F488776
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1038 | 545 | 2076 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300053142|Ga0500577_0001713|Ga0500577_0001713_3315_3884 |
| Length | 189 |
| Sequence | MSTTVAPKRRWVMALPLLGFAIMAALFWFKLGAGDPAKLPSALIGRPAPQTALPALEGLTGIPGLDPAAFQGRVSVVNVWASWCVPCHEEAPLFTTLAQDKRIQIVGINYKDSPDNARRFLGRYGNPFGMVGVDGNGRAAIEWGVYGVPETFIVGRDGRISYKLVGGVTPENFDSVLKVEIEKALKAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 127 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 244 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 247 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 250 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 251 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 263 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 412 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 417 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 419 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 421 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 422 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 424 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 428 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 429 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 430 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 431 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 432 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 433 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 434 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 435 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 436 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 437 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 438 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 439 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 440 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 441 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 442 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 443 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 444 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 445 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 446 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 447 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 448 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 449 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 450 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 451 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 452 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 453 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 454 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 455 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 456 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 457 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 458 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 459 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 460 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 461 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 462 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 463 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 464 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 465 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 466 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 467 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 468 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 469 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 470 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 471 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 472 | 2922368715 | |||
| 473 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 474 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 475 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 476 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 477 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 478 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 479 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 480 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 481 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 482 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 483 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 484 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 485 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 486 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 487 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 488 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 489 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 490 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 491 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 492 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 493 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 494 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 495 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 496 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 497 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 498 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 499 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 500 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 501 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 502 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 503 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 504 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 505 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 506 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 507 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 508 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 509 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 510 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 511 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 512 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 513 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 514 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 515 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 516 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 517 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 518 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 519 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 520 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 521 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 522 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 523 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 524 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 525 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 526 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 527 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 528 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 529 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 530 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 531 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 532 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 533 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 534 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 535 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 536 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 537 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 538 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 539 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 540 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 541 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 542 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 543 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 544 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 545 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.43 |
| Metatranscriptomes | 0.39 |
| Isolates | 11.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.13 |
| Nodule | 9.34 |
| Rhizoplane | 5.3 |
| Rhizosphere | 73.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500577_0001713 | 3300053142 | Bacteria | 5614 |
| 2 | JGI24748J21848_1015566 | 3300002074 | Bacteria | 905 |
| 3 | JGI24744J21845_10029693 | 3300002077 | Bacteria | 1050 |
| 4 | JGI24034J26672_10001856 | 3300002239 | Bacteria | 2850 |
| 5 | JGI25406J46586_10001038 | 3300003203 | Bacteria | 12982 |
| 6 | JGI25165J46597_1006459 | 3300003214 | Bacteria | 2077 |
| 7 | JGI25160J50197_1024431 | 3300003354 | Bacteria | 1714 |
| 8 | JGI25404J52841_10019750 | 3300003659 | Bacteria | 1460 |
| 9 | Ga0070676_10056764 | 3300005328 | Bacteria | 2315 |
| 10 | Ga0070676_10622566 | 3300005328 | Bacteria | 781 |
| 11 | Ga0070683_100020477 | 3300005329 | Bacteria | 5887 |
| 12 | Ga0070683_100623998 | 3300005329 | Bacteria | 1032 |
| 13 | Ga0070690_100213100 | 3300005330 | Bacteria | 1350 |
| 14 | Ga0070670_100010392 | 3300005331 | Bacteria | 7943 |
| 15 | Ga0070670_100028895 | 3300005331 | Bacteria | 4772 |
| 16 | Ga0068869_100053668 | 3300005334 | Bacteria | 2931 |
| 17 | Ga0068869_100064712 | 3300005334 | Bacteria | 2690 |
| 18 | Ga0068869_100118320 | 3300005334 | Bacteria | 2023 |
| 19 | Ga0070666_10068506 | 3300005335 | Bacteria | 2412 |
| 20 | Ga0070682_100084056 | 3300005337 | Bacteria | 2067 |
| 21 | Ga0068868_100007925 | 3300005338 | Bacteria | 7588 |
| 22 | Ga0070660_100057694 | 3300005339 | Bacteria | 3009 |
| 23 | Ga0070660_100057834 | 3300005339 | Bacteria | 3005 |
| 24 | Ga0070660_100323095 | 3300005339 | Bacteria | 1268 |
| 25 | Ga0070689_100088421 | 3300005340 | Bacteria | 2438 |
| 26 | Ga0070689_100138358 | 3300005340 | Bacteria | 1956 |
| 27 | Ga0070691_10006615 | 3300005341 | Bacteria | 5306 |
| 28 | Ga0070687_100003213 | 3300005343 | Bacteria | 6312 |
| 29 | Ga0070661_100030649 | 3300005344 | Bacteria | 3886 |
| 30 | Ga0070692_10177695 | 3300005345 | Bacteria | 1232 |
| 31 | Ga0070668_100039652 | 3300005347 | Bacteria | 3601 |
| 32 | Ga0070668_100295771 | 3300005347 | Bacteria | 1356 |
| 33 | Ga0070668_100813431 | 3300005347 | Bacteria | 831 |
| 34 | Ga0070668_101030464 | 3300005347 | Bacteria | 740 |
| 35 | Ga0070669_100432359 | 3300005353 | Bacteria | 1082 |
| 36 | Ga0070675_100023243 | 3300005354 | Bacteria | 4954 |
| 37 | Ga0070671_100062961 | 3300005355 | Bacteria | 3088 |
| 38 | Ga0070671_100112638 | 3300005355 | Bacteria | 2285 |
| 39 | Ga0070671_100157830 | 3300005355 | Bacteria | 1917 |
| 40 | Ga0070671_100275964 | 3300005355 | Bacteria | 1429 |
| 41 | Ga0070671_100339358 | 3300005355 | Bacteria | 1281 |
| 42 | Ga0070671_100463907 | 3300005355 | Bacteria | 1087 |
| 43 | Ga0070674_100030585 | 3300005356 | Bacteria | 3560 |
| 44 | Ga0070674_100113963 | 3300005356 | Bacteria | 1990 |
| 45 | Ga0070673_100373110 | 3300005364 | Bacteria | 1270 |
| 46 | Ga0070673_100942078 | 3300005364 | Bacteria | 802 |
| 47 | Ga0070688_100019458 | 3300005365 | Bacteria | 3933 |
| 48 | Ga0070688_100516109 | 3300005365 | Bacteria | 904 |
| 49 | Ga0070659_100120020 | 3300005366 | Bacteria | 2128 |
| 50 | Ga0070714_100172604 | 3300005435 | Bacteria | 1963 |
| 51 | Ga0070714_100204994 | 3300005435 | Bacteria | 1806 |
| 52 | Ga0070714_100329444 | 3300005435 | Bacteria | 1430 |
| 53 | Ga0070714_100490107 | 3300005435 | Bacteria | 1171 |
| 54 | Ga0070713_100022398 | 3300005436 | Bacteria | 4883 |
| 55 | Ga0070710_10205902 | 3300005437 | Bacteria | 1244 |
| 56 | Ga0070710_10289417 | 3300005437 | Bacteria | 1066 |
| 57 | Ga0070710_10653984 | 3300005437 | Bacteria | 737 |
| 58 | Ga0070711_100027826 | 3300005439 | Bacteria | 3715 |
| 59 | Ga0070705_100093111 | 3300005440 | Bacteria | 1883 |
| 60 | Ga0070705_100115636 | 3300005440 | Bacteria | 1723 |
| 61 | Ga0070700_100003506 | 3300005441 | Bacteria | 8091 |
| 62 | Ga0070700_100709663 | 3300005441 | Bacteria | 800 |
| 63 | Ga0070694_100248261 | 3300005444 | Bacteria | 1345 |
| 64 | Ga0070663_100034543 | 3300005455 | Bacteria | 3502 |
| 65 | Ga0070663_100077506 | 3300005455 | Bacteria | 2433 |
| 66 | Ga0070663_100306136 | 3300005455 | Bacteria | 1273 |
| 67 | Ga0070663_100399998 | 3300005455 | Bacteria | 1122 |
| 68 | Ga0070678_100118683 | 3300005456 | Bacteria | 2082 |
| 69 | Ga0070678_100302100 | 3300005456 | Bacteria | 1360 |
| 70 | Ga0070678_100411880 | 3300005456 | Bacteria | 1176 |
| 71 | Ga0070678_100895577 | 3300005456 | Bacteria | 811 |
| 72 | Ga0070662_100037362 | 3300005457 | Bacteria | 3443 |
| 73 | Ga0070662_100104780 | 3300005457 | Bacteria | 2146 |
| 74 | Ga0070662_100251296 | 3300005457 | Bacteria | 1421 |
| 75 | Ga0070662_100689437 | 3300005457 | Bacteria | 863 |
| 76 | Ga0070681_10001077 | 3300005458 | Bacteria | 23275 |
| 77 | Ga0068867_100047596 | 3300005459 | Bacteria | 3152 |
| 78 | Ga0070706_100301548 | 3300005467 | Bacteria | 1495 |
| 79 | Ga0070706_100587753 | 3300005467 | Bacteria | 1035 |
| 80 | Ga0070698_100112123 | 3300005471 | Bacteria | 2692 |
| 81 | Ga0070699_100389715 | 3300005518 | Bacteria | 1259 |
| 82 | Ga0070679_100074727 | 3300005530 | Bacteria | 3379 |
| 83 | Ga0070679_100236261 | 3300005530 | Bacteria | 1786 |
| 84 | Ga0070679_100414616 | 3300005530 | Bacteria | 1292 |
| 85 | Ga0070684_100014169 | 3300005535 | Bacteria | 6449 |
| 86 | Ga0070684_100337678 | 3300005535 | Bacteria | 1385 |
| 87 | Ga0070684_100503733 | 3300005535 | Bacteria | 1121 |
| 88 | Ga0070697_100017648 | 3300005536 | Bacteria | 5621 |
| 89 | Ga0070697_100103441 | 3300005536 | Bacteria | 2367 |
| 90 | Ga0070697_100898578 | 3300005536 | Bacteria | 786 |
| 91 | Ga0068853_100076989 | 3300005539 | Bacteria | 2913 |
| 92 | Ga0068853_100173008 | 3300005539 | Bacteria | 1954 |
| 93 | Ga0068853_100508823 | 3300005539 | Bacteria | 1137 |
| 94 | Ga0068853_100601593 | 3300005539 | Bacteria | 1044 |
| 95 | Ga0068853_100673696 | 3300005539 | Bacteria | 985 |
| 96 | Ga0070672_100228804 | 3300005543 | Bacteria | 1562 |
| 97 | Ga0070686_100025193 | 3300005544 | Bacteria | 3576 |
| 98 | Ga0070686_100375672 | 3300005544 | Bacteria | 1074 |
| 99 | Ga0070695_100033091 | 3300005545 | Bacteria | 3234 |
| 100 | Ga0070695_100214825 | 3300005545 | Bacteria | 1382 |
| 101 | Ga0070696_100279755 | 3300005546 | Bacteria | 1272 |
| 102 | Ga0070696_100354646 | 3300005546 | Bacteria | 1137 |
| 103 | Ga0070693_100155781 | 3300005547 | Bacteria | 1451 |
| 104 | Ga0070693_100512607 | 3300005547 | Bacteria | 852 |
| 105 | Ga0070665_100112414 | 3300005548 | Bacteria | 2726 |
| 106 | Ga0070665_100316202 | 3300005548 | Bacteria | 1565 |
| 107 | Ga0070665_100881387 | 3300005548 | Bacteria | 908 |
| 108 | Ga0070704_100129559 | 3300005549 | Bacteria | 1953 |
| 109 | Ga0070704_100264046 | 3300005549 | Bacteria | 1419 |
| 110 | Ga0068855_100114024 | 3300005563 | Bacteria | 3100 |
| 111 | Ga0068855_100204516 | 3300005563 | Bacteria | 2222 |
| 112 | Ga0068855_100627042 | 3300005563 | Bacteria | 1157 |
| 113 | Ga0068855_100748238 | 3300005563 | Bacteria | 1042 |
| 114 | Ga0070664_100337346 | 3300005564 | Bacteria | 1368 |
| 115 | Ga0070664_100576173 | 3300005564 | Bacteria | 1042 |
| 116 | Ga0070664_100784140 | 3300005564 | Bacteria | 890 |
| 117 | Ga0068857_100278299 | 3300005577 | Bacteria | 1539 |
| 118 | Ga0068857_100484269 | 3300005577 | Bacteria | 1160 |
| 119 | Ga0068854_100160519 | 3300005578 | Bacteria | 1740 |
| 120 | Ga0068854_100174960 | 3300005578 | Bacteria | 1672 |
| 121 | Ga0068854_100738504 | 3300005578 | Bacteria | 853 |
| 122 | Ga0068856_100125157 | 3300005614 | Bacteria | 2573 |
| 123 | Ga0068852_100174137 | 3300005616 | Bacteria | 2019 |
| 124 | Ga0068859_100847664 | 3300005617 | Bacteria | 1000 |
| 125 | Ga0068864_100194607 | 3300005618 | Bacteria | 1860 |
| 126 | Ga0068864_100229416 | 3300005618 | Bacteria | 1717 |
| 127 | Ga0068864_100864787 | 3300005618 | Bacteria | 891 |
| 128 | Ga0068866_10080314 | 3300005718 | Bacteria | 1749 |
| 129 | Ga0068866_10446678 | 3300005718 | Bacteria | 844 |
| 130 | Ga0068861_100068282 | 3300005719 | Bacteria | 2746 |
| 131 | Ga0068861_100211907 | 3300005719 | Bacteria | 1632 |
| 132 | Ga0068861_100240542 | 3300005719 | Bacteria | 1539 |
| 133 | Ga0068861_100639319 | 3300005719 | Bacteria | 981 |
| 134 | Ga0068851_10177294 | 3300005834 | Bacteria | 1179 |
| 135 | Ga0068870_10046750 | 3300005840 | Bacteria | 2272 |
| 136 | Ga0068863_100040383 | 3300005841 | Bacteria | 4436 |
| 137 | Ga0068863_100074859 | 3300005841 | Bacteria | 3203 |
| 138 | Ga0068858_100082321 | 3300005842 | Bacteria | 2992 |
| 139 | Ga0068858_100499880 | 3300005842 | Bacteria | 1175 |
| 140 | Ga0068860_100153938 | 3300005843 | Bacteria | 2215 |
| 141 | Ga0068860_100180429 | 3300005843 | Bacteria | 2040 |
| 142 | Ga0068860_100457375 | 3300005843 | Bacteria | 1270 |
| 143 | Ga0068862_100024856 | 3300005844 | Bacteria | 5026 |
| 144 | Ga0068862_100132689 | 3300005844 | Bacteria | 2204 |
| 145 | Ga0068862_100684986 | 3300005844 | Bacteria | 992 |
| 146 | Ga0081455_10012728 | 3300005937 | Bacteria | 8371 |
| 147 | Ga0081538_10039257 | 3300005981 | Bacteria | 3039 |
| 148 | Ga0081538_10054534 | 3300005981 | Bacteria | 2363 |
| 149 | Ga0081540_1005580 | 3300005983 | Bacteria | 9369 |
| 150 | Ga0081540_1011553 | 3300005983 | Bacteria | 5898 |
| 151 | Ga0081540_1030748 | 3300005983 | Bacteria | 2969 |
| 152 | Ga0081539_10003753 | 3300005985 | Bacteria | 18030 |
| 153 | Ga0070717_10053860 | 3300006028 | Bacteria | 3317 |
| 154 | Ga0070717_10097051 | 3300006028 | Bacteria | 2497 |
| 155 | Ga0070717_10184325 | 3300006028 | Bacteria | 1821 |
| 156 | Ga0075365_10017305 | 3300006038 | Bacteria | 4407 |
| 157 | Ga0075365_10053169 | 3300006038 | Bacteria | 2681 |
| 158 | Ga0075365_10088470 | 3300006038 | Bacteria | 2107 |
| 159 | Ga0075365_10132189 | 3300006038 | Bacteria | 1728 |
| 160 | Ga0075365_10153342 | 3300006038 | Bacteria | 1603 |
| 161 | Ga0075365_10411198 | 3300006038 | Bacteria | 955 |
| 162 | Ga0075365_10521979 | 3300006038 | Bacteria | 840 |
| 163 | Ga0075368_10064064 | 3300006042 | Bacteria | 1475 |
| 164 | Ga0075368_10163385 | 3300006042 | Bacteria | 934 |
| 165 | Ga0075368_10193756 | 3300006042 | Bacteria | 859 |
| 166 | Ga0075363_100007350 | 3300006048 | Bacteria | 5056 |
| 167 | Ga0075363_100020186 | 3300006048 | Bacteria | 3340 |
| 168 | Ga0075363_100050348 | 3300006048 | Bacteria | 2219 |
| 169 | Ga0075363_100114480 | 3300006048 | Bacteria | 1501 |
| 170 | Ga0075364_10119152 | 3300006051 | Bacteria | 1766 |
| 171 | Ga0075364_10301488 | 3300006051 | Bacteria | 1091 |
| 172 | Ga0075432_10243891 | 3300006058 | Bacteria | 727 |
| 173 | Ga0070716_100189041 | 3300006173 | Bacteria | 1359 |
| 174 | Ga0070712_100073352 | 3300006175 | Bacteria | 2455 |
| 175 | Ga0070712_100416949 | 3300006175 | Bacteria | 1112 |
| 176 | Ga0075362_10076051 | 3300006177 | Bacteria | 1541 |
| 177 | Ga0075362_10328986 | 3300006177 | Bacteria | 762 |
| 178 | Ga0075367_10383067 | 3300006178 | Bacteria | 889 |
| 179 | Ga0075369_10055303 | 3300006186 | Bacteria | 1724 |
| 180 | Ga0075366_10078725 | 3300006195 | Bacteria | 1967 |
| 181 | Ga0097621_100608306 | 3300006237 | Bacteria | 1000 |
| 182 | Ga0075370_10011007 | 3300006353 | Bacteria | 4744 |
| 183 | Ga0075370_10141709 | 3300006353 | Bacteria | 1405 |
| 184 | Ga0075370_10380472 | 3300006353 | Bacteria | 846 |
| 185 | Ga0068871_100133308 | 3300006358 | Bacteria | 2108 |
| 186 | Ga0068871_100275435 | 3300006358 | Bacteria | 1471 |
| 187 | Ga0068871_100535863 | 3300006358 | Bacteria | 1059 |
| 188 | Ga0075428_100067213 | 3300006844 | Bacteria | 3924 |
| 189 | Ga0075428_100082208 | 3300006844 | Bacteria | 3515 |
| 190 | Ga0075428_100279196 | 3300006844 | Bacteria | 1797 |
| 191 | Ga0075428_100968415 | 3300006844 | Bacteria | 901 |
| 192 | Ga0075434_100074886 | 3300006871 | Bacteria | 3379 |
| 193 | Ga0075434_100106463 | 3300006871 | Bacteria | 2814 |
| 194 | Ga0075429_100020262 | 3300006880 | Bacteria | 5767 |
| 195 | Ga0097620_100847644 | 3300006931 | Bacteria | 1000 |
| 196 | Ga0075435_100066208 | 3300007076 | Bacteria | 2939 |
| 197 | Ga0075435_100108578 | 3300007076 | Bacteria | 2305 |
| 198 | Ga0075435_100151663 | 3300007076 | Bacteria | 1949 |
| 199 | Ga0099795_10256232 | 3300007788 | Bacteria | 756 |
| 200 | Ga0105240_10082975 | 3300009093 | Bacteria | 3935 |
| 201 | Ga0105240_10197980 | 3300009093 | Bacteria | 2357 |
| 202 | Ga0105240_10225649 | 3300009093 | Bacteria | 2180 |
| 203 | Ga0111539_10061009 | 3300009094 | Bacteria | 4468 |
| 204 | Ga0111539_10246353 | 3300009094 | Bacteria | 2081 |
| 205 | Ga0111539_10514348 | 3300009094 | Bacteria | 1394 |
| 206 | Ga0105245_10004490 | 3300009098 | Bacteria | 12337 |
| 207 | Ga0105245_10747765 | 3300009098 | Bacteria | 1013 |
| 208 | Ga0105247_10009526 | 3300009101 | Bacteria | 5893 |
| 209 | Ga0105247_10319158 | 3300009101 | Bacteria | 1083 |
| 210 | Ga0114129_10052932 | 3300009147 | Bacteria | 5696 |
| 211 | Ga0114129_10106009 | 3300009147 | Bacteria | 3883 |
| 212 | Ga0114129_10188583 | 3300009147 | Bacteria | 2801 |
| 213 | Ga0114129_10245258 | 3300009147 | Bacteria | 2407 |
| 214 | Ga0114129_10329128 | 3300009147 | Bacteria | 2029 |
| 215 | Ga0114129_11481406 | 3300009147 | Bacteria | 835 |
| 216 | Ga0105243_10038961 | 3300009148 | Bacteria | 3704 |
| 217 | Ga0105241_10209378 | 3300009174 | Bacteria | 1633 |
| 218 | Ga0105242_10071965 | 3300009176 | Bacteria | 2871 |
| 219 | Ga0105242_10282440 | 3300009176 | Bacteria | 1508 |
| 220 | Ga0105248_10043760 | 3300009177 | Bacteria | 5022 |
| 221 | Ga0105248_10047926 | 3300009177 | Bacteria | 4793 |
| 222 | Ga0105248_11158480 | 3300009177 | Bacteria | 874 |
| 223 | Ga0105237_10066600 | 3300009545 | Bacteria | 3597 |
| 224 | Ga0105237_10224102 | 3300009545 | Bacteria | 1880 |
| 225 | Ga0105237_10383874 | 3300009545 | Bacteria | 1410 |
| 226 | Ga0105237_10398432 | 3300009545 | Bacteria | 1381 |
| 227 | Ga0105237_10618893 | 3300009545 | Bacteria | 1090 |
| 228 | Ga0105238_10063695 | 3300009551 | Bacteria | 3688 |
| 229 | Ga0105249_10875503 | 3300009553 | Bacteria | 964 |
| 230 | Ga0105249_11182661 | 3300009553 | Bacteria | 835 |
| 231 | Ga0105249_11615535 | 3300009553 | Bacteria | 721 |
| 232 | Ga0099796_10037348 | 3300010159 | Bacteria | 1623 |
| 233 | Ga0105239_10022916 | 3300010375 | Bacteria | 6884 |
| 234 | Ga0105239_10199912 | 3300010375 | Bacteria | 2239 |
| 235 | Ga0105239_10413335 | 3300010375 | Bacteria | 1528 |
| 236 | Ga0105239_10652501 | 3300010375 | Bacteria | 1202 |
| 237 | Ga0105239_10683262 | 3300010375 | Bacteria | 1173 |
| 238 | Ga0105239_10957711 | 3300010375 | Bacteria | 983 |
| 239 | Ga0105239_11375953 | 3300010375 | Bacteria | 815 |
| 240 | Ga0105246_10139948 | 3300011119 | Bacteria | 1818 |
| 241 | Ga0157373_10039123 | 3300013100 | Bacteria | 3396 |
| 242 | Ga0157373_10287352 | 3300013100 | Bacteria | 1166 |
| 243 | Ga0157370_10028400 | 3300013104 | Bacteria | 5502 |
| 244 | Ga0157370_10240116 | 3300013104 | Bacteria | 1676 |
| 245 | Ga0157370_10354160 | 3300013104 | Bacteria | 1353 |
| 246 | Ga0157370_10485370 | 3300013104 | Bacteria | 1135 |
| 247 | Ga0157369_10071589 | 3300013105 | Bacteria | 3721 |
| 248 | Ga0157369_10096664 | 3300013105 | Bacteria | 3151 |
| 249 | Ga0157369_10155843 | 3300013105 | Bacteria | 2412 |
| 250 | Ga0157374_11159214 | 3300013296 | Bacteria | 794 |
| 251 | Ga0157378_10379274 | 3300013297 | Bacteria | 1388 |
| 252 | Ga0163162_10179236 | 3300013306 | Bacteria | 2245 |
| 253 | Ga0163162_11343367 | 3300013306 | Bacteria | 813 |
| 254 | Ga0157372_10103182 | 3300013307 | Bacteria | 3258 |
| 255 | Ga0157372_10223986 | 3300013307 | Bacteria | 2180 |
| 256 | Ga0157372_10270361 | 3300013307 | Bacteria | 1975 |
| 257 | Ga0157375_10445206 | 3300013308 | Bacteria | 1461 |
| 258 | Ga0157375_10632210 | 3300013308 | Bacteria | 1228 |
| 259 | Ga0163163_10021857 | 3300014325 | Bacteria | 6045 |
| 260 | Ga0157380_10199597 | 3300014326 | Bacteria | 1773 |
| 261 | Ga0157380_10582045 | 3300014326 | Bacteria | 1104 |
| 262 | Ga0157380_10608921 | 3300014326 | Bacteria | 1082 |
| 263 | Ga0157379_10060482 | 3300014968 | Bacteria | 3386 |
| 264 | Ga0157379_11537911 | 3300014968 | Bacteria | 648 |
| 265 | Ga0157376_10140354 | 3300014969 | Bacteria | 2167 |
| 266 | Ga0157376_10231976 | 3300014969 | Bacteria | 1715 |
| 267 | Ga0157376_10862821 | 3300014969 | Bacteria | 921 |
| 268 | Ga0163161_10056894 | 3300017792 | Bacteria | 2841 |
| 269 | Ga0163161_10314649 | 3300017792 | Bacteria | 1236 |
| 270 | Ga0224572_1015081 | 3300024225 | Bacteria | 1478 |
| 271 | Ga0228598_1007284 | 3300024227 | Bacteria | 2257 |
| 272 | Ga0209233_1008253 | 3300025261 | Bacteria | 3234 |
| 273 | Ga0209564_1005467 | 3300025295 | Bacteria | 7242 |
| 274 | Ga0209758_1001013 | 3300025297 | Bacteria | 37209 |
| 275 | Ga0209758_1005533 | 3300025297 | Bacteria | 9644 |
| 276 | Ga0209256_1017459 | 3300025299 | Bacteria | 2382 |
| 277 | Ga0207426_1002838 | 3300025302 | Bacteria | 10314 |
| 278 | Ga0207426_1012013 | 3300025302 | Bacteria | 3271 |
| 279 | Ga0209257_1035057 | 3300025304 | Bacteria | 1556 |
| 280 | Ga0207697_10111736 | 3300025315 | Bacteria | 1170 |
| 281 | Ga0207653_10012696 | 3300025885 | Bacteria | 2631 |
| 282 | Ga0207692_10199440 | 3300025898 | Bacteria | 1176 |
| 283 | Ga0207710_10044330 | 3300025900 | Bacteria | 1980 |
| 284 | Ga0207710_10217270 | 3300025900 | Bacteria | 948 |
| 285 | Ga0207710_10257003 | 3300025900 | Bacteria | 875 |
| 286 | Ga0207688_10015244 | 3300025901 | Bacteria | 4172 |
| 287 | Ga0207688_10157215 | 3300025901 | Bacteria | 1346 |
| 288 | Ga0207688_10164260 | 3300025901 | Bacteria | 1318 |
| 289 | Ga0207680_10010978 | 3300025903 | Bacteria | 4556 |
| 290 | Ga0207647_10048127 | 3300025904 | Bacteria | 2649 |
| 291 | Ga0207647_10161162 | 3300025904 | Bacteria | 1308 |
| 292 | Ga0207647_10210080 | 3300025904 | Bacteria | 1124 |
| 293 | Ga0207685_10066599 | 3300025905 | Bacteria | 1446 |
| 294 | Ga0207685_10072500 | 3300025905 | Bacteria | 1400 |
| 295 | Ga0207699_10632587 | 3300025906 | Bacteria | 781 |
| 296 | Ga0207645_10018488 | 3300025907 | Bacteria | 4584 |
| 297 | Ga0207645_10067939 | 3300025907 | Bacteria | 2278 |
| 298 | Ga0207643_10001362 | 3300025908 | Bacteria | 14113 |
| 299 | Ga0207707_10001830 | 3300025912 | Bacteria | 19505 |
| 300 | Ga0207695_10030631 | 3300025913 | Bacteria | 5920 |
| 301 | Ga0207695_10293819 | 3300025913 | Bacteria | 1517 |
| 302 | Ga0207671_10275622 | 3300025914 | Bacteria | 1326 |
| 303 | Ga0207693_10029152 | 3300025915 | Bacteria | 4362 |
| 304 | Ga0207693_10203572 | 3300025915 | Bacteria | 1556 |
| 305 | Ga0207663_10204296 | 3300025916 | Bacteria | 1427 |
| 306 | Ga0207660_10189206 | 3300025917 | Bacteria | 1602 |
| 307 | Ga0207660_10215906 | 3300025917 | Bacteria | 1504 |
| 308 | Ga0207662_10001498 | 3300025918 | Bacteria | 11346 |
| 309 | Ga0207662_10181724 | 3300025918 | Bacteria | 1354 |
| 310 | Ga0207657_10022399 | 3300025919 | Bacteria | 5912 |
| 311 | Ga0207657_10045121 | 3300025919 | Bacteria | 3871 |
| 312 | Ga0207649_10192546 | 3300025920 | Bacteria | 1435 |
| 313 | Ga0207652_10076567 | 3300025921 | Bacteria | 2918 |
| 314 | Ga0207652_10078201 | 3300025921 | Bacteria | 2888 |
| 315 | Ga0207681_10336781 | 3300025923 | Bacteria | 1204 |
| 316 | Ga0207650_10006398 | 3300025925 | Bacteria | 8021 |
| 317 | Ga0207650_10042065 | 3300025925 | Bacteria | 3351 |
| 318 | Ga0207650_10103609 | 3300025925 | Bacteria | 2194 |
| 319 | Ga0207659_10047121 | 3300025926 | Bacteria | 3048 |
| 320 | Ga0207687_10022847 | 3300025927 | Bacteria | 4165 |
| 321 | Ga0207687_10031317 | 3300025927 | Bacteria | 3593 |
| 322 | Ga0207687_10076681 | 3300025927 | Bacteria | 2402 |
| 323 | Ga0207700_10391156 | 3300025928 | Bacteria | 1217 |
| 324 | Ga0207664_10447650 | 3300025929 | Bacteria | 1152 |
| 325 | Ga0207644_10116107 | 3300025931 | Bacteria | 2031 |
| 326 | Ga0207644_10276846 | 3300025931 | Bacteria | 1346 |
| 327 | Ga0207644_10316939 | 3300025931 | Bacteria | 1260 |
| 328 | Ga0207644_10346071 | 3300025931 | Bacteria | 1206 |
| 329 | Ga0207644_10444596 | 3300025931 | Bacteria | 1064 |
| 330 | Ga0207644_10749855 | 3300025931 | Bacteria | 815 |
| 331 | Ga0207690_10569055 | 3300025932 | Bacteria | 923 |
| 332 | Ga0207706_10004857 | 3300025933 | Bacteria | 12589 |
| 333 | Ga0207706_10055965 | 3300025933 | Bacteria | 3477 |
| 334 | Ga0207706_10186712 | 3300025933 | Bacteria | 1820 |
| 335 | Ga0207706_10377744 | 3300025933 | Bacteria | 1230 |
| 336 | Ga0207686_10153786 | 3300025934 | Bacteria | 1605 |
| 337 | Ga0207709_10007603 | 3300025935 | Bacteria | 6017 |
| 338 | Ga0207670_10010018 | 3300025936 | Bacteria | 5438 |
| 339 | Ga0207669_10021340 | 3300025937 | Bacteria | 3417 |
| 340 | Ga0207669_10027600 | 3300025937 | Bacteria | 3111 |
| 341 | Ga0207669_10101165 | 3300025937 | Bacteria | 1906 |
| 342 | Ga0207665_10104335 | 3300025939 | Bacteria | 1984 |
| 343 | Ga0207665_10491769 | 3300025939 | Bacteria | 947 |
| 344 | Ga0207691_10006388 | 3300025940 | Bacteria | 11384 |
| 345 | Ga0207711_10154538 | 3300025941 | Bacteria | 2073 |
| 346 | Ga0207711_10168163 | 3300025941 | Bacteria | 1988 |
| 347 | Ga0207689_10011143 | 3300025942 | Bacteria | 7716 |
| 348 | Ga0207689_10105243 | 3300025942 | Bacteria | 2318 |
| 349 | Ga0207689_10246990 | 3300025942 | Bacteria | 1476 |
| 350 | Ga0207689_10301956 | 3300025942 | Bacteria | 1327 |
| 351 | Ga0207661_10004360 | 3300025944 | Bacteria | 9917 |
| 352 | Ga0207661_10235294 | 3300025944 | Bacteria | 1624 |
| 353 | Ga0207661_10995580 | 3300025944 | Bacteria | 772 |
| 354 | Ga0207679_10159939 | 3300025945 | Bacteria | 1843 |
| 355 | Ga0207667_10016003 | 3300025949 | Bacteria | 8492 |
| 356 | Ga0207667_10086452 | 3300025949 | Bacteria | 3245 |
| 357 | Ga0207667_10736113 | 3300025949 | Bacteria | 986 |
| 358 | Ga0207651_10859856 | 3300025960 | Bacteria | 806 |
| 359 | Ga0207712_10120991 | 3300025961 | Bacteria | 1981 |
| 360 | Ga0207712_10261168 | 3300025961 | Bacteria | 1405 |
| 361 | Ga0207712_10310291 | 3300025961 | Bacteria | 1298 |
| 362 | Ga0207668_10014153 | 3300025972 | Bacteria | 4933 |
| 363 | Ga0207668_10042564 | 3300025972 | Bacteria | 3076 |
| 364 | Ga0207668_10214148 | 3300025972 | Bacteria | 1542 |
| 365 | Ga0207668_10249287 | 3300025972 | Bacteria | 1441 |
| 366 | Ga0207668_10249554 | 3300025972 | Bacteria | 1440 |
| 367 | Ga0207640_10151819 | 3300025981 | Bacteria | 1703 |
| 368 | Ga0207640_10638546 | 3300025981 | Bacteria | 906 |
| 369 | Ga0207640_10867510 | 3300025981 | Bacteria | 786 |
| 370 | Ga0207658_10083707 | 3300025986 | Bacteria | 2453 |
| 371 | Ga0207658_10102777 | 3300025986 | Bacteria | 2242 |
| 372 | Ga0207703_10132048 | 3300026035 | Bacteria | 2157 |
| 373 | Ga0207703_10457850 | 3300026035 | Bacteria | 1192 |
| 374 | Ga0207703_10598827 | 3300026035 | Bacteria | 1042 |
| 375 | Ga0207639_10117753 | 3300026041 | Bacteria | 2177 |
| 376 | Ga0207678_10008802 | 3300026067 | Bacteria | 8881 |
| 377 | Ga0207678_10023605 | 3300026067 | Bacteria | 5379 |
| 378 | Ga0207678_10035784 | 3300026067 | Bacteria | 4323 |
| 379 | Ga0207678_10042691 | 3300026067 | Bacteria | 3927 |
| 380 | Ga0207678_10066177 | 3300026067 | Bacteria | 3103 |
| 381 | Ga0207708_10048288 | 3300026075 | Bacteria | 3240 |
| 382 | Ga0207702_10048122 | 3300026078 | Bacteria | 3596 |
| 383 | Ga0207702_10199613 | 3300026078 | Bacteria | 1853 |
| 384 | Ga0207702_10469132 | 3300026078 | Bacteria | 1224 |
| 385 | Ga0207641_10064481 | 3300026088 | Bacteria | 3131 |
| 386 | Ga0207641_10177570 | 3300026088 | Bacteria | 1948 |
| 387 | Ga0207641_10363258 | 3300026088 | Bacteria | 1383 |
| 388 | Ga0207648_10034157 | 3300026089 | Bacteria | 4485 |
| 389 | Ga0207648_10060278 | 3300026089 | Bacteria | 3310 |
| 390 | Ga0207676_10069096 | 3300026095 | Bacteria | 2828 |
| 391 | Ga0207676_10134973 | 3300026095 | Bacteria | 2104 |
| 392 | Ga0207676_10836273 | 3300026095 | Bacteria | 900 |
| 393 | Ga0207674_10100669 | 3300026116 | Bacteria | 2871 |
| 394 | Ga0207674_10222249 | 3300026116 | Bacteria | 1837 |
| 395 | Ga0207674_10442281 | 3300026116 | Bacteria | 1256 |
| 396 | Ga0207674_10543883 | 3300026116 | Bacteria | 1122 |
| 397 | Ga0207674_10685190 | 3300026116 | Bacteria | 990 |
| 398 | Ga0207675_100007482 | 3300026118 | Bacteria | 10321 |
| 399 | Ga0207675_100066389 | 3300026118 | Bacteria | 3372 |
| 400 | Ga0207675_100220968 | 3300026118 | Bacteria | 1825 |
| 401 | Ga0207675_100739936 | 3300026118 | Bacteria | 994 |
| 402 | Ga0207683_10003631 | 3300026121 | Bacteria | 13427 |
| 403 | Ga0207683_10312823 | 3300026121 | Bacteria | 1438 |
| 404 | Ga0207683_10819124 | 3300026121 | Bacteria | 864 |
| 405 | Ga0207698_10033869 | 3300026142 | Bacteria | 3716 |
| 406 | Ga0207428_10073687 | 3300027907 | Bacteria | 2678 |
| 407 | Ga0268266_10012729 | 3300028379 | Bacteria | 7270 |
| 408 | Ga0268266_10039111 | 3300028379 | Bacteria | 4039 |
| 409 | Ga0268266_10065598 | 3300028379 | Bacteria | 3138 |
| 410 | Ga0268265_10103924 | 3300028380 | Bacteria | 2301 |
| 411 | Ga0268265_10235425 | 3300028380 | Bacteria | 1612 |
| 412 | Ga0268265_10615805 | 3300028380 | Bacteria | 1039 |
| 413 | Ga0268264_10414187 | 3300028381 | Bacteria | 1298 |
| 414 | Ga0265762_1046092 | 3300030760 | Bacteria | 864 |
| 415 | Ga0265770_1019529 | 3300030878 | Bacteria | 1063 |
| 416 | Ga0265760_10018660 | 3300031090 | Bacteria | 1998 |
| 417 | Ga0265332_10012491 | 3300031238 | Bacteria | 3768 |
| 418 | Ga0265325_10208551 | 3300031241 | Bacteria | 898 |
| 419 | Ga0265329_10048481 | 3300031242 | Bacteria | 1354 |
| 420 | Ga0265340_10014138 | 3300031247 | Bacteria | 4178 |
| 421 | Ga0265340_10115228 | 3300031247 | Bacteria | 1239 |
| 422 | Ga0265339_10000738 | 3300031249 | Bacteria | 25301 |
| 423 | Ga0265339_10003900 | 3300031249 | Bacteria | 10336 |
| 424 | Ga0265331_10059574 | 3300031250 | Bacteria | 1805 |
| 425 | Ga0265316_10100060 | 3300031344 | Bacteria | 2204 |
| 426 | Ga0265316_10227539 | 3300031344 | Bacteria | 1374 |
| 427 | Ga0265314_10037456 | 3300031711 | Bacteria | 3514 |
| 428 | Ga0265342_10003180 | 3300031712 | Bacteria | 13667 |
| 429 | Ga0307516_10294049 | 3300031730 | Bacteria | 1302 |
| 430 | Ga0307405_10514475 | 3300031731 | Bacteria | 962 |
| 431 | Ga0307405_10614393 | 3300031731 | Bacteria | 889 |
| 432 | Ga0307405_10742955 | 3300031731 | Bacteria | 817 |
| 433 | Ga0307413_10052158 | 3300031824 | Bacteria | 2469 |
| 434 | Ga0307410_10343301 | 3300031852 | Bacteria | 1191 |
| 435 | Ga0307409_100312813 | 3300031995 | Bacteria | 1466 |
| 436 | Ga0307416_100204452 | 3300032002 | Bacteria | 1877 |
| 437 | Ga0307416_100484234 | 3300032002 | Bacteria | 1298 |
| 438 | Ga0307416_100530292 | 3300032002 | Bacteria | 1247 |
| 439 | Ga0307411_10330782 | 3300032005 | Bacteria | 1234 |
| 440 | Ga0307411_11216227 | 3300032005 | Bacteria | 684 |
| 441 | Ga0316215_1003830 | 3300033544 | Bacteria | 1442 |
| 442 | Ga0373934_0112658 | 3300035086 | Bacteria | 1104 |
| 443 | Ga0373934_0135590 | 3300035086 | Bacteria | 1005 |
| 444 | Ga0373944_0011826 | 3300035089 | Bacteria | 2397 |
| 445 | Ga0373923_0031514 | 3300035111 | Bacteria | 2138 |
| 446 | Ga0373923_0052729 | 3300035111 | Bacteria | 1709 |
| 447 | Ga0373932_0042705 | 3300035112 | Bacteria | 1316 |
| 448 | Ga0373936_0014580 | 3300035113 | Bacteria | 3008 |
| 449 | Ga0373936_0255942 | 3300035113 | Bacteria | 783 |
| 450 | Ga0373945_0127093 | 3300035116 | Bacteria | 1018 |
| 451 | Ga0373953_0002353 | 3300035117 | Bacteria | 5693 |
| 452 | Ga0373953_0015566 | 3300035117 | Bacteria | 2760 |
| 453 | Ga0373953_0018502 | 3300035117 | Bacteria | 2579 |
| 454 | Ga0373954_0000445 | 3300035118 | Bacteria | 15476 |
| 455 | Ga0373954_0059464 | 3300035118 | Bacteria | 1801 |
| 456 | Ga0373957_0003642 | 3300035120 | Bacteria | 4591 |
| 457 | Ga0373943_0001478 | 3300035170 | Bacteria | 10640 |
| 458 | Ga0373943_0009727 | 3300035170 | Bacteria | 4307 |
| 459 | Ga0373943_0074622 | 3300035170 | Bacteria | 1725 |
| 460 | Ga0373946_0025069 | 3300035171 | Bacteria | 2343 |
| 461 | Ga0373946_0025985 | 3300035171 | Bacteria | 2306 |
| 462 | Ga0373955_0010529 | 3300035172 | Bacteria | 4371 |
| 463 | Ga0373955_0045870 | 3300035172 | Bacteria | 2360 |
| 464 | Ga0373955_0369992 | 3300035172 | Bacteria | 869 |
| 465 | Ga0373955_0620458 | 3300035172 | Bacteria | 662 |
| 466 | Ga0373962_0034959 | 3300035242 | Bacteria | 1394 |
| 467 | Ga0373924_0001214 | 3300035410 | Bacteria | 8270 |
| 468 | Ga0373931_0329262 | 3300035691 | Bacteria | 951 |
| 469 | Ga0373935_0000011 | 3300035692 | Bacteria | 89873 |
| 470 | Ga0373935_0153636 | 3300035692 | Bacteria | 1564 |
| 471 | Ga0373935_0204999 | 3300035692 | Bacteria | 1364 |
| 472 | Ga0373935_0403449 | 3300035692 | Bacteria | 982 |
| 473 | Ga0373927_0004771 | 3300035695 | Bacteria | 9441 |
| 474 | Ga0373927_0090551 | 3300035695 | Bacteria | 1986 |
| 475 | Ga0373927_0125649 | 3300035695 | Bacteria | 1674 |
| 476 | Ga0373927_0229844 | 3300035695 | Bacteria | 1219 |
| 477 | Ga0373927_0420980 | 3300035695 | Bacteria | 881 |
| 478 | Ga0373927_0704138 | 3300035695 | Bacteria | 667 |
| 479 | Ga0373933_0000885 | 3300035724 | Bacteria | 18316 |
| 480 | Ga0373933_0131778 | 3300035724 | Bacteria | 1572 |
| 481 | Ga0373947_0002928 | 3300035725 | Bacteria | 10182 |
| 482 | Ga0373947_0034346 | 3300035725 | Bacteria | 2998 |
| 483 | Ga0373947_0038544 | 3300035725 | Bacteria | 2840 |
| 484 | Ga0373947_0051017 | 3300035725 | Bacteria | 2488 |
| 485 | Ga0373947_0225814 | 3300035725 | Bacteria | 1232 |
| 486 | Ga0373947_0414913 | 3300035725 | Bacteria | 909 |
| 487 | Ga0373937_0000019 | 3300036401 | Bacteria | 138568 |
| 488 | Ga0373937_0015685 | 3300036401 | Bacteria | 6708 |
| 489 | Ga0373937_0046562 | 3300036401 | Bacteria | 3966 |
| 490 | Ga0372808_000548 | 3300036459 | Bacteria | 3087 |
| 491 | Ga0373925_0000026 | 3300037068 | Bacteria | 154713 |
| 492 | Ga0373925_0012279 | 3300037068 | Bacteria | 6197 |
| 493 | Ga0373925_0222298 | 3300037068 | Bacteria | 1507 |
| 494 | Ga0373925_0226244 | 3300037068 | Bacteria | 1494 |
| 495 | Ga0395899_0038502 | 3300037312 | Bacteria | 3582 |
| 496 | Ga0395900_0023057 | 3300037418 | Bacteria | 6370 |
| 497 | Ga0395900_0106625 | 3300037418 | Bacteria | 2878 |
| 498 | Ga0395898_0158837 | 3300037466 | Bacteria | 2162 |
| 499 | Ga0395901_0031964 | 3300038443 | Bacteria | 5429 |
| 500 | Ga0395901_0240778 | 3300038443 | Bacteria | 1887 |
| 501 | Ga0436365_0422270 | 3300039437 | Bacteria | 2007 |
| 502 | Ga0436365_1141354 | 3300039437 | Bacteria | 941 |
| 503 | Ga0436365_1142518 | 3300039437 | Bacteria | 1041 |
| 504 | Ga0436365_1392289 | 3300039437 | Bacteria | 644 |
| 505 | Ga0436365_1525977 | 3300039437 | Bacteria | 2192 |
| 506 | Ga0436360_0035660 | 3300039438 | Bacteria | 2190 |
| 507 | Ga0436361_0034753 | 3300039447 | Bacteria | 2945 |
| 508 | Ga0436361_0474226 | 3300039447 | Bacteria | 3446 |
| 509 | Ga0436361_0808590 | 3300039447 | Bacteria | 12129 |
| 510 | Ga0436361_0817855 | 3300039447 | Bacteria | 1485 |
| 511 | Ga0436363_1010904 | 3300039450 | Bacteria | 1457 |
| 512 | Ga0436362_0798067 | 3300039453 | Bacteria | 5843 |
| 513 | Ga0451789_0678307 | 3300041443 | Bacteria | 747 |
| 514 | Ga0451795_1160684 | 3300041456 | Bacteria | 842 |
| 515 | Ga0451841_1435836 | 3300041498 | Bacteria | 825 |
| 516 | Ga0451851_0182072 | 3300041507 | Bacteria | 773 |
| 517 | Ga0451853_1644141 | 3300041512 | Bacteria | 1501 |
| 518 | Ga0466969_0039705 | 3300044656 | Bacteria | 2362 |
| 519 | Ga0466969_0120617 | 3300044656 | Bacteria | 1221 |
| 520 | Ga0466972_0008421 | 3300044658 | Bacteria | 5169 |
| 521 | Ga0466966_0056008 | 3300044684 | Bacteria | 2495 |
| 522 | Ga0466961_0190673 | 3300044693 | Bacteria | 1270 |
| 523 | Ga0466963_0050147 | 3300044694 | Bacteria | 2763 |
| 524 | Ga0466963_0082044 | 3300044694 | Bacteria | 2185 |
| 525 | Ga0466963_0358876 | 3300044694 | Bacteria | 1027 |
| 526 | Ga0466964_0036301 | 3300044706 | Bacteria | 1976 |
| 527 | Ga0466968_0002099 | 3300044735 | Bacteria | 7255 |
| 528 | Ga0466970_0142879 | 3300044765 | Bacteria | 1319 |
| 529 | Ga0466959_0014935 | 3300045049 | Bacteria | 5658 |
| 530 | Ga0466959_0090922 | 3300045049 | Bacteria | 2192 |
| 531 | Ga0466958_0008120 | 3300045836 | Bacteria | 5809 |
| 532 | Ga0466967_0281578 | 3300045976 | Bacteria | 1595 |
| 533 | Ga0466967_0348758 | 3300045976 | Bacteria | 1432 |
| 534 | Ga0495627_105109 | 3300046453 | Bacteria | 804 |
| 535 | Ga0495592_0000017 | 3300046454 | Bacteria | 142442 |
| 536 | Ga0495592_0144855 | 3300046454 | Bacteria | 1648 |
| 537 | Ga0495592_0170942 | 3300046454 | Bacteria | 1488 |
| 538 | Ga0495603_0087387 | 3300046455 | Bacteria | 1824 |
| 539 | Ga0495629_0002872 | 3300046459 | Bacteria | 13167 |
| 540 | Ga0495629_0072839 | 3300046459 | Bacteria | 2399 |
| 541 | Ga0495629_0144812 | 3300046459 | Bacteria | 1653 |
| 542 | Ga0495629_0175724 | 3300046459 | Bacteria | 1485 |
| 543 | Ga0495629_0557934 | 3300046459 | Bacteria | 768 |
| 544 | Ga0495638_0034957 | 3300046460 | Bacteria | 3205 |
| 545 | Ga0495641_0038510 | 3300046461 | Bacteria | 2233 |
| 546 | Ga0495641_0064141 | 3300046461 | Bacteria | 1655 |
| 547 | Ga0495651_0000923 | 3300046462 | Bacteria | 22782 |
| 548 | Ga0495651_0149087 | 3300046462 | Bacteria | 1688 |
| 549 | Ga0495653_0000033 | 3300046463 | Bacteria | 131680 |
| 550 | Ga0495580_0001981 | 3300046472 | Bacteria | 18011 |
| 551 | Ga0495580_0101855 | 3300046472 | Bacteria | 1997 |
| 552 | Ga0495580_0371098 | 3300046472 | Bacteria | 967 |
| 553 | Ga0495582_0007153 | 3300046473 | Bacteria | 6200 |
| 554 | Ga0495582_0189449 | 3300046473 | Bacteria | 1173 |
| 555 | Ga0495605_0092059 | 3300046474 | Bacteria | 1404 |
| 556 | Ga0495639_0004165 | 3300046475 | Bacteria | 6200 |
| 557 | Ga0495639_0013870 | 3300046475 | Bacteria | 3483 |
| 558 | Ga0495662_0024982 | 3300046476 | Bacteria | 2885 |
| 559 | Ga0495662_0170411 | 3300046476 | Bacteria | 1073 |
| 560 | Ga0495662_0171387 | 3300046476 | Bacteria | 1069 |
| 561 | Ga0495664_0000008 | 3300046477 | Bacteria | 307158 |
| 562 | Ga0495664_0004612 | 3300046477 | Bacteria | 7535 |
| 563 | Ga0495584_0019489 | 3300046491 | Bacteria | 3446 |
| 564 | Ga0495594_0246709 | 3300046499 | Bacteria | 1017 |
| 565 | Ga0495607_0200273 | 3300046501 | Bacteria | 989 |
| 566 | Ga0495606_0005524 | 3300046507 | Bacteria | 12067 |
| 567 | Ga0495606_0323154 | 3300046507 | Bacteria | 828 |
| 568 | Ga0495608_0000014 | 3300046511 | Bacteria | 221042 |
| 569 | Ga0495608_0067084 | 3300046511 | Bacteria | 2348 |
| 570 | Ga0495618_0000013 | 3300046514 | Bacteria | 168671 |
| 571 | Ga0495618_0162324 | 3300046514 | Bacteria | 1424 |
| 572 | Ga0495620_0085870 | 3300046515 | Bacteria | 1268 |
| 573 | Ga0495628_0000008 | 3300046516 | Bacteria | 284313 |
| 574 | Ga0495628_0404284 | 3300046516 | Bacteria | 997 |
| 575 | Ga0495628_0405174 | 3300046516 | Bacteria | 996 |
| 576 | Ga0495630_0000797 | 3300046517 | Bacteria | 22206 |
| 577 | Ga0495630_0110073 | 3300046517 | Bacteria | 2086 |
| 578 | Ga0495630_0188388 | 3300046517 | Bacteria | 1574 |
| 579 | Ga0495631_0130069 | 3300046518 | Bacteria | 1082 |
| 580 | Ga0495632_0159955 | 3300046519 | Bacteria | 1038 |
| 581 | Ga0495632_0342932 | 3300046519 | Bacteria | 658 |
| 582 | Ga0495644_0102719 | 3300046523 | Bacteria | 1082 |
| 583 | Ga0495644_0117605 | 3300046523 | Bacteria | 1010 |
| 584 | Ga0495648_0002061 | 3300046524 | Bacteria | 19020 |
| 585 | Ga0495663_0009757 | 3300046525 | Bacteria | 2665 |
| 586 | Ga0495666_0222423 | 3300046526 | Bacteria | 864 |
| 587 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 588 | Ga0495652_0112657 | 3300046529 | Bacteria | 2185 |
| 589 | Ga0495652_0133324 | 3300046529 | Bacteria | 1963 |
| 590 | Ga0495652_0207981 | 3300046529 | Bacteria | 1480 |
| 591 | Ga0495665_0045655 | 3300046531 | Bacteria | 2327 |
| 592 | Ga0495665_0053798 | 3300046531 | Bacteria | 2128 |
| 593 | Ga0495665_0081373 | 3300046531 | Bacteria | 1703 |
| 594 | Ga0495640_0000017 | 3300046533 | Bacteria | 138688 |
| 595 | Ga0495640_0027237 | 3300046533 | Bacteria | 4124 |
| 596 | Ga0495640_0057123 | 3300046533 | Bacteria | 2664 |
| 597 | Ga0495640_0120521 | 3300046533 | Bacteria | 1706 |
| 598 | Ga0495640_0182500 | 3300046533 | Bacteria | 1337 |
| 599 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 600 | Ga0495598_0065772 | 3300046537 | Bacteria | 1129 |
| 601 | Ga0495597_0296920 | 3300046542 | Bacteria | 627 |
| 602 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 603 | Ga0495645_0417515 | 3300046543 | Bacteria | 852 |
| 604 | Ga0495622_0028484 | 3300046557 | Bacteria | 2609 |
| 605 | Ga0495622_0088107 | 3300046557 | Bacteria | 1427 |
| 606 | Ga0495633_0182719 | 3300046558 | Bacteria | 965 |
| 607 | Ga0495667_0000012 | 3300046559 | Bacteria | 220967 |
| 608 | Ga0495667_0227930 | 3300046559 | Bacteria | 1188 |
| 609 | Ga0495656_0006929 | 3300046615 | Bacteria | 3986 |
| 610 | Ga0495656_0057921 | 3300046615 | Bacteria | 1679 |
| 611 | Ga0495656_0227746 | 3300046615 | Bacteria | 934 |
| 612 | Ga0495656_0302253 | 3300046615 | Bacteria | 820 |
| 613 | Ga0495656_0383412 | 3300046615 | Bacteria | 733 |
| 614 | Ga0495668_0101673 | 3300046616 | Bacteria | 1572 |
| 615 | Ga0495668_0142901 | 3300046616 | Bacteria | 1310 |
| 616 | Ga0495634_0000070 | 3300046642 | Bacteria | 79664 |
| 617 | Ga0495634_0038373 | 3300046642 | Bacteria | 3267 |
| 618 | Ga0495634_0051141 | 3300046642 | Bacteria | 2773 |
| 619 | Ga0495634_0081451 | 3300046642 | Bacteria | 2117 |
| 620 | Ga0495611_0067172 | 3300046648 | Bacteria | 1636 |
| 621 | Ga0495625_0250549 | 3300046660 | Bacteria | 1150 |
| 622 | Ga0495635_0000010 | 3300046663 | Bacteria | 246385 |
| 623 | Ga0495635_0054013 | 3300046663 | Bacteria | 2767 |
| 624 | Ga0495635_0380268 | 3300046663 | Bacteria | 940 |
| 625 | Ga0495659_0009015 | 3300046664 | Bacteria | 3179 |
| 626 | Ga0495659_0074123 | 3300046664 | Bacteria | 1280 |
| 627 | Ga0495659_0123352 | 3300046664 | Bacteria | 1022 |
| 628 | Ga0495659_0126862 | 3300046664 | Bacteria | 1009 |
| 629 | Ga0495661_0173568 | 3300046665 | Bacteria | 1148 |
| 630 | Ga0495588_0127023 | 3300046674 | Bacteria | 1345 |
| 631 | Ga0495588_0223297 | 3300046674 | Bacteria | 994 |
| 632 | Ga0495657_0000178 | 3300046675 | Bacteria | 57139 |
| 633 | Ga0495599_0000015 | 3300046678 | Bacteria | 175055 |
| 634 | Ga0495599_0095515 | 3300046678 | Bacteria | 1854 |
| 635 | Ga0495623_0000054 | 3300046679 | Bacteria | 70217 |
| 636 | Ga0495623_0081696 | 3300046679 | Bacteria | 1998 |
| 637 | Ga0495646_0000012 | 3300046680 | Bacteria | 185805 |
| 638 | Ga0495646_0183593 | 3300046680 | Bacteria | 1147 |
| 639 | Ga0495647_0012555 | 3300046681 | Bacteria | 2919 |
| 640 | Ga0495658_0046528 | 3300046683 | Bacteria | 2439 |
| 641 | Ga0495658_0730188 | 3300046683 | Bacteria | 634 |
| 642 | Ga0495669_0148133 | 3300046684 | Bacteria | 1110 |
| 643 | Ga0495613_0026149 | 3300046689 | Bacteria | 4349 |
| 644 | Ga0495613_0132279 | 3300046689 | Bacteria | 1786 |
| 645 | Ga0495613_0136139 | 3300046689 | Bacteria | 1757 |
| 646 | Ga0495613_0754791 | 3300046689 | Bacteria | 637 |
| 647 | Ga0495624_0120885 | 3300046690 | Bacteria | 1608 |
| 648 | Ga0495624_0174723 | 3300046690 | Bacteria | 1310 |
| 649 | Ga0495624_0560915 | 3300046690 | Bacteria | 682 |
| 650 | Ga0495670_0286188 | 3300046691 | Bacteria | 882 |
| 651 | Ga0495600_0000031 | 3300046809 | Bacteria | 85535 |
| 652 | Ga0495600_0440459 | 3300046809 | Bacteria | 807 |
| 653 | Ga0495581_0008126 | 3300047315 | Bacteria | 6077 |
| 654 | Ga0495581_0030914 | 3300047315 | Bacteria | 3102 |
| 655 | Ga0495581_0542199 | 3300047315 | Bacteria | 675 |
| 656 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 657 | Ga0495604_0384624 | 3300047317 | Bacteria | 926 |
| 658 | Ga0495674_0000012 | 3300047319 | Bacteria | 270651 |
| 659 | Ga0495674_0031429 | 3300047319 | Bacteria | 4823 |
| 660 | Ga0495674_0100977 | 3300047319 | Bacteria | 2455 |
| 661 | Ga0495674_0205593 | 3300047319 | Bacteria | 1632 |
| 662 | Ga0495672_0189999 | 3300047320 | Bacteria | 1033 |
| 663 | Ga0495676_0136075 | 3300047321 | Bacteria | 1767 |
| 664 | Ga0495680_0003950 | 3300047322 | Bacteria | 14337 |
| 665 | Ga0495680_0450725 | 3300047322 | Bacteria | 881 |
| 666 | Ga0495683_0076690 | 3300047323 | Bacteria | 1635 |
| 667 | Ga0495687_029531 | 3300047443 | Bacteria | 2536 |
| 668 | Ga0495675_0000500 | 3300047444 | Bacteria | 25407 |
| 669 | Ga0495677_0022362 | 3300047445 | Bacteria | 2294 |
| 670 | Ga0495685_155285 | 3300047447 | Bacteria | 743 |
| 671 | Ga0495684_0000021 | 3300047471 | Bacteria | 144901 |
| 672 | Ga0495684_0034017 | 3300047471 | Bacteria | 3910 |
| 673 | Ga0495684_0068810 | 3300047471 | Bacteria | 2692 |
| 674 | Ga0495686_0120040 | 3300047472 | Bacteria | 1568 |
| 675 | Ga0495593_0000387 | 3300047673 | Bacteria | 24410 |
| 676 | Ga0495593_0017042 | 3300047673 | Bacteria | 4089 |
| 677 | Ga0495593_0569691 | 3300047673 | Bacteria | 568 |
| 678 | Ga0495602_0000031 | 3300048088 | Bacteria | 141518 |
| 679 | Ga0495602_0169947 | 3300048088 | Bacteria | 1693 |
| 680 | Ga0496100_0359397 | 3300048903 | Bacteria | 1101 |
| 681 | Ga0496100_0365094 | 3300048903 | Bacteria | 1093 |
| 682 | Ga0496100_0549769 | 3300048903 | Bacteria | 893 |
| 683 | Ga0496101_1245009 | 3300048904 | Bacteria | 582 |
| 684 | Ga0496102_0023604 | 3300048905 | Bacteria | 5464 |
| 685 | Ga0496102_0514371 | 3300048905 | Bacteria | 1119 |
| 686 | Ga0496102_0520218 | 3300048905 | Bacteria | 1112 |
| 687 | Ga0496102_0540613 | 3300048905 | Bacteria | 1088 |
| 688 | Ga0496102_0725131 | 3300048905 | Bacteria | 917 |
| 689 | Ga0496102_0941114 | 3300048905 | Bacteria | 785 |
| 690 | Ga0496103_0015417 | 3300048906 | Bacteria | 4547 |
| 691 | Ga0496103_0227021 | 3300048906 | Bacteria | 1201 |
| 692 | Ga0496104_0007332 | 3300048907 | Bacteria | 9737 |
| 693 | Ga0496104_0050168 | 3300048907 | Bacteria | 3938 |
| 694 | Ga0496104_0277561 | 3300048907 | Bacteria | 1589 |
| 695 | Ga0496104_0509501 | 3300048907 | Bacteria | 1114 |
| 696 | Ga0496105_0002593 | 3300048908 | Bacteria | 13143 |
| 697 | Ga0496105_0172872 | 3300048908 | Bacteria | 1770 |
| 698 | Ga0496106_0017046 | 3300048909 | Bacteria | 5376 |
| 699 | Ga0496106_0040980 | 3300048909 | Bacteria | 3469 |
| 700 | Ga0496106_0041412 | 3300048909 | Bacteria | 3452 |
| 701 | Ga0496106_0317161 | 3300048909 | Bacteria | 1251 |
| 702 | Ga0496106_0530894 | 3300048909 | Bacteria | 945 |
| 703 | Ga0496107_0019184 | 3300048910 | Bacteria | 4825 |
| 704 | Ga0496107_0165905 | 3300048910 | Bacteria | 1637 |
| 705 | Ga0496107_0399873 | 3300048910 | Bacteria | 1021 |
| 706 | Ga0496108_0000730 | 3300048911 | Bacteria | 25558 |
| 707 | Ga0496108_0271318 | 3300048911 | Bacteria | 1477 |
| 708 | Ga0496108_0273076 | 3300048911 | Bacteria | 1472 |
| 709 | Ga0496108_0767680 | 3300048911 | Bacteria | 833 |
| 710 | Ga0496109_0035650 | 3300048912 | Bacteria | 4489 |
| 711 | Ga0496109_0068681 | 3300048912 | Bacteria | 3248 |
| 712 | Ga0496109_0333338 | 3300048912 | Bacteria | 1432 |
| 713 | Ga0496110_0119406 | 3300048913 | Bacteria | 2374 |
| 714 | Ga0496110_0139747 | 3300048913 | Bacteria | 2189 |
| 715 | Ga0496110_0266560 | 3300048913 | Bacteria | 1559 |
| 716 | Ga0496110_0357787 | 3300048913 | Bacteria | 1330 |
| 717 | Ga0496111_0026832 | 3300048914 | Bacteria | 4069 |
| 718 | Ga0496111_0200167 | 3300048914 | Bacteria | 1485 |
| 719 | Ga0496111_0374366 | 3300048914 | Bacteria | 1053 |
| 720 | Ga0496111_0600244 | 3300048914 | Bacteria | 806 |
| 721 | Ga0496112_0001354 | 3300048915 | Bacteria | 18644 |
| 722 | Ga0496112_0036130 | 3300048915 | Bacteria | 4817 |
| 723 | Ga0496112_0072258 | 3300048915 | Bacteria | 3410 |
| 724 | Ga0496112_0379208 | 3300048915 | Bacteria | 1355 |
| 725 | Ga0496113_0001624 | 3300048916 | Bacteria | 12662 |
| 726 | Ga0496113_0026078 | 3300048916 | Bacteria | 4175 |
| 727 | Ga0496113_0042404 | 3300048916 | Bacteria | 3362 |
| 728 | Ga0496113_0440831 | 3300048916 | Bacteria | 1046 |
| 729 | Ga0496114_0294052 | 3300048917 | Bacteria | 1433 |
| 730 | Ga0496115_0330008 | 3300048918 | Bacteria | 1246 |
| 731 | Ga0496115_0475626 | 3300048918 | Bacteria | 1006 |
| 732 | Ga0496115_0546997 | 3300048918 | Bacteria | 926 |
| 733 | Ga0496118_0084793 | 3300048921 | Bacteria | 2209 |
| 734 | Ga0496118_0195075 | 3300048921 | Bacteria | 1206 |
| 735 | Ga0496119_0365651 | 3300048922 | Bacteria | 695 |
| 736 | Ga0496121_0024711 | 3300048924 | Bacteria | 5733 |
| 737 | Ga0496121_0042122 | 3300048924 | Bacteria | 3978 |
| 738 | Ga0496121_0085260 | 3300048924 | Bacteria | 2487 |
| 739 | Ga0496124_0097823 | 3300048927 | Bacteria | 2382 |
| 740 | Ga0496124_0319971 | 3300048927 | Bacteria | 1111 |
| 741 | Ga0496125_0000869 | 3300048928 | Bacteria | 48286 |
| 742 | Ga0496125_0089608 | 3300048928 | Bacteria | 2313 |
| 743 | Ga0496126_0005056 | 3300048929 | Bacteria | 15313 |
| 744 | Ga0496126_0020298 | 3300048929 | Bacteria | 6519 |
| 745 | Ga0496126_0097338 | 3300048929 | Bacteria | 2579 |
| 746 | Ga0496126_0146913 | 3300048929 | Bacteria | 2024 |
| 747 | Ga0496126_0236545 | 3300048929 | Bacteria | 1528 |
| 748 | Ga0496126_0284193 | 3300048929 | Bacteria | 1370 |
| 749 | Ga0501031_0000207 | 3300049568 | Bacteria | 33573 |
| 750 | Ga0501031_0230477 | 3300049568 | Bacteria | 1205 |
| 751 | Ga0501032_0000252 | 3300049569 | Bacteria | 44619 |
| 752 | Ga0501032_0108559 | 3300049569 | Bacteria | 1837 |
| 753 | Ga0501032_0176021 | 3300049569 | Bacteria | 1402 |
| 754 | Ga0501032_0289853 | 3300049569 | Bacteria | 1059 |
| 755 | Ga0501032_0313850 | 3300049569 | Bacteria | 1012 |
| 756 | Ga0501033_0000082 | 3300049570 | Bacteria | 89837 |
| 757 | Ga0501033_0053999 | 3300049570 | Bacteria | 2974 |
| 758 | Ga0501033_0094332 | 3300049570 | Bacteria | 2188 |
| 759 | Ga0501033_0123308 | 3300049570 | Bacteria | 1879 |
| 760 | Ga0501033_0319002 | 3300049570 | Bacteria | 1092 |
| 761 | Ga0501034_0000198 | 3300049571 | Bacteria | 113672 |
| 762 | Ga0501034_0095640 | 3300049571 | Bacteria | 2967 |
| 763 | Ga0501036_0001281 | 3300049572 | Bacteria | 19291 |
| 764 | Ga0501036_0071045 | 3300049572 | Bacteria | 2943 |
| 765 | Ga0501036_0218315 | 3300049572 | Bacteria | 1601 |
| 766 | Ga0501036_0262975 | 3300049572 | Bacteria | 1445 |
| 767 | Ga0501036_0490641 | 3300049572 | Bacteria | 1022 |
| 768 | Ga0501036_0786922 | 3300049572 | Bacteria | 784 |
| 769 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 770 | Ga0501037_0110109 | 3300049573 | Bacteria | 1984 |
| 771 | Ga0501037_0193680 | 3300049573 | Bacteria | 1439 |
| 772 | Ga0501038_0000538 | 3300049574 | Bacteria | 33271 |
| 773 | Ga0501038_0084278 | 3300049574 | Bacteria | 2674 |
| 774 | Ga0501038_0508718 | 3300049574 | Bacteria | 920 |
| 775 | Ga0501039_0000366 | 3300049575 | Bacteria | 32333 |
| 776 | Ga0501040_0365553 | 3300049576 | Bacteria | 1034 |
| 777 | Ga0501042_0081623 | 3300049578 | Bacteria | 2317 |
| 778 | Ga0501042_0616593 | 3300049578 | Bacteria | 789 |
| 779 | Ga0501043_0002344 | 3300049579 | Bacteria | 16056 |
| 780 | Ga0501043_0030258 | 3300049579 | Bacteria | 4254 |
| 781 | Ga0501043_0243818 | 3300049579 | Bacteria | 1386 |
| 782 | Ga0501043_0457990 | 3300049579 | Bacteria | 957 |
| 783 | Ga0501046_0000434 | 3300049580 | Bacteria | 41950 |
| 784 | Ga0501047_0000131 | 3300049581 | Bacteria | 91079 |
| 785 | Ga0501047_0014359 | 3300049581 | Bacteria | 7530 |
| 786 | Ga0501047_0063958 | 3300049581 | Bacteria | 3549 |
| 787 | Ga0501047_0077939 | 3300049581 | Bacteria | 3187 |
| 788 | Ga0501047_0106601 | 3300049581 | Bacteria | 2683 |
| 789 | Ga0501047_0234791 | 3300049581 | Bacteria | 1686 |
| 790 | Ga0501048_0000531 | 3300049582 | Bacteria | 26809 |
| 791 | Ga0501048_0259209 | 3300049582 | Bacteria | 1235 |
| 792 | Ga0501067_0000628 | 3300049583 | Bacteria | 18974 |
| 793 | Ga0501067_0081828 | 3300049583 | Bacteria | 1790 |
| 794 | Ga0501068_0000080 | 3300049584 | Bacteria | 39376 |
| 795 | Ga0501069_0001211 | 3300049585 | Bacteria | 12577 |
| 796 | Ga0501070_0005971 | 3300049586 | Bacteria | 10376 |
| 797 | Ga0501070_0013649 | 3300049586 | Bacteria | 6844 |
| 798 | Ga0501070_0083701 | 3300049586 | Bacteria | 2641 |
| 799 | Ga0501070_0223992 | 3300049586 | Bacteria | 1542 |
| 800 | Ga0501070_0415209 | 3300049586 | Bacteria | 1087 |
| 801 | Ga0501070_0416498 | 3300049586 | Bacteria | 1085 |
| 802 | Ga0501070_0634540 | 3300049586 | Bacteria | 849 |
| 803 | Ga0501071_0148282 | 3300049587 | Bacteria | 1749 |
| 804 | Ga0501072_0000378 | 3300049588 | Bacteria | 31856 |
| 805 | Ga0501072_0004379 | 3300049588 | Bacteria | 10721 |
| 806 | Ga0501073_0000062 | 3300049589 | Bacteria | 66884 |
| 807 | Ga0501073_0153891 | 3300049589 | Bacteria | 1594 |
| 808 | Ga0501074_0003814 | 3300049590 | Bacteria | 10720 |
| 809 | Ga0501074_0183894 | 3300049590 | Bacteria | 1491 |
| 810 | Ga0501076_0015345 | 3300049592 | Bacteria | 5789 |
| 811 | Ga0501076_0551364 | 3300049592 | Bacteria | 950 |
| 812 | Ga0501079_0001399 | 3300049741 | Bacteria | 17010 |
| 813 | Ga0501079_0026413 | 3300049741 | Bacteria | 4452 |
| 814 | Ga0501079_0454522 | 3300049741 | Bacteria | 1006 |
| 815 | Ga0501079_0566016 | 3300049741 | Unclassified | 894 |
| 816 | Ga0501080_0009398 | 3300049742 | Bacteria | 8917 |
| 817 | Ga0501080_0020500 | 3300049742 | Bacteria | 6121 |
| 818 | Ga0501080_0097463 | 3300049742 | Bacteria | 2730 |
| 819 | Ga0501080_0431121 | 3300049742 | Bacteria | 1183 |
| 820 | Ga0501080_0528852 | 3300049742 | Bacteria | 1052 |
| 821 | Ga0501080_0563361 | 3300049742 | Bacteria | 1014 |
| 822 | Ga0501081_0086589 | 3300049743 | Bacteria | 2200 |
| 823 | Ga0501083_0000341 | 3300049744 | Bacteria | 29641 |
| 824 | Ga0501035_0000123 | 3300049822 | Bacteria | 93734 |
| 825 | Ga0501035_0066047 | 3300049822 | Bacteria | 3211 |
| 826 | Ga0501035_0165534 | 3300049822 | Bacteria | 1912 |
| 827 | Ga0501035_0229193 | 3300049822 | Bacteria | 1583 |
| 828 | Ga0501035_0252395 | 3300049822 | Bacteria | 1497 |
| 829 | Ga0501035_0381538 | 3300049822 | Bacteria | 1175 |
| 830 | Ga0501035_0808315 | 3300049822 | Bacteria | 748 |
| 831 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 832 | Ga0501044_0126607 | 3300049823 | Bacteria | 2551 |
| 833 | Ga0501044_0126655 | 3300049823 | Bacteria | 2551 |
| 834 | Ga0501044_0174023 | 3300049823 | Bacteria | 2122 |
| 835 | Ga0501044_0188795 | 3300049823 | Bacteria | 2024 |
| 836 | Ga0501044_0214286 | 3300049823 | Bacteria | 1879 |
| 837 | Ga0501044_0258970 | 3300049823 | Bacteria | 1678 |
| 838 | Ga0501044_0359323 | 3300049823 | Bacteria | 1375 |
| 839 | Ga0501045_0258667 | 3300049824 | Bacteria | 1296 |
| 840 | Ga0501045_0744012 | 3300049824 | Bacteria | 723 |
| 841 | nmdc:mga03683_171734_c1 | 3300050489 | Bacteria | 985 |
| 842 | nmdc:mga03683_63731_c1 | 3300050489 | Bacteria | 1563 |
| 843 | nmdc:mga03n38_20945_c1 | 3300050490 | Bacteria | 2624 |
| 844 | nmdc:mga03n38_788_c1 | 3300050490 | Bacteria | 8412 |
| 845 | nmdc:mga00v17_113629_c1 | 3300050491 | Bacteria | 1719 |
| 846 | nmdc:mga00v17_193210_c1 | 3300050491 | Bacteria | 1315 |
| 847 | nmdc:mga00v17_78621_c1 | 3300050491 | Bacteria | 2056 |
| 848 | nmdc:mga0yw44_10435_c1 | 3300050492 | Bacteria | 4745 |
| 849 | nmdc:mga0yw44_122929_c1 | 3300050492 | Bacteria | 1673 |
| 850 | nmdc:mga0yw44_280364_c1 | 3300050492 | Bacteria | 1114 |
| 851 | nmdc:mga0yw44_3696_c1 | 3300050492 | Bacteria | 6847 |
| 852 | nmdc:mga0yw44_44332_c1 | 3300050492 | Bacteria | 2660 |
| 853 | nmdc:mga0yw44_68065_c1 | 3300050492 | Bacteria | 2201 |
| 854 | nmdc:mga0yw44_90120_c1 | 3300050492 | Bacteria | 1937 |
| 855 | nmdc:mga0k408_241875_c1 | 3300050493 | Bacteria | 1078 |
| 856 | nmdc:mga06z11_181046_c1 | 3300050494 | Bacteria | 1215 |
| 857 | nmdc:mga06z11_222124_c1 | 3300050494 | Bacteria | 1104 |
| 858 | nmdc:mga04h51_35947_c1 | 3300050495 | Bacteria | 1590 |
| 859 | nmdc:mga07m45_10136_c1 | 3300050496 | Bacteria | 4454 |
| 860 | nmdc:mga07m45_129657_c1 | 3300050496 | Bacteria | 1459 |
| 861 | nmdc:mga07m45_16328_c1 | 3300050496 | Bacteria | 3975 |
| 862 | nmdc:mga05p37_321003_c1 | 3300050507 | Bacteria | 1833 |
| 863 | nmdc:mga05p37_88296_c1 | 3300050507 | Bacteria | 3822 |
| 864 | nmdc:mga09592_136043_c1 | 3300050508 | Bacteria | 2116 |
| 865 | nmdc:mga0qj67_197102_c2 | 3300050509 | Bacteria | 1246 |
| 866 | nmdc:mga0qj67_604368_c1 | 3300050509 | Bacteria | 877 |
| 867 | nmdc:mga06r32_117088_c1 | 3300050510 | Bacteria | 2626 |
| 868 | nmdc:mga06r32_131590_c1 | 3300050510 | Bacteria | 2474 |
| 869 | nmdc:mga06r32_96370_c1 | 3300050510 | Bacteria | 2897 |
| 870 | nmdc:mga08y16_140797_c1 | 3300050511 | Bacteria | 2508 |
| 871 | nmdc:mga08y16_67818_c1 | 3300050511 | Bacteria | 3721 |
| 872 | nmdc:mga0n895_101162_c1 | 3300050512 | Bacteria | 2892 |
| 873 | nmdc:mga0n895_253790_c1 | 3300050512 | Bacteria | 1785 |
| 874 | nmdc:mga0n895_463362_c1 | 3300050512 | Bacteria | 1279 |
| 875 | nmdc:mga0n895_95048_c1 | 3300050512 | Bacteria | 2985 |
| 876 | nmdc:mga0rr50_417374_c1 | 3300050513 | Bacteria | 1135 |
| 877 | nmdc:mga0rr50_50577_c1 | 3300050513 | Bacteria | 3080 |
| 878 | nmdc:mga0rr50_65213_c1 | 3300050513 | Bacteria | 2758 |
| 879 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 880 | nmdc:mga0sz30_51290_c1 | 3300050516 | Bacteria | 1750 |
| 881 | nmdc:mga0sz30_59676_c1 | 3300050516 | Bacteria | 1628 |
| 882 | Ga0495601_0000011 | 3300053077 | Bacteria | 264937 |
| 883 | Ga0495601_0022853 | 3300053077 | Bacteria | 3842 |
| 884 | Ga0495601_0107727 | 3300053077 | Bacteria | 1803 |
| 885 | Ga0495601_0121375 | 3300053077 | Bacteria | 1697 |
| 886 | Ga0495612_0000006 | 3300053078 | Bacteria | 269278 |
| 887 | Ga0495612_0020737 | 3300053078 | Bacteria | 2635 |
| 888 | Ga0495612_0153925 | 3300053078 | Bacteria | 1002 |
| 889 | Ga0495655_0033841 | 3300053083 | Bacteria | 1260 |
| 890 | Ga0495595_0000021 | 3300053084 | Bacteria | 115921 |
| 891 | Ga0495595_0038918 | 3300053084 | Bacteria | 2168 |
| 892 | Ga0495595_0059378 | 3300053084 | Bacteria | 1788 |
| 893 | Ga0495619_0000013 | 3300053085 | Bacteria | 264865 |
| 894 | Ga0495619_0012966 | 3300053085 | Bacteria | 5251 |
| 895 | Ga0495619_0034640 | 3300053085 | Bacteria | 3283 |
| 896 | Ga0500646_0018789 | 3300053090 | Bacteria | 1824 |
| 897 | Ga0500566_0000055 | 3300053094 | Bacteria | 54414 |
| 898 | Ga0500641_0010703 | 3300053096 | Bacteria | 3321 |
| 899 | Ga0500641_0027147 | 3300053096 | Bacteria | 2228 |
| 900 | Ga0500594_0183732 | 3300053118 | Bacteria | 683 |
| 901 | Ga0500608_084422 | 3300053122 | Bacteria | 1493 |
| 902 | Ga0500617_190207 | 3300053124 | Bacteria | 765 |
| 903 | Ga0500658_0055005 | 3300053134 | Bacteria | 1637 |
| 904 | Ga0500559_0000362 | 3300053136 | Bacteria | 33750 |
| 905 | Ga0500559_0100450 | 3300053136 | Bacteria | 1332 |
| 906 | Ga0500568_0033662 | 3300053139 | Bacteria | 2101 |
| 907 | Ga0500589_082946 | 3300053147 | Bacteria | 1427 |
| 908 | Ga0500633_0197384 | 3300053160 | Bacteria | 753 |
| 909 | Ga0500636_0001777 | 3300053177 | Bacteria | 11806 |
| 910 | Ga0500637_0139649 | 3300053178 | Bacteria | 1403 |
| 911 | Ga0500645_021788 | 3300053730 | Bacteria | 1975 |
| 912 | Ga0501084_0019061 | 3300054114 | Bacteria | 5714 |
| 913 | Ga0501084_0027413 | 3300054114 | Bacteria | 4760 |
| 914 | Ga0501084_0121841 | 3300054114 | Bacteria | 2193 |
| 915 | Ga0501082_0001776 | 3300060353 | Bacteria | 18967 |
| 916 | Ga0501082_0081197 | 3300060353 | Bacteria | 2798 |
| 917 | Ga0501082_0251508 | 3300060353 | Bacteria | 1538 |
| 918 | Ga0466962_0074710 | 3300061719 | Bacteria | 1620 |
| 919 | Ga0466962_0454593 | 3300061719 | Bacteria | 645 |
| 920 | Ga0530510_0007398 | 3300061734 | Bacteria | 7644 |
| 921 | Ga0530510_1019593 | 3300061734 | Bacteria | 633 |
| 922 | 2507505433 | 2507262055 | Bacteria | 8048963 |
| 923 | 2509152162 | 2508501128 | Bacteria | 8613869 |
| 924 | 2511399107 | 2511231028 | Bacteria | 8046582 |
| 925 | 2513623943 | 2513237092 | Bacteria | 8341956 |
| 926 | 2513675813 | 2513237098 | Bacteria | 9902361 |
| 927 | 2513695270 | 2513237101 | Bacteria | 7952346 |
| 928 | 2513873367 | 2513237139 | Bacteria | 8737671 |
| 929 | 2513888597 | 2513237141 | Bacteria | 8496279 |
| 930 | 2514014697 | 2513237161 | Bacteria | 8871253 |
| 931 | 2524441424 | 2524023205 | Bacteria | 8918781 |
| 932 | 2528853336 | 2528768022 | Bacteria | 10457665 |
| 933 | 2617352078 | 2617270735 | Bacteria | 9163226 |
| 934 | 2644291076 | 2643221651 | Bacteria | 4798932 |
| 935 | 2723841804 | 2721755755 | Bacteria | 8322773 |
| 936 | 2793062217 | 2791355196 | Bacteria | 7323613 |
| 937 | 2805920715 | 2802429603 | Bacteria | 8777136 |
| 938 | 2824670006 | 2824661429 | Bacteria | 9877870 |
| 939 | 2824676593 | 2824671348 | Bacteria | 8369588 |
| 940 | 2824693255 | 2824687955 | Bacteria | 8360029 |
| 941 | 2824702624 | 2824696289 | Bacteria | 8335049 |
| 942 | 2824713730 | 2824704595 | Bacteria | 9667483 |
| 943 | 2824761773 | 2824753945 | Bacteria | 9787441 |
| 944 | 2824772272 | 2824763712 | Bacteria | 9792355 |
| 945 | 2824780862 | 2824773399 | Bacteria | 8360218 |
| 946 | 2838124678 | 2838122688 | Bacteria | 8803140 |
| 947 | 2841945370 | 2841941048 | Bacteria | 8688029 |
| 948 | 2841952155 | 2841949485 | Bacteria | 8680857 |
| 949 | 2841965364 | 2841957949 | Bacteria | 8652217 |
| 950 | 2841970457 | 2841966195 | Bacteria | 8673214 |
| 951 | 2841981705 | 2841974524 | Bacteria | 8931498 |
| 952 | 2841984986 | 2841983080 | Bacteria | 8395090 |
| 953 | 2847942321 | 2847939898 | Bacteria | 8606328 |
| 954 | 2874617998 | 2874612657 | Bacteria | 8252029 |
| 955 | 2874621222 | 2874620515 | Bacteria | 8290088 |
| 956 | 2876814206 | 2876808645 | Bacteria | 8824342 |
| 957 | 2879099907 | 2879099564 | Bacteria | 10442239 |
| 958 | 2879113331 | 2879110137 | Bacteria | 8907982 |
| 959 | 2885369353 | 2885366525 | Bacteria | 8326213 |
| 960 | 2888390519 | 2888388044 | Bacteria | 7304136 |
| 961 | 2893067492 | 2893066018 | Bacteria | 6158120 |
| 962 | 2904667767 | 2904666416 | Bacteria | 8226587 |
| 963 | 2904716348 | 2904711408 | Bacteria | 9771557 |
| 964 | 2922363189 | 2922361189 | Bacteria | 7436256 |
| 965 | 2922369407 | |||
| 966 | 2922388506 | 2922386360 | Bacteria | 7017218 |
| 967 | 2922400045 | 2922393267 | Bacteria | 8285685 |
| 968 | 2929618765 | 2929615660 | Bacteria | 9193770 |
| 969 | 2929628550 | 2929624759 | Bacteria | 9339455 |
| 970 | 2932790947 | 2932784394 | Bacteria | 9704911 |
| 971 | 2932812000 | 2932809354 | Bacteria | 9135765 |
| 972 | 2932825549 | 2932818245 | Bacteria | 9955613 |
| 973 | 2932833663 | 2932828146 | Bacteria | 9745859 |
| 974 | 2933580525 | 2933577622 | Bacteria | 9116884 |
| 975 | 2935615539 | 2935608549 | Bacteria | 8203142 |
| 976 | 2935623189 | 2935616580 | Bacteria | 9032984 |
| 977 | 2935644264 | 2935638405 | Bacteria | 10015038 |
| 978 | 2935672154 | 2935665750 | Bacteria | 9571747 |
| 979 | 2935679325 | 2935675223 | Bacteria | 9928132 |
| 980 | 2935686566 | 2935684952 | Bacteria | 9590419 |
| 981 | 2935700349 | 2935694250 | Bacteria | 9291695 |
| 982 | 2935710297 | 2935703347 | Bacteria | 10242284 |
| 983 | 2935716254 | 2935713505 | Bacteria | 9608509 |
| 984 | 2935723622 | 2935722832 | Bacteria | 9608746 |
| 985 | 2935735177 | 2935732158 | Bacteria | 9706831 |
| 986 | 2935744032 | 2935741537 | Bacteria | 9707219 |
| 987 | 2935752532 | 2935750917 | Bacteria | 9590372 |
| 988 | 2935763334 | 2935760218 | Bacteria | 9817913 |
| 989 | 2935772882 | 2935769743 | Bacteria | 7878163 |
| 990 | 2935783327 | 2935777560 | Bacteria | 8077691 |
| 991 | 2935788130 | 2935785616 | Bacteria | 7962367 |
| 992 | 2935796294 | 2935793552 | Bacteria | 8012592 |
| 993 | 2935808288 | 2935801545 | Bacteria | 9301974 |
| 994 | 2935816099 | 2935810662 | Bacteria | 9401221 |
| 995 | 2935825660 | 2935819856 | Bacteria | 8261050 |
| 996 | 2935833492 | 2935827899 | Bacteria | 10038562 |
| 997 | 2935845950 | 2935837841 | Bacteria | 9454360 |
| 998 | 2935853424 | 2935847175 | Bacteria | 8228321 |
| 999 | 2935861437 | 2935855204 | Bacteria | 9035059 |
| 1000 | 2935869556 | 2935864058 | Bacteria | 9784707 |
| 1001 | 2935879885 | 2935873716 | Bacteria | 9632195 |
| 1002 | 2935915026 | 2935908558 | Bacteria | 8568796 |
| 1003 | 2935918874 | 2935916978 | Bacteria | 9113783 |
| 1004 | 2935931409 | 2935926038 | Bacteria | 8601059 |
| 1005 | 2935940006 | 2935934488 | Bacteria | 8602579 |
| 1006 | 2935947647 | 2935942939 | Bacteria | 8599779 |
| 1007 | 2935956418 | 2935951376 | Bacteria | 8602333 |
| 1008 | 2935973212 | 2935967501 | Bacteria | 8603075 |
| 1009 | 2935997892 | 2935992306 | Bacteria | 9802711 |
| 1010 | 2936008843 | 2936002035 | Bacteria | 9362176 |
| 1011 | 2936041104 | 2936037263 | Bacteria | 9446081 |
| 1012 | 2940558445 | 2940556831 | Bacteria | 9590747 |
| 1013 | 2941547119 | 2941538514 | Bacteria | 9402094 |
| 1014 | 3005594119 | 3005587118 | Bacteria | 7794411 |
| 1015 | 3005718455 | 3005718088 | Bacteria | 8283608 |
| 1016 | 8016526309 | 8016522445 | Bacteria | 8156687 |
| 1017 | 8016531370 | 8016530956 | Bacteria | 8155261 |
| 1018 | 8016544585 | 8016539877 | Bacteria | 8155419 |
| 1019 | 8016557492 | 8016548790 | Bacteria | 8155074 |
| 1020 | 8016565848 | 8016557553 | Bacteria | 8154380 |
| 1021 | 8016569636 | 8016566248 | Bacteria | 8158151 |
| 1022 | 8016582246 | 8016575299 | Bacteria | 8154085 |
| 1023 | 8016603447 | 8016595262 | Bacteria | 8149947 |
| 1024 | 8016606385 | 8016603502 | Bacteria | 8731218 |
| 1025 | 8016618292 | 8016613128 | Bacteria | 8794220 |
| 1026 | 8016622941 | 8016622563 | Bacteria | 7999408 |
| 1027 | 8016635445 | 8016630954 | Bacteria | 9217207 |
| 1028 | 8017058631 | 8017057580 | Bacteria | 10023680 |
| 1029 | 8019531203 | 8019530166 | Bacteria | 8155624 |
| 1030 | 8019540350 | 8019538911 | Bacteria | 7872763 |
| 1031 | 8019549941 | 8019547302 | Bacteria | 7996444 |
| 1032 | 8019577028 | 8019576017 | Bacteria | 10049540 |
| 1033 | 8019595095 | 8019586578 | Bacteria | 10212056 |
| 1034 | 8019606646 | 8019597564 | Bacteria | 10041141 |
| 1035 | 8019611865 | 8019608314 | Bacteria | 10042931 |
| 1036 | 8019696068 | 8019687851 | Bacteria | 8712826 |
| 1037 | 8055742614 | 8055742211 | Bacteria | 9226248 |
| 1038 | 8056676122 | 8056673599 | Bacteria | 7871253 |
| 1039 | Ga0500577_0001713 | |||
| 1040 | JGI24748J21848_1015566 | |||
| 1041 | JGI24744J21845_10029693 | |||
| 1042 | JGI24034J26672_10001856 | |||
| 1043 | JGI25406J46586_10001038 | |||
| 1044 | JGI25165J46597_1006459 | |||
| 1045 | JGI25160J50197_1024431 | |||
| 1046 | JGI25404J52841_10019750 | |||
| 1047 | Ga0070676_10056764 | |||
| 1048 | Ga0070676_10622566 | |||
| 1049 | Ga0070683_100020477 | |||
| 1050 | Ga0070683_100623998 | |||
| 1051 | Ga0070690_100213100 | |||
| 1052 | Ga0070670_100010392 | |||
| 1053 | Ga0070670_100028895 | |||
| 1054 | Ga0068869_100053668 | |||
| 1055 | Ga0068869_100064712 | |||
| 1056 | Ga0068869_100118320 | |||
| 1057 | Ga0070666_10068506 | |||
| 1058 | Ga0070682_100084056 | |||
| 1059 | Ga0068868_100007925 | |||
| 1060 | Ga0070660_100057694 | |||
| 1061 | Ga0070660_100057834 | |||
| 1062 | Ga0070660_100323095 | |||
| 1063 | Ga0070689_100088421 | |||
| 1064 | Ga0070689_100138358 | |||
| 1065 | Ga0070691_10006615 | |||
| 1066 | Ga0070687_100003213 | |||
| 1067 | Ga0070661_100030649 | |||
| 1068 | Ga0070692_10177695 | |||
| 1069 | Ga0070668_100039652 | |||
| 1070 | Ga0070668_100295771 | |||
| 1071 | Ga0070668_100813431 | |||
| 1072 | Ga0070668_101030464 | |||
| 1073 | Ga0070669_100432359 | |||
| 1074 | Ga0070675_100023243 | |||
| 1075 | Ga0070671_100062961 | |||
| 1076 | Ga0070671_100112638 | |||
| 1077 | Ga0070671_100157830 | |||
| 1078 | Ga0070671_100275964 | |||
| 1079 | Ga0070671_100339358 | |||
| 1080 | Ga0070671_100463907 | |||
| 1081 | Ga0070674_100030585 | |||
| 1082 | Ga0070674_100113963 | |||
| 1083 | Ga0070673_100373110 | |||
| 1084 | Ga0070673_100942078 | |||
| 1085 | Ga0070688_100019458 | |||
| 1086 | Ga0070688_100516109 | |||
| 1087 | Ga0070659_100120020 | |||
| 1088 | Ga0070714_100172604 | |||
| 1089 | Ga0070714_100204994 | |||
| 1090 | Ga0070714_100329444 | |||
| 1091 | Ga0070714_100490107 | |||
| 1092 | Ga0070713_100022398 | |||
| 1093 | Ga0070710_10205902 | |||
| 1094 | Ga0070710_10289417 | |||
| 1095 | Ga0070710_10653984 | |||
| 1096 | Ga0070711_100027826 | |||
| 1097 | Ga0070705_100093111 | |||
| 1098 | Ga0070705_100115636 | |||
| 1099 | Ga0070700_100003506 | |||
| 1100 | Ga0070700_100709663 | |||
| 1101 | Ga0070694_100248261 | |||
| 1102 | Ga0070663_100034543 | |||
| 1103 | Ga0070663_100077506 | |||
| 1104 | Ga0070663_100306136 | |||
| 1105 | Ga0070663_100399998 | |||
| 1106 | Ga0070678_100118683 | |||
| 1107 | Ga0070678_100302100 | |||
| 1108 | Ga0070678_100411880 | |||
| 1109 | Ga0070678_100895577 | |||
| 1110 | Ga0070662_100037362 | |||
| 1111 | Ga0070662_100104780 | |||
| 1112 | Ga0070662_100251296 | |||
| 1113 | Ga0070662_100689437 | |||
| 1114 | Ga0070681_10001077 | |||
| 1115 | Ga0068867_100047596 | |||
| 1116 | Ga0070706_100301548 | |||
| 1117 | Ga0070706_100587753 | |||
| 1118 | Ga0070698_100112123 | |||
| 1119 | Ga0070699_100389715 | |||
| 1120 | Ga0070679_100074727 | |||
| 1121 | Ga0070679_100236261 | |||
| 1122 | Ga0070679_100414616 | |||
| 1123 | Ga0070684_100014169 | |||
| 1124 | Ga0070684_100337678 | |||
| 1125 | Ga0070684_100503733 | |||
| 1126 | Ga0070697_100017648 | |||
| 1127 | Ga0070697_100103441 | |||
| 1128 | Ga0070697_100898578 | |||
| 1129 | Ga0068853_100076989 | |||
| 1130 | Ga0068853_100173008 | |||
| 1131 | Ga0068853_100508823 | |||
| 1132 | Ga0068853_100601593 | |||
| 1133 | Ga0068853_100673696 | |||
| 1134 | Ga0070672_100228804 | |||
| 1135 | Ga0070686_100025193 | |||
| 1136 | Ga0070686_100375672 | |||
| 1137 | Ga0070695_100033091 | |||
| 1138 | Ga0070695_100214825 | |||
| 1139 | Ga0070696_100279755 | |||
| 1140 | Ga0070696_100354646 | |||
| 1141 | Ga0070693_100155781 | |||
| 1142 | Ga0070693_100512607 | |||
| 1143 | Ga0070665_100112414 | |||
| 1144 | Ga0070665_100316202 | |||
| 1145 | Ga0070665_100881387 | |||
| 1146 | Ga0070704_100129559 | |||
| 1147 | Ga0070704_100264046 | |||
| 1148 | Ga0068855_100114024 | |||
| 1149 | Ga0068855_100204516 | |||
| 1150 | Ga0068855_100627042 | |||
| 1151 | Ga0068855_100748238 | |||
| 1152 | Ga0070664_100337346 | |||
| 1153 | Ga0070664_100576173 | |||
| 1154 | Ga0070664_100784140 | |||
| 1155 | Ga0068857_100278299 | |||
| 1156 | Ga0068857_100484269 | |||
| 1157 | Ga0068854_100160519 | |||
| 1158 | Ga0068854_100174960 | |||
| 1159 | Ga0068854_100738504 | |||
| 1160 | Ga0068856_100125157 | |||
| 1161 | Ga0068852_100174137 | |||
| 1162 | Ga0068859_100847664 | |||
| 1163 | Ga0068864_100194607 | |||
| 1164 | Ga0068864_100229416 | |||
| 1165 | Ga0068864_100864787 | |||
| 1166 | Ga0068866_10080314 | |||
| 1167 | Ga0068866_10446678 | |||
| 1168 | Ga0068861_100068282 | |||
| 1169 | Ga0068861_100211907 | |||
| 1170 | Ga0068861_100240542 | |||
| 1171 | Ga0068861_100639319 | |||
| 1172 | Ga0068851_10177294 | |||
| 1173 | Ga0068870_10046750 | |||
| 1174 | Ga0068863_100040383 | |||
| 1175 | Ga0068863_100074859 | |||
| 1176 | Ga0068858_100082321 | |||
| 1177 | Ga0068858_100499880 | |||
| 1178 | Ga0068860_100153938 | |||
| 1179 | Ga0068860_100180429 | |||
| 1180 | Ga0068860_100457375 | |||
| 1181 | Ga0068862_100024856 | |||
| 1182 | Ga0068862_100132689 | |||
| 1183 | Ga0068862_100684986 | |||
| 1184 | Ga0081455_10012728 | |||
| 1185 | Ga0081538_10039257 | |||
| 1186 | Ga0081538_10054534 | |||
| 1187 | Ga0081540_1005580 | |||
| 1188 | Ga0081540_1011553 | |||
| 1189 | Ga0081540_1030748 | |||
| 1190 | Ga0081539_10003753 | |||
| 1191 | Ga0070717_10053860 | |||
| 1192 | Ga0070717_10097051 | |||
| 1193 | Ga0070717_10184325 | |||
| 1194 | Ga0075365_10017305 | |||
| 1195 | Ga0075365_10053169 | |||
| 1196 | Ga0075365_10088470 | |||
| 1197 | Ga0075365_10132189 | |||
| 1198 | Ga0075365_10153342 | |||
| 1199 | Ga0075365_10411198 | |||
| 1200 | Ga0075365_10521979 | |||
| 1201 | Ga0075368_10064064 | |||
| 1202 | Ga0075368_10163385 | |||
| 1203 | Ga0075368_10193756 | |||
| 1204 | Ga0075363_100007350 | |||
| 1205 | Ga0075363_100020186 | |||
| 1206 | Ga0075363_100050348 | |||
| 1207 | Ga0075363_100114480 | |||
| 1208 | Ga0075364_10119152 | |||
| 1209 | Ga0075364_10301488 | |||
| 1210 | Ga0075432_10243891 | |||
| 1211 | Ga0070716_100189041 | |||
| 1212 | Ga0070712_100073352 | |||
| 1213 | Ga0070712_100416949 | |||
| 1214 | Ga0075362_10076051 | |||
| 1215 | Ga0075362_10328986 | |||
| 1216 | Ga0075367_10383067 | |||
| 1217 | Ga0075369_10055303 | |||
| 1218 | Ga0075366_10078725 | |||
| 1219 | Ga0097621_100608306 | |||
| 1220 | Ga0075370_10011007 | |||
| 1221 | Ga0075370_10141709 | |||
| 1222 | Ga0075370_10380472 | |||
| 1223 | Ga0068871_100133308 | |||
| 1224 | Ga0068871_100275435 | |||
| 1225 | Ga0068871_100535863 | |||
| 1226 | Ga0075428_100067213 | |||
| 1227 | Ga0075428_100082208 | |||
| 1228 | Ga0075428_100279196 | |||
| 1229 | Ga0075428_100968415 | |||
| 1230 | Ga0075434_100074886 | |||
| 1231 | Ga0075434_100106463 | |||
| 1232 | Ga0075429_100020262 | |||
| 1233 | Ga0097620_100847644 | |||
| 1234 | Ga0075435_100066208 | |||
| 1235 | Ga0075435_100108578 | |||
| 1236 | Ga0075435_100151663 | |||
| 1237 | Ga0099795_10256232 | |||
| 1238 | Ga0105240_10082975 | |||
| 1239 | Ga0105240_10197980 | |||
| 1240 | Ga0105240_10225649 | |||
| 1241 | Ga0111539_10061009 | |||
| 1242 | Ga0111539_10246353 | |||
| 1243 | Ga0111539_10514348 | |||
| 1244 | Ga0105245_10004490 | |||
| 1245 | Ga0105245_10747765 | |||
| 1246 | Ga0105247_10009526 | |||
| 1247 | Ga0105247_10319158 | |||
| 1248 | Ga0114129_10052932 | |||
| 1249 | Ga0114129_10106009 | |||
| 1250 | Ga0114129_10188583 | |||
| 1251 | Ga0114129_10245258 | |||
| 1252 | Ga0114129_10329128 | |||
| 1253 | Ga0114129_11481406 | |||
| 1254 | Ga0105243_10038961 | |||
| 1255 | Ga0105241_10209378 | |||
| 1256 | Ga0105242_10071965 | |||
| 1257 | Ga0105242_10282440 | |||
| 1258 | Ga0105248_10043760 | |||
| 1259 | Ga0105248_10047926 | |||
| 1260 | Ga0105248_11158480 | |||
| 1261 | Ga0105237_10066600 | |||
| 1262 | Ga0105237_10224102 | |||
| 1263 | Ga0105237_10383874 | |||
| 1264 | Ga0105237_10398432 | |||
| 1265 | Ga0105237_10618893 | |||
| 1266 | Ga0105238_10063695 | |||
| 1267 | Ga0105249_10875503 | |||
| 1268 | Ga0105249_11182661 | |||
| 1269 | Ga0105249_11615535 | |||
| 1270 | Ga0099796_10037348 | |||
| 1271 | Ga0105239_10022916 | |||
| 1272 | Ga0105239_10199912 | |||
| 1273 | Ga0105239_10413335 | |||
| 1274 | Ga0105239_10652501 | |||
| 1275 | Ga0105239_10683262 | |||
| 1276 | Ga0105239_10957711 | |||
| 1277 | Ga0105239_11375953 | |||
| 1278 | Ga0105246_10139948 | |||
| 1279 | Ga0157373_10039123 | |||
| 1280 | Ga0157373_10287352 | |||
| 1281 | Ga0157370_10028400 | |||
| 1282 | Ga0157370_10240116 | |||
| 1283 | Ga0157370_10354160 | |||
| 1284 | Ga0157370_10485370 | |||
| 1285 | Ga0157369_10071589 | |||
| 1286 | Ga0157369_10096664 | |||
| 1287 | Ga0157369_10155843 | |||
| 1288 | Ga0157374_11159214 | |||
| 1289 | Ga0157378_10379274 | |||
| 1290 | Ga0163162_10179236 | |||
| 1291 | Ga0163162_11343367 | |||
| 1292 | Ga0157372_10103182 | |||
| 1293 | Ga0157372_10223986 | |||
| 1294 | Ga0157372_10270361 | |||
| 1295 | Ga0157375_10445206 | |||
| 1296 | Ga0157375_10632210 | |||
| 1297 | Ga0163163_10021857 | |||
| 1298 | Ga0157380_10199597 | |||
| 1299 | Ga0157380_10582045 | |||
| 1300 | Ga0157380_10608921 | |||
| 1301 | Ga0157379_10060482 | |||
| 1302 | Ga0157379_11537911 | |||
| 1303 | Ga0157376_10140354 | |||
| 1304 | Ga0157376_10231976 | |||
| 1305 | Ga0157376_10862821 | |||
| 1306 | Ga0163161_10056894 | |||
| 1307 | Ga0163161_10314649 | |||
| 1308 | Ga0224572_1015081 | |||
| 1309 | Ga0228598_1007284 | |||
| 1310 | Ga0209233_1008253 | |||
| 1311 | Ga0209564_1005467 | |||
| 1312 | Ga0209758_1001013 | |||
| 1313 | Ga0209758_1005533 | |||
| 1314 | Ga0209256_1017459 | |||
| 1315 | Ga0207426_1002838 | |||
| 1316 | Ga0207426_1012013 | |||
| 1317 | Ga0209257_1035057 | |||
| 1318 | Ga0207697_10111736 | |||
| 1319 | Ga0207653_10012696 | |||
| 1320 | Ga0207692_10199440 | |||
| 1321 | Ga0207710_10044330 | |||
| 1322 | Ga0207710_10217270 | |||
| 1323 | Ga0207710_10257003 | |||
| 1324 | Ga0207688_10015244 | |||
| 1325 | Ga0207688_10157215 | |||
| 1326 | Ga0207688_10164260 | |||
| 1327 | Ga0207680_10010978 | |||
| 1328 | Ga0207647_10048127 | |||
| 1329 | Ga0207647_10161162 | |||
| 1330 | Ga0207647_10210080 | |||
| 1331 | Ga0207685_10066599 | |||
| 1332 | Ga0207685_10072500 | |||
| 1333 | Ga0207699_10632587 | |||
| 1334 | Ga0207645_10018488 | |||
| 1335 | Ga0207645_10067939 | |||
| 1336 | Ga0207643_10001362 | |||
| 1337 | Ga0207707_10001830 | |||
| 1338 | Ga0207695_10030631 | |||
| 1339 | Ga0207695_10293819 | |||
| 1340 | Ga0207671_10275622 | |||
| 1341 | Ga0207693_10029152 | |||
| 1342 | Ga0207693_10203572 | |||
| 1343 | Ga0207663_10204296 | |||
| 1344 | Ga0207660_10189206 | |||
| 1345 | Ga0207660_10215906 | |||
| 1346 | Ga0207662_10001498 | |||
| 1347 | Ga0207662_10181724 | |||
| 1348 | Ga0207657_10022399 | |||
| 1349 | Ga0207657_10045121 | |||
| 1350 | Ga0207649_10192546 | |||
| 1351 | Ga0207652_10076567 | |||
| 1352 | Ga0207652_10078201 | |||
| 1353 | Ga0207681_10336781 | |||
| 1354 | Ga0207650_10006398 | |||
| 1355 | Ga0207650_10042065 | |||
| 1356 | Ga0207650_10103609 | |||
| 1357 | Ga0207659_10047121 | |||
| 1358 | Ga0207687_10022847 | |||
| 1359 | Ga0207687_10031317 | |||
| 1360 | Ga0207687_10076681 | |||
| 1361 | Ga0207700_10391156 | |||
| 1362 | Ga0207664_10447650 | |||
| 1363 | Ga0207644_10116107 | |||
| 1364 | Ga0207644_10276846 | |||
| 1365 | Ga0207644_10316939 | |||
| 1366 | Ga0207644_10346071 | |||
| 1367 | Ga0207644_10444596 | |||
| 1368 | Ga0207644_10749855 | |||
| 1369 | Ga0207690_10569055 | |||
| 1370 | Ga0207706_10004857 | |||
| 1371 | Ga0207706_10055965 | |||
| 1372 | Ga0207706_10186712 | |||
| 1373 | Ga0207706_10377744 | |||
| 1374 | Ga0207686_10153786 | |||
| 1375 | Ga0207709_10007603 | |||
| 1376 | Ga0207670_10010018 | |||
| 1377 | Ga0207669_10021340 | |||
| 1378 | Ga0207669_10027600 | |||
| 1379 | Ga0207669_10101165 | |||
| 1380 | Ga0207665_10104335 | |||
| 1381 | Ga0207665_10491769 | |||
| 1382 | Ga0207691_10006388 | |||
| 1383 | Ga0207711_10154538 | |||
| 1384 | Ga0207711_10168163 | |||
| 1385 | Ga0207689_10011143 | |||
| 1386 | Ga0207689_10105243 | |||
| 1387 | Ga0207689_10246990 | |||
| 1388 | Ga0207689_10301956 | |||
| 1389 | Ga0207661_10004360 | |||
| 1390 | Ga0207661_10235294 | |||
| 1391 | Ga0207661_10995580 | |||
| 1392 | Ga0207679_10159939 | |||
| 1393 | Ga0207667_10016003 | |||
| 1394 | Ga0207667_10086452 | |||
| 1395 | Ga0207667_10736113 | |||
| 1396 | Ga0207651_10859856 | |||
| 1397 | Ga0207712_10120991 | |||
| 1398 | Ga0207712_10261168 | |||
| 1399 | Ga0207712_10310291 | |||
| 1400 | Ga0207668_10014153 | |||
| 1401 | Ga0207668_10042564 | |||
| 1402 | Ga0207668_10214148 | |||
| 1403 | Ga0207668_10249287 | |||
| 1404 | Ga0207668_10249554 | |||
| 1405 | Ga0207640_10151819 | |||
| 1406 | Ga0207640_10638546 | |||
| 1407 | Ga0207640_10867510 | |||
| 1408 | Ga0207658_10083707 | |||
| 1409 | Ga0207658_10102777 | |||
| 1410 | Ga0207703_10132048 | |||
| 1411 | Ga0207703_10457850 | |||
| 1412 | Ga0207703_10598827 | |||
| 1413 | Ga0207639_10117753 | |||
| 1414 | Ga0207678_10008802 | |||
| 1415 | Ga0207678_10023605 | |||
| 1416 | Ga0207678_10035784 | |||
| 1417 | Ga0207678_10042691 | |||
| 1418 | Ga0207678_10066177 | |||
| 1419 | Ga0207708_10048288 | |||
| 1420 | Ga0207702_10048122 | |||
| 1421 | Ga0207702_10199613 | |||
| 1422 | Ga0207702_10469132 | |||
| 1423 | Ga0207641_10064481 | |||
| 1424 | Ga0207641_10177570 | |||
| 1425 | Ga0207641_10363258 | |||
| 1426 | Ga0207648_10034157 | |||
| 1427 | Ga0207648_10060278 | |||
| 1428 | Ga0207676_10069096 | |||
| 1429 | Ga0207676_10134973 | |||
| 1430 | Ga0207676_10836273 | |||
| 1431 | Ga0207674_10100669 | |||
| 1432 | Ga0207674_10222249 | |||
| 1433 | Ga0207674_10442281 | |||
| 1434 | Ga0207674_10543883 | |||
| 1435 | Ga0207674_10685190 | |||
| 1436 | Ga0207675_100007482 | |||
| 1437 | Ga0207675_100066389 | |||
| 1438 | Ga0207675_100220968 | |||
| 1439 | Ga0207675_100739936 | |||
| 1440 | Ga0207683_10003631 | |||
| 1441 | Ga0207683_10312823 | |||
| 1442 | Ga0207683_10819124 | |||
| 1443 | Ga0207698_10033869 | |||
| 1444 | Ga0207428_10073687 | |||
| 1445 | Ga0268266_10012729 | |||
| 1446 | Ga0268266_10039111 | |||
| 1447 | Ga0268266_10065598 | |||
| 1448 | Ga0268265_10103924 | |||
| 1449 | Ga0268265_10235425 | |||
| 1450 | Ga0268265_10615805 | |||
| 1451 | Ga0268264_10414187 | |||
| 1452 | Ga0265762_1046092 | |||
| 1453 | Ga0265770_1019529 | |||
| 1454 | Ga0265760_10018660 | |||
| 1455 | Ga0265332_10012491 | |||
| 1456 | Ga0265325_10208551 | |||
| 1457 | Ga0265329_10048481 | |||
| 1458 | Ga0265340_10014138 | |||
| 1459 | Ga0265340_10115228 | |||
| 1460 | Ga0265339_10000738 | |||
| 1461 | Ga0265339_10003900 | |||
| 1462 | Ga0265331_10059574 | |||
| 1463 | Ga0265316_10100060 | |||
| 1464 | Ga0265316_10227539 | |||
| 1465 | Ga0265314_10037456 | |||
| 1466 | Ga0265342_10003180 | |||
| 1467 | Ga0307516_10294049 | |||
| 1468 | Ga0307405_10514475 | |||
| 1469 | Ga0307405_10614393 | |||
| 1470 | Ga0307405_10742955 | |||
| 1471 | Ga0307413_10052158 | |||
| 1472 | Ga0307410_10343301 | |||
| 1473 | Ga0307409_100312813 | |||
| 1474 | Ga0307416_100204452 | |||
| 1475 | Ga0307416_100484234 | |||
| 1476 | Ga0307416_100530292 | |||
| 1477 | Ga0307411_10330782 | |||
| 1478 | Ga0307411_11216227 | |||
| 1479 | Ga0316215_1003830 | |||
| 1480 | Ga0373934_0112658 | |||
| 1481 | Ga0373934_0135590 | |||
| 1482 | Ga0373944_0011826 | |||
| 1483 | Ga0373923_0031514 | |||
| 1484 | Ga0373923_0052729 | |||
| 1485 | Ga0373932_0042705 | |||
| 1486 | Ga0373936_0014580 | |||
| 1487 | Ga0373936_0255942 | |||
| 1488 | Ga0373945_0127093 | |||
| 1489 | Ga0373953_0002353 | |||
| 1490 | Ga0373953_0015566 | |||
| 1491 | Ga0373953_0018502 | |||
| 1492 | Ga0373954_0000445 | |||
| 1493 | Ga0373954_0059464 | |||
| 1494 | Ga0373957_0003642 | |||
| 1495 | Ga0373943_0001478 | |||
| 1496 | Ga0373943_0009727 | |||
| 1497 | Ga0373943_0074622 | |||
| 1498 | Ga0373946_0025069 | |||
| 1499 | Ga0373946_0025985 | |||
| 1500 | Ga0373955_0010529 | |||
| 1501 | Ga0373955_0045870 | |||
| 1502 | Ga0373955_0369992 | |||
| 1503 | Ga0373955_0620458 | |||
| 1504 | Ga0373962_0034959 | |||
| 1505 | Ga0373924_0001214 | |||
| 1506 | Ga0373931_0329262 | |||
| 1507 | Ga0373935_0000011 | |||
| 1508 | Ga0373935_0153636 | |||
| 1509 | Ga0373935_0204999 | |||
| 1510 | Ga0373935_0403449 | |||
| 1511 | Ga0373927_0004771 | |||
| 1512 | Ga0373927_0090551 | |||
| 1513 | Ga0373927_0125649 | |||
| 1514 | Ga0373927_0229844 | |||
| 1515 | Ga0373927_0420980 | |||
| 1516 | Ga0373927_0704138 | |||
| 1517 | Ga0373933_0000885 | |||
| 1518 | Ga0373933_0131778 | |||
| 1519 | Ga0373947_0002928 | |||
| 1520 | Ga0373947_0034346 | |||
| 1521 | Ga0373947_0038544 | |||
| 1522 | Ga0373947_0051017 | |||
| 1523 | Ga0373947_0225814 | |||
| 1524 | Ga0373947_0414913 | |||
| 1525 | Ga0373937_0000019 | |||
| 1526 | Ga0373937_0015685 | |||
| 1527 | Ga0373937_0046562 | |||
| 1528 | Ga0372808_000548 | |||
| 1529 | Ga0373925_0000026 | |||
| 1530 | Ga0373925_0012279 | |||
| 1531 | Ga0373925_0222298 | |||
| 1532 | Ga0373925_0226244 | |||
| 1533 | Ga0395899_0038502 | |||
| 1534 | Ga0395900_0023057 | |||
| 1535 | Ga0395900_0106625 | |||
| 1536 | Ga0395898_0158837 | |||
| 1537 | Ga0395901_0031964 | |||
| 1538 | Ga0395901_0240778 | |||
| 1539 | Ga0436365_0422270 | |||
| 1540 | Ga0436365_1141354 | |||
| 1541 | Ga0436365_1142518 | |||
| 1542 | Ga0436365_1392289 | |||
| 1543 | Ga0436365_1525977 | |||
| 1544 | Ga0436360_0035660 | |||
| 1545 | Ga0436361_0034753 | |||
| 1546 | Ga0436361_0474226 | |||
| 1547 | Ga0436361_0808590 | |||
| 1548 | Ga0436361_0817855 | |||
| 1549 | Ga0436363_1010904 | |||
| 1550 | Ga0436362_0798067 | |||
| 1551 | Ga0451789_0678307 | |||
| 1552 | Ga0451795_1160684 | |||
| 1553 | Ga0451841_1435836 | |||
| 1554 | Ga0451851_0182072 | |||
| 1555 | Ga0451853_1644141 | |||
| 1556 | Ga0466969_0039705 | |||
| 1557 | Ga0466969_0120617 | |||
| 1558 | Ga0466972_0008421 | |||
| 1559 | Ga0466966_0056008 | |||
| 1560 | Ga0466961_0190673 | |||
| 1561 | Ga0466963_0050147 | |||
| 1562 | Ga0466963_0082044 | |||
| 1563 | Ga0466963_0358876 | |||
| 1564 | Ga0466964_0036301 | |||
| 1565 | Ga0466968_0002099 | |||
| 1566 | Ga0466970_0142879 | |||
| 1567 | Ga0466959_0014935 | |||
| 1568 | Ga0466959_0090922 | |||
| 1569 | Ga0466958_0008120 | |||
| 1570 | Ga0466967_0281578 | |||
| 1571 | Ga0466967_0348758 | |||
| 1572 | Ga0495627_105109 | |||
| 1573 | Ga0495592_0000017 | |||
| 1574 | Ga0495592_0144855 | |||
| 1575 | Ga0495592_0170942 | |||
| 1576 | Ga0495603_0087387 | |||
| 1577 | Ga0495629_0002872 | |||
| 1578 | Ga0495629_0072839 | |||
| 1579 | Ga0495629_0144812 | |||
| 1580 | Ga0495629_0175724 | |||
| 1581 | Ga0495629_0557934 | |||
| 1582 | Ga0495638_0034957 | |||
| 1583 | Ga0495641_0038510 | |||
| 1584 | Ga0495641_0064141 | |||
| 1585 | Ga0495651_0000923 | |||
| 1586 | Ga0495651_0149087 | |||
| 1587 | Ga0495653_0000033 | |||
| 1588 | Ga0495580_0001981 | |||
| 1589 | Ga0495580_0101855 | |||
| 1590 | Ga0495580_0371098 | |||
| 1591 | Ga0495582_0007153 | |||
| 1592 | Ga0495582_0189449 | |||
| 1593 | Ga0495605_0092059 | |||
| 1594 | Ga0495639_0004165 | |||
| 1595 | Ga0495639_0013870 | |||
| 1596 | Ga0495662_0024982 | |||
| 1597 | Ga0495662_0170411 | |||
| 1598 | Ga0495662_0171387 | |||
| 1599 | Ga0495664_0000008 | |||
| 1600 | Ga0495664_0004612 | |||
| 1601 | Ga0495584_0019489 | |||
| 1602 | Ga0495594_0246709 | |||
| 1603 | Ga0495607_0200273 | |||
| 1604 | Ga0495606_0005524 | |||
| 1605 | Ga0495606_0323154 | |||
| 1606 | Ga0495608_0000014 | |||
| 1607 | Ga0495608_0067084 | |||
| 1608 | Ga0495618_0000013 | |||
| 1609 | Ga0495618_0162324 | |||
| 1610 | Ga0495620_0085870 | |||
| 1611 | Ga0495628_0000008 | |||
| 1612 | Ga0495628_0404284 | |||
| 1613 | Ga0495628_0405174 | |||
| 1614 | Ga0495630_0000797 | |||
| 1615 | Ga0495630_0110073 | |||
| 1616 | Ga0495630_0188388 | |||
| 1617 | Ga0495631_0130069 | |||
| 1618 | Ga0495632_0159955 | |||
| 1619 | Ga0495632_0342932 | |||
| 1620 | Ga0495644_0102719 | |||
| 1621 | Ga0495644_0117605 | |||
| 1622 | Ga0495648_0002061 | |||
| 1623 | Ga0495663_0009757 | |||
| 1624 | Ga0495666_0222423 | |||
| 1625 | Ga0495652_0000005 | |||
| 1626 | Ga0495652_0112657 | |||
| 1627 | Ga0495652_0133324 | |||
| 1628 | Ga0495652_0207981 | |||
| 1629 | Ga0495665_0045655 | |||
| 1630 | Ga0495665_0053798 | |||
| 1631 | Ga0495665_0081373 | |||
| 1632 | Ga0495640_0000017 | |||
| 1633 | Ga0495640_0027237 | |||
| 1634 | Ga0495640_0057123 | |||
| 1635 | Ga0495640_0120521 | |||
| 1636 | Ga0495640_0182500 | |||
| 1637 | Ga0495587_0000005 | |||
| 1638 | Ga0495598_0065772 | |||
| 1639 | Ga0495597_0296920 | |||
| 1640 | Ga0495645_0000007 | |||
| 1641 | Ga0495645_0417515 | |||
| 1642 | Ga0495622_0028484 | |||
| 1643 | Ga0495622_0088107 | |||
| 1644 | Ga0495633_0182719 | |||
| 1645 | Ga0495667_0000012 | |||
| 1646 | Ga0495667_0227930 | |||
| 1647 | Ga0495656_0006929 | |||
| 1648 | Ga0495656_0057921 | |||
| 1649 | Ga0495656_0227746 | |||
| 1650 | Ga0495656_0302253 | |||
| 1651 | Ga0495656_0383412 | |||
| 1652 | Ga0495668_0101673 | |||
| 1653 | Ga0495668_0142901 | |||
| 1654 | Ga0495634_0000070 | |||
| 1655 | Ga0495634_0038373 | |||
| 1656 | Ga0495634_0051141 | |||
| 1657 | Ga0495634_0081451 | |||
| 1658 | Ga0495611_0067172 | |||
| 1659 | Ga0495625_0250549 | |||
| 1660 | Ga0495635_0000010 | |||
| 1661 | Ga0495635_0054013 | |||
| 1662 | Ga0495635_0380268 | |||
| 1663 | Ga0495659_0009015 | |||
| 1664 | Ga0495659_0074123 | |||
| 1665 | Ga0495659_0123352 | |||
| 1666 | Ga0495659_0126862 | |||
| 1667 | Ga0495661_0173568 | |||
| 1668 | Ga0495588_0127023 | |||
| 1669 | Ga0495588_0223297 | |||
| 1670 | Ga0495657_0000178 | |||
| 1671 | Ga0495599_0000015 | |||
| 1672 | Ga0495599_0095515 | |||
| 1673 | Ga0495623_0000054 | |||
| 1674 | Ga0495623_0081696 | |||
| 1675 | Ga0495646_0000012 | |||
| 1676 | Ga0495646_0183593 | |||
| 1677 | Ga0495647_0012555 | |||
| 1678 | Ga0495658_0046528 | |||
| 1679 | Ga0495658_0730188 | |||
| 1680 | Ga0495669_0148133 | |||
| 1681 | Ga0495613_0026149 | |||
| 1682 | Ga0495613_0132279 | |||
| 1683 | Ga0495613_0136139 | |||
| 1684 | Ga0495613_0754791 | |||
| 1685 | Ga0495624_0120885 | |||
| 1686 | Ga0495624_0174723 | |||
| 1687 | Ga0495624_0560915 | |||
| 1688 | Ga0495670_0286188 | |||
| 1689 | Ga0495600_0000031 | |||
| 1690 | Ga0495600_0440459 | |||
| 1691 | Ga0495581_0008126 | |||
| 1692 | Ga0495581_0030914 | |||
| 1693 | Ga0495581_0542199 | |||
| 1694 | Ga0495604_0000001 | |||
| 1695 | Ga0495604_0384624 | |||
| 1696 | Ga0495674_0000012 | |||
| 1697 | Ga0495674_0031429 | |||
| 1698 | Ga0495674_0100977 | |||
| 1699 | Ga0495674_0205593 | |||
| 1700 | Ga0495672_0189999 | |||
| 1701 | Ga0495676_0136075 | |||
| 1702 | Ga0495680_0003950 | |||
| 1703 | Ga0495680_0450725 | |||
| 1704 | Ga0495683_0076690 | |||
| 1705 | Ga0495687_029531 | |||
| 1706 | Ga0495675_0000500 | |||
| 1707 | Ga0495677_0022362 | |||
| 1708 | Ga0495685_155285 | |||
| 1709 | Ga0495684_0000021 | |||
| 1710 | Ga0495684_0034017 | |||
| 1711 | Ga0495684_0068810 | |||
| 1712 | Ga0495686_0120040 | |||
| 1713 | Ga0495593_0000387 | |||
| 1714 | Ga0495593_0017042 | |||
| 1715 | Ga0495593_0569691 | |||
| 1716 | Ga0495602_0000031 | |||
| 1717 | Ga0495602_0169947 | |||
| 1718 | Ga0496100_0359397 | |||
| 1719 | Ga0496100_0365094 | |||
| 1720 | Ga0496100_0549769 | |||
| 1721 | Ga0496101_1245009 | |||
| 1722 | Ga0496102_0023604 | |||
| 1723 | Ga0496102_0514371 | |||
| 1724 | Ga0496102_0520218 | |||
| 1725 | Ga0496102_0540613 | |||
| 1726 | Ga0496102_0725131 | |||
| 1727 | Ga0496102_0941114 | |||
| 1728 | Ga0496103_0015417 | |||
| 1729 | Ga0496103_0227021 | |||
| 1730 | Ga0496104_0007332 | |||
| 1731 | Ga0496104_0050168 | |||
| 1732 | Ga0496104_0277561 | |||
| 1733 | Ga0496104_0509501 | |||
| 1734 | Ga0496105_0002593 | |||
| 1735 | Ga0496105_0172872 | |||
| 1736 | Ga0496106_0017046 | |||
| 1737 | Ga0496106_0040980 | |||
| 1738 | Ga0496106_0041412 | |||
| 1739 | Ga0496106_0317161 | |||
| 1740 | Ga0496106_0530894 | |||
| 1741 | Ga0496107_0019184 | |||
| 1742 | Ga0496107_0165905 | |||
| 1743 | Ga0496107_0399873 | |||
| 1744 | Ga0496108_0000730 | |||
| 1745 | Ga0496108_0271318 | |||
| 1746 | Ga0496108_0273076 | |||
| 1747 | Ga0496108_0767680 | |||
| 1748 | Ga0496109_0035650 | |||
| 1749 | Ga0496109_0068681 | |||
| 1750 | Ga0496109_0333338 | |||
| 1751 | Ga0496110_0119406 | |||
| 1752 | Ga0496110_0139747 | |||
| 1753 | Ga0496110_0266560 | |||
| 1754 | Ga0496110_0357787 | |||
| 1755 | Ga0496111_0026832 | |||
| 1756 | Ga0496111_0200167 | |||
| 1757 | Ga0496111_0374366 | |||
| 1758 | Ga0496111_0600244 | |||
| 1759 | Ga0496112_0001354 | |||
| 1760 | Ga0496112_0036130 | |||
| 1761 | Ga0496112_0072258 | |||
| 1762 | Ga0496112_0379208 | |||
| 1763 | Ga0496113_0001624 | |||
| 1764 | Ga0496113_0026078 | |||
| 1765 | Ga0496113_0042404 | |||
| 1766 | Ga0496113_0440831 | |||
| 1767 | Ga0496114_0294052 | |||
| 1768 | Ga0496115_0330008 | |||
| 1769 | Ga0496115_0475626 | |||
| 1770 | Ga0496115_0546997 | |||
| 1771 | Ga0496118_0084793 | |||
| 1772 | Ga0496118_0195075 | |||
| 1773 | Ga0496119_0365651 | |||
| 1774 | Ga0496121_0024711 | |||
| 1775 | Ga0496121_0042122 | |||
| 1776 | Ga0496121_0085260 | |||
| 1777 | Ga0496124_0097823 | |||
| 1778 | Ga0496124_0319971 | |||
| 1779 | Ga0496125_0000869 | |||
| 1780 | Ga0496125_0089608 | |||
| 1781 | Ga0496126_0005056 | |||
| 1782 | Ga0496126_0020298 | |||
| 1783 | Ga0496126_0097338 | |||
| 1784 | Ga0496126_0146913 | |||
| 1785 | Ga0496126_0236545 | |||
| 1786 | Ga0496126_0284193 | |||
| 1787 | Ga0501031_0000207 | |||
| 1788 | Ga0501031_0230477 | |||
| 1789 | Ga0501032_0000252 | |||
| 1790 | Ga0501032_0108559 | |||
| 1791 | Ga0501032_0176021 | |||
| 1792 | Ga0501032_0289853 | |||
| 1793 | Ga0501032_0313850 | |||
| 1794 | Ga0501033_0000082 | |||
| 1795 | Ga0501033_0053999 | |||
| 1796 | Ga0501033_0094332 | |||
| 1797 | Ga0501033_0123308 | |||
| 1798 | Ga0501033_0319002 | |||
| 1799 | Ga0501034_0000198 | |||
| 1800 | Ga0501034_0095640 | |||
| 1801 | Ga0501036_0001281 | |||
| 1802 | Ga0501036_0071045 | |||
| 1803 | Ga0501036_0218315 | |||
| 1804 | Ga0501036_0262975 | |||
| 1805 | Ga0501036_0490641 | |||
| 1806 | Ga0501036_0786922 | |||
| 1807 | Ga0501037_0000050 | |||
| 1808 | Ga0501037_0110109 | |||
| 1809 | Ga0501037_0193680 | |||
| 1810 | Ga0501038_0000538 | |||
| 1811 | Ga0501038_0084278 | |||
| 1812 | Ga0501038_0508718 | |||
| 1813 | Ga0501039_0000366 | |||
| 1814 | Ga0501040_0365553 | |||
| 1815 | Ga0501042_0081623 | |||
| 1816 | Ga0501042_0616593 | |||
| 1817 | Ga0501043_0002344 | |||
| 1818 | Ga0501043_0030258 | |||
| 1819 | Ga0501043_0243818 | |||
| 1820 | Ga0501043_0457990 | |||
| 1821 | Ga0501046_0000434 | |||
| 1822 | Ga0501047_0000131 | |||
| 1823 | Ga0501047_0014359 | |||
| 1824 | Ga0501047_0063958 | |||
| 1825 | Ga0501047_0077939 | |||
| 1826 | Ga0501047_0106601 | |||
| 1827 | Ga0501047_0234791 | |||
| 1828 | Ga0501048_0000531 | |||
| 1829 | Ga0501048_0259209 | |||
| 1830 | Ga0501067_0000628 | |||
| 1831 | Ga0501067_0081828 | |||
| 1832 | Ga0501068_0000080 | |||
| 1833 | Ga0501069_0001211 | |||
| 1834 | Ga0501070_0005971 | |||
| 1835 | Ga0501070_0013649 | |||
| 1836 | Ga0501070_0083701 | |||
| 1837 | Ga0501070_0223992 | |||
| 1838 | Ga0501070_0415209 | |||
| 1839 | Ga0501070_0416498 | |||
| 1840 | Ga0501070_0634540 | |||
| 1841 | Ga0501071_0148282 | |||
| 1842 | Ga0501072_0000378 | |||
| 1843 | Ga0501072_0004379 | |||
| 1844 | Ga0501073_0000062 | |||
| 1845 | Ga0501073_0153891 | |||
| 1846 | Ga0501074_0003814 | |||
| 1847 | Ga0501074_0183894 | |||
| 1848 | Ga0501076_0015345 | |||
| 1849 | Ga0501076_0551364 | |||
| 1850 | Ga0501079_0001399 | |||
| 1851 | Ga0501079_0026413 | |||
| 1852 | Ga0501079_0454522 | |||
| 1853 | Ga0501079_0566016 | |||
| 1854 | Ga0501080_0009398 | |||
| 1855 | Ga0501080_0020500 | |||
| 1856 | Ga0501080_0097463 | |||
| 1857 | Ga0501080_0431121 | |||
| 1858 | Ga0501080_0528852 | |||
| 1859 | Ga0501080_0563361 | |||
| 1860 | Ga0501081_0086589 | |||
| 1861 | Ga0501083_0000341 | |||
| 1862 | Ga0501035_0000123 | |||
| 1863 | Ga0501035_0066047 | |||
| 1864 | Ga0501035_0165534 | |||
| 1865 | Ga0501035_0229193 | |||
| 1866 | Ga0501035_0252395 | |||
| 1867 | Ga0501035_0381538 | |||
| 1868 | Ga0501035_0808315 | |||
| 1869 | Ga0501044_0000100 | |||
| 1870 | Ga0501044_0126607 | |||
| 1871 | Ga0501044_0126655 | |||
| 1872 | Ga0501044_0174023 | |||
| 1873 | Ga0501044_0188795 | |||
| 1874 | Ga0501044_0214286 | |||
| 1875 | Ga0501044_0258970 | |||
| 1876 | Ga0501044_0359323 | |||
| 1877 | Ga0501045_0258667 | |||
| 1878 | Ga0501045_0744012 | |||
| 1879 | nmdc:mga03683_171734_c1 | |||
| 1880 | nmdc:mga03683_63731_c1 | |||
| 1881 | nmdc:mga03n38_20945_c1 | |||
| 1882 | nmdc:mga03n38_788_c1 | |||
| 1883 | nmdc:mga00v17_113629_c1 | |||
| 1884 | nmdc:mga00v17_193210_c1 | |||
| 1885 | nmdc:mga00v17_78621_c1 | |||
| 1886 | nmdc:mga0yw44_10435_c1 | |||
| 1887 | nmdc:mga0yw44_122929_c1 | |||
| 1888 | nmdc:mga0yw44_280364_c1 | |||
| 1889 | nmdc:mga0yw44_3696_c1 | |||
| 1890 | nmdc:mga0yw44_44332_c1 | |||
| 1891 | nmdc:mga0yw44_68065_c1 | |||
| 1892 | nmdc:mga0yw44_90120_c1 | |||
| 1893 | nmdc:mga0k408_241875_c1 | |||
| 1894 | nmdc:mga06z11_181046_c1 | |||
| 1895 | nmdc:mga06z11_222124_c1 | |||
| 1896 | nmdc:mga04h51_35947_c1 | |||
| 1897 | nmdc:mga07m45_10136_c1 | |||
| 1898 | nmdc:mga07m45_129657_c1 | |||
| 1899 | nmdc:mga07m45_16328_c1 | |||
| 1900 | nmdc:mga05p37_321003_c1 | |||
| 1901 | nmdc:mga05p37_88296_c1 | |||
| 1902 | nmdc:mga09592_136043_c1 | |||
| 1903 | nmdc:mga0qj67_197102_c2 | |||
| 1904 | nmdc:mga0qj67_604368_c1 | |||
| 1905 | nmdc:mga06r32_117088_c1 | |||
| 1906 | nmdc:mga06r32_131590_c1 | |||
| 1907 | nmdc:mga06r32_96370_c1 | |||
| 1908 | nmdc:mga08y16_140797_c1 | |||
| 1909 | nmdc:mga08y16_67818_c1 | |||
| 1910 | nmdc:mga0n895_101162_c1 | |||
| 1911 | nmdc:mga0n895_253790_c1 | |||
| 1912 | nmdc:mga0n895_463362_c1 | |||
| 1913 | nmdc:mga0n895_95048_c1 | |||
| 1914 | nmdc:mga0rr50_417374_c1 | |||
| 1915 | nmdc:mga0rr50_50577_c1 | |||
| 1916 | nmdc:mga0rr50_65213_c1 | |||
| 1917 | nmdc:mga08x19_4_c2 | |||
| 1918 | nmdc:mga0sz30_51290_c1 | |||
| 1919 | nmdc:mga0sz30_59676_c1 | |||
| 1920 | Ga0495601_0000011 | |||
| 1921 | Ga0495601_0022853 | |||
| 1922 | Ga0495601_0107727 | |||
| 1923 | Ga0495601_0121375 | |||
| 1924 | Ga0495612_0000006 | |||
| 1925 | Ga0495612_0020737 | |||
| 1926 | Ga0495612_0153925 | |||
| 1927 | Ga0495655_0033841 | |||
| 1928 | Ga0495595_0000021 | |||
| 1929 | Ga0495595_0038918 | |||
| 1930 | Ga0495595_0059378 | |||
| 1931 | Ga0495619_0000013 | |||
| 1932 | Ga0495619_0012966 | |||
| 1933 | Ga0495619_0034640 | |||
| 1934 | Ga0500646_0018789 | |||
| 1935 | Ga0500566_0000055 | |||
| 1936 | Ga0500641_0010703 | |||
| 1937 | Ga0500641_0027147 | |||
| 1938 | Ga0500594_0183732 | |||
| 1939 | Ga0500608_084422 | |||
| 1940 | Ga0500617_190207 | |||
| 1941 | Ga0500658_0055005 | |||
| 1942 | Ga0500559_0000362 | |||
| 1943 | Ga0500559_0100450 | |||
| 1944 | Ga0500568_0033662 | |||
| 1945 | Ga0500589_082946 | |||
| 1946 | Ga0500633_0197384 | |||
| 1947 | Ga0500636_0001777 | |||
| 1948 | Ga0500637_0139649 | |||
| 1949 | Ga0500645_021788 | |||
| 1950 | Ga0501084_0019061 | |||
| 1951 | Ga0501084_0027413 | |||
| 1952 | Ga0501084_0121841 | |||
| 1953 | Ga0501082_0001776 | |||
| 1954 | Ga0501082_0081197 | |||
| 1955 | Ga0501082_0251508 | |||
| 1956 | Ga0466962_0074710 | |||
| 1957 | Ga0466962_0454593 | |||
| 1958 | Ga0530510_0007398 | |||
| 1959 | Ga0530510_1019593 | |||
| 1960 | 2507505433 | |||
| 1961 | 2509152162 | |||
| 1962 | 2511399107 | |||
| 1963 | 2513623943 | |||
| 1964 | 2513675813 | |||
| 1965 | 2513695270 | |||
| 1966 | 2513873367 | |||
| 1967 | 2513888597 | |||
| 1968 | 2514014697 | |||
| 1969 | 2524441424 | |||
| 1970 | 2528853336 | |||
| 1971 | 2617352078 | |||
| 1972 | 2644291076 | |||
| 1973 | 2723841804 | |||
| 1974 | 2793062217 | |||
| 1975 | 2805920715 | |||
| 1976 | 2824670006 | |||
| 1977 | 2824676593 | |||
| 1978 | 2824693255 | |||
| 1979 | 2824702624 | |||
| 1980 | 2824713730 | |||
| 1981 | 2824761773 | |||
| 1982 | 2824772272 | |||
| 1983 | 2824780862 | |||
| 1984 | 2838124678 | |||
| 1985 | 2841945370 | |||
| 1986 | 2841952155 | |||
| 1987 | 2841965364 | |||
| 1988 | 2841970457 | |||
| 1989 | 2841981705 | |||
| 1990 | 2841984986 | |||
| 1991 | 2847942321 | |||
| 1992 | 2874617998 | |||
| 1993 | 2874621222 | |||
| 1994 | 2876814206 | |||
| 1995 | 2879099907 | |||
| 1996 | 2879113331 | |||
| 1997 | 2885369353 | |||
| 1998 | 2888390519 | |||
| 1999 | 2893067492 | |||
| 2000 | 2904667767 | |||
| 2001 | 2904716348 | |||
| 2002 | 2922363189 | |||
| 2003 | 2922369407 | |||
| 2004 | 2922388506 | |||
| 2005 | 2922400045 | |||
| 2006 | 2929618765 | |||
| 2007 | 2929628550 | |||
| 2008 | 2932790947 | |||
| 2009 | 2932812000 | |||
| 2010 | 2932825549 | |||
| 2011 | 2932833663 | |||
| 2012 | 2933580525 | |||
| 2013 | 2935615539 | |||
| 2014 | 2935623189 | |||
| 2015 | 2935644264 | |||
| 2016 | 2935672154 | |||
| 2017 | 2935679325 | |||
| 2018 | 2935686566 | |||
| 2019 | 2935700349 | |||
| 2020 | 2935710297 | |||
| 2021 | 2935716254 | |||
| 2022 | 2935723622 | |||
| 2023 | 2935735177 | |||
| 2024 | 2935744032 | |||
| 2025 | 2935752532 | |||
| 2026 | 2935763334 | |||
| 2027 | 2935772882 | |||
| 2028 | 2935783327 | |||
| 2029 | 2935788130 | |||
| 2030 | 2935796294 | |||
| 2031 | 2935808288 | |||
| 2032 | 2935816099 | |||
| 2033 | 2935825660 | |||
| 2034 | 2935833492 | |||
| 2035 | 2935845950 | |||
| 2036 | 2935853424 | |||
| 2037 | 2935861437 | |||
| 2038 | 2935869556 | |||
| 2039 | 2935879885 | |||
| 2040 | 2935915026 | |||
| 2041 | 2935918874 | |||
| 2042 | 2935931409 | |||
| 2043 | 2935940006 | |||
| 2044 | 2935947647 | |||
| 2045 | 2935956418 | |||
| 2046 | 2935973212 | |||
| 2047 | 2935997892 | |||
| 2048 | 2936008843 | |||
| 2049 | 2936041104 | |||
| 2050 | 2940558445 | |||
| 2051 | 2941547119 | |||
| 2052 | 3005594119 | |||
| 2053 | 3005718455 | |||
| 2054 | 8016526309 | |||
| 2055 | 8016531370 | |||
| 2056 | 8016544585 | |||
| 2057 | 8016557492 | |||
| 2058 | 8016565848 | |||
| 2059 | 8016569636 | |||
| 2060 | 8016582246 | |||
| 2061 | 8016603447 | |||
| 2062 | 8016606385 | |||
| 2063 | 8016618292 | |||
| 2064 | 8016622941 | |||
| 2065 | 8016635445 | |||
| 2066 | 8017058631 | |||
| 2067 | 8019531203 | |||
| 2068 | 8019540350 | |||
| 2069 | 8019549941 | |||
| 2070 | 8019577028 | |||
| 2071 | 8019595095 | |||
| 2072 | 8019606646 | |||
| 2073 | 8019611865 | |||
| 2074 | 8019696068 | |||
| 2075 | 8055742614 | |||
| 2076 | 8056676122 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kng-assembly1.cif.gz_A | crystal structure of ccmg reducing oxidoreductase at 1.14 a | 0.9799 | 55 | 197 |
| 1kng-assembly1.cif.gz_A | crystal structure of ccmg reducing oxidoreductase at 1.14 a | 0.9666 | 55 | 197 |
| 2b1k-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9059 | 48 | 197 |
| 2g0f-assembly1.cif.gz_A | crystal structure of p144a mutant of e.coli ccmg protein | 0.8957 | 48 | 197 |
| 3kh9-assembly1.cif.gz_A | crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa | 0.8765 | 44 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kngA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9799 | 55 | 197 | 3.40.30.10 |
| 1kngA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9666 | 55 | 197 | 3.40.30.10 |
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9059 | 48 | 197 | 3.40.30.10 |
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8712 | 48 | 197 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8563 | 56 | 197 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4UFG9-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9862 | 68 | 201 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A1Q7WVB3-F1-model_v4 | Thiol:disulfide interchange protein | 0.9812 | 73 | 198 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A434S8A3-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9778 | 91 | 201 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A436QV82-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9766 | 49 | 201 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-E6YG17-F1-model_v4 | Thiol:disulfide interchange protein | 0.9702 | 90 | 198 |
GO:0015036
GO:0017004 GO:0030288 |