F488782

General Info

Members Datasets Scaffolds Average Seq Length
1039 529 2078 340

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10020087|Ga0075432_100200872
Length 371
Sequence MKNLGTIFLLFVLLTVPLWVTDQYYLHIVITTGIFIIGAMSLNLLLGFTGQLSLGHIAFFGIGAYTSALTSLGFDIPVFWGDGRIIHEAWHPVIGILLGTFVAGVCGYVVGKLSFKIRGAYFVIVTISFAEVVRLVALNWVDLTQGPLALSNIPPLGYNLPGLGEMVFWAKAPNYYLVLALALVAYVLIRRIVRSRMGRAMIALRENESLATSVGIDVTRYLVFAAVVSAALAGATGSLYAHYIRIIDPDIFLFVYTVTMVIMVVTGGKGTLAGPIVGGVIFGALPVGLRAVAAPEVQWIVYGIVMILIVFFLPRGIVPAVSDYWHRKTGSSPRHTRATPSAPSKQSPEQASKWDGAASQTMLSAKALTGK

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
130 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
131 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
132 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
201 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
202 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
384 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
389 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
390 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
391 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
392 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
395 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
396 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
397 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
398 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
399 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
400 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
401 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
402 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
403 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
404 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
405 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
406 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
407 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
408 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
409 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
410 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
411 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
412 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
413 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
414 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
415 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
416 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
417 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
420 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
421 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
422 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
423 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
424 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
425 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
426 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
427 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
428 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
429 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
430 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
431 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
434 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
435 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
436 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
437 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
438 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
439 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
440 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
441 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
442 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
443 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
444 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
445 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
446 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
447 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
448 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
449 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
450 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
451 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
452 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
453 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
454 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
455 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
456 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
457 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
458 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
459 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
460 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
461 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
462 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
463 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
464 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
465 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
466 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
467 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
468 2842694124 Methylopila sp. R-72369 Isolate Unclassified
469 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
470 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
471 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
472 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
473 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
474 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
475 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
476 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
477 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
478 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
479 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
480 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
481 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
482 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
483 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
484 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
485 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
486 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
487 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
488 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
489 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
490 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
491 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
492 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
493 2906610324
494 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
495 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
496 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
497 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
498 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
499 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
500 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
501 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
502 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
503 2922425934
504 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
505 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
506 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
507 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
508 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
509 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
510 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
511 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
512 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
513 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
514 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
515 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
516 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
517 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
518 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
519 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
520 641522639 Methylobacterium sp. 4-46 Isolate Nodule
521 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
522 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
523 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
524 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
525 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
526 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
527 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
528 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
529 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.94
Metatranscriptomes 0
Isolates 9.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.13
Nodule 5.49
Rhizoplane 8.57
Rhizosphere 63.33
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10020087 3300006058 Bacteria 2284
2 JGI24737J22298_10032906 3300001990 Bacteria 1612
3 JGI24744J21845_10002032 3300002077 Bacteria 4101
4 JGI24033J26618_1003073 3300002155 Bacteria 1744
5 JGI25153J46596_10000068 3300003215 Bacteria 117909
6 JGI25153J46596_10000094 3300003215 Bacteria 103036
7 JGI25153J46596_10002675 3300003215 Bacteria 10176
8 JGI25160J50197_1000777 3300003354 Bacteria 17100
9 JGI25404J52841_10000108 3300003659 Bacteria 8267
10 Ga0055531_10018269 3300003794 Bacteria 2904
11 Ga0065165_1001845 3300005262 Bacteria 20647
12 Ga0065165_1005504 3300005262 Bacteria 7081
13 Ga0065704_10020805 3300005289 Bacteria 1912
14 Ga0070676_10035764 3300005328 Bacteria 2858
15 Ga0070690_100040155 3300005330 Bacteria 2959
16 Ga0070690_100123144 3300005330 Bacteria 1743
17 Ga0070670_100010874 3300005331 Bacteria 7773
18 Ga0070670_100051718 3300005331 Bacteria 3528
19 Ga0068869_100055588 3300005334 Bacteria 2885
20 Ga0068869_100119789 3300005334 Bacteria 2012
21 Ga0068869_100175633 3300005334 Bacteria 1676
22 Ga0070666_10147580 3300005335 Bacteria 1640
23 Ga0070680_100011909 3300005336 Bacteria 6748
24 Ga0070680_100013678 3300005336 Bacteria 6327
25 Ga0070680_100177071 3300005336 Bacteria 1795
26 Ga0068868_100023511 3300005338 Bacteria 4665
27 Ga0070689_100059991 3300005340 Bacteria 2957
28 Ga0070689_100082543 3300005340 Bacteria 2525
29 Ga0070691_10009631 3300005341 Bacteria 4408
30 Ga0070687_100002478 3300005343 Bacteria 6943
31 Ga0070687_100064871 3300005343 Bacteria 1941
32 Ga0070661_100331832 3300005344 Bacteria 1190
33 Ga0070692_10120819 3300005345 Bacteria 1461
34 Ga0070692_10155862 3300005345 Bacteria 1304
35 Ga0070668_100109997 3300005347 Bacteria 2192
36 Ga0070669_100013682 3300005353 Bacteria 5769
37 Ga0070669_100060444 3300005353 Bacteria 2783
38 Ga0070675_100003565 3300005354 Bacteria 11829
39 Ga0070671_100012862 3300005355 Bacteria 6748
40 Ga0070671_100053207 3300005355 Bacteria 3365
41 Ga0070671_100063572 3300005355 Bacteria 3073
42 Ga0070674_100039243 3300005356 Bacteria 3196
43 Ga0070674_100060525 3300005356 Bacteria 2640
44 Ga0070674_100287504 3300005356 Bacteria 1306
45 Ga0070673_100084789 3300005364 Bacteria 2578
46 Ga0070673_100469065 3300005364 Bacteria 1135
47 Ga0070688_100002030 3300005365 Bacteria 10204
48 Ga0070659_100032166 3300005366 Bacteria 4067
49 Ga0070659_100060819 3300005366 Bacteria 2984
50 Ga0070667_100004500 3300005367 Bacteria 11760
51 Ga0070667_100030529 3300005367 Bacteria 4495
52 Ga0070667_100113122 3300005367 Bacteria 2355
53 Ga0070709_10004866 3300005434 Bacteria 7259
54 Ga0070709_10199039 3300005434 Bacteria 1418
55 Ga0070714_100001309 3300005435 Bacteria 17977
56 Ga0070714_100204624 3300005435 Bacteria 1807
57 Ga0070714_100429654 3300005435 Bacteria 1252
58 Ga0070714_100464283 3300005435 Bacteria 1204
59 Ga0070713_100002404 3300005436 Bacteria 12210
60 Ga0070713_100138447 3300005436 Bacteria 2154
61 Ga0070710_10004275 3300005437 Bacteria 6770
62 Ga0070710_10177003 3300005437 Bacteria 1333
63 Ga0070711_100000362 3300005439 Bacteria 23459
64 Ga0070711_100015017 3300005439 Bacteria 4894
65 Ga0070711_100028066 3300005439 Bacteria 3700
66 Ga0070705_100004675 3300005440 Bacteria 6667
67 Ga0070700_100018434 3300005441 Bacteria 4012
68 Ga0070700_100115285 3300005441 Bacteria 1792
69 Ga0070700_100215770 3300005441 Bacteria 1356
70 Ga0070694_100002889 3300005444 Bacteria 10208
71 Ga0070694_100138247 3300005444 Bacteria 1767
72 Ga0070708_100008473 3300005445 Bacteria 8257
73 Ga0070708_100062084 3300005445 Bacteria 3340
74 Ga0070663_100007257 3300005455 Bacteria 6738
75 Ga0070663_100021917 3300005455 Bacteria 4259
76 Ga0070663_100029127 3300005455 Bacteria 3768
77 Ga0070663_100031511 3300005455 Bacteria 3644
78 Ga0070678_100042423 3300005456 Bacteria 3233
79 Ga0070678_100071874 3300005456 Bacteria 2591
80 Ga0070678_100195659 3300005456 Bacteria 1665
81 Ga0070662_100081318 3300005457 Bacteria 2413
82 Ga0070662_100174128 3300005457 Bacteria 1692
83 Ga0070662_100175436 3300005457 Bacteria 1686
84 Ga0070681_10020166 3300005458 Bacteria 6682
85 Ga0070681_10066987 3300005458 Bacteria 3559
86 Ga0070681_10152622 3300005458 Bacteria 2236
87 Ga0068867_100033474 3300005459 Bacteria 3722
88 Ga0068867_100045107 3300005459 Bacteria 3231
89 Ga0070685_10029846 3300005466 Bacteria 3033
90 Ga0070685_10076575 3300005466 Bacteria 1995
91 Ga0070699_100000545 3300005518 Bacteria 35461
92 Ga0070699_100035875 3300005518 Bacteria 4287
93 Ga0070699_100116591 3300005518 Bacteria 2347
94 Ga0070679_100113019 3300005530 Bacteria 2701
95 Ga0070697_100015043 3300005536 Bacteria 6073
96 Ga0068853_100031522 3300005539 Bacteria 4483
97 Ga0068853_100056742 3300005539 Bacteria 3378
98 Ga0068853_100444590 3300005539 Bacteria 1219
99 Ga0070672_100004369 3300005543 Bacteria 9260
100 Ga0070686_100005070 3300005544 Bacteria 7272
101 Ga0070686_100366433 3300005544 Bacteria 1087
102 Ga0070695_100004516 3300005545 Bacteria 8168
103 Ga0070695_100007706 3300005545 Bacteria 6377
104 Ga0070695_100191255 3300005545 Bacteria 1457
105 Ga0070696_100000249 3300005546 Bacteria 32415
106 Ga0070696_100012128 3300005546 Bacteria 5775
107 Ga0070696_100057255 3300005546 Bacteria 2720
108 Ga0070696_100183914 3300005546 Bacteria 1551
109 Ga0070693_100008195 3300005547 Bacteria 5136
110 Ga0070693_100124044 3300005547 Bacteria 1605
111 Ga0070665_100115402 3300005548 Bacteria 2688
112 Ga0070665_100165949 3300005548 Bacteria 2210
113 Ga0070704_100029961 3300005549 Bacteria 3641
114 Ga0070704_100048479 3300005549 Bacteria 2973
115 Ga0070704_100174802 3300005549 Bacteria 1712
116 Ga0068855_100025399 3300005563 Bacteria 7089
117 Ga0068855_100060100 3300005563 Bacteria 4446
118 Ga0068855_100123173 3300005563 Bacteria 2966
119 Ga0070664_100043666 3300005564 Bacteria 3783
120 Ga0068857_100014404 3300005577 Bacteria 6895
121 Ga0068854_100079306 3300005578 Bacteria 2420
122 Ga0068856_100108101 3300005614 Bacteria 2778
123 Ga0068856_100166670 3300005614 Bacteria 2214
124 Ga0068856_100252217 3300005614 Bacteria 1780
125 Ga0070702_100005145 3300005615 Bacteria 6055
126 Ga0070702_100267274 3300005615 Bacteria 1168
127 Ga0068859_100016683 3300005617 Bacteria 7373
128 Ga0068859_100039940 3300005617 Bacteria 4710
129 Ga0068859_100284152 3300005617 Bacteria 1747
130 Ga0068864_100045321 3300005618 Bacteria 3772
131 Ga0068864_100168521 3300005618 Bacteria 1995
132 Ga0068864_100575089 3300005618 Bacteria 1091
133 Ga0068866_10001554 3300005718 Bacteria 9755
134 Ga0068866_10005088 3300005718 Bacteria 5418
135 Ga0068861_100011419 3300005719 Bacteria 6175
136 Ga0068870_10064265 3300005840 Bacteria 1982
137 Ga0068863_100082082 3300005841 Bacteria 3054
138 Ga0068863_100567432 3300005841 Bacteria 1121
139 Ga0068858_100005194 3300005842 Bacteria 12756
140 Ga0068858_100025390 3300005842 Bacteria 5513
141 Ga0068860_100016382 3300005843 Bacteria 7228
142 Ga0068860_100049518 3300005843 Bacteria 4001
143 Ga0068860_100369935 3300005843 Bacteria 1413
144 Ga0068862_100005647 3300005844 Bacteria 10446
145 Ga0081455_10000029 3300005937 Bacteria 155672
146 Ga0081455_10003782 3300005937 Bacteria 17285
147 Ga0081455_10005788 3300005937 Bacteria 13470
148 Ga0081455_10031199 3300005937 Bacteria 4827
149 Ga0081455_10052904 3300005937 Bacteria 3473
150 Ga0081455_10057782 3300005937 Bacteria 3286
151 Ga0081538_10006418 3300005981 Bacteria 10357
152 Ga0081538_10017150 3300005981 Bacteria 5509
153 Ga0081538_10020850 3300005981 Bacteria 4809
154 Ga0081540_1000048 3300005983 Bacteria 127924
155 Ga0081540_1000937 3300005983 Bacteria 26234
156 Ga0081540_1001679 3300005983 Bacteria 18835
157 Ga0081540_1005784 3300005983 Bacteria 9152
158 Ga0081540_1008639 3300005983 Bacteria 7098
159 Ga0081540_1015468 3300005983 Bacteria 4831
160 Ga0081540_1020642 3300005983 Bacteria 3953
161 Ga0081540_1058933 3300005983 Bacteria 1846
162 Ga0081539_10004692 3300005985 Bacteria 14824
163 Ga0070717_10002967 3300006028 Bacteria 12064
164 Ga0070717_10074371 3300006028 Bacteria 2840
165 Ga0075365_10003935 3300006038 Bacteria 7775
166 Ga0075365_10021126 3300006038 Bacteria 4055
167 Ga0075365_10039788 3300006038 Bacteria 3063
168 Ga0075368_10000671 3300006042 Bacteria 10423
169 Ga0075368_10007055 3300006042 Bacteria 3955
170 Ga0075368_10072004 3300006042 Bacteria 1397
171 Ga0075363_100000761 3300006048 Bacteria 11035
172 Ga0075363_100013498 3300006048 Bacteria 3962
173 Ga0075363_100153852 3300006048 Bacteria 1299
174 Ga0075364_10009955 3300006051 Bacteria 5721
175 Ga0075364_10013926 3300006051 Bacteria 4957
176 Ga0075364_10094586 3300006051 Bacteria 1986
177 Ga0070715_10011015 3300006163 Bacteria 3242
178 Ga0070715_10059722 3300006163 Bacteria 1669
179 Ga0070715_10076423 3300006163 Bacteria 1509
180 Ga0070716_100011005 3300006173 Bacteria 4552
181 Ga0070716_100013289 3300006173 Bacteria 4193
182 Ga0070716_100018949 3300006173 Bacteria 3591
183 Ga0070712_100057934 3300006175 Bacteria 2723
184 Ga0070712_100064170 3300006175 Bacteria 2603
185 Ga0070712_100140922 3300006175 Bacteria 1840
186 Ga0075367_10002090 3300006178 Bacteria 8952
187 Ga0075367_10035633 3300006178 Bacteria 2881
188 Ga0075369_10000436 3300006186 Bacteria 12671
189 Ga0075369_10008913 3300006186 Bacteria 3881
190 Ga0075369_10012833 3300006186 Bacteria 3313
191 Ga0075369_10079228 3300006186 Bacteria 1455
192 Ga0075366_10022499 3300006195 Bacteria 3668
193 Ga0075366_10078135 3300006195 Bacteria 1975
194 Ga0097621_100145673 3300006237 Bacteria 2028
195 Ga0075370_10041668 3300006353 Bacteria 2592
196 Ga0075428_100024125 3300006844 Bacteria 6728
197 Ga0075428_100053458 3300006844 Bacteria 4425
198 Ga0075428_100058333 3300006844 Bacteria 4226
199 Ga0075428_100069932 3300006844 Bacteria 3837
200 Ga0075428_100096916 3300006844 Bacteria 3215
201 Ga0075428_100100255 3300006844 Bacteria 3158
202 Ga0075428_100117413 3300006844 Bacteria 2898
203 Ga0075428_100194866 3300006844 Bacteria 2191
204 Ga0075428_100200691 3300006844 Bacteria 2156
205 Ga0075428_100204869 3300006844 Bacteria 2132
206 Ga0075430_100007063 3300006846 Bacteria 9469
207 Ga0075430_100012474 3300006846 Bacteria 7232
208 Ga0075430_100014692 3300006846 Bacteria 6670
209 Ga0075430_100115306 3300006846 Bacteria 2238
210 Ga0075431_100001007 3300006847 Bacteria 25062
211 Ga0075431_100002204 3300006847 Bacteria 18653
212 Ga0075431_100004487 3300006847 Bacteria 13696
213 Ga0075431_100020866 3300006847 Bacteria 6695
214 Ga0075431_100026130 3300006847 Bacteria 5989
215 Ga0075431_100055261 3300006847 Bacteria 4095
216 Ga0075431_100206039 3300006847 Bacteria 2011
217 Ga0075431_100258715 3300006847 Bacteria 1767
218 Ga0075433_10000125 3300006852 Bacteria 38878
219 Ga0075433_10075221 3300006852 Bacteria 2972
220 Ga0075434_100008387 3300006871 Bacteria 9607
221 Ga0075434_100377658 3300006871 Bacteria 1438
222 Ga0075429_100000183 3300006880 Bacteria 40888
223 Ga0075429_100020360 3300006880 Bacteria 5755
224 Ga0075429_100050064 3300006880 Bacteria 3635
225 Ga0068865_100067979 3300006881 Bacteria 2518
226 Ga0097620_100016683 3300006931 Bacteria 7373
227 Ga0097620_100039940 3300006931 Bacteria 4710
228 Ga0097620_100284153 3300006931 Bacteria 1747
229 Ga0099825_1033101 3300006941 Bacteria 2033
230 Ga0079104_1000772 3300006946 Bacteria 27473
231 Ga0075435_100006471 3300007076 Bacteria 8284
232 Ga0075435_100175503 3300007076 Bacteria 1809
233 Ga0105240_10021211 3300009093 Bacteria 8647
234 Ga0111539_10003120 3300009094 Bacteria 21947
235 Ga0111539_10010381 3300009094 Bacteria 11724
236 Ga0111539_10035947 3300009094 Bacteria 5995
237 Ga0111539_10168777 3300009094 Bacteria 2557
238 Ga0105245_10003785 3300009098 Bacteria 13456
239 Ga0105245_10039830 3300009098 Bacteria 4183
240 Ga0105245_10080471 3300009098 Bacteria 2976
241 Ga0105247_10006629 3300009101 Bacteria 7153
242 Ga0105247_10034192 3300009101 Bacteria 3096
243 Ga0105247_10077134 3300009101 Bacteria 2094
244 Ga0114129_10005398 3300009147 Bacteria 18046
245 Ga0114129_10021657 3300009147 Bacteria 9123
246 Ga0114129_10221736 3300009147 Bacteria 2550
247 Ga0114129_10409322 3300009147 Bacteria 1786
248 Ga0105243_10027268 3300009148 Bacteria 4375
249 Ga0105243_10115385 3300009148 Bacteria 2255
250 Ga0105243_10138101 3300009148 Bacteria 2076
251 Ga0105241_10029956 3300009174 Bacteria 4064
252 Ga0105241_10127258 3300009174 Bacteria 2058
253 Ga0105242_10104545 3300009176 Bacteria 2404
254 Ga0105248_10014926 3300009177 Bacteria 8552
255 Ga0105248_10043198 3300009177 Bacteria 5054
256 Ga0105248_10260904 3300009177 Bacteria 1951
257 Ga0105237_10046888 3300009545 Bacteria 4344
258 Ga0105237_10244619 3300009545 Bacteria 1795
259 Ga0105238_10072474 3300009551 Bacteria 3440
260 Ga0105238_10183534 3300009551 Bacteria 2069
261 Ga0105238_10201674 3300009551 Bacteria 1965
262 Ga0105249_10107666 3300009553 Bacteria 2631
263 Ga0105249_10108754 3300009553 Bacteria 2618
264 Ga0105249_10256209 3300009553 Bacteria 1737
265 Ga0105239_10128432 3300010375 Bacteria 2818
266 Ga0105239_10147389 3300010375 Bacteria 2626
267 Ga0105239_10155237 3300010375 Bacteria 2556
268 Ga0105239_10209072 3300010375 Bacteria 2187
269 Ga0105246_10006437 3300011119 Bacteria 7177
270 Ga0105246_10008875 3300011119 Bacteria 6186
271 Ga0105246_10063443 3300011119 Bacteria 2577
272 Ga0105246_10079580 3300011119 Bacteria 2331
273 Ga0157373_10022116 3300013100 Bacteria 4616
274 Ga0157371_10285144 3300013102 Bacteria 1194
275 Ga0157370_10034208 3300013104 Bacteria 4951
276 Ga0157370_10090185 3300013104 Bacteria 2879
277 Ga0157370_10090695 3300013104 Bacteria 2870
278 Ga0157369_10259333 3300013105 Bacteria 1813
279 Ga0157374_10051941 3300013296 Bacteria 3816
280 Ga0157374_10262320 3300013296 Bacteria 1702
281 Ga0157378_10136986 3300013297 Bacteria 2270
282 Ga0163162_10103627 3300013306 Bacteria 2939
283 Ga0163162_10142417 3300013306 Bacteria 2512
284 Ga0163162_10541075 3300013306 Bacteria 1293
285 Ga0157375_10009111 3300013308 Bacteria 8696
286 Ga0163163_10003696 3300014325 Bacteria 13022
287 Ga0163163_10008749 3300014325 Bacteria 9007
288 Ga0163163_10093806 3300014325 Bacteria 3018
289 Ga0163163_10294721 3300014325 Bacteria 1674
290 Ga0163163_10312257 3300014325 Bacteria 1625
291 Ga0157380_10098758 3300014326 Bacteria 2427
292 Ga0182008_10053802 3300014497 Unclassified 1993
293 Ga0157377_10226984 3300014745 Bacteria 1198
294 Ga0157379_10019887 3300014968 Bacteria 5931
295 Ga0157379_10039826 3300014968 Bacteria 4193
296 Ga0157379_10046373 3300014968 Bacteria 3877
297 Ga0157379_10150442 3300014968 Bacteria 2099
298 Ga0157376_10003716 3300014969 Bacteria 10546
299 Ga0157376_10196217 3300014969 Bacteria 1854
300 Ga0157376_10226284 3300014969 Bacteria 1735
301 Ga0214544_1000004 3300021320 Bacteria 455869
302 Ga0214542_1000001 3300021321 Bacteria 1018696
303 Ga0214542_1027275 3300021321 Bacteria 2637
304 Ga0214545_1000001 3300021324 Bacteria 1092817
305 Ga0214545_1028004 3300021324 Bacteria 2775
306 Ga0214543_1000006 3300021327 Bacteria 443395
307 Ga0214543_1029823 3300021327 Bacteria 2378
308 Ga0213876_10000816 3300021384 Bacteria 21075
309 Ga0213876_10000944 3300021384 Bacteria 19157
310 Ga0213876_10024495 3300021384 Bacteria 3186
311 Ga0213875_10000007 3300021388 Bacteria 562717
312 Ga0209233_1007993 3300025261 Bacteria 3305
313 Ga0209025_1066051 3300025294 Bacteria 1317
314 Ga0209564_1001626 3300025295 Bacteria 21795
315 Ga0209564_1008466 3300025295 Bacteria 5070
316 Ga0209758_1000024 3300025297 Bacteria 591966
317 Ga0209758_1000097 3300025297 Bacteria 230529
318 Ga0209758_1002191 3300025297 Bacteria 20457
319 Ga0209256_1001501 3300025299 Bacteria 23665
320 Ga0207426_1000439 3300025302 Bacteria 67107
321 Ga0209257_1000588 3300025304 Bacteria 60654
322 Ga0209257_1018568 3300025304 Bacteria 2667
323 Ga0207682_10001905 3300025893 Bacteria 9471
324 Ga0207692_10010733 3300025898 Bacteria 3874
325 Ga0207642_10104134 3300025899 Bacteria 1431
326 Ga0207710_10011889 3300025900 Bacteria 3662
327 Ga0207688_10001053 3300025901 Bacteria 14128
328 Ga0207688_10019972 3300025901 Bacteria 3655
329 Ga0207680_10236359 3300025903 Bacteria 1258
330 Ga0207647_10011848 3300025904 Bacteria 6094
331 Ga0207647_10022689 3300025904 Bacteria 4165
332 Ga0207647_10030106 3300025904 Bacteria 3506
333 Ga0207647_10038482 3300025904 Bacteria 3023
334 Ga0207685_10025753 3300025905 Bacteria 2035
335 Ga0207699_10010277 3300025906 Bacteria 4690
336 Ga0207645_10008189 3300025907 Bacteria 7319
337 Ga0207645_10010590 3300025907 Bacteria 6327
338 Ga0207645_10127742 3300025907 Bacteria 1653
339 Ga0207643_10003366 3300025908 Bacteria 8614
340 Ga0207643_10020063 3300025908 Bacteria 3666
341 Ga0207684_10108773 3300025910 Bacteria 2372
342 Ga0207654_10252886 3300025911 Bacteria 1182
343 Ga0207707_10018781 3300025912 Bacteria 6029
344 Ga0207707_10072454 3300025912 Bacteria 3003
345 Ga0207693_10001150 3300025915 Bacteria 23634
346 Ga0207693_10016959 3300025915 Bacteria 5817
347 Ga0207693_10024155 3300025915 Bacteria 4826
348 Ga0207693_10027969 3300025915 Bacteria 4457
349 Ga0207693_10129223 3300025915 Bacteria 1986
350 Ga0207693_10195953 3300025915 Bacteria 1589
351 Ga0207663_10002241 3300025916 Bacteria 9253
352 Ga0207660_10008445 3300025917 Bacteria 6661
353 Ga0207660_10068232 3300025917 Bacteria 2578
354 Ga0207662_10002137 3300025918 Bacteria 9837
355 Ga0207662_10072254 3300025918 Bacteria 2090
356 Ga0207657_10013624 3300025919 Bacteria 7972
357 Ga0207649_10067228 3300025920 Bacteria 2274
358 Ga0207652_10125048 3300025921 Bacteria 2290
359 Ga0207646_10039558 3300025922 Bacteria 4244
360 Ga0207681_10170299 3300025923 Bacteria 1650
361 Ga0207694_10047081 3300025924 Bacteria 3335
362 Ga0207694_10156488 3300025924 Bacteria 1838
363 Ga0207650_10039381 3300025925 Bacteria 3455
364 Ga0207650_10148324 3300025925 Bacteria 1849
365 Ga0207650_10150214 3300025925 Bacteria 1838
366 Ga0207659_10194068 3300025926 Bacteria 1617
367 Ga0207687_10001252 3300025927 Bacteria 17372
368 Ga0207687_10013163 3300025927 Bacteria 5403
369 Ga0207687_10021234 3300025927 Bacteria 4313
370 Ga0207700_10022348 3300025928 Bacteria 4340
371 Ga0207700_10217672 3300025928 Bacteria 1617
372 Ga0207664_10036615 3300025929 Bacteria 3793
373 Ga0207664_10121412 3300025929 Bacteria 2187
374 Ga0207664_10244199 3300025929 Bacteria 1565
375 Ga0207644_10040575 3300025931 Bacteria 3290
376 Ga0207706_10030478 3300025933 Bacteria 4810
377 Ga0207706_10126822 3300025933 Bacteria 2244
378 Ga0207706_10142460 3300025933 Bacteria 2109
379 Ga0207686_10009550 3300025934 Bacteria 5263
380 Ga0207709_10033632 3300025935 Bacteria 3013
381 Ga0207709_10039461 3300025935 Bacteria 2820
382 Ga0207670_10003594 3300025936 Bacteria 8224
383 Ga0207670_10091129 3300025936 Bacteria 2155
384 Ga0207670_10290929 3300025936 Bacteria 1276
385 Ga0207669_10026195 3300025937 Bacteria 3167
386 Ga0207669_10032407 3300025937 Bacteria 2934
387 Ga0207704_10068433 3300025938 Bacteria 2238
388 Ga0207665_10000775 3300025939 Bacteria 21527
389 Ga0207665_10002581 3300025939 Bacteria 12169
390 Ga0207665_10024249 3300025939 Bacteria 3999
391 Ga0207691_10022886 3300025940 Bacteria 5890
392 Ga0207691_10024151 3300025940 Bacteria 5717
393 Ga0207691_10163394 3300025940 Bacteria 1952
394 Ga0207689_10002991 3300025942 Bacteria 15584
395 Ga0207689_10009502 3300025942 Bacteria 8397
396 Ga0207689_10304709 3300025942 Unclassified 1321
397 Ga0207679_10061777 3300025945 Bacteria 2790
398 Ga0207679_10211038 3300025945 Bacteria 1628
399 Ga0207651_10157413 3300025960 Bacteria 1777
400 Ga0207712_10004686 3300025961 Bacteria 8648
401 Ga0207668_10237249 3300025972 Bacteria 1473
402 Ga0207640_10027914 3300025981 Bacteria 3444
403 Ga0207658_10010199 3300025986 Bacteria 6384
404 Ga0207677_10004452 3300026023 Bacteria 7522
405 Ga0207677_10105099 3300026023 Bacteria 2089
406 Ga0207703_10007538 3300026035 Bacteria 8631
407 Ga0207703_10007965 3300026035 Bacteria 8375
408 Ga0207703_10084126 3300026035 Bacteria 2660
409 Ga0207639_10096489 3300026041 Bacteria 2378
410 Ga0207639_10299097 3300026041 Bacteria 1422
411 Ga0207678_10002455 3300026067 Bacteria 16839
412 Ga0207678_10016550 3300026067 Bacteria 6475
413 Ga0207678_10031893 3300026067 Bacteria 4594
414 Ga0207678_10057223 3300026067 Bacteria 3355
415 Ga0207678_10081798 3300026067 Bacteria 2764
416 Ga0207708_10002956 3300026075 Bacteria 12522
417 Ga0207708_10040488 3300026075 Bacteria 3552
418 Ga0207708_10095183 3300026075 Bacteria 2300
419 Ga0207708_10128499 3300026075 Bacteria 1979
420 Ga0207708_10131512 3300026075 Bacteria 1957
421 Ga0207702_10140357 3300026078 Bacteria 2186
422 Ga0207702_10260362 3300026078 Bacteria 1633
423 Ga0207702_10375880 3300026078 Bacteria 1365
424 Ga0207702_10504217 3300026078 Bacteria 1180
425 Ga0207641_10010922 3300026088 Bacteria 7441
426 Ga0207641_10111317 3300026088 Bacteria 2427
427 Ga0207648_10003243 3300026089 Bacteria 17119
428 Ga0207648_10004365 3300026089 Bacteria 14546
429 Ga0207648_10009198 3300026089 Bacteria 9490
430 Ga0207648_10391202 3300026089 Bacteria 1258
431 Ga0207676_10002494 3300026095 Bacteria 13103
432 Ga0207676_10015497 3300026095 Bacteria 5500
433 Ga0207674_10017744 3300026116 Bacteria 7757
434 Ga0207674_10026785 3300026116 Bacteria 6115
435 Ga0207674_10111536 3300026116 Bacteria 2709
436 Ga0207674_10153745 3300026116 Bacteria 2257
437 Ga0207675_100005260 3300026118 Bacteria 12449
438 Ga0207675_100061604 3300026118 Bacteria 3502
439 Ga0207675_100072011 3300026118 Bacteria 3232
440 Ga0207675_100126982 3300026118 Bacteria 2416
441 Ga0207675_100379843 3300026118 Bacteria 1389
442 Ga0207683_10048849 3300026121 Bacteria 3702
443 Ga0207683_10260409 3300026121 Bacteria 1584
444 Ga0207698_10298476 3300026142 Bacteria 1499
445 Ga0209281_1000839 3300027111 Bacteria 27458
446 Ga0209389_1000199 3300027296 Bacteria 43170
447 Ga0209969_1001317 3300027360 Bacteria 3408
448 Ga0209489_102148 3300027361 Bacteria 40384
449 Ga0209700_100005 3300027363 Bacteria 573969
450 Ga0209967_1002257 3300027364 Bacteria 2503
451 Ga0210000_1003297 3300027462 Bacteria 2327
452 Ga0209813_10000408 3300027866 Bacteria 10485
453 Ga0209974_10020453 3300027876 Bacteria 2193
454 Ga0207428_10040114 3300027907 Bacteria 3800
455 Ga0268266_10022350 3300028379 Bacteria 5391
456 Ga0268266_10024247 3300028379 Bacteria 5162
457 Ga0268266_10040575 3300028379 Bacteria 3967
458 Ga0268265_10001732 3300028380 Bacteria 17566
459 Ga0268265_10119178 3300028380 Bacteria 2171
460 Ga0268264_10100948 3300028381 Bacteria 2507
461 Ga0307511_10000014 3300030521 Bacteria 127602
462 Ga0265316_10190919 3300031344 Bacteria 1522
463 Ga0307408_100053003 3300031548 Bacteria 2928
464 Ga0265314_10004888 3300031711 Bacteria 12255
465 Ga0316578_10020840 3300031728 Bacteria 3628
466 Ga0307405_10074589 3300031731 Bacteria 2194
467 Ga0307409_100107720 3300031995 Bacteria 2329
468 Ga0307409_100439824 3300031995 Bacteria 1256
469 Ga0307416_100478923 3300032002 Bacteria 1304
470 Ga0307415_100027417 3300032126 Bacteria 3609
471 Ga0307415_100159664 3300032126 Bacteria 1746
472 Ga0307510_10045817 3300033180 Bacteria 4712
473 Ga0307510_10047901 3300033180 Bacteria 4569
474 Ga0373934_0003068 3300035086 Bacteria 6100
475 Ga0373944_0005124 3300035089 Bacteria 3444
476 Ga0373949_0004068 3300035090 Bacteria 3387
477 Ga0373936_0045182 3300035113 Bacteria 1774
478 Ga0373945_0011192 3300035116 Bacteria 2963
479 Ga0373954_0004828 3300035118 Bacteria 5812
480 Ga0373956_0009898 3300035119 Bacteria 3886
481 Ga0373960_0009259 3300035121 Bacteria 2380
482 Ga0373943_0004642 3300035170 Bacteria 6213
483 Ga0373946_0016859 3300035171 Bacteria 2788
484 Ga0373946_0044250 3300035171 Bacteria 1838
485 Ga0373961_0004701 3300035241 Bacteria 3285
486 Ga0373961_0020627 3300035241 Bacteria 1745
487 Ga0316574_0003660 3300035398 Bacteria 7960
488 Ga0373931_0000199 3300035691 Bacteria 25657
489 Ga0373931_0001050 3300035691 Bacteria 11689
490 Ga0373935_0158844 3300035692 Bacteria 1539
491 Ga0373927_0105012 3300035695 Bacteria 1839
492 Ga0373927_0162364 3300035695 Bacteria 1464
493 Ga0373927_0179206 3300035695 Bacteria 1390
494 Ga0373933_0001341 3300035724 Bacteria 14499
495 Ga0373937_0178249 3300036401 Bacteria 1995
496 Ga0316584_0010529 3300036712 Bacteria 6467
497 Ga0373925_0048671 3300037068 Bacteria 3159
498 Ga0395900_0264308 3300037418 Bacteria 1717
499 Ga0395898_0162622 3300037466 Bacteria 2135
500 Ga0395905_0069896 3300037471 Bacteria 3289
501 Ga0436364_0207394 3300037853 Bacteria 14617
502 Ga0436364_0286306 3300037853 Bacteria 1395
503 Ga0436364_0430154 3300037853 Bacteria 16915
504 Ga0436364_0434654 3300037853 Bacteria 3712
505 Ga0395901_0385679 3300038443 Bacteria 1441
506 Ga0436365_0159339 3300039437 Bacteria 58353
507 Ga0436365_0413923 3300039437 Bacteria 6603
508 Ga0436365_0736793 3300039437 Bacteria 96466
509 Ga0436365_0940551 3300039437 Bacteria 10885
510 Ga0436365_1187256 3300039437 Bacteria 1547
511 Ga0436365_1368008 3300039437 Bacteria 6440
512 Ga0436360_0504894 3300039438 Bacteria 7022
513 Ga0436360_1076044 3300039438 Bacteria 1337
514 Ga0436361_0905452 3300039447 Bacteria 5518
515 Ga0436363_0287186 3300039450 Bacteria 2199
516 Ga0436363_0313348 3300039450 Bacteria 32729
517 Ga0436363_0703923 3300039450 Bacteria 1783
518 Ga0436363_1475436 3300039450 Bacteria 11441
519 Ga0436362_0274206 3300039453 Bacteria 1162
520 Ga0450911_000064 3300042115 Bacteria 43716
521 Ga0466966_0041438 3300044684 Bacteria 2959
522 Ga0466963_0194984 3300044694 Bacteria 1416
523 Ga0466968_0009238 3300044735 Bacteria 3790
524 Ga0466970_0183530 3300044765 Bacteria 1161
525 Ga0466957_0036272 3300044842 Bacteria 2964
526 Ga0466957_0049790 3300044842 Bacteria 2548
527 Ga0466959_0018887 3300045049 Bacteria 5065
528 Ga0451576_0190182 3300045051 Bacteria 2144
529 Ga0495603_0000815 3300046455 Bacteria 17889
530 Ga0495603_0014909 3300046455 Bacteria 4701
531 Ga0495603_0055846 3300046455 Bacteria 2339
532 Ga0495638_0002133 3300046460 Bacteria 16607
533 Ga0495638_0079907 3300046460 Bacteria 1987
534 Ga0495651_0130767 3300046462 Bacteria 1832
535 Ga0495605_0061752 3300046474 Bacteria 1792
536 Ga0495585_0101648 3300046492 Bacteria 1537
537 Ga0495594_0125454 3300046499 Bacteria 1452
538 Ga0495596_0054852 3300046500 Bacteria 1558
539 Ga0495610_0075765 3300046512 Bacteria 1557
540 Ga0495616_0118733 3300046513 Bacteria 1223
541 Ga0495618_0166601 3300046514 Bacteria 1403
542 Ga0495628_0003683 3300046516 Bacteria 13678
543 Ga0495630_0051524 3300046517 Bacteria 3081
544 Ga0495632_0037042 3300046519 Bacteria 2478
545 Ga0495632_0098174 3300046519 Bacteria 1382
546 Ga0495637_0026576 3300046520 Bacteria 2596
547 Ga0495643_0047109 3300046522 Bacteria 2335
548 Ga0495648_0034559 3300046524 Bacteria 3288
549 Ga0495648_0111791 3300046524 Bacteria 1485
550 Ga0495652_0011271 3300046529 Bacteria 8090
551 Ga0495652_0115861 3300046529 Bacteria 2146
552 Ga0495654_0078628 3300046530 Bacteria 1550
553 Ga0495640_0022824 3300046533 Bacteria 4568
554 Ga0495587_0091556 3300046536 Bacteria 1756
555 Ga0495621_0056061 3300046539 Bacteria 1420
556 Ga0495597_0000256 3300046542 Bacteria 48492
557 Ga0495645_0001496 3300046543 Bacteria 15843
558 Ga0495645_0056473 3300046543 Bacteria 2850
559 Ga0495622_0003864 3300046557 Bacteria 6999
560 Ga0495622_0055459 3300046557 Bacteria 1838
561 Ga0495667_0018521 3300046559 Bacteria 4704
562 Ga0495656_0008757 3300046615 Bacteria 3624
563 Ga0495656_0021968 3300046615 Bacteria 2492
564 Ga0495668_0037199 3300046616 Bacteria 2724
565 Ga0495611_0029563 3300046648 Bacteria 2403
566 Ga0495625_0040647 3300046660 Bacteria 3389
567 Ga0495635_0054834 3300046663 Bacteria 2745
568 Ga0495661_0079214 3300046665 Bacteria 1898
569 Ga0495588_0049897 3300046674 Bacteria 2153
570 Ga0495623_0004849 3300046679 Bacteria 8825
571 Ga0495623_0053390 3300046679 Bacteria 2552
572 Ga0495646_0038638 3300046680 Bacteria 2946
573 Ga0495647_0009849 3300046681 Bacteria 3245
574 Ga0495658_0033412 3300046683 Bacteria 2817
575 Ga0495658_0045587 3300046683 Bacteria 2461
576 Ga0495624_0046293 3300046690 Bacteria 2766
577 Ga0495671_0052863 3300046692 Bacteria 2018
578 Ga0495649_0064668 3300046694 Bacteria 1964
579 Ga0495600_0083000 3300046809 Bacteria 2091
580 Ga0495581_0036050 3300047315 Bacteria 2862
581 Ga0495581_0052066 3300047315 Bacteria 2365
582 Ga0495604_0018955 3300047317 Bacteria 5509
583 Ga0495604_0030809 3300047317 Bacteria 4257
584 Ga0495674_0014695 3300047319 Bacteria 7327
585 Ga0495672_0046617 3300047320 Bacteria 2584
586 Ga0495672_0097344 3300047320 Bacteria 1602
587 Ga0495680_0086176 3300047322 Bacteria 2364
588 Ga0495675_0003891 3300047444 Bacteria 9052
589 Ga0495675_0009097 3300047444 Bacteria 6173
590 Ga0495684_0008620 3300047471 Bacteria 7892
591 Ga0495686_0036654 3300047472 Bacteria 3147
592 Ga0495593_0105613 3300047673 Unclassified 1441
593 Ga0495602_0012370 3300048088 Bacteria 8779
594 Ga0495602_0119735 3300048088 Bacteria 2120
595 Ga0495602_0162233 3300048088 Bacteria 1744
596 Ga0495626_0033986 3300048091 Bacteria 2441
597 Ga0495626_0083870 3300048091 Bacteria 1411
598 Ga0496100_0022978 3300048903 Bacteria 3781
599 Ga0496101_0011389 3300048904 Bacteria 5900
600 Ga0496101_0111578 3300048904 Bacteria 2059
601 Ga0496101_0230071 3300048904 Bacteria 1441
602 Ga0496102_0004325 3300048905 Bacteria 12013
603 Ga0496102_0009419 3300048905 Bacteria 8390
604 Ga0496102_0036387 3300048905 Bacteria 4435
605 Ga0496103_0006135 3300048906 Bacteria 7181
606 Ga0496103_0007472 3300048906 Bacteria 6514
607 Ga0496103_0206902 3300048906 Bacteria 1262
608 Ga0496104_0000064 3300048907 Bacteria 112084
609 Ga0496104_0013698 3300048907 Bacteria 7311
610 Ga0496104_0032361 3300048907 Bacteria 4867
611 Ga0496104_0038719 3300048907 Bacteria 4462
612 Ga0496104_0097120 3300048907 Bacteria 2819
613 Ga0496104_0114237 3300048907 Bacteria 2589
614 Ga0496104_0127665 3300048907 Bacteria 2442
615 Ga0496104_0157650 3300048907 Bacteria 2178
616 Ga0496104_0477792 3300048907 Bacteria 1158
617 Ga0496104_0520479 3300048907 Bacteria 1101
618 Ga0496105_0004178 3300048908 Bacteria 10847
619 Ga0496105_0004868 3300048908 Bacteria 10140
620 Ga0496105_0007989 3300048908 Bacteria 8224
621 Ga0496105_0033160 3300048908 Bacteria 4240
622 Ga0496105_0047746 3300048908 Bacteria 3533
623 Ga0496105_0153677 3300048908 Bacteria 1891
624 Ga0496106_0009196 3300048909 Bacteria 7296
625 Ga0496106_0063359 3300048909 Bacteria 2810
626 Ga0496106_0130191 3300048909 Bacteria 1973
627 Ga0496106_0343276 3300048909 Bacteria 1199
628 Ga0496107_0003386 3300048910 Bacteria 10662
629 Ga0496107_0015375 3300048910 Bacteria 5363
630 Ga0496107_0089587 3300048910 Bacteria 2247
631 Ga0496108_0000378 3300048911 Bacteria 37061
632 Ga0496108_0001892 3300048911 Bacteria 16769
633 Ga0496108_0015446 3300048911 Bacteria 6228
634 Ga0496108_0023560 3300048911 Bacteria 5067
635 Ga0496108_0051787 3300048911 Bacteria 3439
636 Ga0496108_0139622 3300048911 Bacteria 2087
637 Ga0496108_0164187 3300048911 Bacteria 1920
638 Ga0496108_0378468 3300048911 Bacteria 1236
639 Ga0496109_0000386 3300048912 Bacteria 39999
640 Ga0496109_0002039 3300048912 Bacteria 16741
641 Ga0496109_0015519 3300048912 Bacteria 6641
642 Ga0496109_0022636 3300048912 Bacteria 5566
643 Ga0496109_0075201 3300048912 Bacteria 3105
644 Ga0496109_0075800 3300048912 Bacteria 3092
645 Ga0496109_0139178 3300048912 Bacteria 2269
646 Ga0496109_0187075 3300048912 Bacteria 1946
647 Ga0496109_0369859 3300048912 Bacteria 1354
648 Ga0496109_0381374 3300048912 Bacteria 1332
649 Ga0496110_0001431 3300048913 Bacteria 17258
650 Ga0496110_0050899 3300048913 Bacteria 3639
651 Ga0496110_0075637 3300048913 Bacteria 2992
652 Ga0496110_0218178 3300048913 Bacteria 1734
653 Ga0496110_0224258 3300048913 Bacteria 1709
654 Ga0496110_0244007 3300048913 Bacteria 1635
655 Ga0496110_0340113 3300048913 Bacteria 1367
656 Ga0496110_0387683 3300048913 Bacteria 1273
657 Ga0496111_0000314 3300048914 Bacteria 23921
658 Ga0496111_0000958 3300048914 Bacteria 15764
659 Ga0496111_0010973 3300048914 Bacteria 6095
660 Ga0496111_0012151 3300048914 Bacteria 5823
661 Ga0496111_0052500 3300048914 Bacteria 2944
662 Ga0496111_0103750 3300048914 Bacteria 2091
663 Ga0496112_0000681 3300048915 Bacteria 23700
664 Ga0496112_0003469 3300048915 Bacteria 13040
665 Ga0496112_0052980 3300048915 Bacteria 3984
666 Ga0496112_0106907 3300048915 Bacteria 2768
667 Ga0496112_0130104 3300048915 Bacteria 2488
668 Ga0496112_0184408 3300048915 Bacteria 2050
669 Ga0496112_0259193 3300048915 Bacteria 1688
670 Ga0496112_0363335 3300048915 Bacteria 1389
671 Ga0496112_0655450 3300048915 Bacteria 979
672 Ga0496113_0000206 3300048916 Bacteria 27352
673 Ga0496113_0000597 3300048916 Bacteria 18003
674 Ga0496113_0001350 3300048916 Bacteria 13586
675 Ga0496113_0013882 3300048916 Bacteria 5475
676 Ga0496113_0057399 3300048916 Bacteria 2925
677 Ga0496113_0070809 3300048916 Bacteria 2652
678 Ga0496114_0007174 3300048917 Bacteria 8793
679 Ga0496114_0067641 3300048917 Bacteria 2997
680 Ga0496114_0091345 3300048917 Bacteria 2586
681 Ga0496115_0014496 3300048918 Bacteria 5968
682 Ga0496115_0040846 3300048918 Bacteria 3689
683 Ga0496115_0136183 3300048918 Bacteria 2025
684 Ga0496115_0187546 3300048918 Bacteria 1709
685 Ga0496115_0189016 3300048918 Bacteria 1701
686 Ga0496116_0001099 3300048919 Bacteria 32485
687 Ga0496117_0041849 3300048920 Bacteria 3350
688 Ga0496117_0159468 3300048920 Bacteria 1324
689 Ga0496118_0023726 3300048921 Bacteria 5316
690 Ga0496118_0036135 3300048921 Bacteria 4000
691 Ga0496118_0043619 3300048921 Bacteria 3522
692 Ga0496118_0068161 3300048921 Bacteria 2586
693 Ga0496119_0049689 3300048922 Bacteria 2591
694 Ga0496119_0056562 3300048922 Bacteria 2377
695 Ga0496120_0026457 3300048923 Bacteria 3582
696 Ga0496121_0000385 3300048924 Bacteria 90105
697 Ga0496121_0004958 3300048924 Bacteria 17463
698 Ga0496121_0017055 3300048924 Bacteria 7448
699 Ga0496121_0017489 3300048924 Bacteria 7321
700 Ga0496121_0017759 3300048924 Bacteria 7235
701 Ga0496121_0019762 3300048924 Bacteria 6714
702 Ga0496121_0072659 3300048924 Bacteria 2761
703 Ga0496121_0114106 3300048924 Bacteria 2054
704 Ga0496122_0000528 3300048925 Bacteria 79201
705 Ga0496122_0030398 3300048925 Bacteria 4525
706 Ga0496123_0001698 3300048926 Bacteria 29435
707 Ga0496124_0000004 3300048927 Bacteria 976131
708 Ga0496124_0061900 3300048927 Bacteria 3135
709 Ga0496124_0130813 3300048927 Bacteria 1994
710 Ga0496125_0003427 3300048928 Bacteria 19225
711 Ga0496125_0006164 3300048928 Bacteria 13070
712 Ga0496125_0013040 3300048928 Bacteria 8201
713 Ga0496125_0029663 3300048928 Bacteria 4911
714 Ga0496125_0034775 3300048928 Bacteria 4434
715 Ga0496125_0070568 3300048928 Bacteria 2734
716 Ga0496126_0001329 3300048929 Bacteria 39310
717 Ga0496126_0007328 3300048929 Bacteria 12113
718 Ga0496126_0015687 3300048929 Bacteria 7612
719 Ga0496126_0022525 3300048929 Bacteria 6127
720 Ga0496126_0038938 3300048929 Bacteria 4418
721 Ga0496126_0083503 3300048929 Bacteria 2819
722 Ga0496126_0115348 3300048929 Bacteria 2336
723 Ga0496126_0123529 3300048929 Bacteria 2242
724 Ga0496126_0364539 3300048929 Bacteria 1179
725 Ga0501032_0047451 3300049569 Bacteria 2900
726 Ga0501033_0017045 3300049570 Bacteria 5491
727 Ga0501033_0056081 3300049570 Bacteria 2913
728 Ga0501033_0161827 3300049570 Bacteria 1611
729 Ga0501034_0024944 3300049571 Bacteria 6083
730 Ga0501034_0026362 3300049571 Bacteria 5919
731 Ga0501036_0019499 3300049572 Bacteria 5695
732 Ga0501036_0165046 3300049572 Bacteria 1867
733 Ga0501036_0394224 3300049572 Bacteria 1155
734 Ga0501038_0106917 3300049574 Bacteria 2321
735 Ga0501038_0204666 3300049574 Bacteria 1582
736 Ga0501039_0031975 3300049575 Bacteria 4057
737 Ga0501039_0411612 3300049575 Bacteria 1062
738 Ga0501040_0038136 3300049576 Bacteria 3266
739 Ga0501040_0149255 3300049576 Bacteria 1648
740 Ga0501041_0020793 3300049577 Bacteria 3927
741 Ga0501041_0038497 3300049577 Bacteria 2900
742 Ga0501041_0050299 3300049577 Bacteria 2540
743 Ga0501042_0029949 3300049578 Bacteria 3842
744 Ga0501042_0050955 3300049578 Bacteria 2953
745 Ga0501042_0146443 3300049578 Bacteria 1703
746 Ga0501043_0055748 3300049579 Bacteria 3105
747 Ga0501043_0164793 3300049579 Bacteria 1731
748 Ga0501046_0006011 3300049580 Bacteria 10798
749 Ga0501046_0063080 3300049580 Bacteria 2894
750 Ga0501046_0119377 3300049580 Bacteria 2008
751 Ga0501046_0225932 3300049580 Bacteria 1385
752 Ga0501047_0009379 3300049581 Bacteria 9245
753 Ga0501048_0178384 3300049582 Bacteria 1506
754 Ga0501070_0035967 3300049586 Bacteria 4136
755 Ga0501070_0061978 3300049586 Bacteria 3098
756 Ga0501070_0085226 3300049586 Bacteria 2616
757 Ga0501070_0140089 3300049586 Bacteria 1997
758 Ga0501071_0014840 3300049587 Bacteria 5336
759 Ga0501071_0072383 3300049587 Bacteria 2514
760 Ga0501071_0249090 3300049587 Bacteria 1341
761 Ga0501072_0004729 3300049588 Bacteria 10373
762 Ga0501072_0008188 3300049588 Bacteria 7936
763 Ga0501072_0019484 3300049588 Bacteria 5246
764 Ga0501072_0069334 3300049588 Bacteria 2784
765 Ga0501074_0072720 3300049590 Bacteria 2470
766 Ga0501074_0161020 3300049590 Bacteria 1603
767 Ga0501075_0003767 3300049591 Bacteria 10188
768 Ga0501075_0035408 3300049591 Bacteria 3723
769 Ga0501075_0175249 3300049591 Bacteria 1637
770 Ga0501076_0002632 3300049592 Bacteria 12380
771 Ga0501076_0088720 3300049592 Bacteria 2485
772 Ga0501076_0270348 3300049592 Bacteria 1392
773 Ga0501079_0011381 3300049741 Bacteria 6790
774 Ga0501079_0012771 3300049741 Bacteria 6416
775 Ga0501079_0019453 3300049741 Bacteria 5186
776 Ga0501079_0063679 3300049741 Bacteria 2845
777 Ga0501080_0007756 3300049742 Bacteria 9703
778 Ga0501080_0256665 3300049742 Bacteria 1593
779 Ga0501081_0044648 3300049743 Bacteria 3042
780 Ga0501081_0175615 3300049743 Bacteria 1548
781 Ga0501081_0301681 3300049743 Bacteria 1175
782 Ga0501083_0039745 3300049744 Bacteria 3195
783 Ga0501083_0195204 3300049744 Bacteria 1321
784 Ga0501083_0210194 3300049744 Bacteria 1268
785 Ga0501035_0016279 3300049822 Bacteria 6861
786 Ga0501035_0033610 3300049822 Bacteria 4663
787 Ga0501044_0087986 3300049823 Bacteria 3136
788 Ga0501044_0266397 3300049823 Bacteria 1650
789 Ga0501044_0361345 3300049823 Bacteria 1370
790 Ga0501045_0000328 3300049824 Bacteria 27844
791 Ga0501045_0078869 3300049824 Bacteria 2428
792 Ga0501045_0187412 3300049824 Bacteria 1542
793 Ga0501045_0205484 3300049824 Bacteria 1467
794 nmdc:mga03683_5781_c1 3300050489 Bacteria 4198
795 nmdc:mga03n38_181532_c1 3300050490 Bacteria 1078
796 nmdc:mga03n38_21055_c1 3300050490 Bacteria 2618
797 nmdc:mga03n38_4978_c1 3300050490 Bacteria 4469
798 nmdc:mga00v17_11124_c1 3300050491 Bacteria 4937
799 nmdc:mga00v17_116283_c1 3300050491 Bacteria 1700
800 nmdc:mga00v17_117840_c1 3300050491 Bacteria 1689
801 nmdc:mga0yw44_11160_c1 3300050492 Bacteria 4622
802 nmdc:mga0yw44_20547_c1 3300050492 Bacteria 3667
803 nmdc:mga0yw44_5724_c1 3300050492 Bacteria 5922
804 nmdc:mga0yw44_64731_c1 3300050492 Bacteria 2251
805 nmdc:mga0k408_96679_c1 3300050493 Bacteria 1739
806 nmdc:mga06z11_3902_c1 3300050494 Bacteria 5815
807 nmdc:mga06z11_7243_c1 3300050494 Bacteria 2635
808 nmdc:mga06z11_85195_c1 3300050494 Bacteria 1704
809 nmdc:mga04h51_1285_c1 3300050495 Bacteria 5796
810 nmdc:mga04h51_16333_c1 3300050495 Bacteria 2154
811 nmdc:mga07m45_69736_c1 3300050496 Bacteria 1999
812 nmdc:mga05p37_156332_c1 3300050507 Bacteria 2786
813 nmdc:mga05p37_186566_c1 3300050507 Bacteria 2521
814 nmdc:mga05p37_222666_c1 3300050507 Bacteria 2276
815 nmdc:mga05p37_278145_c1 3300050507 Bacteria 1997
816 nmdc:mga05p37_416_c1 3300050507 Bacteria 46050
817 nmdc:mga05p37_75754_c1 3300050507 Bacteria 4142
818 nmdc:mga09592_40498_c1 3300050508 Bacteria 3914
819 nmdc:mga09592_52428_c1 3300050508 Bacteria 3443
820 nmdc:mga09592_778_c1 3300050508 Bacteria 24622
821 nmdc:mga0qj67_12381_c1 3300050509 Bacteria 6425
822 nmdc:mga0qj67_148978_c1 3300050509 Bacteria 1898
823 nmdc:mga0qj67_16699_c1 3300050509 Bacteria 5572
824 nmdc:mga0qj67_171320_c1 3300050509 Bacteria 1763
825 nmdc:mga0qj67_25793_c1 3300050509 Bacteria 4546
826 nmdc:mga0qj67_304001_c1 3300050509 Bacteria 1292
827 nmdc:mga0qj67_35774_c1 3300050509 Bacteria 3884
828 nmdc:mga06r32_1227_c1 3300050510 Bacteria 23088
829 nmdc:mga06r32_131426_c1 3300050510 Bacteria 2476
830 nmdc:mga06r32_17258_c1 3300050510 Bacteria 6589
831 nmdc:mga06r32_21619_c1 3300050510 Bacteria 5941
832 nmdc:mga06r32_22348_c1 3300050510 Bacteria 5847
833 nmdc:mga06r32_244511_c1 3300050510 Bacteria 1782
834 nmdc:mga06r32_291121_c1 3300050510 Bacteria 1620
835 nmdc:mga06r32_2927_c1 3300050510 Bacteria 15312
836 nmdc:mga06r32_298284_c1 3300050510 Bacteria 1598
837 nmdc:mga06r32_325079_c1 3300050510 Bacteria 1523
838 nmdc:mga08y16_173347_c1 3300050511 Bacteria 2240
839 nmdc:mga08y16_76324_c1 3300050511 Bacteria 3493
840 nmdc:mga08y16_92306_c1 3300050511 Bacteria 3155
841 nmdc:mga0n895_22044_c1 3300050512 Bacteria 5969
842 nmdc:mga0n895_361535_c1 3300050512 Bacteria 1470
843 nmdc:mga0n895_435585_c1 3300050512 Bacteria 1324
844 nmdc:mga0n895_479237_c1 3300050512 Bacteria 1255
845 nmdc:mga0n895_94511_c1 3300050512 Bacteria 2993
846 nmdc:mga0rr50_434669_c1 3300050513 Bacteria 1111
847 nmdc:mga0rr50_572002_c1 3300050513 Bacteria 963
848 nmdc:mga0rr50_6667_c1 3300050513 Bacteria 7061
849 nmdc:mga0a205_101761_c1 3300050515 Bacteria 2772
850 nmdc:mga0a205_191916_c1 3300050515 Bacteria 1934
851 nmdc:mga0a205_335_c1 3300050515 Bacteria 35266
852 nmdc:mga0sz30_47096_c1 3300050516 Bacteria 1822
853 Ga0495601_0013359 3300053077 Bacteria 4937
854 Ga0495601_0021412 3300053077 Bacteria 3959
855 Ga0495601_0162141 3300053077 Bacteria 1461
856 Ga0495601_0394530 3300053077 Unclassified 897
857 Ga0495612_0007530 3300053078 Bacteria 4450
858 Ga0495612_0015354 3300053078 Bacteria 3069
859 Ga0495612_0063384 3300053078 Bacteria 1533
860 Ga0500635_0002895 3300053080 Bacteria 4270
861 Ga0495655_0005107 3300053083 Bacteria 2297
862 Ga0495595_0058430 3300053084 Bacteria 1801
863 Ga0495619_0030201 3300053085 Bacteria 3507
864 Ga0500643_000040 3300053087 Bacteria 168108
865 Ga0500646_0033522 3300053090 Bacteria 1421
866 Ga0500583_0003885 3300053092 Bacteria 4788
867 Ga0500651_0000787 3300053093 Bacteria 15478
868 Ga0500651_0023641 3300053093 Bacteria 3848
869 Ga0500566_0000005 3300053094 Bacteria 159299
870 Ga0500566_0001430 3300053094 Bacteria 13975
871 Ga0500640_004238 3300053095 Bacteria 5179
872 Ga0500640_061145 3300053095 Bacteria 1633
873 Ga0500641_0017337 3300053096 Bacteria 2692
874 Ga0500641_0071255 3300053096 Bacteria 1463
875 Ga0500650_0008348 3300053098 Bacteria 4090
876 Ga0500555_008753 3300053103 Bacteria 2889
877 Ga0500556_0000019 3300053104 Bacteria 186017
878 Ga0500556_0011374 3300053104 Bacteria 2635
879 Ga0500562_011024 3300053108 Bacteria 2294
880 Ga0500572_000164 3300053111 Bacteria 23114
881 Ga0500591_002791 3300053115 Bacteria 7259
882 Ga0500592_000378 3300053116 Bacteria 7482
883 Ga0500593_000284 3300053117 Bacteria 20609
884 Ga0500593_043337 3300053117 Bacteria 2009
885 Ga0500594_0003781 3300053118 Bacteria 3332
886 Ga0500595_000176 3300053119 Bacteria 42910
887 Ga0500595_002181 3300053119 Bacteria 9945
888 Ga0500595_003323 3300053119 Bacteria 7558
889 Ga0500595_007879 3300053119 Bacteria 4387
890 Ga0500607_035679 3300053121 Bacteria 2718
891 Ga0500608_001003 3300053122 Bacteria 10129
892 Ga0500608_009518 3300053122 Bacteria 4133
893 Ga0500614_000629 3300053123 Bacteria 8979
894 Ga0500614_007561 3300053123 Bacteria 2292
895 Ga0500642_0000048 3300053130 Bacteria 81787
896 Ga0500652_000394 3300053131 Bacteria 15616
897 Ga0500658_0096611 3300053134 Bacteria 1284
898 Ga0500559_0000543 3300053136 Bacteria 26112
899 Ga0500559_0000978 3300053136 Bacteria 17820
900 Ga0500559_0002490 3300053136 Bacteria 9482
901 Ga0500568_0000242 3300053139 Bacteria 46479
902 Ga0500568_0052815 3300053139 Bacteria 1594
903 Ga0500573_0009602 3300053140 Bacteria 5376
904 Ga0500577_0002021 3300053142 Bacteria 5194
905 Ga0500586_000115 3300053145 Bacteria 14310
906 Ga0500590_051710 3300053148 Bacteria 2087
907 Ga0500590_097370 3300053148 Bacteria 1418
908 Ga0500603_000097 3300053150 Bacteria 20631
909 Ga0500603_000900 3300053150 Bacteria 7049
910 Ga0500604_0000407 3300053151 Bacteria 11838
911 Ga0500616_0000059 3300053153 Bacteria 259741
912 Ga0500616_0005912 3300053153 Bacteria 8179
913 Ga0500622_0002088 3300053156 Bacteria 14880
914 Ga0500624_001594 3300053157 Bacteria 3469
915 Ga0500627_0008480 3300053158 Bacteria 3654
916 Ga0500630_000701 3300053159 Bacteria 15344
917 Ga0500633_0050632 3300053160 Bacteria 1432
918 Ga0500634_0132287 3300053161 Bacteria 1196
919 Ga0500638_023788 3300053162 Bacteria 2915
920 Ga0500638_053497 3300053162 Bacteria 1949
921 Ga0500639_000106 3300053163 Bacteria 39379
922 Ga0500639_068445 3300053163 Bacteria 1814
923 Ga0500636_0000028 3300053177 Bacteria 80398
924 Ga0500636_0001221 3300053177 Bacteria 13884
925 Ga0500637_0000119 3300053178 Bacteria 28866
926 Ga0500637_0019087 3300053178 Bacteria 3692
927 Ga0500645_013099 3300053730 Bacteria 2669
928 Ga0500645_025474 3300053730 Bacteria 1805
929 Ga0500601_000137 3300053737 Bacteria 14865
930 Ga0501084_0004628 3300054114 Bacteria 11238
931 Ga0501084_0026969 3300054114 Bacteria 4800
932 Ga0501084_0065115 3300054114 Bacteria 3049
933 Ga0501084_0125048 3300054114 Bacteria 2164
934 Ga0501082_0018381 3300060353 Bacteria 6020
935 Ga0501082_0024431 3300060353 Bacteria 5210
936 Ga0501082_0042663 3300060353 Bacteria 3910
937 Ga0501082_0053841 3300060353 Bacteria 3468
938 Ga0501082_0079675 3300060353 Bacteria 2826
939 Ga0501082_0087894 3300060353 Bacteria 2682
940 Ga0530510_0005801 3300061734 Bacteria 8554
941 Ga0530510_0027778 3300061734 Bacteria 4054
942 Ga0530510_0042778 3300061734 Bacteria 3273
943 Ga0530510_0047342 3300061734 Bacteria 3107
944 2509146916 2508501128 Bacteria 8613869
945 2511399170 2511231028 Bacteria 8046582
946 2513592593 2513237087 Bacteria 5817514
947 2513622213 2513237092 Bacteria 8341956
948 2513647102 2513237095 Bacteria 8976980
949 2513674510 2513237098 Bacteria 9902361
950 2513696629 2513237101 Bacteria 7952346
951 2513699649 2513237102 Bacteria 7703324
952 2517103706 2517093001 Bacteria 9002274
953 2523105686 2522572158 Bacteria 6514390
954 2524465023 2524023210 Bacteria 9029266
955 2545675152 2545555834 Bacteria 8130841
956 2551714257 2551306089 Bacteria 7162724
957 2596372189 2595698237 Bacteria 6712432
958 2599101796 2597490356 Bacteria 7030811
959 2603861732 2602042107 Bacteria 6226103
960 2617378463 2617270741 Bacteria 8201522
961 2644130974 2643221623 Bacteria 5239945
962 2793073773 2791355197 Bacteria 8420563
963 2818236140 2816332527 Bacteria 8933356
964 2824620292 2824617872 Bacteria 8814715
965 2824629557 2824626560 Bacteria 8813858
966 2824635877 2824635225 Bacteria 8785348
967 2824645307 2824644064 Bacteria 8743947
968 2824680393 2824679649 Bacteria 8248951
969 2824706626 2824704595 Bacteria 9667483
970 2824722957 2824714736 Bacteria 8717648
971 2824725286 2824723954 Bacteria 8758240
972 2824737525 2824732956 Bacteria 7810675
973 2824752595 2824746037 Bacteria 7911610
974 2824756567 2824753945 Bacteria 9787441
975 2824766061 2824763712 Bacteria 9792355
976 2837654353 2837651117 Bacteria 3772164
977 2841960124 2841957949 Bacteria 8652217
978 2842697884 2842694124 Bacteria 4063419
979 2842698929 2842698319 Bacteria 5190321
980 2846957940 2846952575 Bacteria 6587527
981 2847936723 2847930680 Bacteria 9342022
982 2848864438 2848858292 Bacteria 7391279
983 2857516201 2857509624 Bacteria 7472071
984 2857525921 2857524615 Bacteria 6615449
985 2857546215 2857542790 Bacteria 5326616
986 2871456714 2871451962 Bacteria 7336357
987 2874612363 2874604998 Bacteria 7834745
988 2874617352 2874612657 Bacteria 8252029
989 2874631697 2874628541 Bacteria 8630250
990 2876770372 2876761206 Bacteria 10111113
991 2879087933 2879083081 Bacteria 8587928
992 2879116284 2879110137 Bacteria 8907982
993 2881368241 2881364244 Bacteria 7710352
994 2885367133 2885366525 Bacteria 8326213
995 2885383535 2885383462 Bacteria 9473874
996 2888385028 2888378607 Bacteria 9652610
997 2889040928 2889033259 Bacteria 9099371
998 2889309566 2889306138 Bacteria 6358934
999 2893067798 2893066018 Bacteria 6158120
1000 2902410493 2902405164 Bacteria 6784948
1001 2903769419 2903768456 Bacteria 9749579
1002 2904715208 2904711408 Bacteria 9771557
1003 2906611714
1004 2906631271 2906626472 Bacteria 8826946
1005 2906646415 2906643746 Bacteria 8722424
1006 2908780708 2908775508 Bacteria 8092255
1007 2916004327 2916000859 Bacteria 6865702
1008 2916047436 2916041962 Bacteria 6820487
1009 2916076684 2916076590 Bacteria 6596108
1010 2919074218 2919073203 Bacteria 6531949
1011 2921208560 2921208531 Bacteria 6745326
1012 2922397521 2922393267 Bacteria 8285685
1013 2922427648
1014 2924181742 2924179722 Bacteria 6843264
1015 2924231036 2924228884 Bacteria 6633132
1016 2928129148 2928125067 Bacteria 5937560
1017 2929204031 2929199973 Bacteria 7260745
1018 2957412676 2957408893 Bacteria 6558585
1019 2960606132 2960603979 Bacteria 6898737
1020 2960691200 2960687367 Bacteria 6535474
1021 2967693939 2967693043 Bacteria 6804451
1022 2970098140 2970095765 Bacteria 6936963
1023 2970130714 2970129317 Bacteria 6806560
1024 2970164198 2970164137 Bacteria 6861252
1025 2970180779 2970177841 Bacteria 6768001
1026 3005477322 3005474847 Bacteria 9259049
1027 3005485225 3005483717 Bacteria 7877331
1028 3005507906 3005506211 Bacteria 6943378
1029 3005587483 3005587118 Bacteria 7794411
1030 641645805 641522639 Bacteria 7737025
1031 8002290610 8002285264 Bacteria 6717907
1032 8006969966 8006964411 Bacteria 8966052
1033 8006989556 8006984368 Bacteria 9651211
1034 8006995182 8006994254 Bacteria 8309700
1035 8016593621 8016583857 Bacteria 10421953
1036 8019559808 8019555841 Bacteria 9642137
1037 8019569914 8019565922 Bacteria 9639779
1038 8055911439 8055909800 Bacteria 7278581
1039 8056686898 8056681323 Bacteria 8472857
1040 Ga0075432_10020087
1041 JGI24737J22298_10032906
1042 JGI24744J21845_10002032
1043 JGI24033J26618_1003073
1044 JGI25153J46596_10000068
1045 JGI25153J46596_10000094
1046 JGI25153J46596_10002675
1047 JGI25160J50197_1000777
1048 JGI25404J52841_10000108
1049 Ga0055531_10018269
1050 Ga0065165_1001845
1051 Ga0065165_1005504
1052 Ga0065704_10020805
1053 Ga0070676_10035764
1054 Ga0070690_100040155
1055 Ga0070690_100123144
1056 Ga0070670_100010874
1057 Ga0070670_100051718
1058 Ga0068869_100055588
1059 Ga0068869_100119789
1060 Ga0068869_100175633
1061 Ga0070666_10147580
1062 Ga0070680_100011909
1063 Ga0070680_100013678
1064 Ga0070680_100177071
1065 Ga0068868_100023511
1066 Ga0070689_100059991
1067 Ga0070689_100082543
1068 Ga0070691_10009631
1069 Ga0070687_100002478
1070 Ga0070687_100064871
1071 Ga0070661_100331832
1072 Ga0070692_10120819
1073 Ga0070692_10155862
1074 Ga0070668_100109997
1075 Ga0070669_100013682
1076 Ga0070669_100060444
1077 Ga0070675_100003565
1078 Ga0070671_100012862
1079 Ga0070671_100053207
1080 Ga0070671_100063572
1081 Ga0070674_100039243
1082 Ga0070674_100060525
1083 Ga0070674_100287504
1084 Ga0070673_100084789
1085 Ga0070673_100469065
1086 Ga0070688_100002030
1087 Ga0070659_100032166
1088 Ga0070659_100060819
1089 Ga0070667_100004500
1090 Ga0070667_100030529
1091 Ga0070667_100113122
1092 Ga0070709_10004866
1093 Ga0070709_10199039
1094 Ga0070714_100001309
1095 Ga0070714_100204624
1096 Ga0070714_100429654
1097 Ga0070714_100464283
1098 Ga0070713_100002404
1099 Ga0070713_100138447
1100 Ga0070710_10004275
1101 Ga0070710_10177003
1102 Ga0070711_100000362
1103 Ga0070711_100015017
1104 Ga0070711_100028066
1105 Ga0070705_100004675
1106 Ga0070700_100018434
1107 Ga0070700_100115285
1108 Ga0070700_100215770
1109 Ga0070694_100002889
1110 Ga0070694_100138247
1111 Ga0070708_100008473
1112 Ga0070708_100062084
1113 Ga0070663_100007257
1114 Ga0070663_100021917
1115 Ga0070663_100029127
1116 Ga0070663_100031511
1117 Ga0070678_100042423
1118 Ga0070678_100071874
1119 Ga0070678_100195659
1120 Ga0070662_100081318
1121 Ga0070662_100174128
1122 Ga0070662_100175436
1123 Ga0070681_10020166
1124 Ga0070681_10066987
1125 Ga0070681_10152622
1126 Ga0068867_100033474
1127 Ga0068867_100045107
1128 Ga0070685_10029846
1129 Ga0070685_10076575
1130 Ga0070699_100000545
1131 Ga0070699_100035875
1132 Ga0070699_100116591
1133 Ga0070679_100113019
1134 Ga0070697_100015043
1135 Ga0068853_100031522
1136 Ga0068853_100056742
1137 Ga0068853_100444590
1138 Ga0070672_100004369
1139 Ga0070686_100005070
1140 Ga0070686_100366433
1141 Ga0070695_100004516
1142 Ga0070695_100007706
1143 Ga0070695_100191255
1144 Ga0070696_100000249
1145 Ga0070696_100012128
1146 Ga0070696_100057255
1147 Ga0070696_100183914
1148 Ga0070693_100008195
1149 Ga0070693_100124044
1150 Ga0070665_100115402
1151 Ga0070665_100165949
1152 Ga0070704_100029961
1153 Ga0070704_100048479
1154 Ga0070704_100174802
1155 Ga0068855_100025399
1156 Ga0068855_100060100
1157 Ga0068855_100123173
1158 Ga0070664_100043666
1159 Ga0068857_100014404
1160 Ga0068854_100079306
1161 Ga0068856_100108101
1162 Ga0068856_100166670
1163 Ga0068856_100252217
1164 Ga0070702_100005145
1165 Ga0070702_100267274
1166 Ga0068859_100016683
1167 Ga0068859_100039940
1168 Ga0068859_100284152
1169 Ga0068864_100045321
1170 Ga0068864_100168521
1171 Ga0068864_100575089
1172 Ga0068866_10001554
1173 Ga0068866_10005088
1174 Ga0068861_100011419
1175 Ga0068870_10064265
1176 Ga0068863_100082082
1177 Ga0068863_100567432
1178 Ga0068858_100005194
1179 Ga0068858_100025390
1180 Ga0068860_100016382
1181 Ga0068860_100049518
1182 Ga0068860_100369935
1183 Ga0068862_100005647
1184 Ga0081455_10000029
1185 Ga0081455_10003782
1186 Ga0081455_10005788
1187 Ga0081455_10031199
1188 Ga0081455_10052904
1189 Ga0081455_10057782
1190 Ga0081538_10006418
1191 Ga0081538_10017150
1192 Ga0081538_10020850
1193 Ga0081540_1000048
1194 Ga0081540_1000937
1195 Ga0081540_1001679
1196 Ga0081540_1005784
1197 Ga0081540_1008639
1198 Ga0081540_1015468
1199 Ga0081540_1020642
1200 Ga0081540_1058933
1201 Ga0081539_10004692
1202 Ga0070717_10002967
1203 Ga0070717_10074371
1204 Ga0075365_10003935
1205 Ga0075365_10021126
1206 Ga0075365_10039788
1207 Ga0075368_10000671
1208 Ga0075368_10007055
1209 Ga0075368_10072004
1210 Ga0075363_100000761
1211 Ga0075363_100013498
1212 Ga0075363_100153852
1213 Ga0075364_10009955
1214 Ga0075364_10013926
1215 Ga0075364_10094586
1216 Ga0070715_10011015
1217 Ga0070715_10059722
1218 Ga0070715_10076423
1219 Ga0070716_100011005
1220 Ga0070716_100013289
1221 Ga0070716_100018949
1222 Ga0070712_100057934
1223 Ga0070712_100064170
1224 Ga0070712_100140922
1225 Ga0075367_10002090
1226 Ga0075367_10035633
1227 Ga0075369_10000436
1228 Ga0075369_10008913
1229 Ga0075369_10012833
1230 Ga0075369_10079228
1231 Ga0075366_10022499
1232 Ga0075366_10078135
1233 Ga0097621_100145673
1234 Ga0075370_10041668
1235 Ga0075428_100024125
1236 Ga0075428_100053458
1237 Ga0075428_100058333
1238 Ga0075428_100069932
1239 Ga0075428_100096916
1240 Ga0075428_100100255
1241 Ga0075428_100117413
1242 Ga0075428_100194866
1243 Ga0075428_100200691
1244 Ga0075428_100204869
1245 Ga0075430_100007063
1246 Ga0075430_100012474
1247 Ga0075430_100014692
1248 Ga0075430_100115306
1249 Ga0075431_100001007
1250 Ga0075431_100002204
1251 Ga0075431_100004487
1252 Ga0075431_100020866
1253 Ga0075431_100026130
1254 Ga0075431_100055261
1255 Ga0075431_100206039
1256 Ga0075431_100258715
1257 Ga0075433_10000125
1258 Ga0075433_10075221
1259 Ga0075434_100008387
1260 Ga0075434_100377658
1261 Ga0075429_100000183
1262 Ga0075429_100020360
1263 Ga0075429_100050064
1264 Ga0068865_100067979
1265 Ga0097620_100016683
1266 Ga0097620_100039940
1267 Ga0097620_100284153
1268 Ga0099825_1033101
1269 Ga0079104_1000772
1270 Ga0075435_100006471
1271 Ga0075435_100175503
1272 Ga0105240_10021211
1273 Ga0111539_10003120
1274 Ga0111539_10010381
1275 Ga0111539_10035947
1276 Ga0111539_10168777
1277 Ga0105245_10003785
1278 Ga0105245_10039830
1279 Ga0105245_10080471
1280 Ga0105247_10006629
1281 Ga0105247_10034192
1282 Ga0105247_10077134
1283 Ga0114129_10005398
1284 Ga0114129_10021657
1285 Ga0114129_10221736
1286 Ga0114129_10409322
1287 Ga0105243_10027268
1288 Ga0105243_10115385
1289 Ga0105243_10138101
1290 Ga0105241_10029956
1291 Ga0105241_10127258
1292 Ga0105242_10104545
1293 Ga0105248_10014926
1294 Ga0105248_10043198
1295 Ga0105248_10260904
1296 Ga0105237_10046888
1297 Ga0105237_10244619
1298 Ga0105238_10072474
1299 Ga0105238_10183534
1300 Ga0105238_10201674
1301 Ga0105249_10107666
1302 Ga0105249_10108754
1303 Ga0105249_10256209
1304 Ga0105239_10128432
1305 Ga0105239_10147389
1306 Ga0105239_10155237
1307 Ga0105239_10209072
1308 Ga0105246_10006437
1309 Ga0105246_10008875
1310 Ga0105246_10063443
1311 Ga0105246_10079580
1312 Ga0157373_10022116
1313 Ga0157371_10285144
1314 Ga0157370_10034208
1315 Ga0157370_10090185
1316 Ga0157370_10090695
1317 Ga0157369_10259333
1318 Ga0157374_10051941
1319 Ga0157374_10262320
1320 Ga0157378_10136986
1321 Ga0163162_10103627
1322 Ga0163162_10142417
1323 Ga0163162_10541075
1324 Ga0157375_10009111
1325 Ga0163163_10003696
1326 Ga0163163_10008749
1327 Ga0163163_10093806
1328 Ga0163163_10294721
1329 Ga0163163_10312257
1330 Ga0157380_10098758
1331 Ga0182008_10053802
1332 Ga0157377_10226984
1333 Ga0157379_10019887
1334 Ga0157379_10039826
1335 Ga0157379_10046373
1336 Ga0157379_10150442
1337 Ga0157376_10003716
1338 Ga0157376_10196217
1339 Ga0157376_10226284
1340 Ga0214544_1000004
1341 Ga0214542_1000001
1342 Ga0214542_1027275
1343 Ga0214545_1000001
1344 Ga0214545_1028004
1345 Ga0214543_1000006
1346 Ga0214543_1029823
1347 Ga0213876_10000816
1348 Ga0213876_10000944
1349 Ga0213876_10024495
1350 Ga0213875_10000007
1351 Ga0209233_1007993
1352 Ga0209025_1066051
1353 Ga0209564_1001626
1354 Ga0209564_1008466
1355 Ga0209758_1000024
1356 Ga0209758_1000097
1357 Ga0209758_1002191
1358 Ga0209256_1001501
1359 Ga0207426_1000439
1360 Ga0209257_1000588
1361 Ga0209257_1018568
1362 Ga0207682_10001905
1363 Ga0207692_10010733
1364 Ga0207642_10104134
1365 Ga0207710_10011889
1366 Ga0207688_10001053
1367 Ga0207688_10019972
1368 Ga0207680_10236359
1369 Ga0207647_10011848
1370 Ga0207647_10022689
1371 Ga0207647_10030106
1372 Ga0207647_10038482
1373 Ga0207685_10025753
1374 Ga0207699_10010277
1375 Ga0207645_10008189
1376 Ga0207645_10010590
1377 Ga0207645_10127742
1378 Ga0207643_10003366
1379 Ga0207643_10020063
1380 Ga0207684_10108773
1381 Ga0207654_10252886
1382 Ga0207707_10018781
1383 Ga0207707_10072454
1384 Ga0207693_10001150
1385 Ga0207693_10016959
1386 Ga0207693_10024155
1387 Ga0207693_10027969
1388 Ga0207693_10129223
1389 Ga0207693_10195953
1390 Ga0207663_10002241
1391 Ga0207660_10008445
1392 Ga0207660_10068232
1393 Ga0207662_10002137
1394 Ga0207662_10072254
1395 Ga0207657_10013624
1396 Ga0207649_10067228
1397 Ga0207652_10125048
1398 Ga0207646_10039558
1399 Ga0207681_10170299
1400 Ga0207694_10047081
1401 Ga0207694_10156488
1402 Ga0207650_10039381
1403 Ga0207650_10148324
1404 Ga0207650_10150214
1405 Ga0207659_10194068
1406 Ga0207687_10001252
1407 Ga0207687_10013163
1408 Ga0207687_10021234
1409 Ga0207700_10022348
1410 Ga0207700_10217672
1411 Ga0207664_10036615
1412 Ga0207664_10121412
1413 Ga0207664_10244199
1414 Ga0207644_10040575
1415 Ga0207706_10030478
1416 Ga0207706_10126822
1417 Ga0207706_10142460
1418 Ga0207686_10009550
1419 Ga0207709_10033632
1420 Ga0207709_10039461
1421 Ga0207670_10003594
1422 Ga0207670_10091129
1423 Ga0207670_10290929
1424 Ga0207669_10026195
1425 Ga0207669_10032407
1426 Ga0207704_10068433
1427 Ga0207665_10000775
1428 Ga0207665_10002581
1429 Ga0207665_10024249
1430 Ga0207691_10022886
1431 Ga0207691_10024151
1432 Ga0207691_10163394
1433 Ga0207689_10002991
1434 Ga0207689_10009502
1435 Ga0207689_10304709
1436 Ga0207679_10061777
1437 Ga0207679_10211038
1438 Ga0207651_10157413
1439 Ga0207712_10004686
1440 Ga0207668_10237249
1441 Ga0207640_10027914
1442 Ga0207658_10010199
1443 Ga0207677_10004452
1444 Ga0207677_10105099
1445 Ga0207703_10007538
1446 Ga0207703_10007965
1447 Ga0207703_10084126
1448 Ga0207639_10096489
1449 Ga0207639_10299097
1450 Ga0207678_10002455
1451 Ga0207678_10016550
1452 Ga0207678_10031893
1453 Ga0207678_10057223
1454 Ga0207678_10081798
1455 Ga0207708_10002956
1456 Ga0207708_10040488
1457 Ga0207708_10095183
1458 Ga0207708_10128499
1459 Ga0207708_10131512
1460 Ga0207702_10140357
1461 Ga0207702_10260362
1462 Ga0207702_10375880
1463 Ga0207702_10504217
1464 Ga0207641_10010922
1465 Ga0207641_10111317
1466 Ga0207648_10003243
1467 Ga0207648_10004365
1468 Ga0207648_10009198
1469 Ga0207648_10391202
1470 Ga0207676_10002494
1471 Ga0207676_10015497
1472 Ga0207674_10017744
1473 Ga0207674_10026785
1474 Ga0207674_10111536
1475 Ga0207674_10153745
1476 Ga0207675_100005260
1477 Ga0207675_100061604
1478 Ga0207675_100072011
1479 Ga0207675_100126982
1480 Ga0207675_100379843
1481 Ga0207683_10048849
1482 Ga0207683_10260409
1483 Ga0207698_10298476
1484 Ga0209281_1000839
1485 Ga0209389_1000199
1486 Ga0209969_1001317
1487 Ga0209489_102148
1488 Ga0209700_100005
1489 Ga0209967_1002257
1490 Ga0210000_1003297
1491 Ga0209813_10000408
1492 Ga0209974_10020453
1493 Ga0207428_10040114
1494 Ga0268266_10022350
1495 Ga0268266_10024247
1496 Ga0268266_10040575
1497 Ga0268265_10001732
1498 Ga0268265_10119178
1499 Ga0268264_10100948
1500 Ga0307511_10000014
1501 Ga0265316_10190919
1502 Ga0307408_100053003
1503 Ga0265314_10004888
1504 Ga0316578_10020840
1505 Ga0307405_10074589
1506 Ga0307409_100107720
1507 Ga0307409_100439824
1508 Ga0307416_100478923
1509 Ga0307415_100027417
1510 Ga0307415_100159664
1511 Ga0307510_10045817
1512 Ga0307510_10047901
1513 Ga0373934_0003068
1514 Ga0373944_0005124
1515 Ga0373949_0004068
1516 Ga0373936_0045182
1517 Ga0373945_0011192
1518 Ga0373954_0004828
1519 Ga0373956_0009898
1520 Ga0373960_0009259
1521 Ga0373943_0004642
1522 Ga0373946_0016859
1523 Ga0373946_0044250
1524 Ga0373961_0004701
1525 Ga0373961_0020627
1526 Ga0316574_0003660
1527 Ga0373931_0000199
1528 Ga0373931_0001050
1529 Ga0373935_0158844
1530 Ga0373927_0105012
1531 Ga0373927_0162364
1532 Ga0373927_0179206
1533 Ga0373933_0001341
1534 Ga0373937_0178249
1535 Ga0316584_0010529
1536 Ga0373925_0048671
1537 Ga0395900_0264308
1538 Ga0395898_0162622
1539 Ga0395905_0069896
1540 Ga0436364_0207394
1541 Ga0436364_0286306
1542 Ga0436364_0430154
1543 Ga0436364_0434654
1544 Ga0395901_0385679
1545 Ga0436365_0159339
1546 Ga0436365_0413923
1547 Ga0436365_0736793
1548 Ga0436365_0940551
1549 Ga0436365_1187256
1550 Ga0436365_1368008
1551 Ga0436360_0504894
1552 Ga0436360_1076044
1553 Ga0436361_0905452
1554 Ga0436363_0287186
1555 Ga0436363_0313348
1556 Ga0436363_0703923
1557 Ga0436363_1475436
1558 Ga0436362_0274206
1559 Ga0450911_000064
1560 Ga0466966_0041438
1561 Ga0466963_0194984
1562 Ga0466968_0009238
1563 Ga0466970_0183530
1564 Ga0466957_0036272
1565 Ga0466957_0049790
1566 Ga0466959_0018887
1567 Ga0451576_0190182
1568 Ga0495603_0000815
1569 Ga0495603_0014909
1570 Ga0495603_0055846
1571 Ga0495638_0002133
1572 Ga0495638_0079907
1573 Ga0495651_0130767
1574 Ga0495605_0061752
1575 Ga0495585_0101648
1576 Ga0495594_0125454
1577 Ga0495596_0054852
1578 Ga0495610_0075765
1579 Ga0495616_0118733
1580 Ga0495618_0166601
1581 Ga0495628_0003683
1582 Ga0495630_0051524
1583 Ga0495632_0037042
1584 Ga0495632_0098174
1585 Ga0495637_0026576
1586 Ga0495643_0047109
1587 Ga0495648_0034559
1588 Ga0495648_0111791
1589 Ga0495652_0011271
1590 Ga0495652_0115861
1591 Ga0495654_0078628
1592 Ga0495640_0022824
1593 Ga0495587_0091556
1594 Ga0495621_0056061
1595 Ga0495597_0000256
1596 Ga0495645_0001496
1597 Ga0495645_0056473
1598 Ga0495622_0003864
1599 Ga0495622_0055459
1600 Ga0495667_0018521
1601 Ga0495656_0008757
1602 Ga0495656_0021968
1603 Ga0495668_0037199
1604 Ga0495611_0029563
1605 Ga0495625_0040647
1606 Ga0495635_0054834
1607 Ga0495661_0079214
1608 Ga0495588_0049897
1609 Ga0495623_0004849
1610 Ga0495623_0053390
1611 Ga0495646_0038638
1612 Ga0495647_0009849
1613 Ga0495658_0033412
1614 Ga0495658_0045587
1615 Ga0495624_0046293
1616 Ga0495671_0052863
1617 Ga0495649_0064668
1618 Ga0495600_0083000
1619 Ga0495581_0036050
1620 Ga0495581_0052066
1621 Ga0495604_0018955
1622 Ga0495604_0030809
1623 Ga0495674_0014695
1624 Ga0495672_0046617
1625 Ga0495672_0097344
1626 Ga0495680_0086176
1627 Ga0495675_0003891
1628 Ga0495675_0009097
1629 Ga0495684_0008620
1630 Ga0495686_0036654
1631 Ga0495593_0105613
1632 Ga0495602_0012370
1633 Ga0495602_0119735
1634 Ga0495602_0162233
1635 Ga0495626_0033986
1636 Ga0495626_0083870
1637 Ga0496100_0022978
1638 Ga0496101_0011389
1639 Ga0496101_0111578
1640 Ga0496101_0230071
1641 Ga0496102_0004325
1642 Ga0496102_0009419
1643 Ga0496102_0036387
1644 Ga0496103_0006135
1645 Ga0496103_0007472
1646 Ga0496103_0206902
1647 Ga0496104_0000064
1648 Ga0496104_0013698
1649 Ga0496104_0032361
1650 Ga0496104_0038719
1651 Ga0496104_0097120
1652 Ga0496104_0114237
1653 Ga0496104_0127665
1654 Ga0496104_0157650
1655 Ga0496104_0477792
1656 Ga0496104_0520479
1657 Ga0496105_0004178
1658 Ga0496105_0004868
1659 Ga0496105_0007989
1660 Ga0496105_0033160
1661 Ga0496105_0047746
1662 Ga0496105_0153677
1663 Ga0496106_0009196
1664 Ga0496106_0063359
1665 Ga0496106_0130191
1666 Ga0496106_0343276
1667 Ga0496107_0003386
1668 Ga0496107_0015375
1669 Ga0496107_0089587
1670 Ga0496108_0000378
1671 Ga0496108_0001892
1672 Ga0496108_0015446
1673 Ga0496108_0023560
1674 Ga0496108_0051787
1675 Ga0496108_0139622
1676 Ga0496108_0164187
1677 Ga0496108_0378468
1678 Ga0496109_0000386
1679 Ga0496109_0002039
1680 Ga0496109_0015519
1681 Ga0496109_0022636
1682 Ga0496109_0075201
1683 Ga0496109_0075800
1684 Ga0496109_0139178
1685 Ga0496109_0187075
1686 Ga0496109_0369859
1687 Ga0496109_0381374
1688 Ga0496110_0001431
1689 Ga0496110_0050899
1690 Ga0496110_0075637
1691 Ga0496110_0218178
1692 Ga0496110_0224258
1693 Ga0496110_0244007
1694 Ga0496110_0340113
1695 Ga0496110_0387683
1696 Ga0496111_0000314
1697 Ga0496111_0000958
1698 Ga0496111_0010973
1699 Ga0496111_0012151
1700 Ga0496111_0052500
1701 Ga0496111_0103750
1702 Ga0496112_0000681
1703 Ga0496112_0003469
1704 Ga0496112_0052980
1705 Ga0496112_0106907
1706 Ga0496112_0130104
1707 Ga0496112_0184408
1708 Ga0496112_0259193
1709 Ga0496112_0363335
1710 Ga0496112_0655450
1711 Ga0496113_0000206
1712 Ga0496113_0000597
1713 Ga0496113_0001350
1714 Ga0496113_0013882
1715 Ga0496113_0057399
1716 Ga0496113_0070809
1717 Ga0496114_0007174
1718 Ga0496114_0067641
1719 Ga0496114_0091345
1720 Ga0496115_0014496
1721 Ga0496115_0040846
1722 Ga0496115_0136183
1723 Ga0496115_0187546
1724 Ga0496115_0189016
1725 Ga0496116_0001099
1726 Ga0496117_0041849
1727 Ga0496117_0159468
1728 Ga0496118_0023726
1729 Ga0496118_0036135
1730 Ga0496118_0043619
1731 Ga0496118_0068161
1732 Ga0496119_0049689
1733 Ga0496119_0056562
1734 Ga0496120_0026457
1735 Ga0496121_0000385
1736 Ga0496121_0004958
1737 Ga0496121_0017055
1738 Ga0496121_0017489
1739 Ga0496121_0017759
1740 Ga0496121_0019762
1741 Ga0496121_0072659
1742 Ga0496121_0114106
1743 Ga0496122_0000528
1744 Ga0496122_0030398
1745 Ga0496123_0001698
1746 Ga0496124_0000004
1747 Ga0496124_0061900
1748 Ga0496124_0130813
1749 Ga0496125_0003427
1750 Ga0496125_0006164
1751 Ga0496125_0013040
1752 Ga0496125_0029663
1753 Ga0496125_0034775
1754 Ga0496125_0070568
1755 Ga0496126_0001329
1756 Ga0496126_0007328
1757 Ga0496126_0015687
1758 Ga0496126_0022525
1759 Ga0496126_0038938
1760 Ga0496126_0083503
1761 Ga0496126_0115348
1762 Ga0496126_0123529
1763 Ga0496126_0364539
1764 Ga0501032_0047451
1765 Ga0501033_0017045
1766 Ga0501033_0056081
1767 Ga0501033_0161827
1768 Ga0501034_0024944
1769 Ga0501034_0026362
1770 Ga0501036_0019499
1771 Ga0501036_0165046
1772 Ga0501036_0394224
1773 Ga0501038_0106917
1774 Ga0501038_0204666
1775 Ga0501039_0031975
1776 Ga0501039_0411612
1777 Ga0501040_0038136
1778 Ga0501040_0149255
1779 Ga0501041_0020793
1780 Ga0501041_0038497
1781 Ga0501041_0050299
1782 Ga0501042_0029949
1783 Ga0501042_0050955
1784 Ga0501042_0146443
1785 Ga0501043_0055748
1786 Ga0501043_0164793
1787 Ga0501046_0006011
1788 Ga0501046_0063080
1789 Ga0501046_0119377
1790 Ga0501046_0225932
1791 Ga0501047_0009379
1792 Ga0501048_0178384
1793 Ga0501070_0035967
1794 Ga0501070_0061978
1795 Ga0501070_0085226
1796 Ga0501070_0140089
1797 Ga0501071_0014840
1798 Ga0501071_0072383
1799 Ga0501071_0249090
1800 Ga0501072_0004729
1801 Ga0501072_0008188
1802 Ga0501072_0019484
1803 Ga0501072_0069334
1804 Ga0501074_0072720
1805 Ga0501074_0161020
1806 Ga0501075_0003767
1807 Ga0501075_0035408
1808 Ga0501075_0175249
1809 Ga0501076_0002632
1810 Ga0501076_0088720
1811 Ga0501076_0270348
1812 Ga0501079_0011381
1813 Ga0501079_0012771
1814 Ga0501079_0019453
1815 Ga0501079_0063679
1816 Ga0501080_0007756
1817 Ga0501080_0256665
1818 Ga0501081_0044648
1819 Ga0501081_0175615
1820 Ga0501081_0301681
1821 Ga0501083_0039745
1822 Ga0501083_0195204
1823 Ga0501083_0210194
1824 Ga0501035_0016279
1825 Ga0501035_0033610
1826 Ga0501044_0087986
1827 Ga0501044_0266397
1828 Ga0501044_0361345
1829 Ga0501045_0000328
1830 Ga0501045_0078869
1831 Ga0501045_0187412
1832 Ga0501045_0205484
1833 nmdc:mga03683_5781_c1
1834 nmdc:mga03n38_181532_c1
1835 nmdc:mga03n38_21055_c1
1836 nmdc:mga03n38_4978_c1
1837 nmdc:mga00v17_11124_c1
1838 nmdc:mga00v17_116283_c1
1839 nmdc:mga00v17_117840_c1
1840 nmdc:mga0yw44_11160_c1
1841 nmdc:mga0yw44_20547_c1
1842 nmdc:mga0yw44_5724_c1
1843 nmdc:mga0yw44_64731_c1
1844 nmdc:mga0k408_96679_c1
1845 nmdc:mga06z11_3902_c1
1846 nmdc:mga06z11_7243_c1
1847 nmdc:mga06z11_85195_c1
1848 nmdc:mga04h51_1285_c1
1849 nmdc:mga04h51_16333_c1
1850 nmdc:mga07m45_69736_c1
1851 nmdc:mga05p37_156332_c1
1852 nmdc:mga05p37_186566_c1
1853 nmdc:mga05p37_222666_c1
1854 nmdc:mga05p37_278145_c1
1855 nmdc:mga05p37_416_c1
1856 nmdc:mga05p37_75754_c1
1857 nmdc:mga09592_40498_c1
1858 nmdc:mga09592_52428_c1
1859 nmdc:mga09592_778_c1
1860 nmdc:mga0qj67_12381_c1
1861 nmdc:mga0qj67_148978_c1
1862 nmdc:mga0qj67_16699_c1
1863 nmdc:mga0qj67_171320_c1
1864 nmdc:mga0qj67_25793_c1
1865 nmdc:mga0qj67_304001_c1
1866 nmdc:mga0qj67_35774_c1
1867 nmdc:mga06r32_1227_c1
1868 nmdc:mga06r32_131426_c1
1869 nmdc:mga06r32_17258_c1
1870 nmdc:mga06r32_21619_c1
1871 nmdc:mga06r32_22348_c1
1872 nmdc:mga06r32_244511_c1
1873 nmdc:mga06r32_291121_c1
1874 nmdc:mga06r32_2927_c1
1875 nmdc:mga06r32_298284_c1
1876 nmdc:mga06r32_325079_c1
1877 nmdc:mga08y16_173347_c1
1878 nmdc:mga08y16_76324_c1
1879 nmdc:mga08y16_92306_c1
1880 nmdc:mga0n895_22044_c1
1881 nmdc:mga0n895_361535_c1
1882 nmdc:mga0n895_435585_c1
1883 nmdc:mga0n895_479237_c1
1884 nmdc:mga0n895_94511_c1
1885 nmdc:mga0rr50_434669_c1
1886 nmdc:mga0rr50_572002_c1
1887 nmdc:mga0rr50_6667_c1
1888 nmdc:mga0a205_101761_c1
1889 nmdc:mga0a205_191916_c1
1890 nmdc:mga0a205_335_c1
1891 nmdc:mga0sz30_47096_c1
1892 Ga0495601_0013359
1893 Ga0495601_0021412
1894 Ga0495601_0162141
1895 Ga0495601_0394530
1896 Ga0495612_0007530
1897 Ga0495612_0015354
1898 Ga0495612_0063384
1899 Ga0500635_0002895
1900 Ga0495655_0005107
1901 Ga0495595_0058430
1902 Ga0495619_0030201
1903 Ga0500643_000040
1904 Ga0500646_0033522
1905 Ga0500583_0003885
1906 Ga0500651_0000787
1907 Ga0500651_0023641
1908 Ga0500566_0000005
1909 Ga0500566_0001430
1910 Ga0500640_004238
1911 Ga0500640_061145
1912 Ga0500641_0017337
1913 Ga0500641_0071255
1914 Ga0500650_0008348
1915 Ga0500555_008753
1916 Ga0500556_0000019
1917 Ga0500556_0011374
1918 Ga0500562_011024
1919 Ga0500572_000164
1920 Ga0500591_002791
1921 Ga0500592_000378
1922 Ga0500593_000284
1923 Ga0500593_043337
1924 Ga0500594_0003781
1925 Ga0500595_000176
1926 Ga0500595_002181
1927 Ga0500595_003323
1928 Ga0500595_007879
1929 Ga0500607_035679
1930 Ga0500608_001003
1931 Ga0500608_009518
1932 Ga0500614_000629
1933 Ga0500614_007561
1934 Ga0500642_0000048
1935 Ga0500652_000394
1936 Ga0500658_0096611
1937 Ga0500559_0000543
1938 Ga0500559_0000978
1939 Ga0500559_0002490
1940 Ga0500568_0000242
1941 Ga0500568_0052815
1942 Ga0500573_0009602
1943 Ga0500577_0002021
1944 Ga0500586_000115
1945 Ga0500590_051710
1946 Ga0500590_097370
1947 Ga0500603_000097
1948 Ga0500603_000900
1949 Ga0500604_0000407
1950 Ga0500616_0000059
1951 Ga0500616_0005912
1952 Ga0500622_0002088
1953 Ga0500624_001594
1954 Ga0500627_0008480
1955 Ga0500630_000701
1956 Ga0500633_0050632
1957 Ga0500634_0132287
1958 Ga0500638_023788
1959 Ga0500638_053497
1960 Ga0500639_000106
1961 Ga0500639_068445
1962 Ga0500636_0000028
1963 Ga0500636_0001221
1964 Ga0500637_0000119
1965 Ga0500637_0019087
1966 Ga0500645_013099
1967 Ga0500645_025474
1968 Ga0500601_000137
1969 Ga0501084_0004628
1970 Ga0501084_0026969
1971 Ga0501084_0065115
1972 Ga0501084_0125048
1973 Ga0501082_0018381
1974 Ga0501082_0024431
1975 Ga0501082_0042663
1976 Ga0501082_0053841
1977 Ga0501082_0079675
1978 Ga0501082_0087894
1979 Ga0530510_0005801
1980 Ga0530510_0027778
1981 Ga0530510_0042778
1982 Ga0530510_0047342
1983 2509146916
1984 2511399170
1985 2513592593
1986 2513622213
1987 2513647102
1988 2513674510
1989 2513696629
1990 2513699649
1991 2517103706
1992 2523105686
1993 2524465023
1994 2545675152
1995 2551714257
1996 2596372189
1997 2599101796
1998 2603861732
1999 2617378463
2000 2644130974
2001 2793073773
2002 2818236140
2003 2824620292
2004 2824629557
2005 2824635877
2006 2824645307
2007 2824680393
2008 2824706626
2009 2824722957
2010 2824725286
2011 2824737525
2012 2824752595
2013 2824756567
2014 2824766061
2015 2837654353
2016 2841960124
2017 2842697884
2018 2842698929
2019 2846957940
2020 2847936723
2021 2848864438
2022 2857516201
2023 2857525921
2024 2857546215
2025 2871456714
2026 2874612363
2027 2874617352
2028 2874631697
2029 2876770372
2030 2879087933
2031 2879116284
2032 2881368241
2033 2885367133
2034 2885383535
2035 2888385028
2036 2889040928
2037 2889309566
2038 2893067798
2039 2902410493
2040 2903769419
2041 2904715208
2042 2906611714
2043 2906631271
2044 2906646415
2045 2908780708
2046 2916004327
2047 2916047436
2048 2916076684
2049 2919074218
2050 2921208560
2051 2922397521
2052 2922427648
2053 2924181742
2054 2924231036
2055 2928129148
2056 2929204031
2057 2957412676
2058 2960606132
2059 2960691200
2060 2967693939
2061 2970098140
2062 2970130714
2063 2970164198
2064 2970180779
2065 3005477322
2066 3005485225
2067 3005507906
2068 3005587483
2069 641645805
2070 8002290610
2071 8006969966
2072 8006989556
2073 8006995182
2074 8016593621
2075 8019559808
2076 8019569914
2077 8055911439
2078 8056686898

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

24

310

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5093 28 314
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4984 28 314
1dow-assembly1.cif.gz_A crystal structure of a chimera of beta-catenin and alpha-catenin 0.3192 92 232
5mx5-assembly2.cif.gz_N mouse pa28alpha-beta 0.3079 59 244
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.3062 92 244
ID Description Score Start End Superfamily
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7869 26 309 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7867 27 308 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7844 25 309 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7791 25 309 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.779 26 309 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2V6RLS7-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9707 2 252 GO:0005886
GO:0015658
AF-A0A3B0RDG5-F1-model_v4 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) 0.9619 11 289 GO:0005886
GO:0015658
AF-A0A0Q4URT7-F1-model_v4 ABC transporter permease 0.9566 1 342 GO:0005886
GO:0015658
AF-A0A1F9D5E6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9529 2 326 GO:0005886
GO:0015658
AF-A0A086D618-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9518 2 316 GO:0005886
GO:0015658

Map