F488782
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1039 | 529 | 2078 | 340 |
Family's Representative Sequence
| Representative Sequence | 3300006058|Ga0075432_10020087|Ga0075432_100200872 |
| Length | 371 |
| Sequence | MKNLGTIFLLFVLLTVPLWVTDQYYLHIVITTGIFIIGAMSLNLLLGFTGQLSLGHIAFFGIGAYTSALTSLGFDIPVFWGDGRIIHEAWHPVIGILLGTFVAGVCGYVVGKLSFKIRGAYFVIVTISFAEVVRLVALNWVDLTQGPLALSNIPPLGYNLPGLGEMVFWAKAPNYYLVLALALVAYVLIRRIVRSRMGRAMIALRENESLATSVGIDVTRYLVFAAVVSAALAGATGSLYAHYIRIIDPDIFLFVYTVTMVIMVVTGGKGTLAGPIVGGVIFGALPVGLRAVAAPEVQWIVYGIVMILIVFFLPRGIVPAVSDYWHRKTGSSPRHTRATPSAPSKQSPEQASKWDGAASQTMLSAKALTGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 130 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 131 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 132 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 331 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 369 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 384 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 389 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 390 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 391 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 393 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 395 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 396 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 398 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 399 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 400 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 404 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 405 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 406 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 407 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 409 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 413 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 414 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 415 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 416 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 420 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 421 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 425 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 427 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 429 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 431 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 434 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 435 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 436 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 437 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 438 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 439 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 440 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 441 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 442 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 443 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 444 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 445 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 446 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 447 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 448 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 449 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 450 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 451 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 452 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 453 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 454 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 455 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 456 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 457 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 458 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 459 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 460 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 461 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 462 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 463 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 464 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 465 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 466 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 467 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 468 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 469 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 470 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 471 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 472 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 473 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 474 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 475 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 476 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 477 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 478 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 479 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 480 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 481 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 482 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 483 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 484 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 485 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 486 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 487 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 488 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 489 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 490 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 491 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 492 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 493 | 2906610324 | |||
| 494 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 495 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 496 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 497 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 498 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 499 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 500 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 501 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 502 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 503 | 2922425934 | |||
| 504 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 505 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 506 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 507 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 508 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 509 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 510 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 511 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 512 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 513 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 514 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 515 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 516 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 517 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 518 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 519 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 520 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 521 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 522 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 523 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 524 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 525 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 526 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 527 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 528 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 529 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.94 |
| Metatranscriptomes | 0 |
| Isolates | 9.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.13 |
| Nodule | 5.49 |
| Rhizoplane | 8.57 |
| Rhizosphere | 63.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075432_10020087 | 3300006058 | Bacteria | 2284 |
| 2 | JGI24737J22298_10032906 | 3300001990 | Bacteria | 1612 |
| 3 | JGI24744J21845_10002032 | 3300002077 | Bacteria | 4101 |
| 4 | JGI24033J26618_1003073 | 3300002155 | Bacteria | 1744 |
| 5 | JGI25153J46596_10000068 | 3300003215 | Bacteria | 117909 |
| 6 | JGI25153J46596_10000094 | 3300003215 | Bacteria | 103036 |
| 7 | JGI25153J46596_10002675 | 3300003215 | Bacteria | 10176 |
| 8 | JGI25160J50197_1000777 | 3300003354 | Bacteria | 17100 |
| 9 | JGI25404J52841_10000108 | 3300003659 | Bacteria | 8267 |
| 10 | Ga0055531_10018269 | 3300003794 | Bacteria | 2904 |
| 11 | Ga0065165_1001845 | 3300005262 | Bacteria | 20647 |
| 12 | Ga0065165_1005504 | 3300005262 | Bacteria | 7081 |
| 13 | Ga0065704_10020805 | 3300005289 | Bacteria | 1912 |
| 14 | Ga0070676_10035764 | 3300005328 | Bacteria | 2858 |
| 15 | Ga0070690_100040155 | 3300005330 | Bacteria | 2959 |
| 16 | Ga0070690_100123144 | 3300005330 | Bacteria | 1743 |
| 17 | Ga0070670_100010874 | 3300005331 | Bacteria | 7773 |
| 18 | Ga0070670_100051718 | 3300005331 | Bacteria | 3528 |
| 19 | Ga0068869_100055588 | 3300005334 | Bacteria | 2885 |
| 20 | Ga0068869_100119789 | 3300005334 | Bacteria | 2012 |
| 21 | Ga0068869_100175633 | 3300005334 | Bacteria | 1676 |
| 22 | Ga0070666_10147580 | 3300005335 | Bacteria | 1640 |
| 23 | Ga0070680_100011909 | 3300005336 | Bacteria | 6748 |
| 24 | Ga0070680_100013678 | 3300005336 | Bacteria | 6327 |
| 25 | Ga0070680_100177071 | 3300005336 | Bacteria | 1795 |
| 26 | Ga0068868_100023511 | 3300005338 | Bacteria | 4665 |
| 27 | Ga0070689_100059991 | 3300005340 | Bacteria | 2957 |
| 28 | Ga0070689_100082543 | 3300005340 | Bacteria | 2525 |
| 29 | Ga0070691_10009631 | 3300005341 | Bacteria | 4408 |
| 30 | Ga0070687_100002478 | 3300005343 | Bacteria | 6943 |
| 31 | Ga0070687_100064871 | 3300005343 | Bacteria | 1941 |
| 32 | Ga0070661_100331832 | 3300005344 | Bacteria | 1190 |
| 33 | Ga0070692_10120819 | 3300005345 | Bacteria | 1461 |
| 34 | Ga0070692_10155862 | 3300005345 | Bacteria | 1304 |
| 35 | Ga0070668_100109997 | 3300005347 | Bacteria | 2192 |
| 36 | Ga0070669_100013682 | 3300005353 | Bacteria | 5769 |
| 37 | Ga0070669_100060444 | 3300005353 | Bacteria | 2783 |
| 38 | Ga0070675_100003565 | 3300005354 | Bacteria | 11829 |
| 39 | Ga0070671_100012862 | 3300005355 | Bacteria | 6748 |
| 40 | Ga0070671_100053207 | 3300005355 | Bacteria | 3365 |
| 41 | Ga0070671_100063572 | 3300005355 | Bacteria | 3073 |
| 42 | Ga0070674_100039243 | 3300005356 | Bacteria | 3196 |
| 43 | Ga0070674_100060525 | 3300005356 | Bacteria | 2640 |
| 44 | Ga0070674_100287504 | 3300005356 | Bacteria | 1306 |
| 45 | Ga0070673_100084789 | 3300005364 | Bacteria | 2578 |
| 46 | Ga0070673_100469065 | 3300005364 | Bacteria | 1135 |
| 47 | Ga0070688_100002030 | 3300005365 | Bacteria | 10204 |
| 48 | Ga0070659_100032166 | 3300005366 | Bacteria | 4067 |
| 49 | Ga0070659_100060819 | 3300005366 | Bacteria | 2984 |
| 50 | Ga0070667_100004500 | 3300005367 | Bacteria | 11760 |
| 51 | Ga0070667_100030529 | 3300005367 | Bacteria | 4495 |
| 52 | Ga0070667_100113122 | 3300005367 | Bacteria | 2355 |
| 53 | Ga0070709_10004866 | 3300005434 | Bacteria | 7259 |
| 54 | Ga0070709_10199039 | 3300005434 | Bacteria | 1418 |
| 55 | Ga0070714_100001309 | 3300005435 | Bacteria | 17977 |
| 56 | Ga0070714_100204624 | 3300005435 | Bacteria | 1807 |
| 57 | Ga0070714_100429654 | 3300005435 | Bacteria | 1252 |
| 58 | Ga0070714_100464283 | 3300005435 | Bacteria | 1204 |
| 59 | Ga0070713_100002404 | 3300005436 | Bacteria | 12210 |
| 60 | Ga0070713_100138447 | 3300005436 | Bacteria | 2154 |
| 61 | Ga0070710_10004275 | 3300005437 | Bacteria | 6770 |
| 62 | Ga0070710_10177003 | 3300005437 | Bacteria | 1333 |
| 63 | Ga0070711_100000362 | 3300005439 | Bacteria | 23459 |
| 64 | Ga0070711_100015017 | 3300005439 | Bacteria | 4894 |
| 65 | Ga0070711_100028066 | 3300005439 | Bacteria | 3700 |
| 66 | Ga0070705_100004675 | 3300005440 | Bacteria | 6667 |
| 67 | Ga0070700_100018434 | 3300005441 | Bacteria | 4012 |
| 68 | Ga0070700_100115285 | 3300005441 | Bacteria | 1792 |
| 69 | Ga0070700_100215770 | 3300005441 | Bacteria | 1356 |
| 70 | Ga0070694_100002889 | 3300005444 | Bacteria | 10208 |
| 71 | Ga0070694_100138247 | 3300005444 | Bacteria | 1767 |
| 72 | Ga0070708_100008473 | 3300005445 | Bacteria | 8257 |
| 73 | Ga0070708_100062084 | 3300005445 | Bacteria | 3340 |
| 74 | Ga0070663_100007257 | 3300005455 | Bacteria | 6738 |
| 75 | Ga0070663_100021917 | 3300005455 | Bacteria | 4259 |
| 76 | Ga0070663_100029127 | 3300005455 | Bacteria | 3768 |
| 77 | Ga0070663_100031511 | 3300005455 | Bacteria | 3644 |
| 78 | Ga0070678_100042423 | 3300005456 | Bacteria | 3233 |
| 79 | Ga0070678_100071874 | 3300005456 | Bacteria | 2591 |
| 80 | Ga0070678_100195659 | 3300005456 | Bacteria | 1665 |
| 81 | Ga0070662_100081318 | 3300005457 | Bacteria | 2413 |
| 82 | Ga0070662_100174128 | 3300005457 | Bacteria | 1692 |
| 83 | Ga0070662_100175436 | 3300005457 | Bacteria | 1686 |
| 84 | Ga0070681_10020166 | 3300005458 | Bacteria | 6682 |
| 85 | Ga0070681_10066987 | 3300005458 | Bacteria | 3559 |
| 86 | Ga0070681_10152622 | 3300005458 | Bacteria | 2236 |
| 87 | Ga0068867_100033474 | 3300005459 | Bacteria | 3722 |
| 88 | Ga0068867_100045107 | 3300005459 | Bacteria | 3231 |
| 89 | Ga0070685_10029846 | 3300005466 | Bacteria | 3033 |
| 90 | Ga0070685_10076575 | 3300005466 | Bacteria | 1995 |
| 91 | Ga0070699_100000545 | 3300005518 | Bacteria | 35461 |
| 92 | Ga0070699_100035875 | 3300005518 | Bacteria | 4287 |
| 93 | Ga0070699_100116591 | 3300005518 | Bacteria | 2347 |
| 94 | Ga0070679_100113019 | 3300005530 | Bacteria | 2701 |
| 95 | Ga0070697_100015043 | 3300005536 | Bacteria | 6073 |
| 96 | Ga0068853_100031522 | 3300005539 | Bacteria | 4483 |
| 97 | Ga0068853_100056742 | 3300005539 | Bacteria | 3378 |
| 98 | Ga0068853_100444590 | 3300005539 | Bacteria | 1219 |
| 99 | Ga0070672_100004369 | 3300005543 | Bacteria | 9260 |
| 100 | Ga0070686_100005070 | 3300005544 | Bacteria | 7272 |
| 101 | Ga0070686_100366433 | 3300005544 | Bacteria | 1087 |
| 102 | Ga0070695_100004516 | 3300005545 | Bacteria | 8168 |
| 103 | Ga0070695_100007706 | 3300005545 | Bacteria | 6377 |
| 104 | Ga0070695_100191255 | 3300005545 | Bacteria | 1457 |
| 105 | Ga0070696_100000249 | 3300005546 | Bacteria | 32415 |
| 106 | Ga0070696_100012128 | 3300005546 | Bacteria | 5775 |
| 107 | Ga0070696_100057255 | 3300005546 | Bacteria | 2720 |
| 108 | Ga0070696_100183914 | 3300005546 | Bacteria | 1551 |
| 109 | Ga0070693_100008195 | 3300005547 | Bacteria | 5136 |
| 110 | Ga0070693_100124044 | 3300005547 | Bacteria | 1605 |
| 111 | Ga0070665_100115402 | 3300005548 | Bacteria | 2688 |
| 112 | Ga0070665_100165949 | 3300005548 | Bacteria | 2210 |
| 113 | Ga0070704_100029961 | 3300005549 | Bacteria | 3641 |
| 114 | Ga0070704_100048479 | 3300005549 | Bacteria | 2973 |
| 115 | Ga0070704_100174802 | 3300005549 | Bacteria | 1712 |
| 116 | Ga0068855_100025399 | 3300005563 | Bacteria | 7089 |
| 117 | Ga0068855_100060100 | 3300005563 | Bacteria | 4446 |
| 118 | Ga0068855_100123173 | 3300005563 | Bacteria | 2966 |
| 119 | Ga0070664_100043666 | 3300005564 | Bacteria | 3783 |
| 120 | Ga0068857_100014404 | 3300005577 | Bacteria | 6895 |
| 121 | Ga0068854_100079306 | 3300005578 | Bacteria | 2420 |
| 122 | Ga0068856_100108101 | 3300005614 | Bacteria | 2778 |
| 123 | Ga0068856_100166670 | 3300005614 | Bacteria | 2214 |
| 124 | Ga0068856_100252217 | 3300005614 | Bacteria | 1780 |
| 125 | Ga0070702_100005145 | 3300005615 | Bacteria | 6055 |
| 126 | Ga0070702_100267274 | 3300005615 | Bacteria | 1168 |
| 127 | Ga0068859_100016683 | 3300005617 | Bacteria | 7373 |
| 128 | Ga0068859_100039940 | 3300005617 | Bacteria | 4710 |
| 129 | Ga0068859_100284152 | 3300005617 | Bacteria | 1747 |
| 130 | Ga0068864_100045321 | 3300005618 | Bacteria | 3772 |
| 131 | Ga0068864_100168521 | 3300005618 | Bacteria | 1995 |
| 132 | Ga0068864_100575089 | 3300005618 | Bacteria | 1091 |
| 133 | Ga0068866_10001554 | 3300005718 | Bacteria | 9755 |
| 134 | Ga0068866_10005088 | 3300005718 | Bacteria | 5418 |
| 135 | Ga0068861_100011419 | 3300005719 | Bacteria | 6175 |
| 136 | Ga0068870_10064265 | 3300005840 | Bacteria | 1982 |
| 137 | Ga0068863_100082082 | 3300005841 | Bacteria | 3054 |
| 138 | Ga0068863_100567432 | 3300005841 | Bacteria | 1121 |
| 139 | Ga0068858_100005194 | 3300005842 | Bacteria | 12756 |
| 140 | Ga0068858_100025390 | 3300005842 | Bacteria | 5513 |
| 141 | Ga0068860_100016382 | 3300005843 | Bacteria | 7228 |
| 142 | Ga0068860_100049518 | 3300005843 | Bacteria | 4001 |
| 143 | Ga0068860_100369935 | 3300005843 | Bacteria | 1413 |
| 144 | Ga0068862_100005647 | 3300005844 | Bacteria | 10446 |
| 145 | Ga0081455_10000029 | 3300005937 | Bacteria | 155672 |
| 146 | Ga0081455_10003782 | 3300005937 | Bacteria | 17285 |
| 147 | Ga0081455_10005788 | 3300005937 | Bacteria | 13470 |
| 148 | Ga0081455_10031199 | 3300005937 | Bacteria | 4827 |
| 149 | Ga0081455_10052904 | 3300005937 | Bacteria | 3473 |
| 150 | Ga0081455_10057782 | 3300005937 | Bacteria | 3286 |
| 151 | Ga0081538_10006418 | 3300005981 | Bacteria | 10357 |
| 152 | Ga0081538_10017150 | 3300005981 | Bacteria | 5509 |
| 153 | Ga0081538_10020850 | 3300005981 | Bacteria | 4809 |
| 154 | Ga0081540_1000048 | 3300005983 | Bacteria | 127924 |
| 155 | Ga0081540_1000937 | 3300005983 | Bacteria | 26234 |
| 156 | Ga0081540_1001679 | 3300005983 | Bacteria | 18835 |
| 157 | Ga0081540_1005784 | 3300005983 | Bacteria | 9152 |
| 158 | Ga0081540_1008639 | 3300005983 | Bacteria | 7098 |
| 159 | Ga0081540_1015468 | 3300005983 | Bacteria | 4831 |
| 160 | Ga0081540_1020642 | 3300005983 | Bacteria | 3953 |
| 161 | Ga0081540_1058933 | 3300005983 | Bacteria | 1846 |
| 162 | Ga0081539_10004692 | 3300005985 | Bacteria | 14824 |
| 163 | Ga0070717_10002967 | 3300006028 | Bacteria | 12064 |
| 164 | Ga0070717_10074371 | 3300006028 | Bacteria | 2840 |
| 165 | Ga0075365_10003935 | 3300006038 | Bacteria | 7775 |
| 166 | Ga0075365_10021126 | 3300006038 | Bacteria | 4055 |
| 167 | Ga0075365_10039788 | 3300006038 | Bacteria | 3063 |
| 168 | Ga0075368_10000671 | 3300006042 | Bacteria | 10423 |
| 169 | Ga0075368_10007055 | 3300006042 | Bacteria | 3955 |
| 170 | Ga0075368_10072004 | 3300006042 | Bacteria | 1397 |
| 171 | Ga0075363_100000761 | 3300006048 | Bacteria | 11035 |
| 172 | Ga0075363_100013498 | 3300006048 | Bacteria | 3962 |
| 173 | Ga0075363_100153852 | 3300006048 | Bacteria | 1299 |
| 174 | Ga0075364_10009955 | 3300006051 | Bacteria | 5721 |
| 175 | Ga0075364_10013926 | 3300006051 | Bacteria | 4957 |
| 176 | Ga0075364_10094586 | 3300006051 | Bacteria | 1986 |
| 177 | Ga0070715_10011015 | 3300006163 | Bacteria | 3242 |
| 178 | Ga0070715_10059722 | 3300006163 | Bacteria | 1669 |
| 179 | Ga0070715_10076423 | 3300006163 | Bacteria | 1509 |
| 180 | Ga0070716_100011005 | 3300006173 | Bacteria | 4552 |
| 181 | Ga0070716_100013289 | 3300006173 | Bacteria | 4193 |
| 182 | Ga0070716_100018949 | 3300006173 | Bacteria | 3591 |
| 183 | Ga0070712_100057934 | 3300006175 | Bacteria | 2723 |
| 184 | Ga0070712_100064170 | 3300006175 | Bacteria | 2603 |
| 185 | Ga0070712_100140922 | 3300006175 | Bacteria | 1840 |
| 186 | Ga0075367_10002090 | 3300006178 | Bacteria | 8952 |
| 187 | Ga0075367_10035633 | 3300006178 | Bacteria | 2881 |
| 188 | Ga0075369_10000436 | 3300006186 | Bacteria | 12671 |
| 189 | Ga0075369_10008913 | 3300006186 | Bacteria | 3881 |
| 190 | Ga0075369_10012833 | 3300006186 | Bacteria | 3313 |
| 191 | Ga0075369_10079228 | 3300006186 | Bacteria | 1455 |
| 192 | Ga0075366_10022499 | 3300006195 | Bacteria | 3668 |
| 193 | Ga0075366_10078135 | 3300006195 | Bacteria | 1975 |
| 194 | Ga0097621_100145673 | 3300006237 | Bacteria | 2028 |
| 195 | Ga0075370_10041668 | 3300006353 | Bacteria | 2592 |
| 196 | Ga0075428_100024125 | 3300006844 | Bacteria | 6728 |
| 197 | Ga0075428_100053458 | 3300006844 | Bacteria | 4425 |
| 198 | Ga0075428_100058333 | 3300006844 | Bacteria | 4226 |
| 199 | Ga0075428_100069932 | 3300006844 | Bacteria | 3837 |
| 200 | Ga0075428_100096916 | 3300006844 | Bacteria | 3215 |
| 201 | Ga0075428_100100255 | 3300006844 | Bacteria | 3158 |
| 202 | Ga0075428_100117413 | 3300006844 | Bacteria | 2898 |
| 203 | Ga0075428_100194866 | 3300006844 | Bacteria | 2191 |
| 204 | Ga0075428_100200691 | 3300006844 | Bacteria | 2156 |
| 205 | Ga0075428_100204869 | 3300006844 | Bacteria | 2132 |
| 206 | Ga0075430_100007063 | 3300006846 | Bacteria | 9469 |
| 207 | Ga0075430_100012474 | 3300006846 | Bacteria | 7232 |
| 208 | Ga0075430_100014692 | 3300006846 | Bacteria | 6670 |
| 209 | Ga0075430_100115306 | 3300006846 | Bacteria | 2238 |
| 210 | Ga0075431_100001007 | 3300006847 | Bacteria | 25062 |
| 211 | Ga0075431_100002204 | 3300006847 | Bacteria | 18653 |
| 212 | Ga0075431_100004487 | 3300006847 | Bacteria | 13696 |
| 213 | Ga0075431_100020866 | 3300006847 | Bacteria | 6695 |
| 214 | Ga0075431_100026130 | 3300006847 | Bacteria | 5989 |
| 215 | Ga0075431_100055261 | 3300006847 | Bacteria | 4095 |
| 216 | Ga0075431_100206039 | 3300006847 | Bacteria | 2011 |
| 217 | Ga0075431_100258715 | 3300006847 | Bacteria | 1767 |
| 218 | Ga0075433_10000125 | 3300006852 | Bacteria | 38878 |
| 219 | Ga0075433_10075221 | 3300006852 | Bacteria | 2972 |
| 220 | Ga0075434_100008387 | 3300006871 | Bacteria | 9607 |
| 221 | Ga0075434_100377658 | 3300006871 | Bacteria | 1438 |
| 222 | Ga0075429_100000183 | 3300006880 | Bacteria | 40888 |
| 223 | Ga0075429_100020360 | 3300006880 | Bacteria | 5755 |
| 224 | Ga0075429_100050064 | 3300006880 | Bacteria | 3635 |
| 225 | Ga0068865_100067979 | 3300006881 | Bacteria | 2518 |
| 226 | Ga0097620_100016683 | 3300006931 | Bacteria | 7373 |
| 227 | Ga0097620_100039940 | 3300006931 | Bacteria | 4710 |
| 228 | Ga0097620_100284153 | 3300006931 | Bacteria | 1747 |
| 229 | Ga0099825_1033101 | 3300006941 | Bacteria | 2033 |
| 230 | Ga0079104_1000772 | 3300006946 | Bacteria | 27473 |
| 231 | Ga0075435_100006471 | 3300007076 | Bacteria | 8284 |
| 232 | Ga0075435_100175503 | 3300007076 | Bacteria | 1809 |
| 233 | Ga0105240_10021211 | 3300009093 | Bacteria | 8647 |
| 234 | Ga0111539_10003120 | 3300009094 | Bacteria | 21947 |
| 235 | Ga0111539_10010381 | 3300009094 | Bacteria | 11724 |
| 236 | Ga0111539_10035947 | 3300009094 | Bacteria | 5995 |
| 237 | Ga0111539_10168777 | 3300009094 | Bacteria | 2557 |
| 238 | Ga0105245_10003785 | 3300009098 | Bacteria | 13456 |
| 239 | Ga0105245_10039830 | 3300009098 | Bacteria | 4183 |
| 240 | Ga0105245_10080471 | 3300009098 | Bacteria | 2976 |
| 241 | Ga0105247_10006629 | 3300009101 | Bacteria | 7153 |
| 242 | Ga0105247_10034192 | 3300009101 | Bacteria | 3096 |
| 243 | Ga0105247_10077134 | 3300009101 | Bacteria | 2094 |
| 244 | Ga0114129_10005398 | 3300009147 | Bacteria | 18046 |
| 245 | Ga0114129_10021657 | 3300009147 | Bacteria | 9123 |
| 246 | Ga0114129_10221736 | 3300009147 | Bacteria | 2550 |
| 247 | Ga0114129_10409322 | 3300009147 | Bacteria | 1786 |
| 248 | Ga0105243_10027268 | 3300009148 | Bacteria | 4375 |
| 249 | Ga0105243_10115385 | 3300009148 | Bacteria | 2255 |
| 250 | Ga0105243_10138101 | 3300009148 | Bacteria | 2076 |
| 251 | Ga0105241_10029956 | 3300009174 | Bacteria | 4064 |
| 252 | Ga0105241_10127258 | 3300009174 | Bacteria | 2058 |
| 253 | Ga0105242_10104545 | 3300009176 | Bacteria | 2404 |
| 254 | Ga0105248_10014926 | 3300009177 | Bacteria | 8552 |
| 255 | Ga0105248_10043198 | 3300009177 | Bacteria | 5054 |
| 256 | Ga0105248_10260904 | 3300009177 | Bacteria | 1951 |
| 257 | Ga0105237_10046888 | 3300009545 | Bacteria | 4344 |
| 258 | Ga0105237_10244619 | 3300009545 | Bacteria | 1795 |
| 259 | Ga0105238_10072474 | 3300009551 | Bacteria | 3440 |
| 260 | Ga0105238_10183534 | 3300009551 | Bacteria | 2069 |
| 261 | Ga0105238_10201674 | 3300009551 | Bacteria | 1965 |
| 262 | Ga0105249_10107666 | 3300009553 | Bacteria | 2631 |
| 263 | Ga0105249_10108754 | 3300009553 | Bacteria | 2618 |
| 264 | Ga0105249_10256209 | 3300009553 | Bacteria | 1737 |
| 265 | Ga0105239_10128432 | 3300010375 | Bacteria | 2818 |
| 266 | Ga0105239_10147389 | 3300010375 | Bacteria | 2626 |
| 267 | Ga0105239_10155237 | 3300010375 | Bacteria | 2556 |
| 268 | Ga0105239_10209072 | 3300010375 | Bacteria | 2187 |
| 269 | Ga0105246_10006437 | 3300011119 | Bacteria | 7177 |
| 270 | Ga0105246_10008875 | 3300011119 | Bacteria | 6186 |
| 271 | Ga0105246_10063443 | 3300011119 | Bacteria | 2577 |
| 272 | Ga0105246_10079580 | 3300011119 | Bacteria | 2331 |
| 273 | Ga0157373_10022116 | 3300013100 | Bacteria | 4616 |
| 274 | Ga0157371_10285144 | 3300013102 | Bacteria | 1194 |
| 275 | Ga0157370_10034208 | 3300013104 | Bacteria | 4951 |
| 276 | Ga0157370_10090185 | 3300013104 | Bacteria | 2879 |
| 277 | Ga0157370_10090695 | 3300013104 | Bacteria | 2870 |
| 278 | Ga0157369_10259333 | 3300013105 | Bacteria | 1813 |
| 279 | Ga0157374_10051941 | 3300013296 | Bacteria | 3816 |
| 280 | Ga0157374_10262320 | 3300013296 | Bacteria | 1702 |
| 281 | Ga0157378_10136986 | 3300013297 | Bacteria | 2270 |
| 282 | Ga0163162_10103627 | 3300013306 | Bacteria | 2939 |
| 283 | Ga0163162_10142417 | 3300013306 | Bacteria | 2512 |
| 284 | Ga0163162_10541075 | 3300013306 | Bacteria | 1293 |
| 285 | Ga0157375_10009111 | 3300013308 | Bacteria | 8696 |
| 286 | Ga0163163_10003696 | 3300014325 | Bacteria | 13022 |
| 287 | Ga0163163_10008749 | 3300014325 | Bacteria | 9007 |
| 288 | Ga0163163_10093806 | 3300014325 | Bacteria | 3018 |
| 289 | Ga0163163_10294721 | 3300014325 | Bacteria | 1674 |
| 290 | Ga0163163_10312257 | 3300014325 | Bacteria | 1625 |
| 291 | Ga0157380_10098758 | 3300014326 | Bacteria | 2427 |
| 292 | Ga0182008_10053802 | 3300014497 | Unclassified | 1993 |
| 293 | Ga0157377_10226984 | 3300014745 | Bacteria | 1198 |
| 294 | Ga0157379_10019887 | 3300014968 | Bacteria | 5931 |
| 295 | Ga0157379_10039826 | 3300014968 | Bacteria | 4193 |
| 296 | Ga0157379_10046373 | 3300014968 | Bacteria | 3877 |
| 297 | Ga0157379_10150442 | 3300014968 | Bacteria | 2099 |
| 298 | Ga0157376_10003716 | 3300014969 | Bacteria | 10546 |
| 299 | Ga0157376_10196217 | 3300014969 | Bacteria | 1854 |
| 300 | Ga0157376_10226284 | 3300014969 | Bacteria | 1735 |
| 301 | Ga0214544_1000004 | 3300021320 | Bacteria | 455869 |
| 302 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 303 | Ga0214542_1027275 | 3300021321 | Bacteria | 2637 |
| 304 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 305 | Ga0214545_1028004 | 3300021324 | Bacteria | 2775 |
| 306 | Ga0214543_1000006 | 3300021327 | Bacteria | 443395 |
| 307 | Ga0214543_1029823 | 3300021327 | Bacteria | 2378 |
| 308 | Ga0213876_10000816 | 3300021384 | Bacteria | 21075 |
| 309 | Ga0213876_10000944 | 3300021384 | Bacteria | 19157 |
| 310 | Ga0213876_10024495 | 3300021384 | Bacteria | 3186 |
| 311 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 312 | Ga0209233_1007993 | 3300025261 | Bacteria | 3305 |
| 313 | Ga0209025_1066051 | 3300025294 | Bacteria | 1317 |
| 314 | Ga0209564_1001626 | 3300025295 | Bacteria | 21795 |
| 315 | Ga0209564_1008466 | 3300025295 | Bacteria | 5070 |
| 316 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 317 | Ga0209758_1000097 | 3300025297 | Bacteria | 230529 |
| 318 | Ga0209758_1002191 | 3300025297 | Bacteria | 20457 |
| 319 | Ga0209256_1001501 | 3300025299 | Bacteria | 23665 |
| 320 | Ga0207426_1000439 | 3300025302 | Bacteria | 67107 |
| 321 | Ga0209257_1000588 | 3300025304 | Bacteria | 60654 |
| 322 | Ga0209257_1018568 | 3300025304 | Bacteria | 2667 |
| 323 | Ga0207682_10001905 | 3300025893 | Bacteria | 9471 |
| 324 | Ga0207692_10010733 | 3300025898 | Bacteria | 3874 |
| 325 | Ga0207642_10104134 | 3300025899 | Bacteria | 1431 |
| 326 | Ga0207710_10011889 | 3300025900 | Bacteria | 3662 |
| 327 | Ga0207688_10001053 | 3300025901 | Bacteria | 14128 |
| 328 | Ga0207688_10019972 | 3300025901 | Bacteria | 3655 |
| 329 | Ga0207680_10236359 | 3300025903 | Bacteria | 1258 |
| 330 | Ga0207647_10011848 | 3300025904 | Bacteria | 6094 |
| 331 | Ga0207647_10022689 | 3300025904 | Bacteria | 4165 |
| 332 | Ga0207647_10030106 | 3300025904 | Bacteria | 3506 |
| 333 | Ga0207647_10038482 | 3300025904 | Bacteria | 3023 |
| 334 | Ga0207685_10025753 | 3300025905 | Bacteria | 2035 |
| 335 | Ga0207699_10010277 | 3300025906 | Bacteria | 4690 |
| 336 | Ga0207645_10008189 | 3300025907 | Bacteria | 7319 |
| 337 | Ga0207645_10010590 | 3300025907 | Bacteria | 6327 |
| 338 | Ga0207645_10127742 | 3300025907 | Bacteria | 1653 |
| 339 | Ga0207643_10003366 | 3300025908 | Bacteria | 8614 |
| 340 | Ga0207643_10020063 | 3300025908 | Bacteria | 3666 |
| 341 | Ga0207684_10108773 | 3300025910 | Bacteria | 2372 |
| 342 | Ga0207654_10252886 | 3300025911 | Bacteria | 1182 |
| 343 | Ga0207707_10018781 | 3300025912 | Bacteria | 6029 |
| 344 | Ga0207707_10072454 | 3300025912 | Bacteria | 3003 |
| 345 | Ga0207693_10001150 | 3300025915 | Bacteria | 23634 |
| 346 | Ga0207693_10016959 | 3300025915 | Bacteria | 5817 |
| 347 | Ga0207693_10024155 | 3300025915 | Bacteria | 4826 |
| 348 | Ga0207693_10027969 | 3300025915 | Bacteria | 4457 |
| 349 | Ga0207693_10129223 | 3300025915 | Bacteria | 1986 |
| 350 | Ga0207693_10195953 | 3300025915 | Bacteria | 1589 |
| 351 | Ga0207663_10002241 | 3300025916 | Bacteria | 9253 |
| 352 | Ga0207660_10008445 | 3300025917 | Bacteria | 6661 |
| 353 | Ga0207660_10068232 | 3300025917 | Bacteria | 2578 |
| 354 | Ga0207662_10002137 | 3300025918 | Bacteria | 9837 |
| 355 | Ga0207662_10072254 | 3300025918 | Bacteria | 2090 |
| 356 | Ga0207657_10013624 | 3300025919 | Bacteria | 7972 |
| 357 | Ga0207649_10067228 | 3300025920 | Bacteria | 2274 |
| 358 | Ga0207652_10125048 | 3300025921 | Bacteria | 2290 |
| 359 | Ga0207646_10039558 | 3300025922 | Bacteria | 4244 |
| 360 | Ga0207681_10170299 | 3300025923 | Bacteria | 1650 |
| 361 | Ga0207694_10047081 | 3300025924 | Bacteria | 3335 |
| 362 | Ga0207694_10156488 | 3300025924 | Bacteria | 1838 |
| 363 | Ga0207650_10039381 | 3300025925 | Bacteria | 3455 |
| 364 | Ga0207650_10148324 | 3300025925 | Bacteria | 1849 |
| 365 | Ga0207650_10150214 | 3300025925 | Bacteria | 1838 |
| 366 | Ga0207659_10194068 | 3300025926 | Bacteria | 1617 |
| 367 | Ga0207687_10001252 | 3300025927 | Bacteria | 17372 |
| 368 | Ga0207687_10013163 | 3300025927 | Bacteria | 5403 |
| 369 | Ga0207687_10021234 | 3300025927 | Bacteria | 4313 |
| 370 | Ga0207700_10022348 | 3300025928 | Bacteria | 4340 |
| 371 | Ga0207700_10217672 | 3300025928 | Bacteria | 1617 |
| 372 | Ga0207664_10036615 | 3300025929 | Bacteria | 3793 |
| 373 | Ga0207664_10121412 | 3300025929 | Bacteria | 2187 |
| 374 | Ga0207664_10244199 | 3300025929 | Bacteria | 1565 |
| 375 | Ga0207644_10040575 | 3300025931 | Bacteria | 3290 |
| 376 | Ga0207706_10030478 | 3300025933 | Bacteria | 4810 |
| 377 | Ga0207706_10126822 | 3300025933 | Bacteria | 2244 |
| 378 | Ga0207706_10142460 | 3300025933 | Bacteria | 2109 |
| 379 | Ga0207686_10009550 | 3300025934 | Bacteria | 5263 |
| 380 | Ga0207709_10033632 | 3300025935 | Bacteria | 3013 |
| 381 | Ga0207709_10039461 | 3300025935 | Bacteria | 2820 |
| 382 | Ga0207670_10003594 | 3300025936 | Bacteria | 8224 |
| 383 | Ga0207670_10091129 | 3300025936 | Bacteria | 2155 |
| 384 | Ga0207670_10290929 | 3300025936 | Bacteria | 1276 |
| 385 | Ga0207669_10026195 | 3300025937 | Bacteria | 3167 |
| 386 | Ga0207669_10032407 | 3300025937 | Bacteria | 2934 |
| 387 | Ga0207704_10068433 | 3300025938 | Bacteria | 2238 |
| 388 | Ga0207665_10000775 | 3300025939 | Bacteria | 21527 |
| 389 | Ga0207665_10002581 | 3300025939 | Bacteria | 12169 |
| 390 | Ga0207665_10024249 | 3300025939 | Bacteria | 3999 |
| 391 | Ga0207691_10022886 | 3300025940 | Bacteria | 5890 |
| 392 | Ga0207691_10024151 | 3300025940 | Bacteria | 5717 |
| 393 | Ga0207691_10163394 | 3300025940 | Bacteria | 1952 |
| 394 | Ga0207689_10002991 | 3300025942 | Bacteria | 15584 |
| 395 | Ga0207689_10009502 | 3300025942 | Bacteria | 8397 |
| 396 | Ga0207689_10304709 | 3300025942 | Unclassified | 1321 |
| 397 | Ga0207679_10061777 | 3300025945 | Bacteria | 2790 |
| 398 | Ga0207679_10211038 | 3300025945 | Bacteria | 1628 |
| 399 | Ga0207651_10157413 | 3300025960 | Bacteria | 1777 |
| 400 | Ga0207712_10004686 | 3300025961 | Bacteria | 8648 |
| 401 | Ga0207668_10237249 | 3300025972 | Bacteria | 1473 |
| 402 | Ga0207640_10027914 | 3300025981 | Bacteria | 3444 |
| 403 | Ga0207658_10010199 | 3300025986 | Bacteria | 6384 |
| 404 | Ga0207677_10004452 | 3300026023 | Bacteria | 7522 |
| 405 | Ga0207677_10105099 | 3300026023 | Bacteria | 2089 |
| 406 | Ga0207703_10007538 | 3300026035 | Bacteria | 8631 |
| 407 | Ga0207703_10007965 | 3300026035 | Bacteria | 8375 |
| 408 | Ga0207703_10084126 | 3300026035 | Bacteria | 2660 |
| 409 | Ga0207639_10096489 | 3300026041 | Bacteria | 2378 |
| 410 | Ga0207639_10299097 | 3300026041 | Bacteria | 1422 |
| 411 | Ga0207678_10002455 | 3300026067 | Bacteria | 16839 |
| 412 | Ga0207678_10016550 | 3300026067 | Bacteria | 6475 |
| 413 | Ga0207678_10031893 | 3300026067 | Bacteria | 4594 |
| 414 | Ga0207678_10057223 | 3300026067 | Bacteria | 3355 |
| 415 | Ga0207678_10081798 | 3300026067 | Bacteria | 2764 |
| 416 | Ga0207708_10002956 | 3300026075 | Bacteria | 12522 |
| 417 | Ga0207708_10040488 | 3300026075 | Bacteria | 3552 |
| 418 | Ga0207708_10095183 | 3300026075 | Bacteria | 2300 |
| 419 | Ga0207708_10128499 | 3300026075 | Bacteria | 1979 |
| 420 | Ga0207708_10131512 | 3300026075 | Bacteria | 1957 |
| 421 | Ga0207702_10140357 | 3300026078 | Bacteria | 2186 |
| 422 | Ga0207702_10260362 | 3300026078 | Bacteria | 1633 |
| 423 | Ga0207702_10375880 | 3300026078 | Bacteria | 1365 |
| 424 | Ga0207702_10504217 | 3300026078 | Bacteria | 1180 |
| 425 | Ga0207641_10010922 | 3300026088 | Bacteria | 7441 |
| 426 | Ga0207641_10111317 | 3300026088 | Bacteria | 2427 |
| 427 | Ga0207648_10003243 | 3300026089 | Bacteria | 17119 |
| 428 | Ga0207648_10004365 | 3300026089 | Bacteria | 14546 |
| 429 | Ga0207648_10009198 | 3300026089 | Bacteria | 9490 |
| 430 | Ga0207648_10391202 | 3300026089 | Bacteria | 1258 |
| 431 | Ga0207676_10002494 | 3300026095 | Bacteria | 13103 |
| 432 | Ga0207676_10015497 | 3300026095 | Bacteria | 5500 |
| 433 | Ga0207674_10017744 | 3300026116 | Bacteria | 7757 |
| 434 | Ga0207674_10026785 | 3300026116 | Bacteria | 6115 |
| 435 | Ga0207674_10111536 | 3300026116 | Bacteria | 2709 |
| 436 | Ga0207674_10153745 | 3300026116 | Bacteria | 2257 |
| 437 | Ga0207675_100005260 | 3300026118 | Bacteria | 12449 |
| 438 | Ga0207675_100061604 | 3300026118 | Bacteria | 3502 |
| 439 | Ga0207675_100072011 | 3300026118 | Bacteria | 3232 |
| 440 | Ga0207675_100126982 | 3300026118 | Bacteria | 2416 |
| 441 | Ga0207675_100379843 | 3300026118 | Bacteria | 1389 |
| 442 | Ga0207683_10048849 | 3300026121 | Bacteria | 3702 |
| 443 | Ga0207683_10260409 | 3300026121 | Bacteria | 1584 |
| 444 | Ga0207698_10298476 | 3300026142 | Bacteria | 1499 |
| 445 | Ga0209281_1000839 | 3300027111 | Bacteria | 27458 |
| 446 | Ga0209389_1000199 | 3300027296 | Bacteria | 43170 |
| 447 | Ga0209969_1001317 | 3300027360 | Bacteria | 3408 |
| 448 | Ga0209489_102148 | 3300027361 | Bacteria | 40384 |
| 449 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 450 | Ga0209967_1002257 | 3300027364 | Bacteria | 2503 |
| 451 | Ga0210000_1003297 | 3300027462 | Bacteria | 2327 |
| 452 | Ga0209813_10000408 | 3300027866 | Bacteria | 10485 |
| 453 | Ga0209974_10020453 | 3300027876 | Bacteria | 2193 |
| 454 | Ga0207428_10040114 | 3300027907 | Bacteria | 3800 |
| 455 | Ga0268266_10022350 | 3300028379 | Bacteria | 5391 |
| 456 | Ga0268266_10024247 | 3300028379 | Bacteria | 5162 |
| 457 | Ga0268266_10040575 | 3300028379 | Bacteria | 3967 |
| 458 | Ga0268265_10001732 | 3300028380 | Bacteria | 17566 |
| 459 | Ga0268265_10119178 | 3300028380 | Bacteria | 2171 |
| 460 | Ga0268264_10100948 | 3300028381 | Bacteria | 2507 |
| 461 | Ga0307511_10000014 | 3300030521 | Bacteria | 127602 |
| 462 | Ga0265316_10190919 | 3300031344 | Bacteria | 1522 |
| 463 | Ga0307408_100053003 | 3300031548 | Bacteria | 2928 |
| 464 | Ga0265314_10004888 | 3300031711 | Bacteria | 12255 |
| 465 | Ga0316578_10020840 | 3300031728 | Bacteria | 3628 |
| 466 | Ga0307405_10074589 | 3300031731 | Bacteria | 2194 |
| 467 | Ga0307409_100107720 | 3300031995 | Bacteria | 2329 |
| 468 | Ga0307409_100439824 | 3300031995 | Bacteria | 1256 |
| 469 | Ga0307416_100478923 | 3300032002 | Bacteria | 1304 |
| 470 | Ga0307415_100027417 | 3300032126 | Bacteria | 3609 |
| 471 | Ga0307415_100159664 | 3300032126 | Bacteria | 1746 |
| 472 | Ga0307510_10045817 | 3300033180 | Bacteria | 4712 |
| 473 | Ga0307510_10047901 | 3300033180 | Bacteria | 4569 |
| 474 | Ga0373934_0003068 | 3300035086 | Bacteria | 6100 |
| 475 | Ga0373944_0005124 | 3300035089 | Bacteria | 3444 |
| 476 | Ga0373949_0004068 | 3300035090 | Bacteria | 3387 |
| 477 | Ga0373936_0045182 | 3300035113 | Bacteria | 1774 |
| 478 | Ga0373945_0011192 | 3300035116 | Bacteria | 2963 |
| 479 | Ga0373954_0004828 | 3300035118 | Bacteria | 5812 |
| 480 | Ga0373956_0009898 | 3300035119 | Bacteria | 3886 |
| 481 | Ga0373960_0009259 | 3300035121 | Bacteria | 2380 |
| 482 | Ga0373943_0004642 | 3300035170 | Bacteria | 6213 |
| 483 | Ga0373946_0016859 | 3300035171 | Bacteria | 2788 |
| 484 | Ga0373946_0044250 | 3300035171 | Bacteria | 1838 |
| 485 | Ga0373961_0004701 | 3300035241 | Bacteria | 3285 |
| 486 | Ga0373961_0020627 | 3300035241 | Bacteria | 1745 |
| 487 | Ga0316574_0003660 | 3300035398 | Bacteria | 7960 |
| 488 | Ga0373931_0000199 | 3300035691 | Bacteria | 25657 |
| 489 | Ga0373931_0001050 | 3300035691 | Bacteria | 11689 |
| 490 | Ga0373935_0158844 | 3300035692 | Bacteria | 1539 |
| 491 | Ga0373927_0105012 | 3300035695 | Bacteria | 1839 |
| 492 | Ga0373927_0162364 | 3300035695 | Bacteria | 1464 |
| 493 | Ga0373927_0179206 | 3300035695 | Bacteria | 1390 |
| 494 | Ga0373933_0001341 | 3300035724 | Bacteria | 14499 |
| 495 | Ga0373937_0178249 | 3300036401 | Bacteria | 1995 |
| 496 | Ga0316584_0010529 | 3300036712 | Bacteria | 6467 |
| 497 | Ga0373925_0048671 | 3300037068 | Bacteria | 3159 |
| 498 | Ga0395900_0264308 | 3300037418 | Bacteria | 1717 |
| 499 | Ga0395898_0162622 | 3300037466 | Bacteria | 2135 |
| 500 | Ga0395905_0069896 | 3300037471 | Bacteria | 3289 |
| 501 | Ga0436364_0207394 | 3300037853 | Bacteria | 14617 |
| 502 | Ga0436364_0286306 | 3300037853 | Bacteria | 1395 |
| 503 | Ga0436364_0430154 | 3300037853 | Bacteria | 16915 |
| 504 | Ga0436364_0434654 | 3300037853 | Bacteria | 3712 |
| 505 | Ga0395901_0385679 | 3300038443 | Bacteria | 1441 |
| 506 | Ga0436365_0159339 | 3300039437 | Bacteria | 58353 |
| 507 | Ga0436365_0413923 | 3300039437 | Bacteria | 6603 |
| 508 | Ga0436365_0736793 | 3300039437 | Bacteria | 96466 |
| 509 | Ga0436365_0940551 | 3300039437 | Bacteria | 10885 |
| 510 | Ga0436365_1187256 | 3300039437 | Bacteria | 1547 |
| 511 | Ga0436365_1368008 | 3300039437 | Bacteria | 6440 |
| 512 | Ga0436360_0504894 | 3300039438 | Bacteria | 7022 |
| 513 | Ga0436360_1076044 | 3300039438 | Bacteria | 1337 |
| 514 | Ga0436361_0905452 | 3300039447 | Bacteria | 5518 |
| 515 | Ga0436363_0287186 | 3300039450 | Bacteria | 2199 |
| 516 | Ga0436363_0313348 | 3300039450 | Bacteria | 32729 |
| 517 | Ga0436363_0703923 | 3300039450 | Bacteria | 1783 |
| 518 | Ga0436363_1475436 | 3300039450 | Bacteria | 11441 |
| 519 | Ga0436362_0274206 | 3300039453 | Bacteria | 1162 |
| 520 | Ga0450911_000064 | 3300042115 | Bacteria | 43716 |
| 521 | Ga0466966_0041438 | 3300044684 | Bacteria | 2959 |
| 522 | Ga0466963_0194984 | 3300044694 | Bacteria | 1416 |
| 523 | Ga0466968_0009238 | 3300044735 | Bacteria | 3790 |
| 524 | Ga0466970_0183530 | 3300044765 | Bacteria | 1161 |
| 525 | Ga0466957_0036272 | 3300044842 | Bacteria | 2964 |
| 526 | Ga0466957_0049790 | 3300044842 | Bacteria | 2548 |
| 527 | Ga0466959_0018887 | 3300045049 | Bacteria | 5065 |
| 528 | Ga0451576_0190182 | 3300045051 | Bacteria | 2144 |
| 529 | Ga0495603_0000815 | 3300046455 | Bacteria | 17889 |
| 530 | Ga0495603_0014909 | 3300046455 | Bacteria | 4701 |
| 531 | Ga0495603_0055846 | 3300046455 | Bacteria | 2339 |
| 532 | Ga0495638_0002133 | 3300046460 | Bacteria | 16607 |
| 533 | Ga0495638_0079907 | 3300046460 | Bacteria | 1987 |
| 534 | Ga0495651_0130767 | 3300046462 | Bacteria | 1832 |
| 535 | Ga0495605_0061752 | 3300046474 | Bacteria | 1792 |
| 536 | Ga0495585_0101648 | 3300046492 | Bacteria | 1537 |
| 537 | Ga0495594_0125454 | 3300046499 | Bacteria | 1452 |
| 538 | Ga0495596_0054852 | 3300046500 | Bacteria | 1558 |
| 539 | Ga0495610_0075765 | 3300046512 | Bacteria | 1557 |
| 540 | Ga0495616_0118733 | 3300046513 | Bacteria | 1223 |
| 541 | Ga0495618_0166601 | 3300046514 | Bacteria | 1403 |
| 542 | Ga0495628_0003683 | 3300046516 | Bacteria | 13678 |
| 543 | Ga0495630_0051524 | 3300046517 | Bacteria | 3081 |
| 544 | Ga0495632_0037042 | 3300046519 | Bacteria | 2478 |
| 545 | Ga0495632_0098174 | 3300046519 | Bacteria | 1382 |
| 546 | Ga0495637_0026576 | 3300046520 | Bacteria | 2596 |
| 547 | Ga0495643_0047109 | 3300046522 | Bacteria | 2335 |
| 548 | Ga0495648_0034559 | 3300046524 | Bacteria | 3288 |
| 549 | Ga0495648_0111791 | 3300046524 | Bacteria | 1485 |
| 550 | Ga0495652_0011271 | 3300046529 | Bacteria | 8090 |
| 551 | Ga0495652_0115861 | 3300046529 | Bacteria | 2146 |
| 552 | Ga0495654_0078628 | 3300046530 | Bacteria | 1550 |
| 553 | Ga0495640_0022824 | 3300046533 | Bacteria | 4568 |
| 554 | Ga0495587_0091556 | 3300046536 | Bacteria | 1756 |
| 555 | Ga0495621_0056061 | 3300046539 | Bacteria | 1420 |
| 556 | Ga0495597_0000256 | 3300046542 | Bacteria | 48492 |
| 557 | Ga0495645_0001496 | 3300046543 | Bacteria | 15843 |
| 558 | Ga0495645_0056473 | 3300046543 | Bacteria | 2850 |
| 559 | Ga0495622_0003864 | 3300046557 | Bacteria | 6999 |
| 560 | Ga0495622_0055459 | 3300046557 | Bacteria | 1838 |
| 561 | Ga0495667_0018521 | 3300046559 | Bacteria | 4704 |
| 562 | Ga0495656_0008757 | 3300046615 | Bacteria | 3624 |
| 563 | Ga0495656_0021968 | 3300046615 | Bacteria | 2492 |
| 564 | Ga0495668_0037199 | 3300046616 | Bacteria | 2724 |
| 565 | Ga0495611_0029563 | 3300046648 | Bacteria | 2403 |
| 566 | Ga0495625_0040647 | 3300046660 | Bacteria | 3389 |
| 567 | Ga0495635_0054834 | 3300046663 | Bacteria | 2745 |
| 568 | Ga0495661_0079214 | 3300046665 | Bacteria | 1898 |
| 569 | Ga0495588_0049897 | 3300046674 | Bacteria | 2153 |
| 570 | Ga0495623_0004849 | 3300046679 | Bacteria | 8825 |
| 571 | Ga0495623_0053390 | 3300046679 | Bacteria | 2552 |
| 572 | Ga0495646_0038638 | 3300046680 | Bacteria | 2946 |
| 573 | Ga0495647_0009849 | 3300046681 | Bacteria | 3245 |
| 574 | Ga0495658_0033412 | 3300046683 | Bacteria | 2817 |
| 575 | Ga0495658_0045587 | 3300046683 | Bacteria | 2461 |
| 576 | Ga0495624_0046293 | 3300046690 | Bacteria | 2766 |
| 577 | Ga0495671_0052863 | 3300046692 | Bacteria | 2018 |
| 578 | Ga0495649_0064668 | 3300046694 | Bacteria | 1964 |
| 579 | Ga0495600_0083000 | 3300046809 | Bacteria | 2091 |
| 580 | Ga0495581_0036050 | 3300047315 | Bacteria | 2862 |
| 581 | Ga0495581_0052066 | 3300047315 | Bacteria | 2365 |
| 582 | Ga0495604_0018955 | 3300047317 | Bacteria | 5509 |
| 583 | Ga0495604_0030809 | 3300047317 | Bacteria | 4257 |
| 584 | Ga0495674_0014695 | 3300047319 | Bacteria | 7327 |
| 585 | Ga0495672_0046617 | 3300047320 | Bacteria | 2584 |
| 586 | Ga0495672_0097344 | 3300047320 | Bacteria | 1602 |
| 587 | Ga0495680_0086176 | 3300047322 | Bacteria | 2364 |
| 588 | Ga0495675_0003891 | 3300047444 | Bacteria | 9052 |
| 589 | Ga0495675_0009097 | 3300047444 | Bacteria | 6173 |
| 590 | Ga0495684_0008620 | 3300047471 | Bacteria | 7892 |
| 591 | Ga0495686_0036654 | 3300047472 | Bacteria | 3147 |
| 592 | Ga0495593_0105613 | 3300047673 | Unclassified | 1441 |
| 593 | Ga0495602_0012370 | 3300048088 | Bacteria | 8779 |
| 594 | Ga0495602_0119735 | 3300048088 | Bacteria | 2120 |
| 595 | Ga0495602_0162233 | 3300048088 | Bacteria | 1744 |
| 596 | Ga0495626_0033986 | 3300048091 | Bacteria | 2441 |
| 597 | Ga0495626_0083870 | 3300048091 | Bacteria | 1411 |
| 598 | Ga0496100_0022978 | 3300048903 | Bacteria | 3781 |
| 599 | Ga0496101_0011389 | 3300048904 | Bacteria | 5900 |
| 600 | Ga0496101_0111578 | 3300048904 | Bacteria | 2059 |
| 601 | Ga0496101_0230071 | 3300048904 | Bacteria | 1441 |
| 602 | Ga0496102_0004325 | 3300048905 | Bacteria | 12013 |
| 603 | Ga0496102_0009419 | 3300048905 | Bacteria | 8390 |
| 604 | Ga0496102_0036387 | 3300048905 | Bacteria | 4435 |
| 605 | Ga0496103_0006135 | 3300048906 | Bacteria | 7181 |
| 606 | Ga0496103_0007472 | 3300048906 | Bacteria | 6514 |
| 607 | Ga0496103_0206902 | 3300048906 | Bacteria | 1262 |
| 608 | Ga0496104_0000064 | 3300048907 | Bacteria | 112084 |
| 609 | Ga0496104_0013698 | 3300048907 | Bacteria | 7311 |
| 610 | Ga0496104_0032361 | 3300048907 | Bacteria | 4867 |
| 611 | Ga0496104_0038719 | 3300048907 | Bacteria | 4462 |
| 612 | Ga0496104_0097120 | 3300048907 | Bacteria | 2819 |
| 613 | Ga0496104_0114237 | 3300048907 | Bacteria | 2589 |
| 614 | Ga0496104_0127665 | 3300048907 | Bacteria | 2442 |
| 615 | Ga0496104_0157650 | 3300048907 | Bacteria | 2178 |
| 616 | Ga0496104_0477792 | 3300048907 | Bacteria | 1158 |
| 617 | Ga0496104_0520479 | 3300048907 | Bacteria | 1101 |
| 618 | Ga0496105_0004178 | 3300048908 | Bacteria | 10847 |
| 619 | Ga0496105_0004868 | 3300048908 | Bacteria | 10140 |
| 620 | Ga0496105_0007989 | 3300048908 | Bacteria | 8224 |
| 621 | Ga0496105_0033160 | 3300048908 | Bacteria | 4240 |
| 622 | Ga0496105_0047746 | 3300048908 | Bacteria | 3533 |
| 623 | Ga0496105_0153677 | 3300048908 | Bacteria | 1891 |
| 624 | Ga0496106_0009196 | 3300048909 | Bacteria | 7296 |
| 625 | Ga0496106_0063359 | 3300048909 | Bacteria | 2810 |
| 626 | Ga0496106_0130191 | 3300048909 | Bacteria | 1973 |
| 627 | Ga0496106_0343276 | 3300048909 | Bacteria | 1199 |
| 628 | Ga0496107_0003386 | 3300048910 | Bacteria | 10662 |
| 629 | Ga0496107_0015375 | 3300048910 | Bacteria | 5363 |
| 630 | Ga0496107_0089587 | 3300048910 | Bacteria | 2247 |
| 631 | Ga0496108_0000378 | 3300048911 | Bacteria | 37061 |
| 632 | Ga0496108_0001892 | 3300048911 | Bacteria | 16769 |
| 633 | Ga0496108_0015446 | 3300048911 | Bacteria | 6228 |
| 634 | Ga0496108_0023560 | 3300048911 | Bacteria | 5067 |
| 635 | Ga0496108_0051787 | 3300048911 | Bacteria | 3439 |
| 636 | Ga0496108_0139622 | 3300048911 | Bacteria | 2087 |
| 637 | Ga0496108_0164187 | 3300048911 | Bacteria | 1920 |
| 638 | Ga0496108_0378468 | 3300048911 | Bacteria | 1236 |
| 639 | Ga0496109_0000386 | 3300048912 | Bacteria | 39999 |
| 640 | Ga0496109_0002039 | 3300048912 | Bacteria | 16741 |
| 641 | Ga0496109_0015519 | 3300048912 | Bacteria | 6641 |
| 642 | Ga0496109_0022636 | 3300048912 | Bacteria | 5566 |
| 643 | Ga0496109_0075201 | 3300048912 | Bacteria | 3105 |
| 644 | Ga0496109_0075800 | 3300048912 | Bacteria | 3092 |
| 645 | Ga0496109_0139178 | 3300048912 | Bacteria | 2269 |
| 646 | Ga0496109_0187075 | 3300048912 | Bacteria | 1946 |
| 647 | Ga0496109_0369859 | 3300048912 | Bacteria | 1354 |
| 648 | Ga0496109_0381374 | 3300048912 | Bacteria | 1332 |
| 649 | Ga0496110_0001431 | 3300048913 | Bacteria | 17258 |
| 650 | Ga0496110_0050899 | 3300048913 | Bacteria | 3639 |
| 651 | Ga0496110_0075637 | 3300048913 | Bacteria | 2992 |
| 652 | Ga0496110_0218178 | 3300048913 | Bacteria | 1734 |
| 653 | Ga0496110_0224258 | 3300048913 | Bacteria | 1709 |
| 654 | Ga0496110_0244007 | 3300048913 | Bacteria | 1635 |
| 655 | Ga0496110_0340113 | 3300048913 | Bacteria | 1367 |
| 656 | Ga0496110_0387683 | 3300048913 | Bacteria | 1273 |
| 657 | Ga0496111_0000314 | 3300048914 | Bacteria | 23921 |
| 658 | Ga0496111_0000958 | 3300048914 | Bacteria | 15764 |
| 659 | Ga0496111_0010973 | 3300048914 | Bacteria | 6095 |
| 660 | Ga0496111_0012151 | 3300048914 | Bacteria | 5823 |
| 661 | Ga0496111_0052500 | 3300048914 | Bacteria | 2944 |
| 662 | Ga0496111_0103750 | 3300048914 | Bacteria | 2091 |
| 663 | Ga0496112_0000681 | 3300048915 | Bacteria | 23700 |
| 664 | Ga0496112_0003469 | 3300048915 | Bacteria | 13040 |
| 665 | Ga0496112_0052980 | 3300048915 | Bacteria | 3984 |
| 666 | Ga0496112_0106907 | 3300048915 | Bacteria | 2768 |
| 667 | Ga0496112_0130104 | 3300048915 | Bacteria | 2488 |
| 668 | Ga0496112_0184408 | 3300048915 | Bacteria | 2050 |
| 669 | Ga0496112_0259193 | 3300048915 | Bacteria | 1688 |
| 670 | Ga0496112_0363335 | 3300048915 | Bacteria | 1389 |
| 671 | Ga0496112_0655450 | 3300048915 | Bacteria | 979 |
| 672 | Ga0496113_0000206 | 3300048916 | Bacteria | 27352 |
| 673 | Ga0496113_0000597 | 3300048916 | Bacteria | 18003 |
| 674 | Ga0496113_0001350 | 3300048916 | Bacteria | 13586 |
| 675 | Ga0496113_0013882 | 3300048916 | Bacteria | 5475 |
| 676 | Ga0496113_0057399 | 3300048916 | Bacteria | 2925 |
| 677 | Ga0496113_0070809 | 3300048916 | Bacteria | 2652 |
| 678 | Ga0496114_0007174 | 3300048917 | Bacteria | 8793 |
| 679 | Ga0496114_0067641 | 3300048917 | Bacteria | 2997 |
| 680 | Ga0496114_0091345 | 3300048917 | Bacteria | 2586 |
| 681 | Ga0496115_0014496 | 3300048918 | Bacteria | 5968 |
| 682 | Ga0496115_0040846 | 3300048918 | Bacteria | 3689 |
| 683 | Ga0496115_0136183 | 3300048918 | Bacteria | 2025 |
| 684 | Ga0496115_0187546 | 3300048918 | Bacteria | 1709 |
| 685 | Ga0496115_0189016 | 3300048918 | Bacteria | 1701 |
| 686 | Ga0496116_0001099 | 3300048919 | Bacteria | 32485 |
| 687 | Ga0496117_0041849 | 3300048920 | Bacteria | 3350 |
| 688 | Ga0496117_0159468 | 3300048920 | Bacteria | 1324 |
| 689 | Ga0496118_0023726 | 3300048921 | Bacteria | 5316 |
| 690 | Ga0496118_0036135 | 3300048921 | Bacteria | 4000 |
| 691 | Ga0496118_0043619 | 3300048921 | Bacteria | 3522 |
| 692 | Ga0496118_0068161 | 3300048921 | Bacteria | 2586 |
| 693 | Ga0496119_0049689 | 3300048922 | Bacteria | 2591 |
| 694 | Ga0496119_0056562 | 3300048922 | Bacteria | 2377 |
| 695 | Ga0496120_0026457 | 3300048923 | Bacteria | 3582 |
| 696 | Ga0496121_0000385 | 3300048924 | Bacteria | 90105 |
| 697 | Ga0496121_0004958 | 3300048924 | Bacteria | 17463 |
| 698 | Ga0496121_0017055 | 3300048924 | Bacteria | 7448 |
| 699 | Ga0496121_0017489 | 3300048924 | Bacteria | 7321 |
| 700 | Ga0496121_0017759 | 3300048924 | Bacteria | 7235 |
| 701 | Ga0496121_0019762 | 3300048924 | Bacteria | 6714 |
| 702 | Ga0496121_0072659 | 3300048924 | Bacteria | 2761 |
| 703 | Ga0496121_0114106 | 3300048924 | Bacteria | 2054 |
| 704 | Ga0496122_0000528 | 3300048925 | Bacteria | 79201 |
| 705 | Ga0496122_0030398 | 3300048925 | Bacteria | 4525 |
| 706 | Ga0496123_0001698 | 3300048926 | Bacteria | 29435 |
| 707 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 708 | Ga0496124_0061900 | 3300048927 | Bacteria | 3135 |
| 709 | Ga0496124_0130813 | 3300048927 | Bacteria | 1994 |
| 710 | Ga0496125_0003427 | 3300048928 | Bacteria | 19225 |
| 711 | Ga0496125_0006164 | 3300048928 | Bacteria | 13070 |
| 712 | Ga0496125_0013040 | 3300048928 | Bacteria | 8201 |
| 713 | Ga0496125_0029663 | 3300048928 | Bacteria | 4911 |
| 714 | Ga0496125_0034775 | 3300048928 | Bacteria | 4434 |
| 715 | Ga0496125_0070568 | 3300048928 | Bacteria | 2734 |
| 716 | Ga0496126_0001329 | 3300048929 | Bacteria | 39310 |
| 717 | Ga0496126_0007328 | 3300048929 | Bacteria | 12113 |
| 718 | Ga0496126_0015687 | 3300048929 | Bacteria | 7612 |
| 719 | Ga0496126_0022525 | 3300048929 | Bacteria | 6127 |
| 720 | Ga0496126_0038938 | 3300048929 | Bacteria | 4418 |
| 721 | Ga0496126_0083503 | 3300048929 | Bacteria | 2819 |
| 722 | Ga0496126_0115348 | 3300048929 | Bacteria | 2336 |
| 723 | Ga0496126_0123529 | 3300048929 | Bacteria | 2242 |
| 724 | Ga0496126_0364539 | 3300048929 | Bacteria | 1179 |
| 725 | Ga0501032_0047451 | 3300049569 | Bacteria | 2900 |
| 726 | Ga0501033_0017045 | 3300049570 | Bacteria | 5491 |
| 727 | Ga0501033_0056081 | 3300049570 | Bacteria | 2913 |
| 728 | Ga0501033_0161827 | 3300049570 | Bacteria | 1611 |
| 729 | Ga0501034_0024944 | 3300049571 | Bacteria | 6083 |
| 730 | Ga0501034_0026362 | 3300049571 | Bacteria | 5919 |
| 731 | Ga0501036_0019499 | 3300049572 | Bacteria | 5695 |
| 732 | Ga0501036_0165046 | 3300049572 | Bacteria | 1867 |
| 733 | Ga0501036_0394224 | 3300049572 | Bacteria | 1155 |
| 734 | Ga0501038_0106917 | 3300049574 | Bacteria | 2321 |
| 735 | Ga0501038_0204666 | 3300049574 | Bacteria | 1582 |
| 736 | Ga0501039_0031975 | 3300049575 | Bacteria | 4057 |
| 737 | Ga0501039_0411612 | 3300049575 | Bacteria | 1062 |
| 738 | Ga0501040_0038136 | 3300049576 | Bacteria | 3266 |
| 739 | Ga0501040_0149255 | 3300049576 | Bacteria | 1648 |
| 740 | Ga0501041_0020793 | 3300049577 | Bacteria | 3927 |
| 741 | Ga0501041_0038497 | 3300049577 | Bacteria | 2900 |
| 742 | Ga0501041_0050299 | 3300049577 | Bacteria | 2540 |
| 743 | Ga0501042_0029949 | 3300049578 | Bacteria | 3842 |
| 744 | Ga0501042_0050955 | 3300049578 | Bacteria | 2953 |
| 745 | Ga0501042_0146443 | 3300049578 | Bacteria | 1703 |
| 746 | Ga0501043_0055748 | 3300049579 | Bacteria | 3105 |
| 747 | Ga0501043_0164793 | 3300049579 | Bacteria | 1731 |
| 748 | Ga0501046_0006011 | 3300049580 | Bacteria | 10798 |
| 749 | Ga0501046_0063080 | 3300049580 | Bacteria | 2894 |
| 750 | Ga0501046_0119377 | 3300049580 | Bacteria | 2008 |
| 751 | Ga0501046_0225932 | 3300049580 | Bacteria | 1385 |
| 752 | Ga0501047_0009379 | 3300049581 | Bacteria | 9245 |
| 753 | Ga0501048_0178384 | 3300049582 | Bacteria | 1506 |
| 754 | Ga0501070_0035967 | 3300049586 | Bacteria | 4136 |
| 755 | Ga0501070_0061978 | 3300049586 | Bacteria | 3098 |
| 756 | Ga0501070_0085226 | 3300049586 | Bacteria | 2616 |
| 757 | Ga0501070_0140089 | 3300049586 | Bacteria | 1997 |
| 758 | Ga0501071_0014840 | 3300049587 | Bacteria | 5336 |
| 759 | Ga0501071_0072383 | 3300049587 | Bacteria | 2514 |
| 760 | Ga0501071_0249090 | 3300049587 | Bacteria | 1341 |
| 761 | Ga0501072_0004729 | 3300049588 | Bacteria | 10373 |
| 762 | Ga0501072_0008188 | 3300049588 | Bacteria | 7936 |
| 763 | Ga0501072_0019484 | 3300049588 | Bacteria | 5246 |
| 764 | Ga0501072_0069334 | 3300049588 | Bacteria | 2784 |
| 765 | Ga0501074_0072720 | 3300049590 | Bacteria | 2470 |
| 766 | Ga0501074_0161020 | 3300049590 | Bacteria | 1603 |
| 767 | Ga0501075_0003767 | 3300049591 | Bacteria | 10188 |
| 768 | Ga0501075_0035408 | 3300049591 | Bacteria | 3723 |
| 769 | Ga0501075_0175249 | 3300049591 | Bacteria | 1637 |
| 770 | Ga0501076_0002632 | 3300049592 | Bacteria | 12380 |
| 771 | Ga0501076_0088720 | 3300049592 | Bacteria | 2485 |
| 772 | Ga0501076_0270348 | 3300049592 | Bacteria | 1392 |
| 773 | Ga0501079_0011381 | 3300049741 | Bacteria | 6790 |
| 774 | Ga0501079_0012771 | 3300049741 | Bacteria | 6416 |
| 775 | Ga0501079_0019453 | 3300049741 | Bacteria | 5186 |
| 776 | Ga0501079_0063679 | 3300049741 | Bacteria | 2845 |
| 777 | Ga0501080_0007756 | 3300049742 | Bacteria | 9703 |
| 778 | Ga0501080_0256665 | 3300049742 | Bacteria | 1593 |
| 779 | Ga0501081_0044648 | 3300049743 | Bacteria | 3042 |
| 780 | Ga0501081_0175615 | 3300049743 | Bacteria | 1548 |
| 781 | Ga0501081_0301681 | 3300049743 | Bacteria | 1175 |
| 782 | Ga0501083_0039745 | 3300049744 | Bacteria | 3195 |
| 783 | Ga0501083_0195204 | 3300049744 | Bacteria | 1321 |
| 784 | Ga0501083_0210194 | 3300049744 | Bacteria | 1268 |
| 785 | Ga0501035_0016279 | 3300049822 | Bacteria | 6861 |
| 786 | Ga0501035_0033610 | 3300049822 | Bacteria | 4663 |
| 787 | Ga0501044_0087986 | 3300049823 | Bacteria | 3136 |
| 788 | Ga0501044_0266397 | 3300049823 | Bacteria | 1650 |
| 789 | Ga0501044_0361345 | 3300049823 | Bacteria | 1370 |
| 790 | Ga0501045_0000328 | 3300049824 | Bacteria | 27844 |
| 791 | Ga0501045_0078869 | 3300049824 | Bacteria | 2428 |
| 792 | Ga0501045_0187412 | 3300049824 | Bacteria | 1542 |
| 793 | Ga0501045_0205484 | 3300049824 | Bacteria | 1467 |
| 794 | nmdc:mga03683_5781_c1 | 3300050489 | Bacteria | 4198 |
| 795 | nmdc:mga03n38_181532_c1 | 3300050490 | Bacteria | 1078 |
| 796 | nmdc:mga03n38_21055_c1 | 3300050490 | Bacteria | 2618 |
| 797 | nmdc:mga03n38_4978_c1 | 3300050490 | Bacteria | 4469 |
| 798 | nmdc:mga00v17_11124_c1 | 3300050491 | Bacteria | 4937 |
| 799 | nmdc:mga00v17_116283_c1 | 3300050491 | Bacteria | 1700 |
| 800 | nmdc:mga00v17_117840_c1 | 3300050491 | Bacteria | 1689 |
| 801 | nmdc:mga0yw44_11160_c1 | 3300050492 | Bacteria | 4622 |
| 802 | nmdc:mga0yw44_20547_c1 | 3300050492 | Bacteria | 3667 |
| 803 | nmdc:mga0yw44_5724_c1 | 3300050492 | Bacteria | 5922 |
| 804 | nmdc:mga0yw44_64731_c1 | 3300050492 | Bacteria | 2251 |
| 805 | nmdc:mga0k408_96679_c1 | 3300050493 | Bacteria | 1739 |
| 806 | nmdc:mga06z11_3902_c1 | 3300050494 | Bacteria | 5815 |
| 807 | nmdc:mga06z11_7243_c1 | 3300050494 | Bacteria | 2635 |
| 808 | nmdc:mga06z11_85195_c1 | 3300050494 | Bacteria | 1704 |
| 809 | nmdc:mga04h51_1285_c1 | 3300050495 | Bacteria | 5796 |
| 810 | nmdc:mga04h51_16333_c1 | 3300050495 | Bacteria | 2154 |
| 811 | nmdc:mga07m45_69736_c1 | 3300050496 | Bacteria | 1999 |
| 812 | nmdc:mga05p37_156332_c1 | 3300050507 | Bacteria | 2786 |
| 813 | nmdc:mga05p37_186566_c1 | 3300050507 | Bacteria | 2521 |
| 814 | nmdc:mga05p37_222666_c1 | 3300050507 | Bacteria | 2276 |
| 815 | nmdc:mga05p37_278145_c1 | 3300050507 | Bacteria | 1997 |
| 816 | nmdc:mga05p37_416_c1 | 3300050507 | Bacteria | 46050 |
| 817 | nmdc:mga05p37_75754_c1 | 3300050507 | Bacteria | 4142 |
| 818 | nmdc:mga09592_40498_c1 | 3300050508 | Bacteria | 3914 |
| 819 | nmdc:mga09592_52428_c1 | 3300050508 | Bacteria | 3443 |
| 820 | nmdc:mga09592_778_c1 | 3300050508 | Bacteria | 24622 |
| 821 | nmdc:mga0qj67_12381_c1 | 3300050509 | Bacteria | 6425 |
| 822 | nmdc:mga0qj67_148978_c1 | 3300050509 | Bacteria | 1898 |
| 823 | nmdc:mga0qj67_16699_c1 | 3300050509 | Bacteria | 5572 |
| 824 | nmdc:mga0qj67_171320_c1 | 3300050509 | Bacteria | 1763 |
| 825 | nmdc:mga0qj67_25793_c1 | 3300050509 | Bacteria | 4546 |
| 826 | nmdc:mga0qj67_304001_c1 | 3300050509 | Bacteria | 1292 |
| 827 | nmdc:mga0qj67_35774_c1 | 3300050509 | Bacteria | 3884 |
| 828 | nmdc:mga06r32_1227_c1 | 3300050510 | Bacteria | 23088 |
| 829 | nmdc:mga06r32_131426_c1 | 3300050510 | Bacteria | 2476 |
| 830 | nmdc:mga06r32_17258_c1 | 3300050510 | Bacteria | 6589 |
| 831 | nmdc:mga06r32_21619_c1 | 3300050510 | Bacteria | 5941 |
| 832 | nmdc:mga06r32_22348_c1 | 3300050510 | Bacteria | 5847 |
| 833 | nmdc:mga06r32_244511_c1 | 3300050510 | Bacteria | 1782 |
| 834 | nmdc:mga06r32_291121_c1 | 3300050510 | Bacteria | 1620 |
| 835 | nmdc:mga06r32_2927_c1 | 3300050510 | Bacteria | 15312 |
| 836 | nmdc:mga06r32_298284_c1 | 3300050510 | Bacteria | 1598 |
| 837 | nmdc:mga06r32_325079_c1 | 3300050510 | Bacteria | 1523 |
| 838 | nmdc:mga08y16_173347_c1 | 3300050511 | Bacteria | 2240 |
| 839 | nmdc:mga08y16_76324_c1 | 3300050511 | Bacteria | 3493 |
| 840 | nmdc:mga08y16_92306_c1 | 3300050511 | Bacteria | 3155 |
| 841 | nmdc:mga0n895_22044_c1 | 3300050512 | Bacteria | 5969 |
| 842 | nmdc:mga0n895_361535_c1 | 3300050512 | Bacteria | 1470 |
| 843 | nmdc:mga0n895_435585_c1 | 3300050512 | Bacteria | 1324 |
| 844 | nmdc:mga0n895_479237_c1 | 3300050512 | Bacteria | 1255 |
| 845 | nmdc:mga0n895_94511_c1 | 3300050512 | Bacteria | 2993 |
| 846 | nmdc:mga0rr50_434669_c1 | 3300050513 | Bacteria | 1111 |
| 847 | nmdc:mga0rr50_572002_c1 | 3300050513 | Bacteria | 963 |
| 848 | nmdc:mga0rr50_6667_c1 | 3300050513 | Bacteria | 7061 |
| 849 | nmdc:mga0a205_101761_c1 | 3300050515 | Bacteria | 2772 |
| 850 | nmdc:mga0a205_191916_c1 | 3300050515 | Bacteria | 1934 |
| 851 | nmdc:mga0a205_335_c1 | 3300050515 | Bacteria | 35266 |
| 852 | nmdc:mga0sz30_47096_c1 | 3300050516 | Bacteria | 1822 |
| 853 | Ga0495601_0013359 | 3300053077 | Bacteria | 4937 |
| 854 | Ga0495601_0021412 | 3300053077 | Bacteria | 3959 |
| 855 | Ga0495601_0162141 | 3300053077 | Bacteria | 1461 |
| 856 | Ga0495601_0394530 | 3300053077 | Unclassified | 897 |
| 857 | Ga0495612_0007530 | 3300053078 | Bacteria | 4450 |
| 858 | Ga0495612_0015354 | 3300053078 | Bacteria | 3069 |
| 859 | Ga0495612_0063384 | 3300053078 | Bacteria | 1533 |
| 860 | Ga0500635_0002895 | 3300053080 | Bacteria | 4270 |
| 861 | Ga0495655_0005107 | 3300053083 | Bacteria | 2297 |
| 862 | Ga0495595_0058430 | 3300053084 | Bacteria | 1801 |
| 863 | Ga0495619_0030201 | 3300053085 | Bacteria | 3507 |
| 864 | Ga0500643_000040 | 3300053087 | Bacteria | 168108 |
| 865 | Ga0500646_0033522 | 3300053090 | Bacteria | 1421 |
| 866 | Ga0500583_0003885 | 3300053092 | Bacteria | 4788 |
| 867 | Ga0500651_0000787 | 3300053093 | Bacteria | 15478 |
| 868 | Ga0500651_0023641 | 3300053093 | Bacteria | 3848 |
| 869 | Ga0500566_0000005 | 3300053094 | Bacteria | 159299 |
| 870 | Ga0500566_0001430 | 3300053094 | Bacteria | 13975 |
| 871 | Ga0500640_004238 | 3300053095 | Bacteria | 5179 |
| 872 | Ga0500640_061145 | 3300053095 | Bacteria | 1633 |
| 873 | Ga0500641_0017337 | 3300053096 | Bacteria | 2692 |
| 874 | Ga0500641_0071255 | 3300053096 | Bacteria | 1463 |
| 875 | Ga0500650_0008348 | 3300053098 | Bacteria | 4090 |
| 876 | Ga0500555_008753 | 3300053103 | Bacteria | 2889 |
| 877 | Ga0500556_0000019 | 3300053104 | Bacteria | 186017 |
| 878 | Ga0500556_0011374 | 3300053104 | Bacteria | 2635 |
| 879 | Ga0500562_011024 | 3300053108 | Bacteria | 2294 |
| 880 | Ga0500572_000164 | 3300053111 | Bacteria | 23114 |
| 881 | Ga0500591_002791 | 3300053115 | Bacteria | 7259 |
| 882 | Ga0500592_000378 | 3300053116 | Bacteria | 7482 |
| 883 | Ga0500593_000284 | 3300053117 | Bacteria | 20609 |
| 884 | Ga0500593_043337 | 3300053117 | Bacteria | 2009 |
| 885 | Ga0500594_0003781 | 3300053118 | Bacteria | 3332 |
| 886 | Ga0500595_000176 | 3300053119 | Bacteria | 42910 |
| 887 | Ga0500595_002181 | 3300053119 | Bacteria | 9945 |
| 888 | Ga0500595_003323 | 3300053119 | Bacteria | 7558 |
| 889 | Ga0500595_007879 | 3300053119 | Bacteria | 4387 |
| 890 | Ga0500607_035679 | 3300053121 | Bacteria | 2718 |
| 891 | Ga0500608_001003 | 3300053122 | Bacteria | 10129 |
| 892 | Ga0500608_009518 | 3300053122 | Bacteria | 4133 |
| 893 | Ga0500614_000629 | 3300053123 | Bacteria | 8979 |
| 894 | Ga0500614_007561 | 3300053123 | Bacteria | 2292 |
| 895 | Ga0500642_0000048 | 3300053130 | Bacteria | 81787 |
| 896 | Ga0500652_000394 | 3300053131 | Bacteria | 15616 |
| 897 | Ga0500658_0096611 | 3300053134 | Bacteria | 1284 |
| 898 | Ga0500559_0000543 | 3300053136 | Bacteria | 26112 |
| 899 | Ga0500559_0000978 | 3300053136 | Bacteria | 17820 |
| 900 | Ga0500559_0002490 | 3300053136 | Bacteria | 9482 |
| 901 | Ga0500568_0000242 | 3300053139 | Bacteria | 46479 |
| 902 | Ga0500568_0052815 | 3300053139 | Bacteria | 1594 |
| 903 | Ga0500573_0009602 | 3300053140 | Bacteria | 5376 |
| 904 | Ga0500577_0002021 | 3300053142 | Bacteria | 5194 |
| 905 | Ga0500586_000115 | 3300053145 | Bacteria | 14310 |
| 906 | Ga0500590_051710 | 3300053148 | Bacteria | 2087 |
| 907 | Ga0500590_097370 | 3300053148 | Bacteria | 1418 |
| 908 | Ga0500603_000097 | 3300053150 | Bacteria | 20631 |
| 909 | Ga0500603_000900 | 3300053150 | Bacteria | 7049 |
| 910 | Ga0500604_0000407 | 3300053151 | Bacteria | 11838 |
| 911 | Ga0500616_0000059 | 3300053153 | Bacteria | 259741 |
| 912 | Ga0500616_0005912 | 3300053153 | Bacteria | 8179 |
| 913 | Ga0500622_0002088 | 3300053156 | Bacteria | 14880 |
| 914 | Ga0500624_001594 | 3300053157 | Bacteria | 3469 |
| 915 | Ga0500627_0008480 | 3300053158 | Bacteria | 3654 |
| 916 | Ga0500630_000701 | 3300053159 | Bacteria | 15344 |
| 917 | Ga0500633_0050632 | 3300053160 | Bacteria | 1432 |
| 918 | Ga0500634_0132287 | 3300053161 | Bacteria | 1196 |
| 919 | Ga0500638_023788 | 3300053162 | Bacteria | 2915 |
| 920 | Ga0500638_053497 | 3300053162 | Bacteria | 1949 |
| 921 | Ga0500639_000106 | 3300053163 | Bacteria | 39379 |
| 922 | Ga0500639_068445 | 3300053163 | Bacteria | 1814 |
| 923 | Ga0500636_0000028 | 3300053177 | Bacteria | 80398 |
| 924 | Ga0500636_0001221 | 3300053177 | Bacteria | 13884 |
| 925 | Ga0500637_0000119 | 3300053178 | Bacteria | 28866 |
| 926 | Ga0500637_0019087 | 3300053178 | Bacteria | 3692 |
| 927 | Ga0500645_013099 | 3300053730 | Bacteria | 2669 |
| 928 | Ga0500645_025474 | 3300053730 | Bacteria | 1805 |
| 929 | Ga0500601_000137 | 3300053737 | Bacteria | 14865 |
| 930 | Ga0501084_0004628 | 3300054114 | Bacteria | 11238 |
| 931 | Ga0501084_0026969 | 3300054114 | Bacteria | 4800 |
| 932 | Ga0501084_0065115 | 3300054114 | Bacteria | 3049 |
| 933 | Ga0501084_0125048 | 3300054114 | Bacteria | 2164 |
| 934 | Ga0501082_0018381 | 3300060353 | Bacteria | 6020 |
| 935 | Ga0501082_0024431 | 3300060353 | Bacteria | 5210 |
| 936 | Ga0501082_0042663 | 3300060353 | Bacteria | 3910 |
| 937 | Ga0501082_0053841 | 3300060353 | Bacteria | 3468 |
| 938 | Ga0501082_0079675 | 3300060353 | Bacteria | 2826 |
| 939 | Ga0501082_0087894 | 3300060353 | Bacteria | 2682 |
| 940 | Ga0530510_0005801 | 3300061734 | Bacteria | 8554 |
| 941 | Ga0530510_0027778 | 3300061734 | Bacteria | 4054 |
| 942 | Ga0530510_0042778 | 3300061734 | Bacteria | 3273 |
| 943 | Ga0530510_0047342 | 3300061734 | Bacteria | 3107 |
| 944 | 2509146916 | 2508501128 | Bacteria | 8613869 |
| 945 | 2511399170 | 2511231028 | Bacteria | 8046582 |
| 946 | 2513592593 | 2513237087 | Bacteria | 5817514 |
| 947 | 2513622213 | 2513237092 | Bacteria | 8341956 |
| 948 | 2513647102 | 2513237095 | Bacteria | 8976980 |
| 949 | 2513674510 | 2513237098 | Bacteria | 9902361 |
| 950 | 2513696629 | 2513237101 | Bacteria | 7952346 |
| 951 | 2513699649 | 2513237102 | Bacteria | 7703324 |
| 952 | 2517103706 | 2517093001 | Bacteria | 9002274 |
| 953 | 2523105686 | 2522572158 | Bacteria | 6514390 |
| 954 | 2524465023 | 2524023210 | Bacteria | 9029266 |
| 955 | 2545675152 | 2545555834 | Bacteria | 8130841 |
| 956 | 2551714257 | 2551306089 | Bacteria | 7162724 |
| 957 | 2596372189 | 2595698237 | Bacteria | 6712432 |
| 958 | 2599101796 | 2597490356 | Bacteria | 7030811 |
| 959 | 2603861732 | 2602042107 | Bacteria | 6226103 |
| 960 | 2617378463 | 2617270741 | Bacteria | 8201522 |
| 961 | 2644130974 | 2643221623 | Bacteria | 5239945 |
| 962 | 2793073773 | 2791355197 | Bacteria | 8420563 |
| 963 | 2818236140 | 2816332527 | Bacteria | 8933356 |
| 964 | 2824620292 | 2824617872 | Bacteria | 8814715 |
| 965 | 2824629557 | 2824626560 | Bacteria | 8813858 |
| 966 | 2824635877 | 2824635225 | Bacteria | 8785348 |
| 967 | 2824645307 | 2824644064 | Bacteria | 8743947 |
| 968 | 2824680393 | 2824679649 | Bacteria | 8248951 |
| 969 | 2824706626 | 2824704595 | Bacteria | 9667483 |
| 970 | 2824722957 | 2824714736 | Bacteria | 8717648 |
| 971 | 2824725286 | 2824723954 | Bacteria | 8758240 |
| 972 | 2824737525 | 2824732956 | Bacteria | 7810675 |
| 973 | 2824752595 | 2824746037 | Bacteria | 7911610 |
| 974 | 2824756567 | 2824753945 | Bacteria | 9787441 |
| 975 | 2824766061 | 2824763712 | Bacteria | 9792355 |
| 976 | 2837654353 | 2837651117 | Bacteria | 3772164 |
| 977 | 2841960124 | 2841957949 | Bacteria | 8652217 |
| 978 | 2842697884 | 2842694124 | Bacteria | 4063419 |
| 979 | 2842698929 | 2842698319 | Bacteria | 5190321 |
| 980 | 2846957940 | 2846952575 | Bacteria | 6587527 |
| 981 | 2847936723 | 2847930680 | Bacteria | 9342022 |
| 982 | 2848864438 | 2848858292 | Bacteria | 7391279 |
| 983 | 2857516201 | 2857509624 | Bacteria | 7472071 |
| 984 | 2857525921 | 2857524615 | Bacteria | 6615449 |
| 985 | 2857546215 | 2857542790 | Bacteria | 5326616 |
| 986 | 2871456714 | 2871451962 | Bacteria | 7336357 |
| 987 | 2874612363 | 2874604998 | Bacteria | 7834745 |
| 988 | 2874617352 | 2874612657 | Bacteria | 8252029 |
| 989 | 2874631697 | 2874628541 | Bacteria | 8630250 |
| 990 | 2876770372 | 2876761206 | Bacteria | 10111113 |
| 991 | 2879087933 | 2879083081 | Bacteria | 8587928 |
| 992 | 2879116284 | 2879110137 | Bacteria | 8907982 |
| 993 | 2881368241 | 2881364244 | Bacteria | 7710352 |
| 994 | 2885367133 | 2885366525 | Bacteria | 8326213 |
| 995 | 2885383535 | 2885383462 | Bacteria | 9473874 |
| 996 | 2888385028 | 2888378607 | Bacteria | 9652610 |
| 997 | 2889040928 | 2889033259 | Bacteria | 9099371 |
| 998 | 2889309566 | 2889306138 | Bacteria | 6358934 |
| 999 | 2893067798 | 2893066018 | Bacteria | 6158120 |
| 1000 | 2902410493 | 2902405164 | Bacteria | 6784948 |
| 1001 | 2903769419 | 2903768456 | Bacteria | 9749579 |
| 1002 | 2904715208 | 2904711408 | Bacteria | 9771557 |
| 1003 | 2906611714 | |||
| 1004 | 2906631271 | 2906626472 | Bacteria | 8826946 |
| 1005 | 2906646415 | 2906643746 | Bacteria | 8722424 |
| 1006 | 2908780708 | 2908775508 | Bacteria | 8092255 |
| 1007 | 2916004327 | 2916000859 | Bacteria | 6865702 |
| 1008 | 2916047436 | 2916041962 | Bacteria | 6820487 |
| 1009 | 2916076684 | 2916076590 | Bacteria | 6596108 |
| 1010 | 2919074218 | 2919073203 | Bacteria | 6531949 |
| 1011 | 2921208560 | 2921208531 | Bacteria | 6745326 |
| 1012 | 2922397521 | 2922393267 | Bacteria | 8285685 |
| 1013 | 2922427648 | |||
| 1014 | 2924181742 | 2924179722 | Bacteria | 6843264 |
| 1015 | 2924231036 | 2924228884 | Bacteria | 6633132 |
| 1016 | 2928129148 | 2928125067 | Bacteria | 5937560 |
| 1017 | 2929204031 | 2929199973 | Bacteria | 7260745 |
| 1018 | 2957412676 | 2957408893 | Bacteria | 6558585 |
| 1019 | 2960606132 | 2960603979 | Bacteria | 6898737 |
| 1020 | 2960691200 | 2960687367 | Bacteria | 6535474 |
| 1021 | 2967693939 | 2967693043 | Bacteria | 6804451 |
| 1022 | 2970098140 | 2970095765 | Bacteria | 6936963 |
| 1023 | 2970130714 | 2970129317 | Bacteria | 6806560 |
| 1024 | 2970164198 | 2970164137 | Bacteria | 6861252 |
| 1025 | 2970180779 | 2970177841 | Bacteria | 6768001 |
| 1026 | 3005477322 | 3005474847 | Bacteria | 9259049 |
| 1027 | 3005485225 | 3005483717 | Bacteria | 7877331 |
| 1028 | 3005507906 | 3005506211 | Bacteria | 6943378 |
| 1029 | 3005587483 | 3005587118 | Bacteria | 7794411 |
| 1030 | 641645805 | 641522639 | Bacteria | 7737025 |
| 1031 | 8002290610 | 8002285264 | Bacteria | 6717907 |
| 1032 | 8006969966 | 8006964411 | Bacteria | 8966052 |
| 1033 | 8006989556 | 8006984368 | Bacteria | 9651211 |
| 1034 | 8006995182 | 8006994254 | Bacteria | 8309700 |
| 1035 | 8016593621 | 8016583857 | Bacteria | 10421953 |
| 1036 | 8019559808 | 8019555841 | Bacteria | 9642137 |
| 1037 | 8019569914 | 8019565922 | Bacteria | 9639779 |
| 1038 | 8055911439 | 8055909800 | Bacteria | 7278581 |
| 1039 | 8056686898 | 8056681323 | Bacteria | 8472857 |
| 1040 | Ga0075432_10020087 | |||
| 1041 | JGI24737J22298_10032906 | |||
| 1042 | JGI24744J21845_10002032 | |||
| 1043 | JGI24033J26618_1003073 | |||
| 1044 | JGI25153J46596_10000068 | |||
| 1045 | JGI25153J46596_10000094 | |||
| 1046 | JGI25153J46596_10002675 | |||
| 1047 | JGI25160J50197_1000777 | |||
| 1048 | JGI25404J52841_10000108 | |||
| 1049 | Ga0055531_10018269 | |||
| 1050 | Ga0065165_1001845 | |||
| 1051 | Ga0065165_1005504 | |||
| 1052 | Ga0065704_10020805 | |||
| 1053 | Ga0070676_10035764 | |||
| 1054 | Ga0070690_100040155 | |||
| 1055 | Ga0070690_100123144 | |||
| 1056 | Ga0070670_100010874 | |||
| 1057 | Ga0070670_100051718 | |||
| 1058 | Ga0068869_100055588 | |||
| 1059 | Ga0068869_100119789 | |||
| 1060 | Ga0068869_100175633 | |||
| 1061 | Ga0070666_10147580 | |||
| 1062 | Ga0070680_100011909 | |||
| 1063 | Ga0070680_100013678 | |||
| 1064 | Ga0070680_100177071 | |||
| 1065 | Ga0068868_100023511 | |||
| 1066 | Ga0070689_100059991 | |||
| 1067 | Ga0070689_100082543 | |||
| 1068 | Ga0070691_10009631 | |||
| 1069 | Ga0070687_100002478 | |||
| 1070 | Ga0070687_100064871 | |||
| 1071 | Ga0070661_100331832 | |||
| 1072 | Ga0070692_10120819 | |||
| 1073 | Ga0070692_10155862 | |||
| 1074 | Ga0070668_100109997 | |||
| 1075 | Ga0070669_100013682 | |||
| 1076 | Ga0070669_100060444 | |||
| 1077 | Ga0070675_100003565 | |||
| 1078 | Ga0070671_100012862 | |||
| 1079 | Ga0070671_100053207 | |||
| 1080 | Ga0070671_100063572 | |||
| 1081 | Ga0070674_100039243 | |||
| 1082 | Ga0070674_100060525 | |||
| 1083 | Ga0070674_100287504 | |||
| 1084 | Ga0070673_100084789 | |||
| 1085 | Ga0070673_100469065 | |||
| 1086 | Ga0070688_100002030 | |||
| 1087 | Ga0070659_100032166 | |||
| 1088 | Ga0070659_100060819 | |||
| 1089 | Ga0070667_100004500 | |||
| 1090 | Ga0070667_100030529 | |||
| 1091 | Ga0070667_100113122 | |||
| 1092 | Ga0070709_10004866 | |||
| 1093 | Ga0070709_10199039 | |||
| 1094 | Ga0070714_100001309 | |||
| 1095 | Ga0070714_100204624 | |||
| 1096 | Ga0070714_100429654 | |||
| 1097 | Ga0070714_100464283 | |||
| 1098 | Ga0070713_100002404 | |||
| 1099 | Ga0070713_100138447 | |||
| 1100 | Ga0070710_10004275 | |||
| 1101 | Ga0070710_10177003 | |||
| 1102 | Ga0070711_100000362 | |||
| 1103 | Ga0070711_100015017 | |||
| 1104 | Ga0070711_100028066 | |||
| 1105 | Ga0070705_100004675 | |||
| 1106 | Ga0070700_100018434 | |||
| 1107 | Ga0070700_100115285 | |||
| 1108 | Ga0070700_100215770 | |||
| 1109 | Ga0070694_100002889 | |||
| 1110 | Ga0070694_100138247 | |||
| 1111 | Ga0070708_100008473 | |||
| 1112 | Ga0070708_100062084 | |||
| 1113 | Ga0070663_100007257 | |||
| 1114 | Ga0070663_100021917 | |||
| 1115 | Ga0070663_100029127 | |||
| 1116 | Ga0070663_100031511 | |||
| 1117 | Ga0070678_100042423 | |||
| 1118 | Ga0070678_100071874 | |||
| 1119 | Ga0070678_100195659 | |||
| 1120 | Ga0070662_100081318 | |||
| 1121 | Ga0070662_100174128 | |||
| 1122 | Ga0070662_100175436 | |||
| 1123 | Ga0070681_10020166 | |||
| 1124 | Ga0070681_10066987 | |||
| 1125 | Ga0070681_10152622 | |||
| 1126 | Ga0068867_100033474 | |||
| 1127 | Ga0068867_100045107 | |||
| 1128 | Ga0070685_10029846 | |||
| 1129 | Ga0070685_10076575 | |||
| 1130 | Ga0070699_100000545 | |||
| 1131 | Ga0070699_100035875 | |||
| 1132 | Ga0070699_100116591 | |||
| 1133 | Ga0070679_100113019 | |||
| 1134 | Ga0070697_100015043 | |||
| 1135 | Ga0068853_100031522 | |||
| 1136 | Ga0068853_100056742 | |||
| 1137 | Ga0068853_100444590 | |||
| 1138 | Ga0070672_100004369 | |||
| 1139 | Ga0070686_100005070 | |||
| 1140 | Ga0070686_100366433 | |||
| 1141 | Ga0070695_100004516 | |||
| 1142 | Ga0070695_100007706 | |||
| 1143 | Ga0070695_100191255 | |||
| 1144 | Ga0070696_100000249 | |||
| 1145 | Ga0070696_100012128 | |||
| 1146 | Ga0070696_100057255 | |||
| 1147 | Ga0070696_100183914 | |||
| 1148 | Ga0070693_100008195 | |||
| 1149 | Ga0070693_100124044 | |||
| 1150 | Ga0070665_100115402 | |||
| 1151 | Ga0070665_100165949 | |||
| 1152 | Ga0070704_100029961 | |||
| 1153 | Ga0070704_100048479 | |||
| 1154 | Ga0070704_100174802 | |||
| 1155 | Ga0068855_100025399 | |||
| 1156 | Ga0068855_100060100 | |||
| 1157 | Ga0068855_100123173 | |||
| 1158 | Ga0070664_100043666 | |||
| 1159 | Ga0068857_100014404 | |||
| 1160 | Ga0068854_100079306 | |||
| 1161 | Ga0068856_100108101 | |||
| 1162 | Ga0068856_100166670 | |||
| 1163 | Ga0068856_100252217 | |||
| 1164 | Ga0070702_100005145 | |||
| 1165 | Ga0070702_100267274 | |||
| 1166 | Ga0068859_100016683 | |||
| 1167 | Ga0068859_100039940 | |||
| 1168 | Ga0068859_100284152 | |||
| 1169 | Ga0068864_100045321 | |||
| 1170 | Ga0068864_100168521 | |||
| 1171 | Ga0068864_100575089 | |||
| 1172 | Ga0068866_10001554 | |||
| 1173 | Ga0068866_10005088 | |||
| 1174 | Ga0068861_100011419 | |||
| 1175 | Ga0068870_10064265 | |||
| 1176 | Ga0068863_100082082 | |||
| 1177 | Ga0068863_100567432 | |||
| 1178 | Ga0068858_100005194 | |||
| 1179 | Ga0068858_100025390 | |||
| 1180 | Ga0068860_100016382 | |||
| 1181 | Ga0068860_100049518 | |||
| 1182 | Ga0068860_100369935 | |||
| 1183 | Ga0068862_100005647 | |||
| 1184 | Ga0081455_10000029 | |||
| 1185 | Ga0081455_10003782 | |||
| 1186 | Ga0081455_10005788 | |||
| 1187 | Ga0081455_10031199 | |||
| 1188 | Ga0081455_10052904 | |||
| 1189 | Ga0081455_10057782 | |||
| 1190 | Ga0081538_10006418 | |||
| 1191 | Ga0081538_10017150 | |||
| 1192 | Ga0081538_10020850 | |||
| 1193 | Ga0081540_1000048 | |||
| 1194 | Ga0081540_1000937 | |||
| 1195 | Ga0081540_1001679 | |||
| 1196 | Ga0081540_1005784 | |||
| 1197 | Ga0081540_1008639 | |||
| 1198 | Ga0081540_1015468 | |||
| 1199 | Ga0081540_1020642 | |||
| 1200 | Ga0081540_1058933 | |||
| 1201 | Ga0081539_10004692 | |||
| 1202 | Ga0070717_10002967 | |||
| 1203 | Ga0070717_10074371 | |||
| 1204 | Ga0075365_10003935 | |||
| 1205 | Ga0075365_10021126 | |||
| 1206 | Ga0075365_10039788 | |||
| 1207 | Ga0075368_10000671 | |||
| 1208 | Ga0075368_10007055 | |||
| 1209 | Ga0075368_10072004 | |||
| 1210 | Ga0075363_100000761 | |||
| 1211 | Ga0075363_100013498 | |||
| 1212 | Ga0075363_100153852 | |||
| 1213 | Ga0075364_10009955 | |||
| 1214 | Ga0075364_10013926 | |||
| 1215 | Ga0075364_10094586 | |||
| 1216 | Ga0070715_10011015 | |||
| 1217 | Ga0070715_10059722 | |||
| 1218 | Ga0070715_10076423 | |||
| 1219 | Ga0070716_100011005 | |||
| 1220 | Ga0070716_100013289 | |||
| 1221 | Ga0070716_100018949 | |||
| 1222 | Ga0070712_100057934 | |||
| 1223 | Ga0070712_100064170 | |||
| 1224 | Ga0070712_100140922 | |||
| 1225 | Ga0075367_10002090 | |||
| 1226 | Ga0075367_10035633 | |||
| 1227 | Ga0075369_10000436 | |||
| 1228 | Ga0075369_10008913 | |||
| 1229 | Ga0075369_10012833 | |||
| 1230 | Ga0075369_10079228 | |||
| 1231 | Ga0075366_10022499 | |||
| 1232 | Ga0075366_10078135 | |||
| 1233 | Ga0097621_100145673 | |||
| 1234 | Ga0075370_10041668 | |||
| 1235 | Ga0075428_100024125 | |||
| 1236 | Ga0075428_100053458 | |||
| 1237 | Ga0075428_100058333 | |||
| 1238 | Ga0075428_100069932 | |||
| 1239 | Ga0075428_100096916 | |||
| 1240 | Ga0075428_100100255 | |||
| 1241 | Ga0075428_100117413 | |||
| 1242 | Ga0075428_100194866 | |||
| 1243 | Ga0075428_100200691 | |||
| 1244 | Ga0075428_100204869 | |||
| 1245 | Ga0075430_100007063 | |||
| 1246 | Ga0075430_100012474 | |||
| 1247 | Ga0075430_100014692 | |||
| 1248 | Ga0075430_100115306 | |||
| 1249 | Ga0075431_100001007 | |||
| 1250 | Ga0075431_100002204 | |||
| 1251 | Ga0075431_100004487 | |||
| 1252 | Ga0075431_100020866 | |||
| 1253 | Ga0075431_100026130 | |||
| 1254 | Ga0075431_100055261 | |||
| 1255 | Ga0075431_100206039 | |||
| 1256 | Ga0075431_100258715 | |||
| 1257 | Ga0075433_10000125 | |||
| 1258 | Ga0075433_10075221 | |||
| 1259 | Ga0075434_100008387 | |||
| 1260 | Ga0075434_100377658 | |||
| 1261 | Ga0075429_100000183 | |||
| 1262 | Ga0075429_100020360 | |||
| 1263 | Ga0075429_100050064 | |||
| 1264 | Ga0068865_100067979 | |||
| 1265 | Ga0097620_100016683 | |||
| 1266 | Ga0097620_100039940 | |||
| 1267 | Ga0097620_100284153 | |||
| 1268 | Ga0099825_1033101 | |||
| 1269 | Ga0079104_1000772 | |||
| 1270 | Ga0075435_100006471 | |||
| 1271 | Ga0075435_100175503 | |||
| 1272 | Ga0105240_10021211 | |||
| 1273 | Ga0111539_10003120 | |||
| 1274 | Ga0111539_10010381 | |||
| 1275 | Ga0111539_10035947 | |||
| 1276 | Ga0111539_10168777 | |||
| 1277 | Ga0105245_10003785 | |||
| 1278 | Ga0105245_10039830 | |||
| 1279 | Ga0105245_10080471 | |||
| 1280 | Ga0105247_10006629 | |||
| 1281 | Ga0105247_10034192 | |||
| 1282 | Ga0105247_10077134 | |||
| 1283 | Ga0114129_10005398 | |||
| 1284 | Ga0114129_10021657 | |||
| 1285 | Ga0114129_10221736 | |||
| 1286 | Ga0114129_10409322 | |||
| 1287 | Ga0105243_10027268 | |||
| 1288 | Ga0105243_10115385 | |||
| 1289 | Ga0105243_10138101 | |||
| 1290 | Ga0105241_10029956 | |||
| 1291 | Ga0105241_10127258 | |||
| 1292 | Ga0105242_10104545 | |||
| 1293 | Ga0105248_10014926 | |||
| 1294 | Ga0105248_10043198 | |||
| 1295 | Ga0105248_10260904 | |||
| 1296 | Ga0105237_10046888 | |||
| 1297 | Ga0105237_10244619 | |||
| 1298 | Ga0105238_10072474 | |||
| 1299 | Ga0105238_10183534 | |||
| 1300 | Ga0105238_10201674 | |||
| 1301 | Ga0105249_10107666 | |||
| 1302 | Ga0105249_10108754 | |||
| 1303 | Ga0105249_10256209 | |||
| 1304 | Ga0105239_10128432 | |||
| 1305 | Ga0105239_10147389 | |||
| 1306 | Ga0105239_10155237 | |||
| 1307 | Ga0105239_10209072 | |||
| 1308 | Ga0105246_10006437 | |||
| 1309 | Ga0105246_10008875 | |||
| 1310 | Ga0105246_10063443 | |||
| 1311 | Ga0105246_10079580 | |||
| 1312 | Ga0157373_10022116 | |||
| 1313 | Ga0157371_10285144 | |||
| 1314 | Ga0157370_10034208 | |||
| 1315 | Ga0157370_10090185 | |||
| 1316 | Ga0157370_10090695 | |||
| 1317 | Ga0157369_10259333 | |||
| 1318 | Ga0157374_10051941 | |||
| 1319 | Ga0157374_10262320 | |||
| 1320 | Ga0157378_10136986 | |||
| 1321 | Ga0163162_10103627 | |||
| 1322 | Ga0163162_10142417 | |||
| 1323 | Ga0163162_10541075 | |||
| 1324 | Ga0157375_10009111 | |||
| 1325 | Ga0163163_10003696 | |||
| 1326 | Ga0163163_10008749 | |||
| 1327 | Ga0163163_10093806 | |||
| 1328 | Ga0163163_10294721 | |||
| 1329 | Ga0163163_10312257 | |||
| 1330 | Ga0157380_10098758 | |||
| 1331 | Ga0182008_10053802 | |||
| 1332 | Ga0157377_10226984 | |||
| 1333 | Ga0157379_10019887 | |||
| 1334 | Ga0157379_10039826 | |||
| 1335 | Ga0157379_10046373 | |||
| 1336 | Ga0157379_10150442 | |||
| 1337 | Ga0157376_10003716 | |||
| 1338 | Ga0157376_10196217 | |||
| 1339 | Ga0157376_10226284 | |||
| 1340 | Ga0214544_1000004 | |||
| 1341 | Ga0214542_1000001 | |||
| 1342 | Ga0214542_1027275 | |||
| 1343 | Ga0214545_1000001 | |||
| 1344 | Ga0214545_1028004 | |||
| 1345 | Ga0214543_1000006 | |||
| 1346 | Ga0214543_1029823 | |||
| 1347 | Ga0213876_10000816 | |||
| 1348 | Ga0213876_10000944 | |||
| 1349 | Ga0213876_10024495 | |||
| 1350 | Ga0213875_10000007 | |||
| 1351 | Ga0209233_1007993 | |||
| 1352 | Ga0209025_1066051 | |||
| 1353 | Ga0209564_1001626 | |||
| 1354 | Ga0209564_1008466 | |||
| 1355 | Ga0209758_1000024 | |||
| 1356 | Ga0209758_1000097 | |||
| 1357 | Ga0209758_1002191 | |||
| 1358 | Ga0209256_1001501 | |||
| 1359 | Ga0207426_1000439 | |||
| 1360 | Ga0209257_1000588 | |||
| 1361 | Ga0209257_1018568 | |||
| 1362 | Ga0207682_10001905 | |||
| 1363 | Ga0207692_10010733 | |||
| 1364 | Ga0207642_10104134 | |||
| 1365 | Ga0207710_10011889 | |||
| 1366 | Ga0207688_10001053 | |||
| 1367 | Ga0207688_10019972 | |||
| 1368 | Ga0207680_10236359 | |||
| 1369 | Ga0207647_10011848 | |||
| 1370 | Ga0207647_10022689 | |||
| 1371 | Ga0207647_10030106 | |||
| 1372 | Ga0207647_10038482 | |||
| 1373 | Ga0207685_10025753 | |||
| 1374 | Ga0207699_10010277 | |||
| 1375 | Ga0207645_10008189 | |||
| 1376 | Ga0207645_10010590 | |||
| 1377 | Ga0207645_10127742 | |||
| 1378 | Ga0207643_10003366 | |||
| 1379 | Ga0207643_10020063 | |||
| 1380 | Ga0207684_10108773 | |||
| 1381 | Ga0207654_10252886 | |||
| 1382 | Ga0207707_10018781 | |||
| 1383 | Ga0207707_10072454 | |||
| 1384 | Ga0207693_10001150 | |||
| 1385 | Ga0207693_10016959 | |||
| 1386 | Ga0207693_10024155 | |||
| 1387 | Ga0207693_10027969 | |||
| 1388 | Ga0207693_10129223 | |||
| 1389 | Ga0207693_10195953 | |||
| 1390 | Ga0207663_10002241 | |||
| 1391 | Ga0207660_10008445 | |||
| 1392 | Ga0207660_10068232 | |||
| 1393 | Ga0207662_10002137 | |||
| 1394 | Ga0207662_10072254 | |||
| 1395 | Ga0207657_10013624 | |||
| 1396 | Ga0207649_10067228 | |||
| 1397 | Ga0207652_10125048 | |||
| 1398 | Ga0207646_10039558 | |||
| 1399 | Ga0207681_10170299 | |||
| 1400 | Ga0207694_10047081 | |||
| 1401 | Ga0207694_10156488 | |||
| 1402 | Ga0207650_10039381 | |||
| 1403 | Ga0207650_10148324 | |||
| 1404 | Ga0207650_10150214 | |||
| 1405 | Ga0207659_10194068 | |||
| 1406 | Ga0207687_10001252 | |||
| 1407 | Ga0207687_10013163 | |||
| 1408 | Ga0207687_10021234 | |||
| 1409 | Ga0207700_10022348 | |||
| 1410 | Ga0207700_10217672 | |||
| 1411 | Ga0207664_10036615 | |||
| 1412 | Ga0207664_10121412 | |||
| 1413 | Ga0207664_10244199 | |||
| 1414 | Ga0207644_10040575 | |||
| 1415 | Ga0207706_10030478 | |||
| 1416 | Ga0207706_10126822 | |||
| 1417 | Ga0207706_10142460 | |||
| 1418 | Ga0207686_10009550 | |||
| 1419 | Ga0207709_10033632 | |||
| 1420 | Ga0207709_10039461 | |||
| 1421 | Ga0207670_10003594 | |||
| 1422 | Ga0207670_10091129 | |||
| 1423 | Ga0207670_10290929 | |||
| 1424 | Ga0207669_10026195 | |||
| 1425 | Ga0207669_10032407 | |||
| 1426 | Ga0207704_10068433 | |||
| 1427 | Ga0207665_10000775 | |||
| 1428 | Ga0207665_10002581 | |||
| 1429 | Ga0207665_10024249 | |||
| 1430 | Ga0207691_10022886 | |||
| 1431 | Ga0207691_10024151 | |||
| 1432 | Ga0207691_10163394 | |||
| 1433 | Ga0207689_10002991 | |||
| 1434 | Ga0207689_10009502 | |||
| 1435 | Ga0207689_10304709 | |||
| 1436 | Ga0207679_10061777 | |||
| 1437 | Ga0207679_10211038 | |||
| 1438 | Ga0207651_10157413 | |||
| 1439 | Ga0207712_10004686 | |||
| 1440 | Ga0207668_10237249 | |||
| 1441 | Ga0207640_10027914 | |||
| 1442 | Ga0207658_10010199 | |||
| 1443 | Ga0207677_10004452 | |||
| 1444 | Ga0207677_10105099 | |||
| 1445 | Ga0207703_10007538 | |||
| 1446 | Ga0207703_10007965 | |||
| 1447 | Ga0207703_10084126 | |||
| 1448 | Ga0207639_10096489 | |||
| 1449 | Ga0207639_10299097 | |||
| 1450 | Ga0207678_10002455 | |||
| 1451 | Ga0207678_10016550 | |||
| 1452 | Ga0207678_10031893 | |||
| 1453 | Ga0207678_10057223 | |||
| 1454 | Ga0207678_10081798 | |||
| 1455 | Ga0207708_10002956 | |||
| 1456 | Ga0207708_10040488 | |||
| 1457 | Ga0207708_10095183 | |||
| 1458 | Ga0207708_10128499 | |||
| 1459 | Ga0207708_10131512 | |||
| 1460 | Ga0207702_10140357 | |||
| 1461 | Ga0207702_10260362 | |||
| 1462 | Ga0207702_10375880 | |||
| 1463 | Ga0207702_10504217 | |||
| 1464 | Ga0207641_10010922 | |||
| 1465 | Ga0207641_10111317 | |||
| 1466 | Ga0207648_10003243 | |||
| 1467 | Ga0207648_10004365 | |||
| 1468 | Ga0207648_10009198 | |||
| 1469 | Ga0207648_10391202 | |||
| 1470 | Ga0207676_10002494 | |||
| 1471 | Ga0207676_10015497 | |||
| 1472 | Ga0207674_10017744 | |||
| 1473 | Ga0207674_10026785 | |||
| 1474 | Ga0207674_10111536 | |||
| 1475 | Ga0207674_10153745 | |||
| 1476 | Ga0207675_100005260 | |||
| 1477 | Ga0207675_100061604 | |||
| 1478 | Ga0207675_100072011 | |||
| 1479 | Ga0207675_100126982 | |||
| 1480 | Ga0207675_100379843 | |||
| 1481 | Ga0207683_10048849 | |||
| 1482 | Ga0207683_10260409 | |||
| 1483 | Ga0207698_10298476 | |||
| 1484 | Ga0209281_1000839 | |||
| 1485 | Ga0209389_1000199 | |||
| 1486 | Ga0209969_1001317 | |||
| 1487 | Ga0209489_102148 | |||
| 1488 | Ga0209700_100005 | |||
| 1489 | Ga0209967_1002257 | |||
| 1490 | Ga0210000_1003297 | |||
| 1491 | Ga0209813_10000408 | |||
| 1492 | Ga0209974_10020453 | |||
| 1493 | Ga0207428_10040114 | |||
| 1494 | Ga0268266_10022350 | |||
| 1495 | Ga0268266_10024247 | |||
| 1496 | Ga0268266_10040575 | |||
| 1497 | Ga0268265_10001732 | |||
| 1498 | Ga0268265_10119178 | |||
| 1499 | Ga0268264_10100948 | |||
| 1500 | Ga0307511_10000014 | |||
| 1501 | Ga0265316_10190919 | |||
| 1502 | Ga0307408_100053003 | |||
| 1503 | Ga0265314_10004888 | |||
| 1504 | Ga0316578_10020840 | |||
| 1505 | Ga0307405_10074589 | |||
| 1506 | Ga0307409_100107720 | |||
| 1507 | Ga0307409_100439824 | |||
| 1508 | Ga0307416_100478923 | |||
| 1509 | Ga0307415_100027417 | |||
| 1510 | Ga0307415_100159664 | |||
| 1511 | Ga0307510_10045817 | |||
| 1512 | Ga0307510_10047901 | |||
| 1513 | Ga0373934_0003068 | |||
| 1514 | Ga0373944_0005124 | |||
| 1515 | Ga0373949_0004068 | |||
| 1516 | Ga0373936_0045182 | |||
| 1517 | Ga0373945_0011192 | |||
| 1518 | Ga0373954_0004828 | |||
| 1519 | Ga0373956_0009898 | |||
| 1520 | Ga0373960_0009259 | |||
| 1521 | Ga0373943_0004642 | |||
| 1522 | Ga0373946_0016859 | |||
| 1523 | Ga0373946_0044250 | |||
| 1524 | Ga0373961_0004701 | |||
| 1525 | Ga0373961_0020627 | |||
| 1526 | Ga0316574_0003660 | |||
| 1527 | Ga0373931_0000199 | |||
| 1528 | Ga0373931_0001050 | |||
| 1529 | Ga0373935_0158844 | |||
| 1530 | Ga0373927_0105012 | |||
| 1531 | Ga0373927_0162364 | |||
| 1532 | Ga0373927_0179206 | |||
| 1533 | Ga0373933_0001341 | |||
| 1534 | Ga0373937_0178249 | |||
| 1535 | Ga0316584_0010529 | |||
| 1536 | Ga0373925_0048671 | |||
| 1537 | Ga0395900_0264308 | |||
| 1538 | Ga0395898_0162622 | |||
| 1539 | Ga0395905_0069896 | |||
| 1540 | Ga0436364_0207394 | |||
| 1541 | Ga0436364_0286306 | |||
| 1542 | Ga0436364_0430154 | |||
| 1543 | Ga0436364_0434654 | |||
| 1544 | Ga0395901_0385679 | |||
| 1545 | Ga0436365_0159339 | |||
| 1546 | Ga0436365_0413923 | |||
| 1547 | Ga0436365_0736793 | |||
| 1548 | Ga0436365_0940551 | |||
| 1549 | Ga0436365_1187256 | |||
| 1550 | Ga0436365_1368008 | |||
| 1551 | Ga0436360_0504894 | |||
| 1552 | Ga0436360_1076044 | |||
| 1553 | Ga0436361_0905452 | |||
| 1554 | Ga0436363_0287186 | |||
| 1555 | Ga0436363_0313348 | |||
| 1556 | Ga0436363_0703923 | |||
| 1557 | Ga0436363_1475436 | |||
| 1558 | Ga0436362_0274206 | |||
| 1559 | Ga0450911_000064 | |||
| 1560 | Ga0466966_0041438 | |||
| 1561 | Ga0466963_0194984 | |||
| 1562 | Ga0466968_0009238 | |||
| 1563 | Ga0466970_0183530 | |||
| 1564 | Ga0466957_0036272 | |||
| 1565 | Ga0466957_0049790 | |||
| 1566 | Ga0466959_0018887 | |||
| 1567 | Ga0451576_0190182 | |||
| 1568 | Ga0495603_0000815 | |||
| 1569 | Ga0495603_0014909 | |||
| 1570 | Ga0495603_0055846 | |||
| 1571 | Ga0495638_0002133 | |||
| 1572 | Ga0495638_0079907 | |||
| 1573 | Ga0495651_0130767 | |||
| 1574 | Ga0495605_0061752 | |||
| 1575 | Ga0495585_0101648 | |||
| 1576 | Ga0495594_0125454 | |||
| 1577 | Ga0495596_0054852 | |||
| 1578 | Ga0495610_0075765 | |||
| 1579 | Ga0495616_0118733 | |||
| 1580 | Ga0495618_0166601 | |||
| 1581 | Ga0495628_0003683 | |||
| 1582 | Ga0495630_0051524 | |||
| 1583 | Ga0495632_0037042 | |||
| 1584 | Ga0495632_0098174 | |||
| 1585 | Ga0495637_0026576 | |||
| 1586 | Ga0495643_0047109 | |||
| 1587 | Ga0495648_0034559 | |||
| 1588 | Ga0495648_0111791 | |||
| 1589 | Ga0495652_0011271 | |||
| 1590 | Ga0495652_0115861 | |||
| 1591 | Ga0495654_0078628 | |||
| 1592 | Ga0495640_0022824 | |||
| 1593 | Ga0495587_0091556 | |||
| 1594 | Ga0495621_0056061 | |||
| 1595 | Ga0495597_0000256 | |||
| 1596 | Ga0495645_0001496 | |||
| 1597 | Ga0495645_0056473 | |||
| 1598 | Ga0495622_0003864 | |||
| 1599 | Ga0495622_0055459 | |||
| 1600 | Ga0495667_0018521 | |||
| 1601 | Ga0495656_0008757 | |||
| 1602 | Ga0495656_0021968 | |||
| 1603 | Ga0495668_0037199 | |||
| 1604 | Ga0495611_0029563 | |||
| 1605 | Ga0495625_0040647 | |||
| 1606 | Ga0495635_0054834 | |||
| 1607 | Ga0495661_0079214 | |||
| 1608 | Ga0495588_0049897 | |||
| 1609 | Ga0495623_0004849 | |||
| 1610 | Ga0495623_0053390 | |||
| 1611 | Ga0495646_0038638 | |||
| 1612 | Ga0495647_0009849 | |||
| 1613 | Ga0495658_0033412 | |||
| 1614 | Ga0495658_0045587 | |||
| 1615 | Ga0495624_0046293 | |||
| 1616 | Ga0495671_0052863 | |||
| 1617 | Ga0495649_0064668 | |||
| 1618 | Ga0495600_0083000 | |||
| 1619 | Ga0495581_0036050 | |||
| 1620 | Ga0495581_0052066 | |||
| 1621 | Ga0495604_0018955 | |||
| 1622 | Ga0495604_0030809 | |||
| 1623 | Ga0495674_0014695 | |||
| 1624 | Ga0495672_0046617 | |||
| 1625 | Ga0495672_0097344 | |||
| 1626 | Ga0495680_0086176 | |||
| 1627 | Ga0495675_0003891 | |||
| 1628 | Ga0495675_0009097 | |||
| 1629 | Ga0495684_0008620 | |||
| 1630 | Ga0495686_0036654 | |||
| 1631 | Ga0495593_0105613 | |||
| 1632 | Ga0495602_0012370 | |||
| 1633 | Ga0495602_0119735 | |||
| 1634 | Ga0495602_0162233 | |||
| 1635 | Ga0495626_0033986 | |||
| 1636 | Ga0495626_0083870 | |||
| 1637 | Ga0496100_0022978 | |||
| 1638 | Ga0496101_0011389 | |||
| 1639 | Ga0496101_0111578 | |||
| 1640 | Ga0496101_0230071 | |||
| 1641 | Ga0496102_0004325 | |||
| 1642 | Ga0496102_0009419 | |||
| 1643 | Ga0496102_0036387 | |||
| 1644 | Ga0496103_0006135 | |||
| 1645 | Ga0496103_0007472 | |||
| 1646 | Ga0496103_0206902 | |||
| 1647 | Ga0496104_0000064 | |||
| 1648 | Ga0496104_0013698 | |||
| 1649 | Ga0496104_0032361 | |||
| 1650 | Ga0496104_0038719 | |||
| 1651 | Ga0496104_0097120 | |||
| 1652 | Ga0496104_0114237 | |||
| 1653 | Ga0496104_0127665 | |||
| 1654 | Ga0496104_0157650 | |||
| 1655 | Ga0496104_0477792 | |||
| 1656 | Ga0496104_0520479 | |||
| 1657 | Ga0496105_0004178 | |||
| 1658 | Ga0496105_0004868 | |||
| 1659 | Ga0496105_0007989 | |||
| 1660 | Ga0496105_0033160 | |||
| 1661 | Ga0496105_0047746 | |||
| 1662 | Ga0496105_0153677 | |||
| 1663 | Ga0496106_0009196 | |||
| 1664 | Ga0496106_0063359 | |||
| 1665 | Ga0496106_0130191 | |||
| 1666 | Ga0496106_0343276 | |||
| 1667 | Ga0496107_0003386 | |||
| 1668 | Ga0496107_0015375 | |||
| 1669 | Ga0496107_0089587 | |||
| 1670 | Ga0496108_0000378 | |||
| 1671 | Ga0496108_0001892 | |||
| 1672 | Ga0496108_0015446 | |||
| 1673 | Ga0496108_0023560 | |||
| 1674 | Ga0496108_0051787 | |||
| 1675 | Ga0496108_0139622 | |||
| 1676 | Ga0496108_0164187 | |||
| 1677 | Ga0496108_0378468 | |||
| 1678 | Ga0496109_0000386 | |||
| 1679 | Ga0496109_0002039 | |||
| 1680 | Ga0496109_0015519 | |||
| 1681 | Ga0496109_0022636 | |||
| 1682 | Ga0496109_0075201 | |||
| 1683 | Ga0496109_0075800 | |||
| 1684 | Ga0496109_0139178 | |||
| 1685 | Ga0496109_0187075 | |||
| 1686 | Ga0496109_0369859 | |||
| 1687 | Ga0496109_0381374 | |||
| 1688 | Ga0496110_0001431 | |||
| 1689 | Ga0496110_0050899 | |||
| 1690 | Ga0496110_0075637 | |||
| 1691 | Ga0496110_0218178 | |||
| 1692 | Ga0496110_0224258 | |||
| 1693 | Ga0496110_0244007 | |||
| 1694 | Ga0496110_0340113 | |||
| 1695 | Ga0496110_0387683 | |||
| 1696 | Ga0496111_0000314 | |||
| 1697 | Ga0496111_0000958 | |||
| 1698 | Ga0496111_0010973 | |||
| 1699 | Ga0496111_0012151 | |||
| 1700 | Ga0496111_0052500 | |||
| 1701 | Ga0496111_0103750 | |||
| 1702 | Ga0496112_0000681 | |||
| 1703 | Ga0496112_0003469 | |||
| 1704 | Ga0496112_0052980 | |||
| 1705 | Ga0496112_0106907 | |||
| 1706 | Ga0496112_0130104 | |||
| 1707 | Ga0496112_0184408 | |||
| 1708 | Ga0496112_0259193 | |||
| 1709 | Ga0496112_0363335 | |||
| 1710 | Ga0496112_0655450 | |||
| 1711 | Ga0496113_0000206 | |||
| 1712 | Ga0496113_0000597 | |||
| 1713 | Ga0496113_0001350 | |||
| 1714 | Ga0496113_0013882 | |||
| 1715 | Ga0496113_0057399 | |||
| 1716 | Ga0496113_0070809 | |||
| 1717 | Ga0496114_0007174 | |||
| 1718 | Ga0496114_0067641 | |||
| 1719 | Ga0496114_0091345 | |||
| 1720 | Ga0496115_0014496 | |||
| 1721 | Ga0496115_0040846 | |||
| 1722 | Ga0496115_0136183 | |||
| 1723 | Ga0496115_0187546 | |||
| 1724 | Ga0496115_0189016 | |||
| 1725 | Ga0496116_0001099 | |||
| 1726 | Ga0496117_0041849 | |||
| 1727 | Ga0496117_0159468 | |||
| 1728 | Ga0496118_0023726 | |||
| 1729 | Ga0496118_0036135 | |||
| 1730 | Ga0496118_0043619 | |||
| 1731 | Ga0496118_0068161 | |||
| 1732 | Ga0496119_0049689 | |||
| 1733 | Ga0496119_0056562 | |||
| 1734 | Ga0496120_0026457 | |||
| 1735 | Ga0496121_0000385 | |||
| 1736 | Ga0496121_0004958 | |||
| 1737 | Ga0496121_0017055 | |||
| 1738 | Ga0496121_0017489 | |||
| 1739 | Ga0496121_0017759 | |||
| 1740 | Ga0496121_0019762 | |||
| 1741 | Ga0496121_0072659 | |||
| 1742 | Ga0496121_0114106 | |||
| 1743 | Ga0496122_0000528 | |||
| 1744 | Ga0496122_0030398 | |||
| 1745 | Ga0496123_0001698 | |||
| 1746 | Ga0496124_0000004 | |||
| 1747 | Ga0496124_0061900 | |||
| 1748 | Ga0496124_0130813 | |||
| 1749 | Ga0496125_0003427 | |||
| 1750 | Ga0496125_0006164 | |||
| 1751 | Ga0496125_0013040 | |||
| 1752 | Ga0496125_0029663 | |||
| 1753 | Ga0496125_0034775 | |||
| 1754 | Ga0496125_0070568 | |||
| 1755 | Ga0496126_0001329 | |||
| 1756 | Ga0496126_0007328 | |||
| 1757 | Ga0496126_0015687 | |||
| 1758 | Ga0496126_0022525 | |||
| 1759 | Ga0496126_0038938 | |||
| 1760 | Ga0496126_0083503 | |||
| 1761 | Ga0496126_0115348 | |||
| 1762 | Ga0496126_0123529 | |||
| 1763 | Ga0496126_0364539 | |||
| 1764 | Ga0501032_0047451 | |||
| 1765 | Ga0501033_0017045 | |||
| 1766 | Ga0501033_0056081 | |||
| 1767 | Ga0501033_0161827 | |||
| 1768 | Ga0501034_0024944 | |||
| 1769 | Ga0501034_0026362 | |||
| 1770 | Ga0501036_0019499 | |||
| 1771 | Ga0501036_0165046 | |||
| 1772 | Ga0501036_0394224 | |||
| 1773 | Ga0501038_0106917 | |||
| 1774 | Ga0501038_0204666 | |||
| 1775 | Ga0501039_0031975 | |||
| 1776 | Ga0501039_0411612 | |||
| 1777 | Ga0501040_0038136 | |||
| 1778 | Ga0501040_0149255 | |||
| 1779 | Ga0501041_0020793 | |||
| 1780 | Ga0501041_0038497 | |||
| 1781 | Ga0501041_0050299 | |||
| 1782 | Ga0501042_0029949 | |||
| 1783 | Ga0501042_0050955 | |||
| 1784 | Ga0501042_0146443 | |||
| 1785 | Ga0501043_0055748 | |||
| 1786 | Ga0501043_0164793 | |||
| 1787 | Ga0501046_0006011 | |||
| 1788 | Ga0501046_0063080 | |||
| 1789 | Ga0501046_0119377 | |||
| 1790 | Ga0501046_0225932 | |||
| 1791 | Ga0501047_0009379 | |||
| 1792 | Ga0501048_0178384 | |||
| 1793 | Ga0501070_0035967 | |||
| 1794 | Ga0501070_0061978 | |||
| 1795 | Ga0501070_0085226 | |||
| 1796 | Ga0501070_0140089 | |||
| 1797 | Ga0501071_0014840 | |||
| 1798 | Ga0501071_0072383 | |||
| 1799 | Ga0501071_0249090 | |||
| 1800 | Ga0501072_0004729 | |||
| 1801 | Ga0501072_0008188 | |||
| 1802 | Ga0501072_0019484 | |||
| 1803 | Ga0501072_0069334 | |||
| 1804 | Ga0501074_0072720 | |||
| 1805 | Ga0501074_0161020 | |||
| 1806 | Ga0501075_0003767 | |||
| 1807 | Ga0501075_0035408 | |||
| 1808 | Ga0501075_0175249 | |||
| 1809 | Ga0501076_0002632 | |||
| 1810 | Ga0501076_0088720 | |||
| 1811 | Ga0501076_0270348 | |||
| 1812 | Ga0501079_0011381 | |||
| 1813 | Ga0501079_0012771 | |||
| 1814 | Ga0501079_0019453 | |||
| 1815 | Ga0501079_0063679 | |||
| 1816 | Ga0501080_0007756 | |||
| 1817 | Ga0501080_0256665 | |||
| 1818 | Ga0501081_0044648 | |||
| 1819 | Ga0501081_0175615 | |||
| 1820 | Ga0501081_0301681 | |||
| 1821 | Ga0501083_0039745 | |||
| 1822 | Ga0501083_0195204 | |||
| 1823 | Ga0501083_0210194 | |||
| 1824 | Ga0501035_0016279 | |||
| 1825 | Ga0501035_0033610 | |||
| 1826 | Ga0501044_0087986 | |||
| 1827 | Ga0501044_0266397 | |||
| 1828 | Ga0501044_0361345 | |||
| 1829 | Ga0501045_0000328 | |||
| 1830 | Ga0501045_0078869 | |||
| 1831 | Ga0501045_0187412 | |||
| 1832 | Ga0501045_0205484 | |||
| 1833 | nmdc:mga03683_5781_c1 | |||
| 1834 | nmdc:mga03n38_181532_c1 | |||
| 1835 | nmdc:mga03n38_21055_c1 | |||
| 1836 | nmdc:mga03n38_4978_c1 | |||
| 1837 | nmdc:mga00v17_11124_c1 | |||
| 1838 | nmdc:mga00v17_116283_c1 | |||
| 1839 | nmdc:mga00v17_117840_c1 | |||
| 1840 | nmdc:mga0yw44_11160_c1 | |||
| 1841 | nmdc:mga0yw44_20547_c1 | |||
| 1842 | nmdc:mga0yw44_5724_c1 | |||
| 1843 | nmdc:mga0yw44_64731_c1 | |||
| 1844 | nmdc:mga0k408_96679_c1 | |||
| 1845 | nmdc:mga06z11_3902_c1 | |||
| 1846 | nmdc:mga06z11_7243_c1 | |||
| 1847 | nmdc:mga06z11_85195_c1 | |||
| 1848 | nmdc:mga04h51_1285_c1 | |||
| 1849 | nmdc:mga04h51_16333_c1 | |||
| 1850 | nmdc:mga07m45_69736_c1 | |||
| 1851 | nmdc:mga05p37_156332_c1 | |||
| 1852 | nmdc:mga05p37_186566_c1 | |||
| 1853 | nmdc:mga05p37_222666_c1 | |||
| 1854 | nmdc:mga05p37_278145_c1 | |||
| 1855 | nmdc:mga05p37_416_c1 | |||
| 1856 | nmdc:mga05p37_75754_c1 | |||
| 1857 | nmdc:mga09592_40498_c1 | |||
| 1858 | nmdc:mga09592_52428_c1 | |||
| 1859 | nmdc:mga09592_778_c1 | |||
| 1860 | nmdc:mga0qj67_12381_c1 | |||
| 1861 | nmdc:mga0qj67_148978_c1 | |||
| 1862 | nmdc:mga0qj67_16699_c1 | |||
| 1863 | nmdc:mga0qj67_171320_c1 | |||
| 1864 | nmdc:mga0qj67_25793_c1 | |||
| 1865 | nmdc:mga0qj67_304001_c1 | |||
| 1866 | nmdc:mga0qj67_35774_c1 | |||
| 1867 | nmdc:mga06r32_1227_c1 | |||
| 1868 | nmdc:mga06r32_131426_c1 | |||
| 1869 | nmdc:mga06r32_17258_c1 | |||
| 1870 | nmdc:mga06r32_21619_c1 | |||
| 1871 | nmdc:mga06r32_22348_c1 | |||
| 1872 | nmdc:mga06r32_244511_c1 | |||
| 1873 | nmdc:mga06r32_291121_c1 | |||
| 1874 | nmdc:mga06r32_2927_c1 | |||
| 1875 | nmdc:mga06r32_298284_c1 | |||
| 1876 | nmdc:mga06r32_325079_c1 | |||
| 1877 | nmdc:mga08y16_173347_c1 | |||
| 1878 | nmdc:mga08y16_76324_c1 | |||
| 1879 | nmdc:mga08y16_92306_c1 | |||
| 1880 | nmdc:mga0n895_22044_c1 | |||
| 1881 | nmdc:mga0n895_361535_c1 | |||
| 1882 | nmdc:mga0n895_435585_c1 | |||
| 1883 | nmdc:mga0n895_479237_c1 | |||
| 1884 | nmdc:mga0n895_94511_c1 | |||
| 1885 | nmdc:mga0rr50_434669_c1 | |||
| 1886 | nmdc:mga0rr50_572002_c1 | |||
| 1887 | nmdc:mga0rr50_6667_c1 | |||
| 1888 | nmdc:mga0a205_101761_c1 | |||
| 1889 | nmdc:mga0a205_191916_c1 | |||
| 1890 | nmdc:mga0a205_335_c1 | |||
| 1891 | nmdc:mga0sz30_47096_c1 | |||
| 1892 | Ga0495601_0013359 | |||
| 1893 | Ga0495601_0021412 | |||
| 1894 | Ga0495601_0162141 | |||
| 1895 | Ga0495601_0394530 | |||
| 1896 | Ga0495612_0007530 | |||
| 1897 | Ga0495612_0015354 | |||
| 1898 | Ga0495612_0063384 | |||
| 1899 | Ga0500635_0002895 | |||
| 1900 | Ga0495655_0005107 | |||
| 1901 | Ga0495595_0058430 | |||
| 1902 | Ga0495619_0030201 | |||
| 1903 | Ga0500643_000040 | |||
| 1904 | Ga0500646_0033522 | |||
| 1905 | Ga0500583_0003885 | |||
| 1906 | Ga0500651_0000787 | |||
| 1907 | Ga0500651_0023641 | |||
| 1908 | Ga0500566_0000005 | |||
| 1909 | Ga0500566_0001430 | |||
| 1910 | Ga0500640_004238 | |||
| 1911 | Ga0500640_061145 | |||
| 1912 | Ga0500641_0017337 | |||
| 1913 | Ga0500641_0071255 | |||
| 1914 | Ga0500650_0008348 | |||
| 1915 | Ga0500555_008753 | |||
| 1916 | Ga0500556_0000019 | |||
| 1917 | Ga0500556_0011374 | |||
| 1918 | Ga0500562_011024 | |||
| 1919 | Ga0500572_000164 | |||
| 1920 | Ga0500591_002791 | |||
| 1921 | Ga0500592_000378 | |||
| 1922 | Ga0500593_000284 | |||
| 1923 | Ga0500593_043337 | |||
| 1924 | Ga0500594_0003781 | |||
| 1925 | Ga0500595_000176 | |||
| 1926 | Ga0500595_002181 | |||
| 1927 | Ga0500595_003323 | |||
| 1928 | Ga0500595_007879 | |||
| 1929 | Ga0500607_035679 | |||
| 1930 | Ga0500608_001003 | |||
| 1931 | Ga0500608_009518 | |||
| 1932 | Ga0500614_000629 | |||
| 1933 | Ga0500614_007561 | |||
| 1934 | Ga0500642_0000048 | |||
| 1935 | Ga0500652_000394 | |||
| 1936 | Ga0500658_0096611 | |||
| 1937 | Ga0500559_0000543 | |||
| 1938 | Ga0500559_0000978 | |||
| 1939 | Ga0500559_0002490 | |||
| 1940 | Ga0500568_0000242 | |||
| 1941 | Ga0500568_0052815 | |||
| 1942 | Ga0500573_0009602 | |||
| 1943 | Ga0500577_0002021 | |||
| 1944 | Ga0500586_000115 | |||
| 1945 | Ga0500590_051710 | |||
| 1946 | Ga0500590_097370 | |||
| 1947 | Ga0500603_000097 | |||
| 1948 | Ga0500603_000900 | |||
| 1949 | Ga0500604_0000407 | |||
| 1950 | Ga0500616_0000059 | |||
| 1951 | Ga0500616_0005912 | |||
| 1952 | Ga0500622_0002088 | |||
| 1953 | Ga0500624_001594 | |||
| 1954 | Ga0500627_0008480 | |||
| 1955 | Ga0500630_000701 | |||
| 1956 | Ga0500633_0050632 | |||
| 1957 | Ga0500634_0132287 | |||
| 1958 | Ga0500638_023788 | |||
| 1959 | Ga0500638_053497 | |||
| 1960 | Ga0500639_000106 | |||
| 1961 | Ga0500639_068445 | |||
| 1962 | Ga0500636_0000028 | |||
| 1963 | Ga0500636_0001221 | |||
| 1964 | Ga0500637_0000119 | |||
| 1965 | Ga0500637_0019087 | |||
| 1966 | Ga0500645_013099 | |||
| 1967 | Ga0500645_025474 | |||
| 1968 | Ga0500601_000137 | |||
| 1969 | Ga0501084_0004628 | |||
| 1970 | Ga0501084_0026969 | |||
| 1971 | Ga0501084_0065115 | |||
| 1972 | Ga0501084_0125048 | |||
| 1973 | Ga0501082_0018381 | |||
| 1974 | Ga0501082_0024431 | |||
| 1975 | Ga0501082_0042663 | |||
| 1976 | Ga0501082_0053841 | |||
| 1977 | Ga0501082_0079675 | |||
| 1978 | Ga0501082_0087894 | |||
| 1979 | Ga0530510_0005801 | |||
| 1980 | Ga0530510_0027778 | |||
| 1981 | Ga0530510_0042778 | |||
| 1982 | Ga0530510_0047342 | |||
| 1983 | 2509146916 | |||
| 1984 | 2511399170 | |||
| 1985 | 2513592593 | |||
| 1986 | 2513622213 | |||
| 1987 | 2513647102 | |||
| 1988 | 2513674510 | |||
| 1989 | 2513696629 | |||
| 1990 | 2513699649 | |||
| 1991 | 2517103706 | |||
| 1992 | 2523105686 | |||
| 1993 | 2524465023 | |||
| 1994 | 2545675152 | |||
| 1995 | 2551714257 | |||
| 1996 | 2596372189 | |||
| 1997 | 2599101796 | |||
| 1998 | 2603861732 | |||
| 1999 | 2617378463 | |||
| 2000 | 2644130974 | |||
| 2001 | 2793073773 | |||
| 2002 | 2818236140 | |||
| 2003 | 2824620292 | |||
| 2004 | 2824629557 | |||
| 2005 | 2824635877 | |||
| 2006 | 2824645307 | |||
| 2007 | 2824680393 | |||
| 2008 | 2824706626 | |||
| 2009 | 2824722957 | |||
| 2010 | 2824725286 | |||
| 2011 | 2824737525 | |||
| 2012 | 2824752595 | |||
| 2013 | 2824756567 | |||
| 2014 | 2824766061 | |||
| 2015 | 2837654353 | |||
| 2016 | 2841960124 | |||
| 2017 | 2842697884 | |||
| 2018 | 2842698929 | |||
| 2019 | 2846957940 | |||
| 2020 | 2847936723 | |||
| 2021 | 2848864438 | |||
| 2022 | 2857516201 | |||
| 2023 | 2857525921 | |||
| 2024 | 2857546215 | |||
| 2025 | 2871456714 | |||
| 2026 | 2874612363 | |||
| 2027 | 2874617352 | |||
| 2028 | 2874631697 | |||
| 2029 | 2876770372 | |||
| 2030 | 2879087933 | |||
| 2031 | 2879116284 | |||
| 2032 | 2881368241 | |||
| 2033 | 2885367133 | |||
| 2034 | 2885383535 | |||
| 2035 | 2888385028 | |||
| 2036 | 2889040928 | |||
| 2037 | 2889309566 | |||
| 2038 | 2893067798 | |||
| 2039 | 2902410493 | |||
| 2040 | 2903769419 | |||
| 2041 | 2904715208 | |||
| 2042 | 2906611714 | |||
| 2043 | 2906631271 | |||
| 2044 | 2906646415 | |||
| 2045 | 2908780708 | |||
| 2046 | 2916004327 | |||
| 2047 | 2916047436 | |||
| 2048 | 2916076684 | |||
| 2049 | 2919074218 | |||
| 2050 | 2921208560 | |||
| 2051 | 2922397521 | |||
| 2052 | 2922427648 | |||
| 2053 | 2924181742 | |||
| 2054 | 2924231036 | |||
| 2055 | 2928129148 | |||
| 2056 | 2929204031 | |||
| 2057 | 2957412676 | |||
| 2058 | 2960606132 | |||
| 2059 | 2960691200 | |||
| 2060 | 2967693939 | |||
| 2061 | 2970098140 | |||
| 2062 | 2970130714 | |||
| 2063 | 2970164198 | |||
| 2064 | 2970180779 | |||
| 2065 | 3005477322 | |||
| 2066 | 3005485225 | |||
| 2067 | 3005507906 | |||
| 2068 | 3005587483 | |||
| 2069 | 641645805 | |||
| 2070 | 8002290610 | |||
| 2071 | 8006969966 | |||
| 2072 | 8006989556 | |||
| 2073 | 8006995182 | |||
| 2074 | 8016593621 | |||
| 2075 | 8019559808 | |||
| 2076 | 8019569914 | |||
| 2077 | 8055911439 | |||
| 2078 | 8056686898 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5093 | 28 | 314 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4984 | 28 | 314 |
| 1dow-assembly1.cif.gz_A | crystal structure of a chimera of beta-catenin and alpha-catenin | 0.3192 | 92 | 232 |
| 5mx5-assembly2.cif.gz_N | mouse pa28alpha-beta | 0.3079 | 59 | 244 |
| 7rh5-assembly1.cif.gz_S | mycobacterial ciii2civ2 supercomplex, inhibitor free | 0.3062 | 92 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7869 | 26 | 309 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7867 | 27 | 308 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7844 | 25 | 309 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7791 | 25 | 309 | 1.10.3470.10 |
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.779 | 26 | 309 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6RLS7-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9707 | 2 | 252 |
GO:0005886
GO:0015658 |
| AF-A0A3B0RDG5-F1-model_v4 | Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) | 0.9619 | 11 | 289 |
GO:0005886
GO:0015658 |
| AF-A0A0Q4URT7-F1-model_v4 | ABC transporter permease | 0.9566 | 1 | 342 |
GO:0005886
GO:0015658 |
| AF-A0A1F9D5E6-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9529 | 2 | 326 |
GO:0005886
GO:0015658 |
| AF-A0A086D618-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9518 | 2 | 316 |
GO:0005886
GO:0015658 |