacteria 1410
226 Ga0105237_10398432 3300009545 Bacteria 1381
227 Ga0105237_10618893 3300009545 Bacteria 1090
228 Ga0105238_10063695 3300009551 Bacteria 3688
229 Ga0105249_10875503 3300009553 Bacteria 964
230 Ga0105249_11182661 3300009553 Bacteria 835
231 Ga0105249_11615535 3300009553 Bacteria 721
232 Ga0099796_10037348 3300010159 Bacteria 1623
233 Ga0105239_10022916 3300010375 Bacteria 6884
234 Ga0105239_10199912 3300010375 Bacteria 2239
235 Ga0105239_10413335 3300010375 Bacteria 1528
236 Ga0105239_10652501 3300010375 Bacteria 1202
237 Ga0105239_10683262 3300010375 Bacteria 1173
238 Ga0105239_10957711 3300010375 Bacteria 983
239 Ga0105239_11375953 3300010375 Bacteria 815
240 Ga0105246_10139948 3300011119 Bacteria 1818
241 Ga0157373_10039123 3300013100 Bacteria 3396
242 Ga0157373_10287352 3300013100 Bacteria 1166
243 Ga0157370_10028400 3300013104 Bacteria 5502
244 Ga0157370_10240116 3300013104 Bacteria 1676
245 Ga0157370_10354160 3300013104 Bacteria 1353
246 Ga0157370_10485370 3300013104 Bacteria 1135
247 Ga0157369_10071589 3300013105 Bacteria 3721
248 Ga0157369_10096664 3300013105 Bacteria 3151
249 Ga0157369_10155843 3300013105 Bacteria 2412
250 Ga0157374_11159214 3300013296 Bacteria 794
251 Ga0157378_10379274 3300013297 Bacteria 1388
252 Ga0163162_10179236 3300013306 Bacteria 2245
253 Ga0163162_11343367 3300013306 Bacteria 813
254 Ga0157372_10103182 3300013307 Bacteria 3258
255 Ga0157372_10223986 3300013307 Bacteria 2180
256 Ga0157372_10270361 3300013307 Bacteria 1975
257 Ga0157375_10445206 3300013308 Bacteria 1461
258 Ga0157375_10632210 3300013308 Bacteria 1228
259 Ga0163163_10021857 3300014325 Bacteria 6045
260 Ga0157380_10199597 3300014326 Bacteria 1773
261 Ga0157380_10582045 3300014326 Bacteria 1104
262 Ga0157380_10608921 3300014326 Bacteria 1082
263 Ga0157379_10060482 3300014968 Bacteria 3386
264 Ga0157379_11537911 3300014968 Bacteria 648
265 Ga0157376_10140354 3300014969 Bacteria 2167
266 Ga0157376_10231976 3300014969 Bacteria 1715
267 Ga0157376_10862821 3300014969 Bacteria 921
268 Ga0163161_10056894 3300017792 Bacteria 2841
269 Ga0163161_10314649 3300017792 Bacteria 1236
270 Ga0224572_1015081 3300024225 Bacteria 1478
271 Ga0228598_1007284 3300024227 Bacteria 2257
272 Ga0209233_1008253 3300025261 Bacteria 3234
273 Ga0209564_1005467 3300025295 Bacteria 7242
274 Ga0209758_1001013 3300025297 Bacteria 37209
275 Ga0209758_1005533 3300025297 Bacteria 9644
276 Ga0209256_1017459 3300025299 Bacteria 2382
277 Ga0207426_1002838 3300025302 Bacteria 10314
278 Ga0207426_1012013 3300025302 Bacteria 3271
279 Ga0209257_1035057 3300025304 Bacteria 1556
280 Ga0207697_10111736 3300025315 Bacteria 1170
281 Ga0207653_10012696 3300025885 Bacteria 2631
282 Ga0207692_10199440 3300025898 Bacteria 1176
283 Ga0207710_10044330 3300025900 Bacteria 1980
284 Ga0207710_10217270 3300025900 Bacteria 948
285 Ga0207710_10257003 3300025900 Bacteria 875
286 Ga0207688_10015244 3300025901 Bacteria 4172
287 Ga0207688_10157215 3300025901 Bacteria 1346
288 Ga0207688_10164260 3300025901 Bacteria 1318
289 Ga0207680_10010978 3300025903 Bacteria 4556
290 Ga0207647_10048127 3300025904 Bacteria 2649
291 Ga0207647_10161162 3300025904 Bacteria 1308
292 Ga0207647_10210080 3300025904 Bacteria 1124
293 Ga0207685_10066599 3300025905 Bacteria 1446
294 Ga0207685_10072500 3300025905 Bacteria 1400
295 Ga0207699_10632587 3300025906 Bacteria 781
296 Ga0207645_10018488 3300025907 Bacteria 4584
297 Ga0207645_10067939 3300025907 Bacteria 2278
298 Ga0207643_10001362 3300025908 Bacteria 14113
299 Ga0207707_10001830 3300025912 Bacteria 19505
300 Ga0207695_10030631 3300025913 Bacteria 5920
301 Ga0207695_10293819 3300025913 Bacteria 1517
302 Ga0207671_10275622 3300025914 Bacteria 1326
303 Ga0207693_10029152 3300025915 Bacteria 4362
304 Ga0207693_10203572 3300025915 Bacteria 1556
305 Ga0207663_10204296 3300025916 Bacteria 1427
306 Ga0207660_10189206 3300025917 Bacteria 1602
307 Ga0207660_10215906 3300025917 Bacteria 1504
308 Ga0207662_10001498 3300025918 Bacteria 11346
309 Ga0207662_10181724 3300025918 Bacteria 1354
310 Ga0207657_10022399 3300025919 Bacteria 5912
311 Ga0207657_10045121 3300025919 Bacteria 3871
312 Ga0207649_10192546 3300025920 Bacteria 1435
313 Ga0207652_10076567 3300025921 Bacteria 2918
314 Ga0207652_10078201 3300025921 Bacteria 2888
315 Ga0207681_10336781 3300025923 Bacteria 1204
316 Ga0207650_10006398 3300025925 Bacteria 8021
317 Ga0207650_10042065 3300025925 Bacteria 3351
318 Ga0207650_10103609 3300025925 Bacteria 2194
319 Ga0207659_10047121 3300025926 Bacteria 3048
320 Ga0207687_10022847 3300025927 Bacteria 4165
321 Ga0207687_10031317 3300025927 Bacteria 3593
322 Ga0207687_10076681 3300025927 Bacteria 2402
323 Ga0207700_10391156 3300025928 Bacteria 1217
324 Ga0207664_10447650 3300025929 Bacteria 1152
325 Ga0207644_10116107 3300025931 Bacteria 2031
326 Ga0207644_10276846 3300025931 Bacteria 1346
327 Ga0207644_10316939 3300025931 Bacteria 1260
328 Ga0207644_10346071 3300025931 Bacteria 1206
329 Ga0207644_10444596 3300025931 Bacteria 1064
330 Ga0207644_10749855 3300025931 Bacteria 815
331 Ga0207690_10569055 3300025932 Bacteria 923
332 Ga0207706_10004857 3300025933 Bacteria 12589
333 Ga0207706_10055965 3300025933 Bacteria 3477
334 Ga0207706_10186712 3300025933 Bacteria 1820
335 Ga0207706_10377744 3300025933 Bacteria 1230
336 Ga0207686_10153786 3300025934 Bacteria 1605
337 Ga0207709_10007603 3300025935 Bacteria 6017
338 Ga0207670_10010018 3300025936 Bacteria 5438
339 Ga0207669_10021340 3300025937 Bacteria 3417
340 Ga0207669_10027600 3300025937 Bacteria 3111
341 Ga0207669_10101165 3300025937 Bacteria 1906
342 Ga0207665_10104335 3300025939 Bacteria 1984
343 Ga0207665_10491769 3300025939 Bacteria 947
344 Ga0207691_10006388 3300025940 Bacteria 11384
345 Ga0207711_10154538 3300025941 Bacteria 2073
346 Ga0207711_10168163 3300025941 Bacteria 1988
347 Ga0207689_10011143 3300025942 Bacteria 7716
348 Ga0207689_10105243 3300025942 Bacteria 2318
349 Ga0207689_10246990 3300025942 Bacteria 1476
350 Ga0207689_10301956 3300025942 Bacteria 1327
351 Ga0207661_10004360 3300025944 Bacteria 9917
352 Ga0207661_10235294 3300025944 Bacteria 1624
353 Ga0207661_10995580 3300025944 Bacteria 772
354 Ga0207679_10159939 3300025945 Bacteria 1843
355 Ga0207667_10016003 3300025949 Bacteria 8492
356 Ga0207667_10086452 3300025949 Bacteria 3245
357 Ga0207667_10736113 3300025949 Bacteria 986
358 Ga0207651_10859856 3300025960 Bacteria 806
359 Ga0207712_10120991 3300025961 Bacteria 1981
360 Ga0207712_10261168 3300025961 Bacteria 1405
361 Ga0207712_10310291 3300025961 Bacteria 1298
362 Ga0207668_10014153 3300025972 Bacteria 4933
363 Ga0207668_10042564 3300025972 Bacteria 3076
364 Ga0207668_10214148 3300025972 Bacteria 1542
365 Ga0207668_10249287 3300025972 Bacteria 1441
366 Ga0207668_10249554 3300025972 Bacteria 1440
367 Ga0207640_10151819 3300025981 Bacteria 1703
368 Ga0207640_10638546 3300025981 Bacteria 906
369 Ga0207640_10867510 3300025981 Bacteria 786
370 Ga0207658_10083707 3300025986 Bacteria 2453
371 Ga0207658_10102777 3300025986 Bacteria 2242
372 Ga0207703_10132048 3300026035 Bacteria 2157
373 Ga0207703_10457850 3300026035 Bacteria 1192
374 Ga0207703_10598827 3300026035 Bacteria 1042
375 Ga0207639_10117753 3300026041 Bacteria 2177
376 Ga0207678_10008802 3300026067 Bacteria 8881
377 Ga0207678_10023605 3300026067 Bacteria 5379
378 Ga0207678_10035784 3300026067 Bacteria 4323
379 Ga0207678_10042691 3300026067 Bacteria 3927
380 Ga0207678_10066177 3300026067 Bacteria 3103
381 Ga0207708_10048288 3300026075 Bacteria 3240
382 Ga0207702_10048122 3300026078 Bacteria 3596
383 Ga0207702_10199613 3300026078 Bacteria 1853
384 Ga0207702_10469132 3300026078 Bacteria 1224
385 Ga0207641_10064481 3300026088 Bacteria 3131
386 Ga0207641_10177570 3300026088 Bacteria 1948
387 Ga0207641_10363258 3300026088 Bacteria 1383
388 Ga0207648_10034157 3300026089 Bacteria 4485
389 Ga0207648_10060278 3300026089 Bacteria 3310
390 Ga0207676_10069096 3300026095 Bacteria 2828
391 Ga0207676_10134973 3300026095 Bacteria 2104
392 Ga0207676_10836273 3300026095 Bacteria 900
393 Ga0207674_10100669 3300026116 Bacteria 2871
394 Ga0207674_10222249 3300026116 Bacteria 1837
395 Ga0207674_10442281 3300026116 Bacteria 1256
396 Ga0207674_10543883 3300026116 Bacteria 1122
397 Ga0207674_10685190 3300026116 Bacteria 990
398 Ga0207675_100007482 3300026118 Bacteria 10321
399 Ga0207675_100066389 3300026118 Bacteria 3372
400 Ga0207675_100220968 3300026118 Bacteria 1825
401 Ga0207675_100739936 3300026118 Bacteria 994
402 Ga0207683_10003631 3300026121 Bacteria 13427
403 Ga0207683_10312823 3300026121 Bacteria 1438
404 Ga0207683_10819124 3300026121 Bacteria 864
405 Ga0207698_10033869 3300026142 Bacteria 3716
406 Ga0207428_10073687 3300027907 Bacteria 2678
407 Ga0268266_10012729 3300028379 Bacteria 7270
408 Ga0268266_10039111 3300028379 Bacteria 4039
409 Ga0268266_10065598 3300028379 Bacteria 3138
410 Ga0268265_10103924 3300028380 Bacteria 2301
411 Ga0268265_10235425 3300028380 Bacteria 1612
412 Ga0268265_10615805 3300028380 Bacteria 1039
413 Ga0268264_10414187 3300028381 Bacteria 1298
414 Ga0265762_1046092 3300030760 Bacteria 864
415 Ga0265770_1019529 3300030878 Bacteria 1063
416 Ga0265760_10018660 3300031090 Bacteria 1998
417 Ga0265332_10012491 3300031238 Bacteria 3768
418 Ga0265325_10208551 3300031241 Bacteria 898
419 Ga0265329_10048481 3300031242 Bacteria 1354
420 Ga0265340_10014138 3300031247 Bacteria 4178
421 Ga0265340_10115228 3300031247 Bacteria 1239
422 Ga0265339_10000738 3300031249 Bacteria 25301
423 Ga0265339_10003900 3300031249 Bacteria 10336
424 Ga0265331_10059574 3300031250 Bacteria 1805
425 Ga0265316_10100060 3300031344 Bacteria 2204
426 Ga0265316_10227539 3300031344 Bacteria 1374
427 Ga0265314_10037456 3300031711 Bacteria 3514
428 Ga0265342_10003180 3300031712 Bacteria 13667
429 Ga0307516_10294049 3300031730 Bacteria 1302
430 Ga0307405_10514475 3300031731 Bacteria 962
431 Ga0307405_10614393 3300031731 Bacteria 889
432 Ga0307405_10742955 3300031731 Bacteria 817
433 Ga0307413_10052158 3300031824 Bacteria 2469
434 Ga0307410_10343301 3300031852 Bacteria 1191
435 Ga0307409_100312813 3300031995 Bacteria 1466
436 Ga0307416_100204452 3300032002 Bacteria 1877
437 Ga0307416_100484234 3300032002 Bacteria 1298
438 Ga0307416_100530292 3300032002 Bacteria 1247
439 Ga0307411_10330782 3300032005 Bacteria 1234
440 Ga0307411_11216227 3300032005 Bacteria 684
441 Ga0316215_1003830 3300033544 Bacteria 1442
442 Ga0373934_0112658 3300035086 Bacteria 1104
443 Ga0373934_0135590 3300035086 Bacteria 1005
444 Ga0373944_0011826 3300035089 Bacteria 2397
445 Ga0373923_0031514 3300035111 Bacteria 2138
446 Ga0373923_0052729 3300035111 Bacteria 1709
447 Ga0373932_0042705 3300035112 Bacteria 1316
448 Ga0373936_0014580 3300035113 Bacteria 3008
449 Ga0373936_0255942 3300035113 Bacteria 783
450 Ga0373945_0127093 3300035116 Bacteria 1018
451 Ga0373953_0002353 3300035117 Bacteria 5693
452 Ga0373953_0015566 3300035117 Bacteria 2760
453 Ga0373953_0018502 3300035117 Bacteria 2579
454 Ga0373954_0000445 3300035118 Bacteria 15476
455 Ga0373954_0059464 3300035118 Bacteria 1801
456 Ga0373957_0003642 3300035120 Bacteria 4591
457 Ga0373943_0001478 3300035170 Bacteria 10640
458 Ga0373943_0009727 3300035170 Bacteria 4307
459 Ga0373943_0074622 3300035170 Bacteria 1725
460 Ga0373946_0025069 3300035171 Bacteria 2343
461 Ga0373946_0025985 3300035171 Bacteria 2306
462 Ga0373955_0010529 3300035172 Bacteria 4371
463 Ga0373955_0045870 3300035172 Bacteria 2360
464 Ga0373955_0369992 3300035172 Bacteria 869
465 Ga0373955_0620458 3300035172 Bacteria 662
466 Ga0373962_0034959 3300035242 Bacteria 1394
467 Ga0373924_0001214 3300035410 Bacteria 8270
468 Ga0373931_0329262 3300035691 Bacteria 951
469 Ga0373935_0000011 3300035692 Bacteria 89873
470 Ga0373935_0153636 3300035692 Bacteria 1564
471 Ga0373935_0204999 3300035692 Bacteria 1364
472 Ga0373935_0403449 3300035692 Bacteria 982
473 Ga0373927_0004771 3300035695 Bacteria 9441
474 Ga0373927_0090551 3300035695 Bacteria 1986
475 Ga0373927_0125649 3300035695 Bacteria 1674
476 Ga0373927_0229844 3300035695 Bacteria 1219
477 Ga0373927_0420980 3300035695 Bacteria 881
478 Ga0373927_0704138 3300035695 Bacteria 667
479 Ga0373933_0000885 3300035724 Bacteria 18316
480 Ga0373933_0131778 3300035724 Bacteria 1572
481 Ga0373947_0002928 3300035725 Bacteria 10182
482 Ga0373947_0034346 3300035725 Bacteria 2998
483 Ga0373947_0038544 3300035725 Bacteria 2840
484 Ga0373947_0051017 3300035725 Bacteria 2488
485 Ga0373947_0225814 3300035725 Bacteria 1232
486 Ga0373947_0414913 3300035725 Bacteria 909
487 Ga0373937_0000019 3300036401 Bacteria 138568
488 Ga0373937_0015685 3300036401 Bacteria 6708
489 Ga0373937_0046562 3300036401 Bacteria 3966
490 Ga0372808_000548 3300036459 Bacteria 3087
491 Ga0373925_0000026 3300037068 Bacteria 154713
492 Ga0373925_0012279 3300037068 Bacteria 6197
493 Ga0373925_0222298 3300037068 Bacteria 1507
494 Ga0373925_0226244 3300037068 Bacteria 1494
495 Ga0395899_0038502 3300037312 Bacteria 3582
496 Ga0395900_0023057 3300037418 Bacteria 6370
497 Ga0395900_0106625 3300037418 Bacteria 2878
498 Ga0395898_0158837 3300037466 Bacteria 2162
499 Ga0395901_0031964 3300038443 Bacteria 5429
500 Ga0395901_0240778 3300038443 Bacteria 1887
501 Ga0436365_0422270 3300039437 Bacteria 2007
502 Ga0436365_1141354 3300039437 Bacteria 941
503 Ga0436365_1142518 3300039437 Bacteria 1041
504 Ga0436365_1392289 3300039437 Bacteria 644
505 Ga0436365_1525977 3300039437 Bacteria 2192
506 Ga0436360_0035660 3300039438 Bacteria 2190
507 Ga0436361_0034753 3300039447 Bacteria 2945
508 Ga0436361_0474226 3300039447 Bacteria 3446
509 Ga0436361_0808590 3300039447 Bacteria 12129
510 Ga0436361_0817855 3300039447 Bacteria 1485
511 Ga0436363_1010904 3300039450 Bacteria 1457
512 Ga0436362_0798067 3300039453 Bacteria 5843
513 Ga0451789_0678307 3300041443 Bacteria 747
514 Ga0451795_1160684 3300041456 Bacteria 842
515 Ga0451841_1435836 3300041498 Bacteria 825
516 Ga0451851_0182072 3300041507 Bacteria 773
517 Ga0451853_1644141 3300041512 Bacteria 1501
518 Ga0466969_0039705 3300044656 Bacteria 2362
519 Ga0466969_0120617 3300044656 Bacteria 1221
520 Ga0466972_0008421 3300044658 Bacteria 5169
521 Ga0466966_0056008 3300044684 Bacteria 2495
522 Ga0466961_0190673 3300044693 Bacteria 1270
523 Ga0466963_0050147 3300044694 Bacteria 2763
524 Ga0466963_0082044 3300044694 Bacteria 2185
525 Ga0466963_0358876 3300044694 Bacteria 1027
526 Ga0466964_0036301 3300044706 Bacteria 1976
527 Ga0466968_0002099 3300044735 Bacteria 7255
528 Ga0466970_0142879 3300044765 Bacteria 1319
529 Ga0466959_0014935 3300045049 Bacteria 5658
530 Ga0466959_0090922 3300045049 Bacteria 2192
531 Ga0466958_0008120 3300045836 Bacteria 5809
532 Ga0466967_0281578 3300045976 Bacteria 1595
533 Ga0466967_0348758 3300045976 Bacteria 1432
534 Ga0495627_105109 3300046453 Bacteria 804
535 Ga0495592_0000017 3300046454 Bacteria 142442
536 Ga0495592_0144855 3300046454 Bacteria 1648
537 Ga0495592_0170942 3300046454 Bacteria 1488
538 Ga0495603_0087387 3300046455 Bacteria 1824
539 Ga0495629_0002872 3300046459 Bacteria 13167
540 Ga0495629_0072839 3300046459 Bacteria 2399
541 Ga0495629_0144812 3300046459 Bacteria 1653
542 Ga0495629_0175724 3300046459 Bacteria 1485
543 Ga0495629_0557934 3300046459 Bacteria 768
544 Ga0495638_0034957 3300046460 Bacteria 3205
545 Ga0495641_0038510 3300046461 Bacteria 2233
546 Ga0495641_0064141 3300046461 Bacteria 1655
547 Ga0495651_0000923 3300046462 Bacteria 22782
548 Ga0495651_0149087 3300046462 Bacteria 1688
549 Ga0495653_0000033 3300046463 Bacteria 131680
550 Ga0495580_0001981 3300046472 Bacteria 18011
551 Ga0495580_0101855 3300046472 Bacteria 1997
552 Ga0495580_0371098 3300046472 Bacteria 967
553 Ga0495582_0007153 3300046473 Bacteria 6200
554 Ga0495582_0189449 3300046473 Bacteria 1173
555 Ga0495605_0092059 3300046474 Bacteria 1404
556 Ga0495639_0004165 3300046475 Bacteria 6200
557 Ga0495639_0013870 3300046475 Bacteria 3483
558 Ga0495662_0024982 3300046476 Bacteria 2885
559 Ga0495662_0170411 3300046476 Bacteria 1073
560 Ga0495662_0171387 3300046476 Bacteria 1069
561 Ga0495664_0000008 3300046477 Bacteria 307158
562 Ga0495664_0004612 3300046477 Bacteria 7535
563 Ga0495584_0019489 3300046491 Bacteria 3446
564 Ga0495594_0246709 3300046499 Bacteria 1017
565 Ga0495607_0200273 3300046501 Bacteria 989
566 Ga0495606_0005524 3300046507 Bacteria 12067
567 Ga0495606_0323154 3300046507 Bacteria 828
568 Ga0495608_0000014 3300046511 Bacteria 221042
569 Ga0495608_0067084 3300046511 Bacteria 2348
570 Ga0495618_0000013 3300046514 Bacteria 168671
571 Ga0495618_0162324 3300046514 Bacteria 1424
572 Ga0495620_0085870 3300046515 Bacteria 1268
573 Ga0495628_0000008 3300046516 Bacteria 284313
574 Ga0495628_0404284 3300046516 Bacteria 997
575 Ga0495628_0405174 3300046516 Bacteria 996
576 Ga0495630_0000797 3300046517 Bacteria 22206
577 Ga0495630_0110073 3300046517 Bacteria 2086
578 Ga0495630_0188388 3300046517 Bacteria 1574
579 Ga0495631_0130069 3300046518 Bacteria 1082
580 Ga0495632_0159955 3300046519 Bacteria 1038
581 Ga0495632_0342932 3300046519 Bacteria 658
582 Ga0495644_0102719 3300046523 Bacteria 1082
583 Ga0495644_0117605 3300046523 Bacteria 1010
584 Ga0495648_0002061 3300046524 Bacteria 19020
585 Ga0495663_0009757 3300046525 Bacteria 2665
586 Ga0495666_0222423 3300046526 Bacteria 864
587 Ga0495652_0000005 3300046529 Bacteria 524368
588 Ga0495652_0112657 3300046529 Bacteria 2185
589 Ga0495652_0133324 3300046529 Bacteria 1963
590 Ga0495652_0207981 3300046529 Bacteria 1480
591 Ga0495665_0045655 3300046531 Bacteria 2327
592 Ga0495665_0053798 3300046531 Bacteria 2128
593 Ga0495665_0081373 3300046531 Bacteria 1703
594 Ga0495640_0000017 3300046533 Bacteria 138688
595 Ga0495640_0027237 3300046533 Bacteria 4124
596 Ga0495640_0057123 3300046533 Bacteria 2664
597 Ga0495640_0120521 3300046533 Bacteria 1706
598 Ga0495640_0182500 3300046533 Bacteria 1337
599 Ga0495587_0000005 3300046536 Bacteria 358412
600 Ga0495598_0065772 3300046537 Bacteria 1129
601 Ga0495597_0296920 3300046542 Bacteria 627
602 Ga0495645_0000007 3300046543 Bacteria 376299
603 Ga0495645_0417515 3300046543 Bacteria 852
604 Ga0495622_0028484 3300046557 Bacteria 2609
605 Ga0495622_0088107 3300046557 Bacteria 1427
606 Ga0495633_0182719 3300046558 Bacteria 965
607 Ga0495667_0000012 3300046559 Bacteria 220967
608 Ga0495667_0227930 3300046559 Bacteria 1188
609 Ga0495656_0006929 3300046615 Bacteria 3986
610 Ga0495656_0057921 3300046615 Bacteria 1679
611 Ga0495656_0227746 3300046615 Bacteria 934
612 Ga0495656_0302253 3300046615 Bacteria 820
613 Ga0495656_0383412 3300046615 Bacteria 733
614 Ga0495668_0101673 3300046616 Bacteria 1572
615 Ga0495668_0142901 3300046616 Bacteria 1310
616 Ga0495634_0000070 3300046642 Bacteria 79664
617 Ga0495634_0038373 3300046642 Bacteria 3267
618 Ga0495634_0051141 3300046642 Bacteria 2773
619 Ga0495634_0081451 3300046642 Bacteria 2117
620 Ga0495611_0067172 3300046648 Bacteria 1636
621 Ga0495625_0250549 3300046660 Bacteria 1150
622 Ga0495635_0000010 3300046663 Bacteria 246385
623 Ga0495635_0054013 3300046663 Bacteria 2767
624 Ga0495635_0380268 3300046663 Bacteria 940
625 Ga0495659_0009015 3300046664 Bacteria 3179
626 Ga0495659_0074123 3300046664 Bacteria 1280
627 Ga0495659_0123352 3300046664 Bacteria 1022
628 Ga0495659_0126862 3300046664 Bacteria 1009
629 Ga0495661_0173568 3300046665 Bacteria 1148
630 Ga0495588_0127023 3300046674 Bacteria 1345
631 Ga0495588_0223297 3300046674 Bacteria 994
632 Ga0495657_0000178 3300046675 Bacteria 57139
633 Ga0495599_0000015 3300046678 Bacteria 175055
634 Ga0495599_0095515 3300046678 Bacteria 1854
635 Ga0495623_0000054 3300046679 Bacteria 70217
636 Ga0495623_0081696 3300046679 Bacteria 1998
637 Ga0495646_0000012 3300046680 Bacteria 185805
638 Ga0495646_0183593 3300046680 Bacteria 1147
639 Ga0495647_0012555 3300046681 Bacteria 2919
640 Ga0495658_0046528 3300046683 Bacteria 2439
641 Ga0495658_0730188 3300046683 Bacteria 634
642 Ga0495669_0148133 3300046684 Bacteria 1110
643 Ga0495613_0026149 3300046689 Bacteria 4349
644 Ga0495613_0132279 3300046689 Bacteria 1786
645 Ga0495613_0136139 3300046689 Bacteria 1757
646 Ga0495613_0754791 3300046689 Bacteria 637
647 Ga0495624_0120885 3300046690 Bacteria 1608
648 Ga0495624_0174723 3300046690 Bacteria 1310
649 Ga0495624_0560915 3300046690 Bacteria 682
650 Ga0495670_0286188 3300046691 Bacteria 882
651 Ga0495600_0000031 3300046809 Bacteria 85535
652 Ga0495600_0440459 3300046809 Bacteria 807
653 Ga0495581_0008126 3300047315 Bacteria 6077
654 Ga0495581_0030914 3300047315 Bacteria 3102
655 Ga0495581_0542199 3300047315 Bacteria 675
656 Ga0495604_0000001 3300047317 Bacteria 708627
657 Ga0495604_0384624 3300047317 Bacteria 926
658 Ga0495674_0000012 3300047319 Bacteria 270651
659 Ga0495674_0031429 3300047319 Bacteria 4823
660 Ga0495674_0100977 3300047319 Bacteria 2455
661 Ga0495674_0205593 3300047319 Bacteria 1632
662 Ga0495672_0189999 3300047320 Bacteria 1033
663 Ga0495676_0136075 3300047321 Bacteria 1767
664 Ga0495680_0003950 3300047322 Bacteria 14337
665 Ga0495680_0450725 3300047322 Bacteria 881
666 Ga0495683_0076690 3300047323 Bacteria 1635
667 Ga0495687_029531 3300047443 Bacteria 2536
668 Ga0495675_0000500 3300047444 Bacteria 25407
669 Ga0495677_0022362 3300047445 Bacteria 2294
670 Ga0495685_155285 3300047447 Bacteria 743
671 Ga0495684_0000021 3300047471 Bacteria 144901
672 Ga0495684_0034017 3300047471 Bacteria 3910
673 Ga0495684_0068810 3300047471 Bacteria 2692
674 Ga0495686_0120040 3300047472 Bacteria 1568
675 Ga0495593_0000387 3300047673 Bacteria 24410
676 Ga0495593_0017042 3300047673 Bacteria 4089
677 Ga0495593_0569691 3300047673 Bacteria 568
678 Ga0495602_0000031 3300048088 Bacteria 141518
679 Ga0495602_0169947 3300048088 Bacteria 1693
680 Ga0496100_0359397 3300048903 Bacteria 1101
681 Ga0496100_0365094 3300048903 Bacteria 1093
682 Ga0496100_0549769 3300048903 Bacteria 893
683 Ga0496101_1245009 3300048904 Bacteria 582
684 Ga0496102_0023604 3300048905 Bacteria 5464
685 Ga0496102_0514371 3300048905 Bacteria 1119
686 Ga0496102_0520218 3300048905 Bacteria 1112
687 Ga0496102_0540613 3300048905 Bacteria 1088
688 Ga0496102_0725131 3300048905 Bacteria 917
689 Ga0496102_0941114 3300048905 Bacteria 785
690 Ga0496103_0015417 3300048906 Bacteria 4547
691 Ga0496103_0227021 3300048906 Bacteria 1201
692 Ga0496104_0007332 3300048907 Bacteria 9737
693 Ga0496104_0050168 3300048907 Bacteria 3938
694 Ga0496104_0277561 3300048907 Bacteria 1589
695 Ga0496104_0509501 3300048907 Bacteria 1114
696 Ga0496105_0002593 3300048908 Bacteria 13143
697 Ga0496105_0172872 3300048908 Bacteria 1770
698 Ga0496106_0017046 3300048909 Bacteria 5376
699 Ga0496106_0040980 3300048909 Bacteria 3469
700 Ga0496106_0041412 3300048909 Bacteria 3452
701 Ga0496106_0317161 3300048909 Bacteria 1251
702 Ga0496106_0530894 3300048909 Bacteria 945
703 Ga0496107_0019184 3300048910 Bacteria 4825
704 Ga0496107_0165905 3300048910 Bacteria 1637
705 Ga0496107_0399873 3300048910 Bacteria 1021
706 Ga0496108_0000730 3300048911 Bacteria 25558
707 Ga0496108_0271318 3300048911 Bacteria 1477
708 Ga0496108_0273076 3300048911 Bacteria 1472
709 Ga0496108_0767680 3300048911 Bacteria 833
710 Ga0496109_0035650 3300048912 Bacteria 4489
711 Ga0496109_0068681 3300048912 Bacteria 3248
712 Ga0496109_0333338 3300048912 Bacteria 1432
713 Ga0496110_0119406 3300048913 Bacteria 2374
714 Ga0496110_0139747 3300048913 Bacteria 2189
715 Ga0496110_0266560 3300048913 Bacteria 1559
716 Ga0496110_0357787 3300048913 Bacteria 1330
717 Ga0496111_0026832 3300048914 Bacteria 4069
718 Ga0496111_0200167 3300048914 Bacteria 1485
719 Ga0496111_0374366 3300048914 Bacteria 1053
720 Ga0496111_0600244 3300048914 Bacteria 806
721 Ga0496112_0001354 3300048915 Bacteria 18644
722 Ga0496112_0036130 3300048915 Bacteria 4817
723 Ga0496112_0072258 3300048915 Bacteria 3410
724 Ga0496112_0379208 3300048915 Bacteria 1355
725 Ga0496113_0001624 3300048916 Bacteria 12662
726 Ga0496113_0026078 3300048916 Bacteria 4175
727 Ga0496113_0042404 3300048916 Bacteria 3362
728 Ga0496113_0440831 3300048916 Bacteria 1046
729 Ga0496114_0294052 3300048917 Bacteria 1433
730 Ga0496115_0330008 3300048918 Bacteria 1246
731 Ga0496115_0475626 3300048918 Bacteria 1006
732 Ga0496115_0546997 3300048918 Bacteria 926
733 Ga0496118_0084793 3300048921 Bacteria 2209
734 Ga0496118_0195075 3300048921 Bacteria 1206
735 Ga0496119_0365651 3300048922 Bacteria 695
736 Ga0496121_0024711 3300048924 Bacteria 5733
737 Ga0496121_0042122 3300048924 Bacteria 3978
738 Ga0496121_0085260 3300048924 Bacteria 2487
739 Ga0496124_0097823 3300048927 Bacteria 2382
740 Ga0496124_0319971 3300048927 Bacteria 1111
741 Ga0496125_0000869 3300048928 Bacteria 48286
742 Ga0496125_0089608 3300048928 Bacteria 2313
743 Ga0496126_0005056 3300048929 Bacteria 15313
744 Ga0496126_0020298 3300048929 Bacteria 6519
745 Ga0496126_0097338 3300048929 Bacteria 2579
746 Ga0496126_0146913 3300048929 Bacteria 2024
747 Ga0496126_0236545 3300048929 Bacteria 1528
748 Ga0496126_0284193 3300048929 Bacteria 1370
749 Ga0501031_0000207 3300049568 Bacteria 33573
750 Ga0501031_0230477 3300049568 Bacteria 1205
751 Ga0501032_0000252 3300049569 Bacteria 44619
752 Ga0501032_0108559 3300049569 Bacteria 1837
753 Ga0501032_0176021 3300049569 Bacteria 1402
754 Ga0501032_0289853 3300049569 Bacteria 1059
755 Ga0501032_0313850 3300049569 Bacteria 1012
756 Ga0501033_0000082 3300049570 Bacteria 89837
757 Ga0501033_0053999 3300049570 Bacteria 2974
758 Ga0501033_0094332 3300049570 Bacteria 2188
759 Ga0501033_0123308 3300049570 Bacteria 1879
760 Ga0501033_0319002 3300049570 Bacteria 1092
761 Ga0501034_0000198 3300049571 Bacteria 113672
762 Ga0501034_0095640 3300049571 Bacteria 2967
763 Ga0501036_0001281 3300049572 Bacteria 19291
764 Ga0501036_0071045 3300049572 Bacteria 2943
765 Ga0501036_0218315 3300049572 Bacteria 1601
766 Ga0501036_0262975 3300049572 Bacteria 1445
767 Ga0501036_0490641 3300049572 Bacteria 1022
768 Ga0501036_0786922 3300049572 Bacteria 784
769 Ga0501037_0000050 3300049573 Bacteria 112824
770 Ga0501037_0110109 3300049573 Bacteria 1984
771 Ga0501037_0193680 3300049573 Bacteria 1439
772 Ga0501038_0000538 3300049574 Bacteria 33271
773 Ga0501038_0084278 3300049574 Bacteria 2674
774 Ga0501038_0508718 3300049574 Bacteria 920
775 Ga0501039_0000366 3300049575 Bacteria 32333
776 Ga0501040_0365553 3300049576 Bacteria 1034
777 Ga0501042_0081623 3300049578 Bacteria 2317
778 Ga0501042_0616593 3300049578 Bacteria 789
779 Ga0501043_0002344 3300049579 Bacteria 16056
780 Ga0501043_0030258 3300049579 Bacteria 4254
781 Ga0501043_0243818 3300049579 Bacteria 1386
782 Ga0501043_0457990 3300049579 Bacteria 957
783 Ga0501046_0000434 3300049580 Bacteria 41950
784 Ga0501047_0000131 3300049581 Bacteria 91079
785 Ga0501047_0014359 3300049581 Bacteria 7530
786 Ga0501047_0063958 3300049581 Bacteria 3549
787 Ga0501047_0077939 3300049581 Bacteria 3187
788 Ga0501047_0106601 3300049581 Bacteria 2683
789 Ga0501047_0234791 3300049581 Bacteria 1686
790 Ga0501048_0000531 3300049582 Bacteria 26809
791 Ga0501048_0259209 3300049582 Bacteria 1235
792 Ga0501067_0000628 3300049583 Bacteria 18974
793 Ga0501067_0081828 3300049583 Bacteria 1790
794 Ga0501068_0000080 3300049584 Bacteria 39376
795 Ga0501069_0001211 3300049585 Bacteria 12577
796 Ga0501070_0005971 3300049586 Bacteria 10376
797 Ga0501070_0013649 3300049586 Bacteria 6844
798 Ga0501070_0083701 3300049586 Bacteria 2641
799 Ga0501070_0223992 3300049586 Bacteria 1542
800 Ga0501070_0415209 3300049586 Bacteria 1087
801 Ga0501070_0416498 3300049586 Bacteria 1085
802 Ga0501070_0634540 3300049586 Bacteria 849
803 Ga0501071_0148282 3300049587 Bacteria 1749
804 Ga0501072_0000378 3300049588 Bacteria 31856
805 Ga0501072_0004379 3300049588 Bacteria 10721
806 Ga0501073_0000062 3300049589 Bacteria 66884
807 Ga0501073_0153891 3300049589 Bacteria 1594
808 Ga0501074_0003814 3300049590 Bacteria 10720
809 Ga0501074_0183894 3300049590 Bacteria 1491
810 Ga0501076_0015345 3300049592 Bacteria 5789
811 Ga0501076_0551364 3300049592 Bacteria 950
812 Ga0501079_0001399 3300049741 Bacteria 17010
813 Ga0501079_0026413 3300049741 Bacteria 4452
814 Ga0501079_0454522 3300049741 Bacteria 1006
815 Ga0501079_0566016 3300049741 Unclassified 894
816 Ga0501080_0009398 3300049742 Bacteria 8917
817 Ga0501080_0020500 3300049742 Bacteria 6121
818 Ga0501080_0097463 3300049742 Bacteria 2730
819 Ga0501080_0431121 3300049742 Bacteria 1183
820 Ga0501080_0528852 3300049742 Bacteria 1052
821 Ga0501080_0563361 3300049742 Bacteria 1014
822 Ga0501081_0086589 3300049743 Bacteria 2200
823 Ga0501083_0000341 3300049744 Bacteria 29641
824 Ga0501035_0000123 3300049822 Bacteria 93734
825 Ga0501035_0066047 3300049822 Bacteria 3211
826 Ga0501035_0165534 3300049822 Bacteria 1912
827 Ga0501035_0229193 3300049822 Bacteria 1583
828 Ga0501035_0252395 3300049822 Bacteria 1497
829 Ga0501035_0381538 3300049822 Bacteria 1175
830 Ga0501035_0808315 3300049822 Bacteria 748
831 Ga0501044_0000100 3300049823 Bacteria 106729
832 Ga0501044_0126607 3300049823 Bacteria 2551
833 Ga0501044_0126655 3300049823 Bacteria 2551
834 Ga0501044_0174023 3300049823 Bacteria 2122
835 Ga0501044_0188795 3300049823 Bacteria 2024
836 Ga0501044_0214286 3300049823 Bacteria 1879
837 Ga0501044_0258970 3300049823 Bacteria 1678
838 Ga0501044_0359323 3300049823 Bacteria 1375
839 Ga0501045_0258667 3300049824 Bacteria 1296
840 Ga0501045_0744012 3300049824 Bacteria 723
841 nmdc:mga03683_171734_c1 3300050489 Bacteria 985
842 nmdc:mga03683_63731_c1 3300050489 Bacteria 1563
843 nmdc:mga03n38_20945_c1 3300050490 Bacteria 2624
844 nmdc:mga03n38_788_c1 3300050490 Bacteria 8412
845 nmdc:mga00v17_113629_c1 3300050491 Bacteria 1719
846 nmdc:mga00v17_193210_c1 3300050491 Bacteria 1315
847 nmdc:mga00v17_78621_c1 3300050491 Bacteria 2056
848 nmdc:mga0yw44_10435_c1 3300050492 Bacteria 4745
849 nmdc:mga0yw44_122929_c1 3300050492 Bacteria 1673
850 nmdc:mga0yw44_280364_c1 3300050492 Bacteria 1114
851 nmdc:mga0yw44_3696_c1 3300050492 Bacteria 6847
852 nmdc:mga0yw44_44332_c1 3300050492 Bacteria 2660
853 nmdc:mga0yw44_68065_c1 3300050492 Bacteria 2201
854 nmdc:mga0yw44_90120_c1 3300050492 Bacteria 1937
855 nmdc:mga0k408_241875_c1 3300050493 Bacteria 1078
856 nmdc:mga06z11_181046_c1 3300050494 Bacteria 1215
857 nmdc:mga06z11_222124_c1 3300050494 Bacteria 1104
858 nmdc:mga04h51_35947_c1 3300050495 Bacteria 1590
859 nmdc:mga07m45_10136_c1 3300050496 Bacteria 4454
860 nmdc:mga07m45_129657_c1 3300050496 Bacteria 1459
861 nmdc:mga07m45_16328_c1 3300050496 Bacteria 3975
862 nmdc:mga05p37_321003_c1 3300050507 Bacteria 1833
863 nmdc:mga05p37_88296_c1 3300050507 Bacteria 3822
864 nmdc:mga09592_136043_c1 3300050508 Bacteria 2116
865 nmdc:mga0qj67_197102_c2 3300050509 Bacteria 1246
866 nmdc:mga0qj67_604368_c1 3300050509 Bacteria 877
867 nmdc:mga06r32_117088_c1 3300050510 Bacteria 2626
868 nmdc:mga06r32_131590_c1 3300050510 Bacteria 2474
869 nmdc:mga06r32_96370_c1 3300050510 Bacteria 2897
870 nmdc:mga08y16_140797_c1 3300050511 Bacteria 2508
871 nmdc:mga08y16_67818_c1 3300050511 Bacteria 3721
872 nmdc:mga0n895_101162_c1 3300050512 Bacteria 2892
873 nmdc:mga0n895_253790_c1 3300050512 Bacteria 1785
874 nmdc:mga0n895_463362_c1 3300050512 Bacteria 1279
875 nmdc:mga0n895_95048_c1 3300050512 Bacteria 2985
876 nmdc:mga0rr50_417374_c1 3300050513 Bacteria 1135
877 nmdc:mga0rr50_50577_c1 3300050513 Bacteria 3080
878 nmdc:mga0rr50_65213_c1 3300050513 Bacteria 2758
879 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
880 nmdc:mga0sz30_51290_c1 3300050516 Bacteria 1750
881 nmdc:mga0sz30_59676_c1 3300050516 Bacteria 1628
882 Ga0495601_0000011 3300053077 Bacteria 264937
883 Ga0495601_0022853 3300053077 Bacteria 3842
884 Ga0495601_0107727 3300053077 Bacteria 1803
885 Ga0495601_0121375 3300053077 Bacteria 1697
886 Ga0495612_0000006 3300053078 Bacteria 269278
887 Ga0495612_0020737 3300053078 Bacteria 2635
888 Ga0495612_0153925 3300053078 Bacteria 1002
889 Ga0495655_0033841 3300053083 Bacteria 1260
890 Ga0495595_0000021 3300053084 Bacteria 115921
891 Ga0495595_0038918 3300053084 Bacteria 2168
892 Ga0495595_0059378 3300053084 Bacteria 1788
893 Ga0495619_0000013 3300053085 Bacteria 264865
894 Ga0495619_0012966 3300053085 Bacteria 5251
895 Ga0495619_0034640 3300053085 Bacteria 3283
896 Ga0500646_0018789 3300053090 Bacteria 1824
897 Ga0500566_0000055 3300053094 Bacteria 54414
898 Ga0500641_0010703 3300053096 Bacteria 3321
899 Ga0500641_0027147 3300053096 Bacteria 2228
900 Ga0500594_0183732 3300053118 Bacteria 683
901 Ga0500608_084422 3300053122 Bacteria 1493
902 Ga0500617_190207 3300053124 Bacteria 765
903 Ga0500658_0055005 3300053134 Bacteria 1637
904 Ga0500559_0000362 3300053136 Bacteria 33750
905 Ga0500559_0100450 3300053136 Bacteria 1332
906 Ga0500568_0033662 3300053139 Bacteria 2101
907 Ga0500589_082946 3300053147 Bacteria 1427
908 Ga0500633_0197384 3300053160 Bacteria 753
909 Ga0500636_0001777 3300053177 Bacteria 11806
910 Ga0500637_0139649 3300053178 Bacteria 1403
911 Ga0500645_021788 3300053730 Bacteria 1975
912 Ga0501084_0019061 3300054114 Bacteria 5714
913 Ga0501084_0027413 3300054114 Bacteria 4760
914 Ga0501084_0121841 3300054114 Bacteria 2193
915 Ga0501082_0001776 3300060353 Bacteria 18967
916 Ga0501082_0081197 3300060353 Bacteria 2798
917 Ga0501082_0251508 3300060353 Bacteria 1538
918 Ga0466962_0074710 3300061719 Bacteria 1620
919 Ga0466962_0454593 3300061719 Bacteria 645
920 Ga0530510_0007398 3300061734 Bacteria 7644
921 Ga0530510_1019593 3300061734 Bacteria 633
922 2507505433 2507262055 Bacteria 8048963
923 2509152162 2508501128 Bacteria 8613869
924 2511399107 2511231028 Bacteria 8046582
925 2513623943 2513237092 Bacteria 8341956
926 2513675813 2513237098 Bacteria 9902361
927 2513695270 2513237101 Bacteria 7952346
928 2513873367 2513237139 Bacteria 8737671
929 2513888597 2513237141 Bacteria 8496279
930 2514014697 2513237161 Bacteria 8871253
931 2524441424 2524023205 Bacteria 8918781
932 2528853336 2528768022 Bacteria 10457665
933 2617352078 2617270735 Bacteria 9163226
934 2644291076 2643221651 Bacteria 4798932
935 2723841804 2721755755 Bacteria 8322773
936 2793062217 2791355196 Bacteria 7323613
937 2805920715 2802429603 Bacteria 8777136
938 2824670006 2824661429 Bacteria 9877870
939 2824676593 2824671348 Bacteria 8369588
940 2824693255 2824687955 Bacteria 8360029
941 2824702624 2824696289 Bacteria 8335049
942 2824713730 2824704595 Bacteria 9667483
943 2824761773 2824753945 Bacteria 9787441
944 2824772272 2824763712 Bacteria 9792355
945 2824780862 2824773399 Bacteria 8360218
946 2838124678 2838122688 Bacteria 8803140
947 2841945370 2841941048 Bacteria 8688029
948 2841952155 2841949485 Bacteria 8680857
949 2841965364 2841957949 Bacteria 8652217
950 2841970457 2841966195 Bacteria 8673214
951 2841981705 2841974524 Bacteria 8931498
952 2841984986 2841983080 Bacteria 8395090
953 2847942321 2847939898 Bacteria 8606328
954 2874617998 2874612657 Bacteria 8252029
955 2874621222 2874620515 Bacteria 8290088
956 2876814206 2876808645 Bacteria 8824342
957 2879099907 2879099564 Bacteria 10442239
958 2879113331 2879110137 Bacteria 8907982
959 2885369353 2885366525 Bacteria 8326213
960 2888390519 2888388044 Bacteria 7304136
961 2893067492 2893066018 Bacteria 6158120
962 2904667767 2904666416 Bacteria 8226587
963 2904716348 2904711408 Bacteria 9771557
964 2922363189 2922361189 Bacteria 7436256
965 2922369407
966 2922388506 2922386360 Bacteria 7017218
967 2922400045 2922393267 Bacteria 8285685
968 2929618765 2929615660 Bacteria 9193770
969 2929628550 2929624759 Bacteria 9339455
970 2932790947 2932784394 Bacteria 9704911
971 2932812000 2932809354 Bacteria 9135765
972 2932825549 2932818245 Bacteria 9955613
973 2932833663 2932828146 Bacteria 9745859
974 2933580525 2933577622 Bacteria 9116884
975 2935615539 2935608549 Bacteria 8203142
976 2935623189 2935616580 Bacteria 9032984
977 2935644264 2935638405 Bacteria 10015038
978 2935672154 2935665750 Bacteria 9571747
979 2935679325 2935675223 Bacteria 9928132
980 2935686566 2935684952 Bacteria 9590419
981 2935700349 2935694250 Bacteria 9291695
982 2935710297 2935703347 Bacteria 10242284
983 2935716254 2935713505 Bacteria 9608509
984 2935723622 2935722832 Bacteria 9608746
985 2935735177 2935732158 Bacteria 9706831
986 2935744032 2935741537 Bacteria 9707219
987 2935752532 2935750917 Bacteria 9590372
988 2935763334 2935760218 Bacteria 9817913
989 2935772882 2935769743 Bacteria 7878163
990 2935783327 2935777560 Bacteria 8077691
991 2935788130 2935785616 Bacteria 7962367
992 2935796294 2935793552 Bacteria 8012592
993 2935808288 2935801545 Bacteria 9301974
994 2935816099 2935810662 Bacteria 9401221
995 2935825660 2935819856 Bacteria 8261050
996 2935833492 2935827899 Bacteria 10038562
997 2935845950 2935837841 Bacteria 9454360
998 2935853424 2935847175 Bacteria 8228321
999 2935861437 2935855204 Bacteria 9035059
1000 2935869556 2935864058 Bacteria 9784707
1001 2935879885 2935873716 Bacteria 9632195
1002 2935915026 2935908558 Bacteria 8568796
1003 2935918874 2935916978 Bacteria 9113783
1004 2935931409 2935926038 Bacteria 8601059
1005 2935940006 2935934488 Bacteria 8602579
1006 2935947647 2935942939 Bacteria 8599779
1007 2935956418 2935951376 Bacteria 8602333
1008 2935973212 2935967501 Bacteria 8603075
1009 2935997892 2935992306 Bacteria 9802711
1010 2936008843 2936002035 Bacteria 9362176
1011 2936041104 2936037263 Bacteria 9446081
1012 2940558445 2940556831 Bacteria 9590747
1013 2941547119 2941538514 Bacteria 9402094
1014 3005594119 3005587118 Bacteria 7794411
1015 3005718455 3005718088 Bacteria 8283608
1016 8016526309 8016522445 Bacteria 8156687
1017 8016531370 8016530956 Bacteria 8155261
1018 8016544585 8016539877 Bacteria 8155419
1019 8016557492 8016548790 Bacteria 8155074
1020 8016565848 8016557553 Bacteria 8154380
1021 8016569636 8016566248 Bacteria 8158151
1022 8016582246 8016575299 Bacteria 8154085
1023 8016603447 8016595262 Bacteria 8149947
1024 8016606385 8016603502 Bacteria 8731218
1025 8016618292 8016613128 Bacteria 8794220
1026 8016622941 8016622563 Bacteria 7999408
1027 8016635445 8016630954 Bacteria 9217207
1028 8017058631 8017057580 Bacteria 10023680
1029 8019531203 8019530166 Bacteria 8155624
1030 8019540350 8019538911 Bacteria 7872763
1031 8019549941 8019547302 Bacteria 7996444
1032 8019577028 8019576017 Bacteria 10049540
1033 8019595095 8019586578 Bacteria 10212056
1034 8019606646 8019597564 Bacteria 10041141
1035 8019611865 8019608314 Bacteria 10042931
1036 8019696068 8019687851 Bacteria 8712826
1037 8055742614 8055742211 Bacteria 9226248
1038 8056676122 8056673599 Bacteria 7871253
1039 Ga0500577_0001713
1040 JGI24748J21848_1015566
1041 JGI24744J21845_10029693
1042 JGI24034J26672_10001856
1043 JGI25406J46586_10001038
1044 JGI25165J46597_1006459
1045 JGI25160J50197_1024431
1046 JGI25404J52841_10019750
1047 Ga0070676_10056764
1048 Ga0070676_10622566
1049 Ga0070683_100020477
1050 Ga0070683_100623998
1051 Ga0070690_100213100
1052 Ga0070670_100010392
1053 Ga0070670_100028895
1054 Ga0068869_100053668
1055 Ga0068869_100064712
1056 Ga0068869_100118320
1057 Ga0070666_10068506
1058 Ga0070682_100084056
1059 Ga0068868_100007925
1060 Ga0070660_100057694
1061 Ga0070660_100057834
1062 Ga0070660_100323095
1063 Ga0070689_100088421
1064 Ga0070689_100138358
1065 Ga0070691_10006615
1066 Ga0070687_100003213
1067 Ga0070661_100030649
1068 Ga0070692_10177695
1069 Ga0070668_100039652
1070 Ga0070668_100295771
1071 Ga0070668_100813431
1072 Ga0070668_101030464
1073 Ga0070669_100432359
1074 Ga0070675_100023243
1075 Ga0070671_100062961
1076 Ga0070671_100112638
1077 Ga0070671_100157830
1078 Ga0070671_100275964
1079 Ga0070671_100339358
1080 Ga0070671_100463907
1081 Ga0070674_100030585
1082 Ga0070674_100113963
1083 Ga0070673_100373110
1084 Ga0070673_100942078
1085 Ga0070688_100019458
1086 Ga0070688_100516109
1087 Ga0070659_100120020
1088 Ga0070714_100172604
1089 Ga0070714_100204994
1090 Ga0070714_100329444
1091 Ga0070714_100490107
1092 Ga0070713_100022398
1093 Ga0070710_10205902
1094 Ga0070710_10289417
1095 Ga0070710_10653984
1096 Ga0070711_100027826
1097 Ga0070705_100093111
1098 Ga0070705_100115636
1099 Ga0070700_100003506
1100 Ga0070700_100709663
1101 Ga0070694_100248261
1102 Ga0070663_100034543
1103 Ga0070663_100077506
1104 Ga0070663_100306136
1105 Ga0070663_100399998
1106 Ga0070678_100118683
1107 Ga0070678_100302100
1108 Ga0070678_100411880
1109 Ga0070678_100895577
1110 Ga0070662_100037362
1111 Ga0070662_100104780
1112 Ga0070662_100251296
1113 Ga0070662_100689437
1114 Ga0070681_10001077
1115 Ga0068867_100047596
1116 Ga0070706_100301548
1117 Ga0070706_100587753
1118 Ga0070698_100112123
1119 Ga0070699_100389715
1120 Ga0070679_100074727
1121 Ga0070679_100236261
1122 Ga0070679_100414616
1123 Ga0070684_100014169
1124 Ga0070684_100337678
1125 Ga0070684_100503733
1126 Ga0070697_100017648
1127 Ga0070697_100103441
1128 Ga0070697_100898578
1129 Ga0068853_100076989
1130 Ga0068853_100173008
1131 Ga0068853_100508823
1132 Ga0068853_100601593
1133 Ga0068853_100673696
1134 Ga0070672_100228804
1135 Ga0070686_100025193
1136 Ga0070686_100375672
1137 Ga0070695_100033091
1138 Ga0070695_100214825
1139 Ga0070696_100279755
1140 Ga0070696_100354646
1141 Ga0070693_100155781
1142 Ga0070693_100512607
1143 Ga0070665_100112414
1144 Ga0070665_100316202
1145 Ga0070665_100881387
1146 Ga0070704_100129559
1147 Ga0070704_100264046
1148 Ga0068855_100114024
1149 Ga0068855_100204516
1150 Ga0068855_100627042
1151 Ga0068855_100748238
1152 Ga0070664_100337346
1153 Ga0070664_100576173
1154 Ga0070664_100784140
1155 Ga0068857_100278299
1156 Ga0068857_100484269
1157 Ga0068854_100160519
1158 Ga0068854_100174960
1159 Ga0068854_100738504
1160 Ga0068856_100125157
1161 Ga0068852_100174137
1162 Ga0068859_100847664
1163 Ga0068864_100194607
1164 Ga0068864_100229416
1165 Ga0068864_100864787
1166 Ga0068866_10080314
1167 Ga0068866_10446678
1168 Ga0068861_100068282
1169 Ga0068861_100211907
1170 Ga0068861_100240542
1171 Ga0068861_100639319
1172 Ga0068851_10177294
1173 Ga0068870_10046750
1174 Ga0068863_100040383
1175 Ga0068863_100074859
1176 Ga0068858_100082321
1177 Ga0068858_100499880
1178 Ga0068860_100153938
1179 Ga0068860_100180429
1180 Ga0068860_100457375
1181 Ga0068862_100024856
1182 Ga0068862_100132689
1183 Ga0068862_100684986
1184 Ga0081455_10012728
1185 Ga0081538_10039257
1186 Ga0081538_10054534
1187 Ga0081540_1005580
1188 Ga0081540_1011553
1189 Ga0081540_1030748
1190 Ga0081539_10003753
1191 Ga0070717_10053860
1192 Ga0070717_10097051
1193 Ga0070717_10184325
1194 Ga0075365_10017305
1195 Ga0075365_10053169
1196 Ga0075365_10088470
1197 Ga0075365_10132189
1198 Ga0075365_10153342
1199 Ga0075365_10411198
1200 Ga0075365_10521979
1201 Ga0075368_10064064
1202 Ga0075368_10163385
1203 Ga0075368_10193756
1204 Ga0075363_100007350
1205 Ga0075363_100020186
1206 Ga0075363_100050348
1207 Ga0075363_100114480
1208 Ga0075364_10119152
1209 Ga0075364_10301488
1210 Ga0075432_10243891
1211 Ga0070716_100189041
1212 Ga0070712_100073352
1213 Ga0070712_100416949
1214 Ga0075362_10076051
1215 Ga0075362_10328986
1216 Ga0075367_10383067
1217 Ga0075369_10055303
1218 Ga0075366_10078725
1219 Ga0097621_100608306
1220 Ga0075370_10011007
1221 Ga0075370_10141709
1222 Ga0075370_10380472
1223 Ga0068871_100133308
1224 Ga0068871_100275435
1225 Ga0068871_100535863
1226 Ga0075428_100067213
1227 Ga0075428_100082208
1228 Ga0075428_100279196
1229 Ga0075428_100968415
1230 Ga0075434_100074886
1231 Ga0075434_100106463
1232 Ga0075429_100020262
1233 Ga0097620_100847644
1234 Ga0075435_100066208
1235 Ga0075435_100108578
1236 Ga0075435_100151663
1237 Ga0099795_10256232
1238 Ga0105240_10082975
1239 Ga0105240_10197980
1240 Ga0105240_10225649
1241 Ga0111539_10061009
1242 Ga0111539_10246353
1243 Ga0111539_10514348
1244 Ga0105245_10004490
1245 Ga0105245_10747765
1246 Ga0105247_10009526
1247 Ga0105247_10319158
1248 Ga0114129_10052932
1249 Ga0114129_10106009
1250 Ga0114129_10188583
1251 Ga0114129_10245258
1252 Ga0114129_10329128
1253 Ga0114129_11481406
1254 Ga0105243_10038961
1255 Ga0105241_10209378
1256 Ga0105242_10071965
1257 Ga0105242_10282440
1258 Ga0105248_10043760
1259 Ga0105248_10047926
1260 Ga0105248_11158480
1261 Ga0105237_10066600
1262 Ga0105237_10224102
1263 Ga0105237_10383874
1264 Ga0105237_10398432
1265 Ga0105237_10618893
1266 Ga0105238_10063695
1267 Ga0105249_10875503
1268 Ga0105249_11182661
1269 Ga0105249_11615535
1270 Ga0099796_10037348
1271 Ga0105239_10022916
1272 Ga0105239_10199912
1273 Ga0105239_10413335
1274 Ga0105239_10652501
1275 Ga0105239_10683262
1276 Ga0105239_10957711
1277 Ga0105239_11375953
1278 Ga0105246_10139948
1279 Ga0157373_10039123
1280 Ga0157373_10287352
1281 Ga0157370_10028400
1282 Ga0157370_10240116
1283 Ga0157370_10354160
1284 Ga0157370_10485370
1285 Ga0157369_10071589
1286 Ga0157369_10096664
1287 Ga0157369_10155843
1288 Ga0157374_11159214
1289 Ga0157378_10379274
1290 Ga0163162_10179236
1291 Ga0163162_11343367
1292 Ga0157372_10103182
1293 Ga0157372_10223986
1294 Ga0157372_10270361
1295 Ga0157375_10445206
1296 Ga0157375_10632210
1297 Ga0163163_10021857
1298 Ga0157380_10199597
1299 Ga0157380_10582045
1300 Ga0157380_10608921
1301 Ga0157379_10060482
1302 Ga0157379_11537911
1303 Ga0157376_10140354
1304 Ga0157376_10231976
1305 Ga0157376_10862821
1306 Ga0163161_10056894
1307 Ga0163161_10314649
1308 Ga0224572_1015081
1309 Ga0228598_1007284
1310 Ga0209233_1008253
1311 Ga0209564_1005467
1312 Ga0209758_1001013
1313 Ga0209758_1005533
1314 Ga0209256_1017459
1315 Ga0207426_1002838
1316 Ga0207426_1012013
1317 Ga0209257_1035057
1318 Ga0207697_10111736
1319 Ga0207653_10012696
1320 Ga0207692_10199440
1321 Ga0207710_10044330
1322 Ga0207710_10217270
1323 Ga0207710_10257003
1324 Ga0207688_10015244
1325 Ga0207688_10157215
1326 Ga0207688_10164260
1327 Ga0207680_10010978
1328 Ga0207647_10048127
1329 Ga0207647_10161162
1330 Ga0207647_10210080
1331 Ga0207685_10066599
1332 Ga0207685_10072500
1333 Ga0207699_10632587
1334 Ga0207645_10018488
1335 Ga0207645_10067939
1336 Ga0207643_10001362
1337 Ga0207707_10001830
1338 Ga0207695_10030631
1339 Ga0207695_10293819
1340 Ga0207671_10275622
1341 Ga0207693_10029152
1342 Ga0207693_10203572
1343 Ga0207663_10204296
1344 Ga0207660_10189206
1345 Ga0207660_10215906
1346 Ga0207662_10001498
1347 Ga0207662_10181724
1348 Ga0207657_10022399
1349 Ga0207657_10045121
1350 Ga0207649_10192546
1351 Ga0207652_10076567
1352 Ga0207652_10078201
1353 Ga0207681_10336781
1354 Ga0207650_10006398
1355 Ga0207650_10042065
1356 Ga0207650_10103609
1357 Ga0207659_10047121
1358 Ga0207687_10022847
1359 Ga0207687_10031317
1360 Ga0207687_10076681
1361 Ga0207700_10391156
1362 Ga0207664_10447650
1363 Ga0207644_10116107
1364 Ga0207644_10276846
1365 Ga0207644_10316939
1366 Ga0207644_10346071
1367 Ga0207644_10444596
1368 Ga0207644_10749855
1369 Ga0207690_10569055
1370 Ga0207706_10004857
1371 Ga0207706_10055965
1372 Ga0207706_10186712
1373 Ga0207706_10377744
1374 Ga0207686_10153786
1375 Ga0207709_10007603
1376 Ga0207670_10010018
1377 Ga0207669_10021340
1378 Ga0207669_10027600
1379 Ga0207669_10101165
1380 Ga0207665_10104335
1381 Ga0207665_10491769
1382 Ga0207691_10006388
1383 Ga0207711_10154538
1384 Ga0207711_10168163
1385 Ga0207689_10011143
1386 Ga0207689_10105243
1387 Ga0207689_10246990
1388 Ga0207689_10301956
1389 Ga0207661_10004360
1390 Ga0207661_10235294
1391 Ga0207661_10995580
1392 Ga0207679_10159939
1393 Ga0207667_10016003
1394 Ga0207667_10086452
1395 Ga0207667_10736113
1396 Ga0207651_10859856
1397 Ga0207712_10120991
1398 Ga0207712_10261168
1399 Ga0207712_10310291
1400 Ga0207668_10014153
1401 Ga0207668_10042564
1402 Ga0207668_10214148
1403 Ga0207668_10249287
1404 Ga0207668_10249554
1405 Ga0207640_10151819
1406 Ga0207640_10638546
1407 Ga0207640_10867510
1408 Ga0207658_10083707
1409 Ga0207658_10102777
1410 Ga0207703_10132048
1411 Ga0207703_10457850
1412 Ga0207703_10598827
1413 Ga0207639_10117753
1414 Ga0207678_10008802
1415 Ga0207678_10023605
1416 Ga0207678_10035784
1417 Ga0207678_10042691
1418 Ga0207678_10066177
1419 Ga0207708_10048288
1420 Ga0207702_10048122
1421 Ga0207702_10199613
1422 Ga0207702_10469132
1423 Ga0207641_10064481
1424 Ga0207641_10177570
1425 Ga0207641_10363258
1426 Ga0207648_10034157
1427 Ga0207648_10060278
1428 Ga0207676_10069096
1429 Ga0207676_10134973
1430 Ga0207676_10836273
1431 Ga0207674_10100669
1432 Ga0207674_10222249
1433 Ga0207674_10442281
1434 Ga0207674_10543883
1435 Ga0207674_10685190
1436 Ga0207675_100007482
1437 Ga0207675_100066389
1438 Ga0207675_100220968
1439 Ga0207675_100739936
1440 Ga0207683_10003631
1441 Ga0207683_10312823
1442 Ga0207683_10819124
1443 Ga0207698_10033869
1444 Ga0207428_10073687
1445 Ga0268266_10012729
1446 Ga0268266_10039111
1447 Ga0268266_10065598
1448 Ga0268265_10103924
1449 Ga0268265_10235425
1450 Ga0268265_10615805
1451 Ga0268264_10414187
1452 Ga0265762_1046092
1453 Ga0265770_1019529
1454 Ga0265760_10018660
1455 Ga0265332_10012491
1456 Ga0265325_10208551
1457 Ga0265329_10048481
1458 Ga0265340_10014138
1459 Ga0265340_10115228
1460 Ga0265339_10000738
1461 Ga0265339_10003900
1462 Ga0265331_10059574
1463 Ga0265316_10100060
1464 Ga0265316_10227539
1465 Ga0265314_10037456
1466 Ga0265342_10003180
1467 Ga0307516_10294049
1468 Ga0307405_10514475
1469 Ga0307405_10614393
1470 Ga0307405_10742955
1471 Ga0307413_10052158
1472 Ga0307410_10343301
1473 Ga0307409_100312813
1474 Ga0307416_100204452
1475 Ga0307416_100484234
1476 Ga0307416_100530292
1477 Ga0307411_10330782
1478 Ga0307411_11216227
1479 Ga0316215_1003830
1480 Ga0373934_0112658
1481 Ga0373934_0135590
1482 Ga0373944_0011826
1483 Ga0373923_0031514
1484 Ga0373923_0052729
1485 Ga0373932_0042705
1486 Ga0373936_0014580
1487 Ga0373936_0255942
1488 Ga0373945_0127093
1489 Ga0373953_0002353
1490 Ga0373953_0015566
1491 Ga0373953_0018502
1492 Ga0373954_0000445
1493 Ga0373954_0059464
1494 Ga0373957_0003642
1495 Ga0373943_0001478
1496 Ga0373943_0009727
1497 Ga0373943_0074622
1498 Ga0373946_0025069
1499 Ga0373946_0025985
1500 Ga0373955_0010529
1501 Ga0373955_0045870
1502 Ga0373955_0369992
1503 Ga0373955_0620458
1504 Ga0373962_0034959
1505 Ga0373924_0001214
1506 Ga0373931_0329262
1507 Ga0373935_0000011
1508 Ga0373935_0153636
1509 Ga0373935_0204999
1510 Ga0373935_0403449
1511 Ga0373927_0004771
1512 Ga0373927_0090551
1513 Ga0373927_0125649
1514 Ga0373927_0229844
1515 Ga0373927_0420980
1516 Ga0373927_0704138
1517 Ga0373933_0000885
1518 Ga0373933_0131778
1519 Ga0373947_0002928
1520 Ga0373947_0034346
1521 Ga0373947_0038544
1522 Ga0373947_0051017
1523 Ga0373947_0225814
1524 Ga0373947_0414913
1525 Ga0373937_0000019
1526 Ga0373937_0015685
1527 Ga0373937_0046562
1528 Ga0372808_000548
1529 Ga0373925_0000026
1530 Ga0373925_0012279
1531 Ga0373925_0222298
1532 Ga0373925_0226244
1533 Ga0395899_0038502
1534 Ga0395900_0023057
1535 Ga0395900_0106625
1536 Ga0395898_0158837
1537 Ga0395901_0031964
1538 Ga0395901_0240778
1539 Ga0436365_0422270
1540 Ga0436365_1141354
1541 Ga0436365_1142518
1542 Ga0436365_1392289
1543 Ga0436365_1525977
1544 Ga0436360_0035660
1545 Ga0436361_0034753
1546 Ga0436361_0474226
1547 Ga0436361_0808590
1548 Ga0436361_0817855
1549 Ga0436363_1010904
1550 Ga0436362_0798067
1551 Ga0451789_0678307
1552 Ga0451795_1160684
1553 Ga0451841_1435836
1554 Ga0451851_0182072
1555 Ga0451853_1644141
1556 Ga0466969_0039705
1557 Ga0466969_0120617
1558 Ga0466972_0008421
1559 Ga0466966_0056008
1560 Ga0466961_0190673
1561 Ga0466963_0050147
1562 Ga0466963_0082044
1563 Ga0466963_0358876
1564 Ga0466964_0036301
1565 Ga0466968_0002099
1566 Ga0466970_0142879
1567 Ga0466959_0014935
1568 Ga0466959_0090922
1569 Ga0466958_0008120
1570 Ga0466967_0281578
1571 Ga0466967_0348758
1572 Ga0495627_105109
1573 Ga0495592_0000017
1574 Ga0495592_0144855
1575 Ga0495592_0170942
1576 Ga0495603_0087387
1577 Ga0495629_0002872
1578 Ga0495629_0072839
1579 Ga0495629_0144812
1580 Ga0495629_0175724
1581 Ga0495629_0557934
1582 Ga0495638_0034957
1583 Ga0495641_0038510
1584 Ga0495641_0064141
1585 Ga0495651_0000923
1586 Ga0495651_0149087
1587 Ga0495653_0000033
1588 Ga0495580_0001981
1589 Ga0495580_0101855
1590 Ga0495580_0371098
1591 Ga0495582_0007153
1592 Ga0495582_0189449
1593 Ga0495605_0092059
1594 Ga0495639_0004165
1595 Ga0495639_0013870
1596 Ga0495662_0024982
1597 Ga0495662_0170411
1598 Ga0495662_0171387
1599 Ga0495664_0000008
1600 Ga0495664_0004612
1601 Ga0495584_0019489
1602 Ga0495594_0246709
1603 Ga0495607_0200273
1604 Ga0495606_0005524
1605 Ga0495606_0323154
1606 Ga0495608_0000014
1607 Ga0495608_0067084
1608 Ga0495618_0000013
1609 Ga0495618_0162324
1610 Ga0495620_0085870
1611 Ga0495628_0000008
1612 Ga0495628_0404284
1613 Ga0495628_0405174
1614 Ga0495630_0000797
1615 Ga0495630_0110073
1616 Ga0495630_0188388
1617 Ga0495631_0130069
1618 Ga0495632_0159955
1619 Ga0495632_0342932
1620 Ga0495644_0102719
1621 Ga0495644_0117605
1622 Ga0495648_0002061
1623 Ga0495663_0009757
1624 Ga0495666_0222423
1625 Ga0495652_0000005
1626 Ga0495652_0112657
1627 Ga0495652_0133324
1628 Ga0495652_0207981
1629 Ga0495665_0045655
1630 Ga0495665_0053798
1631 Ga0495665_0081373
1632 Ga0495640_0000017
1633 Ga0495640_0027237
1634 Ga0495640_0057123
1635 Ga0495640_0120521
1636 Ga0495640_0182500
1637 Ga0495587_0000005
1638 Ga0495598_0065772
1639 Ga0495597_0296920
1640 Ga0495645_0000007
1641 Ga0495645_0417515
1642 Ga0495622_0028484
1643 Ga0495622_0088107
1644 Ga0495633_0182719
1645 Ga0495667_0000012
1646 Ga0495667_0227930
1647 Ga0495656_0006929
1648 Ga0495656_0057921
1649 Ga0495656_0227746
1650 Ga0495656_0302253
1651 Ga0495656_0383412
1652 Ga0495668_0101673
1653 Ga0495668_0142901
1654 Ga0495634_0000070
1655 Ga0495634_0038373
1656 Ga0495634_0051141
1657 Ga0495634_0081451
1658 Ga0495611_0067172
1659 Ga0495625_0250549
1660 Ga0495635_0000010
1661 Ga0495635_0054013
1662 Ga0495635_0380268
1663 Ga0495659_0009015
1664 Ga0495659_0074123
1665 Ga0495659_0123352
1666 Ga0495659_0126862
1667 Ga0495661_0173568
1668 Ga0495588_0127023
1669 Ga0495588_0223297
1670 Ga0495657_0000178
1671 Ga0495599_0000015
1672 Ga0495599_0095515
1673 Ga0495623_0000054
1674 Ga0495623_0081696
1675 Ga0495646_0000012
1676 Ga0495646_0183593
1677 Ga0495647_0012555
1678 Ga0495658_0046528
1679 Ga0495658_0730188
1680 Ga0495669_0148133
1681 Ga0495613_0026149
1682 Ga0495613_0132279
1683 Ga0495613_0136139
1684 Ga0495613_0754791
1685 Ga0495624_0120885
1686 Ga0495624_0174723
1687 Ga0495624_0560915
1688 Ga0495670_0286188
1689 Ga0495600_0000031
1690 Ga0495600_0440459
1691 Ga0495581_0008126
1692 Ga0495581_0030914
1693 Ga0495581_0542199
1694 Ga0495604_0000001
1695 Ga0495604_0384624
1696 Ga0495674_0000012
1697 Ga0495674_0031429
1698 Ga0495674_0100977
1699 Ga0495674_0205593
1700 Ga0495672_0189999
1701 Ga0495676_0136075
1702 Ga0495680_0003950
1703 Ga0495680_0450725
1704 Ga0495683_0076690
1705 Ga0495687_029531
1706 Ga0495675_0000500
1707 Ga0495677_0022362
1708 Ga0495685_155285
1709 Ga0495684_0000021
1710 Ga0495684_0034017
1711 Ga0495684_0068810
1712 Ga0495686_0120040
1713 Ga0495593_0000387
1714 Ga0495593_0017042
1715 Ga0495593_0569691
1716 Ga0495602_0000031
1717 Ga0495602_0169947
1718 Ga0496100_0359397
1719 Ga0496100_0365094
1720 Ga0496100_0549769
1721 Ga0496101_1245009
1722 Ga0496102_0023604
1723 Ga0496102_0514371
1724 Ga0496102_0520218
1725 Ga0496102_0540613
1726 Ga0496102_0725131
1727 Ga0496102_0941114
1728 Ga0496103_0015417
1729 Ga0496103_0227021
1730 Ga0496104_0007332
1731 Ga0496104_0050168
1732 Ga0496104_0277561
1733 Ga0496104_0509501
1734 Ga0496105_0002593
1735 Ga0496105_0172872
1736 Ga0496106_0017046
1737 Ga0496106_0040980
1738 Ga0496106_0041412
1739 Ga0496106_0317161
1740 Ga0496106_0530894
1741 Ga0496107_0019184
1742 Ga0496107_0165905
1743 Ga0496107_0399873
1744 Ga0496108_0000730
1745 Ga0496108_0271318
1746 Ga0496108_0273076
1747 Ga0496108_0767680
1748 Ga0496109_0035650
1749 Ga0496109_0068681
1750 Ga0496109_0333338
1751 Ga0496110_0119406
1752 Ga0496110_0139747
1753 Ga0496110_0266560
1754 Ga0496110_0357787
1755 Ga0496111_0026832
1756 Ga0496111_0200167
1757 Ga0496111_0374366
1758 Ga0496111_0600244
1759 Ga0496112_0001354
1760 Ga0496112_0036130
1761 Ga0496112_0072258
1762 Ga0496112_0379208
1763 Ga0496113_0001624
1764 Ga0496113_0026078
1765 Ga0496113_0042404
1766 Ga0496113_0440831
1767 Ga0496114_0294052
1768 Ga0496115_0330008
1769 Ga0496115_0475626
1770 Ga0496115_0546997
1771 Ga0496118_0084793
1772 Ga0496118_0195075
1773 Ga0496119_0365651
1774 Ga0496121_0024711
1775 Ga0496121_0042122
1776 Ga0496121_0085260
1777 Ga0496124_0097823
1778 Ga0496124_0319971
1779 Ga0496125_0000869
1780 Ga0496125_0089608
1781 Ga0496126_0005056
1782 Ga0496126_0020298
1783 Ga0496126_0097338
1784 Ga0496126_0146913
1785 Ga0496126_0236545
1786 Ga0496126_0284193
1787 Ga0501031_0000207
1788 Ga0501031_0230477
1789 Ga0501032_0000252
1790 Ga0501032_0108559
1791 Ga0501032_0176021
1792 Ga0501032_0289853
1793 Ga0501032_0313850
1794 Ga0501033_0000082
1795 Ga0501033_0053999
1796 Ga0501033_0094332
1797 Ga0501033_0123308
1798 Ga0501033_0319002
1799 Ga0501034_0000198
1800 Ga0501034_0095640
1801 Ga0501036_0001281
1802 Ga0501036_0071045
1803 Ga0501036_0218315
1804 Ga0501036_0262975
1805 Ga0501036_0490641
1806 Ga0501036_0786922
1807 Ga0501037_0000050
1808 Ga0501037_0110109
1809 Ga0501037_0193680
1810 Ga0501038_0000538
1811 Ga0501038_0084278
1812 Ga0501038_0508718
1813 Ga0501039_0000366
1814 Ga0501040_0365553
1815 Ga0501042_0081623
1816 Ga0501042_0616593
1817 Ga0501043_0002344
1818 Ga0501043_0030258
1819 Ga0501043_0243818
1820 Ga0501043_0457990
1821 Ga0501046_0000434
1822 Ga0501047_0000131
1823 Ga0501047_0014359
1824 Ga0501047_0063958
1825 Ga0501047_0077939
1826 Ga0501047_0106601
1827 Ga0501047_0234791
1828 Ga0501048_0000531
1829 Ga0501048_0259209
1830 Ga0501067_0000628
1831 Ga0501067_0081828
1832 Ga0501068_0000080
1833 Ga0501069_0001211
1834 Ga0501070_0005971
1835 Ga0501070_0013649
1836 Ga0501070_0083701
1837 Ga0501070_0223992
1838 Ga0501070_0415209
1839 Ga0501070_0416498
1840 Ga0501070_0634540
1841 Ga0501071_0148282
1842 Ga0501072_0000378
1843 Ga0501072_0004379
1844 Ga0501073_0000062
1845 Ga0501073_0153891
1846 Ga0501074_0003814
1847 Ga0501074_0183894
1848 Ga0501076_0015345
1849 Ga0501076_0551364
1850 Ga0501079_0001399
1851 Ga0501079_0026413
1852 Ga0501079_0454522
1853 Ga0501079_0566016
1854 Ga0501080_0009398
1855 Ga0501080_0020500
1856 Ga0501080_0097463
1857 Ga0501080_0431121
1858 Ga0501080_0528852
1859 Ga0501080_0563361
1860 Ga0501081_0086589
1861 Ga0501083_0000341
1862 Ga0501035_0000123
1863 Ga0501035_0066047
1864 Ga0501035_0165534
1865 Ga0501035_0229193
1866 Ga0501035_0252395
1867 Ga0501035_0381538
1868 Ga0501035_0808315
1869 Ga0501044_0000100
1870 Ga0501044_0126607
1871 Ga0501044_0126655
1872 Ga0501044_0174023
1873 Ga0501044_0188795
1874 Ga0501044_0214286
1875 Ga0501044_0258970
1876 Ga0501044_0359323
1877 Ga0501045_0258667
1878 Ga0501045_0744012
1879 nmdc:mga03683_171734_c1
1880 nmdc:mga03683_63731_c1
1881 nmdc:mga03n38_20945_c1
1882 nmdc:mga03n38_788_c1
1883 nmdc:mga00v17_113629_c1
1884 nmdc:mga00v17_193210_c1
1885 nmdc:mga00v17_78621_c1
1886 nmdc:mga0yw44_10435_c1
1887 nmdc:mga0yw44_122929_c1
1888 nmdc:mga0yw44_280364_c1
1889 nmdc:mga0yw44_3696_c1
1890 nmdc:mga0yw44_44332_c1
1891 nmdc:mga0yw44_68065_c1
1892 nmdc:mga0yw44_90120_c1
1893 nmdc:mga0k408_241875_c1
1894 nmdc:mga06z11_181046_c1
1895 nmdc:mga06z11_222124_c1
1896 nmdc:mga04h51_35947_c1
1897 nmdc:mga07m45_10136_c1
1898 nmdc:mga07m45_129657_c1
1899 nmdc:mga07m45_16328_c1
1900 nmdc:mga05p37_321003_c1
1901 nmdc:mga05p37_88296_c1
1902 nmdc:mga09592_136043_c1
1903 nmdc:mga0qj67_197102_c2
1904 nmdc:mga0qj67_604368_c1
1905 nmdc:mga06r32_117088_c1
1906 nmdc:mga06r32_131590_c1
1907 nmdc:mga06r32_96370_c1
1908 nmdc:mga08y16_140797_c1
1909 nmdc:mga08y16_67818_c1
1910 nmdc:mga0n895_101162_c1
1911 nmdc:mga0n895_253790_c1
1912 nmdc:mga0n895_463362_c1
1913 nmdc:mga0n895_95048_c1
1914 nmdc:mga0rr50_417374_c1
1915 nmdc:mga0rr50_50577_c1
1916 nmdc:mga0rr50_65213_c1
1917 nmdc:mga08x19_4_c2
1918 nmdc:mga0sz30_51290_c1
1919 nmdc:mga0sz30_59676_c1
1920 Ga0495601_0000011
1921 Ga0495601_0022853
1922 Ga0495601_0107727
1923 Ga0495601_0121375
1924 Ga0495612_0000006
1925 Ga0495612_0020737
1926 Ga0495612_0153925
1927 Ga0495655_0033841
1928 Ga0495595_0000021
1929 Ga0495595_0038918
1930 Ga0495595_0059378
1931 Ga0495619_0000013
1932 Ga0495619_0012966
1933 Ga0495619_0034640
1934 Ga0500646_0018789
1935 Ga0500566_0000055
1936 Ga0500641_0010703
1937 Ga0500641_0027147
1938 Ga0500594_0183732
1939 Ga0500608_084422
1940 Ga0500617_190207
1941 Ga0500658_0055005
1942 Ga0500559_0000362
1943 Ga0500559_0100450
1944 Ga0500568_0033662
1945 Ga0500589_082946
1946 Ga0500633_0197384
1947 Ga0500636_0001777
1948 Ga0500637_0139649
1949 Ga0500645_021788
1950 Ga0501084_0019061
1951 Ga0501084_0027413
1952 Ga0501084_0121841
1953 Ga0501082_0001776
1954 Ga0501082_0081197
1955 Ga0501082_0251508
1956 Ga0466962_0074710
1957 Ga0466962_0454593
1958 Ga0530510_0007398
1959 Ga0530510_1019593
1960 2507505433
1961 2509152162
1962 2511399107
1963 2513623943
1964 2513675813
1965 2513695270
1966 2513873367
1967 2513888597
1968 2514014697
1969 2524441424
1970 2528853336
1971 2617352078
1972 2644291076
1973 2723841804
1974 2793062217
1975 2805920715
1976 2824670006
1977 2824676593
1978 2824693255
1979 2824702624
1980 2824713730
1981 2824761773
1982 2824772272
1983 2824780862
1984 2838124678
1985 2841945370
1986 2841952155
1987 2841965364
1988 2841970457
1989 2841981705
1990 2841984986
1991 2847942321
1992 2874617998
1993 2874621222
1994 2876814206
1995 2879099907
1996 2879113331
1997 2885369353
1998 2888390519
1999 2893067492
2000 2904667767
2001 2904716348
2002 2922363189
2003 2922369407
2004 2922388506
2005 2922400045
2006 2929618765
2007 2929628550
2008 2932790947
2009 2932812000
2010 2932825549
2011 2932833663
2012 2933580525
2013 2935615539
2014 2935623189
2015 2935644264
2016 2935672154
2017 2935679325
2018 2935686566
2019 2935700349
2020 2935710297
2021 2935716254
2022 2935723622
2023 2935735177
2024 2935744032
2025 2935752532
2026 2935763334
2027 2935772882
2028 2935783327
2029 2935788130
2030 2935796294
2031 2935808288
2032 2935816099
2033 2935825660
2034 2935833492
2035 2935845950
2036 2935853424
2037 2935861437
2038 2935869556
2039 2935879885
2040 2935915026
2041 2935918874
2042 2935931409
2043 2935940006
2044 2935947647
2045 2935956418
2046 2935973212
2047 2935997892
2048 2936008843
2049 2936041104
2050 2940558445
2051 2941547119
2052 3005594119
2053 3005718455
2054 8016526309
2055 8016531370
2056 8016544585
2057 8016557492
2058 8016565848
2059 8016569636
2060 8016582246
2061 8016603447
2062 8016606385
2063 8016618292
2064 8016622941
2065 8016635445
2066 8017058631
2067 8019531203
2068 8019540350
2069 8019549941
2070 8019577028
2071 8019595095
2072 8019606646
2073 8019611865
2074 8019696068
2075 8055742614
2076 8056676122

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

68

121

0.9

PF00578

AhpC-TSA

AhpC/TSA family

44

163

0.89

PF08534

Redoxin

Redoxin

45

179

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9799 55 197
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9666 55 197
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9059 48 197
2g0f-assembly1.cif.gz_A crystal structure of p144a mutant of e.coli ccmg protein 0.8957 48 197
3kh9-assembly1.cif.gz_A crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa 0.8765 44 198
ID Description Score Start End Superfamily
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9799 55 197 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9666 55 197 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9059 48 197 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8712 48 197 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8563 56 197 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V4UFG9-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9862 68 201 GO:0015036
GO:0017004
GO:0030288
AF-A0A1Q7WVB3-F1-model_v4 Thiol:disulfide interchange protein 0.9812 73 198 GO:0015036
GO:0017004
GO:0030288
AF-A0A434S8A3-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9778 91 201 GO:0015036
GO:0017004
GO:0030288
AF-A0A436QV82-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9766 49 201 GO:0015036
GO:0017004
GO:0030288
AF-E6YG17-F1-model_v4 Thiol:disulfide interchange protein 0.9702 90 198 GO:0015036
GO:0017004
GO:0030288

Map