F488786

General Info

Members Datasets Scaffolds Average Seq Length
1039 348 1032 148

Family's Representative Sequence

Representative Sequence 3300012500|Ga0157314_1004845|Ga0157314_10048452
Length 172
Sequence MTSSPSSLPPQLAELVDEFAEVGPRDRLQLLLELSQELPELPDRYSDATASMEQVPECQSPLFLAVEVEPAGDRRVHLFFSAPPEAPTTRGFASILRTGLDGEPAAGILAVPDDFYVKLGLGQAVSPLRLRGMAAMLARIKRQVRAGVAGWGISVVEATSKLCEERSPPLPP

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
3 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
4 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
5 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
6 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
7 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
109 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
110 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
111 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
112 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
113 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
114 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
211 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
251 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
252 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
253 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
348 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.67
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.06
Rhizosphere 91.34
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003654 3300000549 Bacteria 2043
2 JGI24735J21928_10088676 3300002067 Bacteria 886
3 JGI25404J52841_10011177 3300003659 Bacteria 1934
4 Ga0070658_10104305 3300005327 Bacteria 2346
5 Ga0070658_11199661 3300005327 Bacteria 660
6 Ga0070676_10061481 3300005328 Bacteria 2233
7 Ga0070683_100010133 3300005329 Bacteria 8089
8 Ga0070683_100164581 3300005329 Bacteria 2104
9 Ga0070683_101075843 3300005329 Bacteria 772
10 Ga0070683_101556590 3300005329 Bacteria 636
11 Ga0070690_101526229 3300005330 Bacteria 540
12 Ga0070670_100214632 3300005331 Bacteria 1673
13 Ga0070670_100385794 3300005331 Bacteria 1235
14 Ga0068869_100048457 3300005334 Bacteria 3072
15 Ga0068869_100080265 3300005334 Bacteria 2433
16 Ga0068869_100194027 3300005334 Bacteria 1598
17 Ga0068869_100959253 3300005334 Bacteria 743
18 Ga0068869_101324989 3300005334 Bacteria 636
19 Ga0070666_10326768 3300005335 Bacteria 1095
20 Ga0070680_100219269 3300005336 Bacteria 1605
21 Ga0070682_100017777 3300005337 Bacteria 4147
22 Ga0070682_100045590 3300005337 Bacteria 2718
23 Ga0070682_100170657 3300005337 Bacteria 1511
24 Ga0070682_100239092 3300005337 Bacteria 1303
25 Ga0070682_100388346 3300005337 Bacteria 1052
26 Ga0070682_100414165 3300005337 Bacteria 1022
27 Ga0068868_100043012 3300005338 Bacteria 3528
28 Ga0068868_100073280 3300005338 Bacteria 2734
29 Ga0068868_100672822 3300005338 Bacteria 923
30 Ga0068868_101312291 3300005338 Bacteria 672
31 Ga0070660_100145004 3300005339 Bacteria 1907
32 Ga0070660_100424222 3300005339 Bacteria 1101
33 Ga0070689_100231932 3300005340 Bacteria 1518
34 Ga0070689_100284504 3300005340 Bacteria 1372
35 Ga0070687_100072860 3300005343 Bacteria 1849
36 Ga0070687_100126729 3300005343 Bacteria 1468
37 Ga0070687_100629113 3300005343 Bacteria 741
38 Ga0070661_100112341 3300005344 Bacteria 2035
39 Ga0070692_10106524 3300005345 Bacteria 1544
40 Ga0070692_11368045 3300005345 Bacteria 510
41 Ga0070668_100115767 3300005347 Bacteria 2137
42 Ga0070668_100139024 3300005347 Bacteria 1956
43 Ga0070668_100959467 3300005347 Bacteria 767
44 Ga0070668_101217430 3300005347 Bacteria 683
45 Ga0070669_100128058 3300005353 Bacteria 1945
46 Ga0070675_100409654 3300005354 Bacteria 1211
47 Ga0070675_100426706 3300005354 Bacteria 1186
48 Ga0070671_100006613 3300005355 Bacteria 9266
49 Ga0070671_100288097 3300005355 Bacteria 1397
50 Ga0070674_100051392 3300005356 Bacteria 2840
51 Ga0070674_100073178 3300005356 Bacteria 2429
52 Ga0070674_100960786 3300005356 Bacteria 748
53 Ga0070674_101383304 3300005356 Bacteria 630
54 Ga0070673_100121492 3300005364 Bacteria 2179
55 Ga0070688_100666547 3300005365 Bacteria 802
56 Ga0070659_100130430 3300005366 Bacteria 2041
57 Ga0070659_100178220 3300005366 Bacteria 1743
58 Ga0070667_100238828 3300005367 Bacteria 1622
59 Ga0070667_100373763 3300005367 Bacteria 1294
60 Ga0070667_100434140 3300005367 Bacteria 1199
61 Ga0070709_10089746 3300005434 Bacteria 2024
62 Ga0070709_10195797 3300005434 Bacteria 1428
63 Ga0070709_10266605 3300005434 Bacteria 1239
64 Ga0070714_100010968 3300005435 Bacteria 7178
65 Ga0070714_100085432 3300005435 Bacteria 2756
66 Ga0070714_100219711 3300005435 Bacteria 1746
67 Ga0070714_100282170 3300005435 Bacteria 1543
68 Ga0070714_100343810 3300005435 Bacteria 1400
69 Ga0070714_100456387 3300005435 Bacteria 1214
70 Ga0070714_100484702 3300005435 Bacteria 1178
71 Ga0070714_100745686 3300005435 Bacteria 946
72 Ga0070714_100897474 3300005435 Bacteria 860
73 Ga0070713_100066279 3300005436 Bacteria 3036
74 Ga0070713_100097647 3300005436 Bacteria 2539
75 Ga0070713_100324547 3300005436 Bacteria 1422
76 Ga0070713_100443980 3300005436 Bacteria 1217
77 Ga0070713_100547427 3300005436 Bacteria 1095
78 Ga0070713_100714225 3300005436 Bacteria 957
79 Ga0070713_100886238 3300005436 Bacteria 858
80 Ga0070710_10010220 3300005437 Bacteria 4606
81 Ga0070710_10025021 3300005437 Bacteria 3156
82 Ga0070710_10038180 3300005437 Bacteria 2636
83 Ga0070710_10123243 3300005437 Bacteria 1571
84 Ga0070710_10224077 3300005437 Bacteria 1197
85 Ga0070710_10250867 3300005437 Bacteria 1137
86 Ga0070710_10259639 3300005437 Bacteria 1120
87 Ga0070710_11085554 3300005437 Bacteria 587
88 Ga0070701_10057036 3300005438 Bacteria 2046
89 Ga0070701_10094393 3300005438 Bacteria 1645
90 Ga0070711_100093981 3300005439 Bacteria 2167
91 Ga0070711_100378670 3300005439 Bacteria 1144
92 Ga0070711_100445242 3300005439 Bacteria 1059
93 Ga0070711_100836482 3300005439 Bacteria 782
94 Ga0070711_100950369 3300005439 Bacteria 735
95 Ga0070705_100756102 3300005440 Bacteria 769
96 Ga0070700_100136296 3300005441 Bacteria 1662
97 Ga0070700_100301955 3300005441 Bacteria 1169
98 Ga0070700_100637938 3300005441 Bacteria 839
99 Ga0070694_100085169 3300005444 Bacteria 2206
100 Ga0070708_100067758 3300005445 Bacteria 3206
101 Ga0070708_100235526 3300005445 Bacteria 1718
102 Ga0070708_100282789 3300005445 Bacteria 1561
103 Ga0070708_100344647 3300005445 Bacteria 1404
104 Ga0070708_100770854 3300005445 Bacteria 904
105 Ga0070708_101327390 3300005445 Bacteria 672
106 Ga0070663_100071242 3300005455 Bacteria 2529
107 Ga0070663_100084123 3300005455 Bacteria 2344
108 Ga0070663_101133845 3300005455 Bacteria 685
109 Ga0070678_100058826 3300005456 Bacteria 2822
110 Ga0070662_101194932 3300005457 Bacteria 654
111 Ga0070685_10081386 3300005466 Bacteria 1942
112 Ga0070685_10125327 3300005466 Bacteria 1599
113 Ga0070685_10293079 3300005466 Bacteria 1094
114 Ga0070685_10359573 3300005466 Bacteria 998
115 Ga0070706_100014528 3300005467 Bacteria 7274
116 Ga0070706_100020291 3300005467 Bacteria 6124
117 Ga0070706_100061918 3300005467 Bacteria 3456
118 Ga0070706_100121825 3300005467 Bacteria 2431
119 Ga0070706_100369843 3300005467 Bacteria 1335
120 Ga0070706_100375891 3300005467 Bacteria 1323
121 Ga0070706_100508414 3300005467 Bacteria 1121
122 Ga0070706_100934721 3300005467 Bacteria 800
123 Ga0070707_100008637 3300005468 Bacteria 9452
124 Ga0070707_100032225 3300005468 Bacteria 4992
125 Ga0070707_100063807 3300005468 Bacteria 3535
126 Ga0070707_100574495 3300005468 Bacteria 1090
127 Ga0070707_100855700 3300005468 Bacteria 873
128 Ga0070707_100868332 3300005468 Bacteria 866
129 Ga0070707_100905693 3300005468 Bacteria 846
130 Ga0070698_100000308 3300005471 Bacteria 49751
131 Ga0070698_100101305 3300005471 Bacteria 2851
132 Ga0070698_100164232 3300005471 Bacteria 2163
133 Ga0070698_100189813 3300005471 Bacteria 1993
134 Ga0070698_100214794 3300005471 Bacteria 1857
135 Ga0070698_100348892 3300005471 Bacteria 1411
136 Ga0070698_100551986 3300005471 Bacteria 1091
137 Ga0070699_100293372 3300005518 Bacteria 1458
138 Ga0070699_100447674 3300005518 Bacteria 1171
139 Ga0070699_100516626 3300005518 Bacteria 1085
140 Ga0070699_100784151 3300005518 Bacteria 872
141 Ga0070699_101124410 3300005518 Bacteria 721
142 Ga0070679_100306096 3300005530 Bacteria 1539
143 Ga0070684_100328046 3300005535 Bacteria 1406
144 Ga0070684_100570997 3300005535 Bacteria 1050
145 Ga0070684_101073271 3300005535 Bacteria 756
146 Ga0070684_101299886 3300005535 Bacteria 684
147 Ga0070684_101410953 3300005535 Bacteria 656
148 Ga0070697_100004980 3300005536 Bacteria 10196
149 Ga0070697_100005122 3300005536 Bacteria 10067
150 Ga0070697_101253910 3300005536 Bacteria 661
151 Ga0068853_100197362 3300005539 Bacteria 1830
152 Ga0068853_100309321 3300005539 Bacteria 1462
153 Ga0068853_101578733 3300005539 Bacteria 636
154 Ga0070672_100585599 3300005543 Bacteria 971
155 Ga0070686_100067208 3300005544 Bacteria 2334
156 Ga0070686_100112399 3300005544 Bacteria 1858
157 Ga0070686_100214821 3300005544 Bacteria 1387
158 Ga0070696_100093758 3300005546 Bacteria 2141
159 Ga0070696_100097333 3300005546 Bacteria 2104
160 Ga0070693_100187885 3300005547 Bacteria 1334
161 Ga0070693_100270120 3300005547 Bacteria 1135
162 Ga0070693_100527194 3300005547 Bacteria 842
163 Ga0070665_100015619 3300005548 Bacteria 7626
164 Ga0070665_100308847 3300005548 Bacteria 1585
165 Ga0070665_100366743 3300005548 Bacteria 1447
166 Ga0070665_100472572 3300005548 Bacteria 1264
167 Ga0070665_100480081 3300005548 Bacteria 1254
168 Ga0070665_100698090 3300005548 Bacteria 1028
169 Ga0070665_100752493 3300005548 Bacteria 987
170 Ga0070665_100903229 3300005548 Bacteria 896
171 Ga0070665_101214992 3300005548 Bacteria 764
172 Ga0070704_100166852 3300005549 Bacteria 1747
173 Ga0068855_100315232 3300005563 Bacteria 1730
174 Ga0068855_102102916 3300005563 Bacteria 568
175 Ga0070664_100058853 3300005564 Bacteria 3268
176 Ga0070664_100393262 3300005564 Bacteria 1267
177 Ga0070664_100498746 3300005564 Bacteria 1122
178 Ga0070664_101563227 3300005564 Bacteria 624
179 Ga0068857_100146134 3300005577 Bacteria 2139
180 Ga0068857_101723658 3300005577 Bacteria 613
181 Ga0068854_100067452 3300005578 Bacteria 2606
182 Ga0068854_100123082 3300005578 Bacteria 1972
183 Ga0068854_100188554 3300005578 Bacteria 1615
184 Ga0068856_100089102 3300005614 Bacteria 3068
185 Ga0068856_100208657 3300005614 Bacteria 1968
186 Ga0068856_100380665 3300005614 Bacteria 1430
187 Ga0068856_100385112 3300005614 Bacteria 1422
188 Ga0068856_100553582 3300005614 Bacteria 1171
189 Ga0068856_101680397 3300005614 Bacteria 647
190 Ga0070702_100098795 3300005615 Bacteria 1786
191 Ga0068852_100023215 3300005616 Bacteria 4989
192 Ga0068852_100727427 3300005616 Bacteria 1004
193 Ga0068859_100090223 3300005617 Bacteria 3116
194 Ga0068864_100259012 3300005618 Bacteria 1617
195 Ga0068864_100338043 3300005618 Bacteria 1418
196 Ga0068864_100426400 3300005618 Bacteria 1264
197 Ga0068864_100849294 3300005618 Bacteria 899
198 Ga0068866_10034753 3300005718 Bacteria 2457
199 Ga0068861_100144239 3300005719 Bacteria 1947
200 Ga0068861_101188824 3300005719 Bacteria 737
201 Ga0068851_10076079 3300005834 Bacteria 1745
202 Ga0068851_10337054 3300005834 Bacteria 875
203 Ga0068870_10064193 3300005840 Bacteria 1983
204 Ga0068870_10088250 3300005840 Bacteria 1728
205 Ga0068870_10290919 3300005840 Bacteria 1028
206 Ga0068870_10395839 3300005840 Bacteria 898
207 Ga0068863_100050833 3300005841 Bacteria 3928
208 Ga0068863_100151463 3300005841 Bacteria 2219
209 Ga0068863_100267518 3300005841 Bacteria 1654
210 Ga0068863_100425178 3300005841 Bacteria 1302
211 Ga0068863_101476785 3300005841 Bacteria 688
212 Ga0068858_100141636 3300005842 Bacteria 2257
213 Ga0068858_100203922 3300005842 Bacteria 1871
214 Ga0068860_100053636 3300005843 Bacteria 3833
215 Ga0068860_100536568 3300005843 Bacteria 1171
216 Ga0068860_102601993 3300005843 Bacteria 525
217 Ga0068862_100198562 3300005844 Bacteria 1808
218 Ga0068862_101111707 3300005844 Bacteria 786
219 Ga0081540_1001418 3300005983 Bacteria 20736
220 Ga0070717_10004588 3300006028 Bacteria 10003
221 Ga0070717_10118622 3300006028 Bacteria 2264
222 Ga0070717_10297442 3300006028 Bacteria 1434
223 Ga0070717_10385994 3300006028 Bacteria 1256
224 Ga0070717_10391053 3300006028 Bacteria 1248
225 Ga0070717_10486228 3300006028 Bacteria 1115
226 Ga0070717_10557928 3300006028 Bacteria 1037
227 Ga0070717_10861681 3300006028 Bacteria 824
228 Ga0070717_11891003 3300006028 Bacteria 539
229 Ga0075432_10143774 3300006058 Bacteria 912
230 Ga0070715_10007549 3300006163 Bacteria 3748
231 Ga0070715_10032347 3300006163 Bacteria 2130
232 Ga0070715_10061303 3300006163 Bacteria 1651
233 Ga0070716_100027939 3300006173 Bacteria 3036
234 Ga0070712_100046024 3300006175 Bacteria 3015
235 Ga0070712_100180523 3300006175 Bacteria 1644
236 Ga0070712_100571476 3300006175 Bacteria 954
237 Ga0070712_101139784 3300006175 Bacteria 677
238 Ga0097621_100084496 3300006237 Bacteria 2646
239 Ga0097621_100313178 3300006237 Bacteria 1389
240 Ga0097621_100360564 3300006237 Bacteria 1295
241 Ga0097621_100533450 3300006237 Bacteria 1067
242 Ga0068871_100099025 3300006358 Bacteria 2440
243 Ga0068871_100223692 3300006358 Bacteria 1631
244 Ga0075433_10035089 3300006852 Bacteria 4311
245 Ga0075433_10584660 3300006852 Bacteria 981
246 Ga0075433_10649805 3300006852 Bacteria 925
247 Ga0075434_100036726 3300006871 Bacteria 4846
248 Ga0075434_100103356 3300006871 Bacteria 2857
249 Ga0075434_101772673 3300006871 Bacteria 624
250 Ga0068865_100143391 3300006881 Bacteria 1803
251 Ga0075436_100019486 3300006914 Bacteria 4649
252 Ga0075436_100849045 3300006914 Bacteria 681
253 Ga0075436_101314648 3300006914 Bacteria 547
254 Ga0097620_100090221 3300006931 Bacteria 3116
255 Ga0075435_100042367 3300007076 Bacteria 3642
256 Ga0075435_100044934 3300007076 Bacteria 3539
257 Ga0075435_101242608 3300007076 Bacteria 652
258 Ga0075435_101343885 3300007076 Bacteria 626
259 Ga0099794_10124513 3300007265 Bacteria 1299
260 Ga0105251_10054880 3300009011 Bacteria 1890
261 Ga0105240_10654932 3300009093 Bacteria 1151
262 Ga0105240_11234018 3300009093 Bacteria 791
263 Ga0111539_10276078 3300009094 Bacteria 1956
264 Ga0111539_10307871 3300009094 Bacteria 1844
265 Ga0111539_11437839 3300009094 Bacteria 800
266 Ga0105245_10084613 3300009098 Bacteria 2906
267 Ga0105245_10327120 3300009098 Bacteria 1512
268 Ga0105245_10939064 3300009098 Bacteria 908
269 Ga0105247_10115558 3300009101 Bacteria 1732
270 Ga0105247_10305072 3300009101 Bacteria 1106
271 Ga0105247_10428711 3300009101 Bacteria 948
272 Ga0105243_10972136 3300009148 Bacteria 850
273 Ga0105241_10145741 3300009174 Bacteria 1932
274 Ga0105241_11388256 3300009174 Bacteria 672
275 Ga0105248_11611908 3300009177 Bacteria 735
276 Ga0105248_12166737 3300009177 Bacteria 632
277 Ga0105237_10213237 3300009545 Bacteria 1930
278 Ga0105237_10822384 3300009545 Bacteria 936
279 Ga0105238_10129854 3300009551 Bacteria 2498
280 Ga0105249_10041106 3300009553 Bacteria 4202
281 Ga0105249_10496493 3300009553 Bacteria 1265
282 Ga0105249_12533046 3300009553 Bacteria 585
283 Ga0099796_10053526 3300010159 Bacteria 1408
284 Ga0105239_10259912 3300010375 Bacteria 1951
285 Ga0105239_10528798 3300010375 Bacteria 1342
286 Ga0105239_10957648 3300010375 Bacteria 983
287 Ga0105246_10077914 3300011119 Bacteria 2353
288 Ga0105246_10728530 3300011119 Bacteria 872
289 Ga0105246_11690965 3300011119 Bacteria 601
290 Ga0105246_11897251 3300011119 Bacteria 572
291 Ga0157343_1005703 3300012488 Bacteria 817
292 Ga0157314_1004845 3300012500 Bacteria 1003
293 Ga0157314_1005099 3300012500 Bacteria 988
294 Ga0157347_1008417 3300012502 Bacteria 1048
295 Ga0157313_1015068 3300012503 Bacteria 722
296 Ga0157342_1004643 3300012507 Bacteria 1229
297 Ga0157316_1021675 3300012510 Bacteria 708
298 Ga0157338_1007878 3300012515 Bacteria 1020
299 Ga0157373_10103326 3300013100 Bacteria 2004
300 Ga0157371_10039209 3300013102 Bacteria 3387
301 Ga0157371_10210603 3300013102 Bacteria 1395
302 Ga0157369_10039494 3300013105 Bacteria 5157
303 Ga0157369_10187760 3300013105 Bacteria 2173
304 Ga0157369_10219124 3300013105 Bacteria 1992
305 Ga0157369_10846810 3300013105 Bacteria 939
306 Ga0157369_10851300 3300013105 Bacteria 936
307 Ga0157369_10869402 3300013105 Bacteria 925
308 Ga0157369_11083434 3300013105 Bacteria 819
309 Ga0157374_11015790 3300013296 Bacteria 849
310 Ga0157378_10965584 3300013297 Bacteria 885
311 Ga0157378_12044892 3300013297 Bacteria 623
312 Ga0163162_10258861 3300013306 Bacteria 1872
313 Ga0163162_11027732 3300013306 Bacteria 932
314 Ga0157372_10075612 3300013307 Bacteria 3800
315 Ga0157372_10311525 3300013307 Bacteria 1832
316 Ga0157372_11945606 3300013307 Bacteria 676
317 Ga0157375_10304650 3300013308 Bacteria 1757
318 Ga0157375_10620938 3300013308 Bacteria 1239
319 Ga0157375_10959864 3300013308 Bacteria 996
320 Ga0157375_11735641 3300013308 Bacteria 739
321 Ga0157375_11754759 3300013308 Bacteria 735
322 Ga0163163_10080889 3300014325 Bacteria 3250
323 Ga0163163_10421235 3300014325 Bacteria 1394
324 Ga0163163_10445921 3300014325 Bacteria 1354
325 Ga0163163_10446241 3300014325 Bacteria 1354
326 Ga0163163_12411555 3300014325 Bacteria 584
327 Ga0163163_12918918 3300014325 Bacteria 533
328 Ga0157380_10019892 3300014326 Bacteria 5009
329 Ga0157380_10918064 3300014326 Bacteria 903
330 Ga0182008_10311211 3300014497 Bacteria 826
331 Ga0157377_10042907 3300014745 Bacteria 2514
332 Ga0157377_10126583 3300014745 Bacteria 1555
333 Ga0157379_10363521 3300014968 Bacteria 1326
334 Ga0157379_10410016 3300014968 Bacteria 1247
335 Ga0157379_10933670 3300014968 Bacteria 824
336 Ga0157379_11161452 3300014968 Bacteria 741
337 Ga0157376_10997969 3300014969 Bacteria 859
338 Ga0157376_11043053 3300014969 Bacteria 842
339 Ga0157376_11453371 3300014969 Bacteria 718
340 Ga0163161_10053874 3300017792 Bacteria 2918
341 Ga0206356_10642078 3300020070 Bacteria 2302
342 Ga0206354_10265570 3300020081 Bacteria 519
343 Ga0206354_10793134 3300020081 Bacteria 2531
344 Ga0206353_11413974 3300020082 Bacteria 1606
345 Ga0213872_10234874 3300021361 Bacteria 777
346 Ga0213874_10045451 3300021377 Bacteria 1329
347 Ga0213874_10211796 3300021377 Bacteria 701
348 Ga0213876_10036362 3300021384 Bacteria 2597
349 Ga0213875_10001142 3300021388 Bacteria 18252
350 Ga0213875_10045334 3300021388 Bacteria 2064
351 Ga0213875_10052591 3300021388 Bacteria 1908
352 Ga0213875_10058196 3300021388 Bacteria 1809
353 Ga0224712_10061690 3300022467 Bacteria 1496
354 Ga0224712_10233497 3300022467 Bacteria 845
355 Ga0228598_1018484 3300024227 Bacteria 1375
356 Ga0228598_1071779 3300024227 Bacteria 692
357 Ga0207653_10010804 3300025885 Bacteria 2848
358 Ga0207692_10004053 3300025898 Bacteria 5774
359 Ga0207692_10040924 3300025898 Bacteria 2290
360 Ga0207692_10071650 3300025898 Bacteria 1828
361 Ga0207642_10073402 3300025899 Bacteria 1636
362 Ga0207642_10303438 3300025899 Bacteria 926
363 Ga0207710_10079641 3300025900 Bacteria 1518
364 Ga0207688_10007772 3300025901 Bacteria 5838
365 Ga0207688_10045836 3300025901 Bacteria 2440
366 Ga0207688_10157397 3300025901 Bacteria 1345
367 Ga0207680_10784292 3300025903 Bacteria 683
368 Ga0207647_10057589 3300025904 Bacteria 2382
369 Ga0207647_10256929 3300025904 Bacteria 1001
370 Ga0207699_10044202 3300025906 Bacteria 2592
371 Ga0207699_10073928 3300025906 Bacteria 2092
372 Ga0207699_10079456 3300025906 Bacteria 2029
373 Ga0207699_10180052 3300025906 Bacteria 1420
374 Ga0207699_10429931 3300025906 Bacteria 944
375 Ga0207699_10845814 3300025906 Bacteria 674
376 Ga0207645_10013813 3300025907 Bacteria 5420
377 Ga0207645_10053173 3300025907 Bacteria 2588
378 Ga0207643_10076171 3300025908 Bacteria 1937
379 Ga0207643_10383788 3300025908 Bacteria 886
380 Ga0207705_10121471 3300025909 Bacteria 1939
381 Ga0207684_10003200 3300025910 Bacteria 16082
382 Ga0207684_10020102 3300025910 Bacteria 5704
383 Ga0207684_10077003 3300025910 Bacteria 2835
384 Ga0207684_10094850 3300025910 Bacteria 2545
385 Ga0207684_10606029 3300025910 Bacteria 935
386 Ga0207684_10885432 3300025910 Bacteria 751
387 Ga0207654_10800665 3300025911 Bacteria 681
388 Ga0207654_10897858 3300025911 Bacteria 642
389 Ga0207654_11189221 3300025911 Bacteria 556
390 Ga0207707_10101703 3300025912 Bacteria 2512
391 Ga0207671_10963621 3300025914 Bacteria 673
392 Ga0207693_10011756 3300025915 Bacteria 7075
393 Ga0207693_10056576 3300025915 Bacteria 3075
394 Ga0207693_10059120 3300025915 Bacteria 3002
395 Ga0207663_10114576 3300025916 Bacteria 1835
396 Ga0207663_10131176 3300025916 Bacteria 1732
397 Ga0207663_10144604 3300025916 Bacteria 1661
398 Ga0207663_10190152 3300025916 Bacteria 1473
399 Ga0207663_10347975 3300025916 Bacteria 1121
400 Ga0207663_10847353 3300025916 Bacteria 729
401 Ga0207660_10192159 3300025917 Bacteria 1590
402 Ga0207662_10002144 3300025918 Bacteria 9824
403 Ga0207662_10045119 3300025918 Bacteria 2605
404 Ga0207657_10015479 3300025919 Bacteria 7389
405 Ga0207657_10023888 3300025919 Bacteria 5678
406 Ga0207649_10406832 3300025920 Bacteria 1019
407 Ga0207646_10005011 3300025922 Bacteria 14111
408 Ga0207646_10112534 3300025922 Bacteria 2443
409 Ga0207646_10271339 3300025922 Bacteria 1533
410 Ga0207646_10396792 3300025922 Bacteria 1246
411 Ga0207646_10400802 3300025922 Bacteria 1239
412 Ga0207646_10481015 3300025922 Bacteria 1119
413 Ga0207646_10545398 3300025922 Bacteria 1043
414 Ga0207681_10132749 3300025923 Bacteria 1843
415 Ga0207659_10333269 3300025926 Bacteria 1255
416 Ga0207659_11039468 3300025926 Bacteria 705
417 Ga0207687_10045231 3300025927 Bacteria 3042
418 Ga0207687_10276077 3300025927 Bacteria 1345
419 Ga0207700_10135686 3300025928 Bacteria 2015
420 Ga0207700_10224393 3300025928 Bacteria 1594
421 Ga0207700_10226535 3300025928 Bacteria 1587
422 Ga0207700_10234458 3300025928 Bacteria 1562
423 Ga0207700_10305846 3300025928 Bacteria 1374
424 Ga0207700_10334989 3300025928 Bacteria 1314
425 Ga0207700_10577756 3300025928 Bacteria 999
426 Ga0207700_10689956 3300025928 Bacteria 911
427 Ga0207700_10854659 3300025928 Bacteria 814
428 Ga0207700_10871614 3300025928 Bacteria 806
429 Ga0207664_10014609 3300025929 Bacteria 5678
430 Ga0207664_10022615 3300025929 Bacteria 4699
431 Ga0207664_10042704 3300025929 Bacteria 3541
432 Ga0207664_10045230 3300025929 Bacteria 3451
433 Ga0207664_10223400 3300025929 Bacteria 1634
434 Ga0207664_10460867 3300025929 Bacteria 1135
435 Ga0207664_10921506 3300025929 Bacteria 784
436 Ga0207664_11824816 3300025929 Bacteria 531
437 Ga0207644_10013700 3300025931 Bacteria 5412
438 Ga0207644_10218922 3300025931 Bacteria 1508
439 Ga0207644_10886441 3300025931 Bacteria 748
440 Ga0207690_11457995 3300025932 Bacteria 572
441 Ga0207706_10014518 3300025933 Bacteria 7139
442 Ga0207706_10020900 3300025933 Bacteria 5878
443 Ga0207706_10749861 3300025933 Bacteria 832
444 Ga0207686_10545499 3300025934 Bacteria 906
445 Ga0207709_10338926 3300025935 Bacteria 1131
446 Ga0207669_10529025 3300025937 Bacteria 948
447 Ga0207669_10822733 3300025937 Bacteria 771
448 Ga0207669_11132866 3300025937 Bacteria 661
449 Ga0207704_11144556 3300025938 Bacteria 662
450 Ga0207665_10017424 3300025939 Bacteria 4720
451 Ga0207665_10023191 3300025939 Bacteria 4088
452 Ga0207691_10063086 3300025940 Bacteria 3361
453 Ga0207691_10144081 3300025940 Bacteria 2098
454 Ga0207711_10648251 3300025941 Bacteria 985
455 Ga0207689_10005167 3300025942 Bacteria 11725
456 Ga0207689_10092506 3300025942 Bacteria 2484
457 Ga0207689_10287121 3300025942 Bacteria 1363
458 Ga0207689_10734424 3300025942 Bacteria 833
459 Ga0207661_10623231 3300025944 Bacteria 991
460 Ga0207661_10876822 3300025944 Bacteria 826
461 Ga0207679_10034943 3300025945 Bacteria 3552
462 Ga0207679_11077229 3300025945 Bacteria 737
463 Ga0207667_10100747 3300025949 Bacteria 2980
464 Ga0207667_11069387 3300025949 Bacteria 791
465 Ga0207651_10334335 3300025960 Bacteria 1271
466 Ga0207651_10607282 3300025960 Bacteria 957
467 Ga0207712_10886559 3300025961 Bacteria 788
468 Ga0207668_10770099 3300025972 Bacteria 850
469 Ga0207668_11511063 3300025972 Bacteria 606
470 Ga0207640_10198576 3300025981 Bacteria 1518
471 Ga0207640_10283131 3300025981 Bacteria 1303
472 Ga0207640_10311143 3300025981 Bacteria 1250
473 Ga0207658_10091859 3300025986 Bacteria 2357
474 Ga0207658_10871532 3300025986 Bacteria 819
475 Ga0207677_10421295 3300026023 Bacteria 1137
476 Ga0207677_10907012 3300026023 Bacteria 795
477 Ga0207703_10885744 3300026035 Bacteria 854
478 Ga0207639_10331386 3300026041 Bacteria 1354
479 Ga0207639_10839814 3300026041 Bacteria 857
480 Ga0207678_10016013 3300026067 Bacteria 6586
481 Ga0207678_10112718 3300026067 Bacteria 2320
482 Ga0207708_10017813 3300026075 Bacteria 5346
483 Ga0207708_10032843 3300026075 Bacteria 3940
484 Ga0207708_11276017 3300026075 Bacteria 643
485 Ga0207702_10132402 3300026078 Bacteria 2245
486 Ga0207702_10228150 3300026078 Bacteria 1739
487 Ga0207702_10426448 3300026078 Bacteria 1283
488 Ga0207641_10027486 3300026088 Bacteria 4699
489 Ga0207641_10640357 3300026088 Bacteria 1043
490 Ga0207641_11298905 3300026088 Bacteria 728
491 Ga0207648_10089701 3300026089 Bacteria 2686
492 Ga0207648_10871823 3300026089 Bacteria 840
493 Ga0207648_11790044 3300026089 Bacteria 576
494 Ga0207676_10418403 3300026095 Bacteria 1256
495 Ga0207676_10650781 3300026095 Bacteria 1017
496 Ga0207676_12175077 3300026095 Bacteria 553
497 Ga0207674_10009354 3300026116 Bacteria 11212
498 Ga0207674_10257954 3300026116 Bacteria 1690
499 Ga0207674_10540600 3300026116 Bacteria 1126
500 Ga0207674_10595912 3300026116 Bacteria 1067
501 Ga0207675_100019761 3300026118 Bacteria 6288
502 Ga0207675_100024633 3300026118 Bacteria 5595
503 Ga0207683_10003875 3300026121 Bacteria 12975
504 Ga0207683_10055388 3300026121 Bacteria 3477
505 Ga0207683_10209191 3300026121 Bacteria 1775
506 Ga0207683_10944602 3300026121 Bacteria 801
507 Ga0207683_11268424 3300026121 Bacteria 682
508 Ga0207698_10252216 3300026142 Bacteria 1615
509 Ga0207428_10088366 3300027907 Bacteria 2410
510 Ga0207428_10732624 3300027907 Bacteria 705
511 Ga0268266_10045907 3300028379 Bacteria 3739
512 Ga0268266_10256942 3300028379 Bacteria 1618
513 Ga0268266_10421736 3300028379 Bacteria 1264
514 Ga0268266_10542530 3300028379 Bacteria 1113
515 Ga0268266_10798690 3300028379 Bacteria 911
516 Ga0268265_11187905 3300028380 Bacteria 760
517 Ga0268265_11413055 3300028380 Bacteria 698
518 Ga0268264_10170508 3300028381 Bacteria 1968
519 Ga0268264_10388922 3300028381 Bacteria 1337
520 Ga0268264_11535869 3300028381 Bacteria 676
521 Ga0268264_11624319 3300028381 Bacteria 657
522 Ga0307513_10159162 3300031456 Bacteria 2153
523 Ga0307408_100230070 3300031548 Bacteria 1518
524 Ga0307410_10294707 3300031852 Bacteria 1278
525 Ga0307410_10368141 3300031852 Bacteria 1153
526 Ga0307410_10624912 3300031852 Bacteria 901
527 Ga0307407_10717815 3300031903 Bacteria 754
528 Ga0307409_100850988 3300031995 Bacteria 923
529 Ga0307414_10157537 3300032004 Bacteria 1800
530 Ga0307411_10195843 3300032005 Bacteria 1547
531 Ga0307411_10368746 3300032005 Bacteria 1177
532 Ga0307411_10439682 3300032005 Bacteria 1088
533 Ga0307415_100041407 3300032126 Bacteria 3059
534 Ga0373948_0003687 3300034817 Bacteria 2375
535 Ga0373948_0053412 3300034817 Bacteria 873
536 Ga0373950_0088072 3300034818 Bacteria 656
537 Ga0373958_0176063 3300034819 Bacteria 549
538 Ga0373938_0039601 3300034957 Bacteria 1043
539 Ga0373926_0002520 3300035083 Bacteria 5818
540 Ga0373926_0004166 3300035083 Bacteria 4716
541 Ga0373928_0022469 3300035084 Bacteria 1338
542 Ga0373929_0140969 3300035085 Bacteria 640
543 Ga0373934_0000065 3300035086 Bacteria 35636
544 Ga0373934_0042856 3300035086 Bacteria 1788
545 Ga0373934_0044329 3300035086 Bacteria 1758
546 Ga0373934_0137968 3300035086 Bacteria 996
547 Ga0373934_0421338 3300035086 Bacteria 559
548 Ga0373940_0001960 3300035088 Bacteria 3886
549 Ga0373940_0059107 3300035088 Bacteria 1093
550 Ga0373944_0000553 3300035089 Bacteria 8845
551 Ga0373944_0001897 3300035089 Bacteria 5285
552 Ga0373944_0024453 3300035089 Bacteria 1771
553 Ga0373944_0093564 3300035089 Bacteria 1007
554 Ga0373944_0153117 3300035089 Bacteria 814
555 Ga0373944_0310731 3300035089 Bacteria 593
556 Ga0373952_0099451 3300035092 Bacteria 766
557 Ga0373923_0025669 3300035111 Bacteria 2338
558 Ga0373923_0058965 3300035111 Bacteria 1626
559 Ga0373923_0082972 3300035111 Bacteria 1392
560 Ga0373923_0112828 3300035111 Bacteria 1208
561 Ga0373923_0217771 3300035111 Bacteria 887
562 Ga0373932_0333493 3300035112 Bacteria 573
563 Ga0373936_0002649 3300035113 Bacteria 6698
564 Ga0373936_0012075 3300035113 Bacteria 3280
565 Ga0373936_0021757 3300035113 Bacteria 2494
566 Ga0373936_0116916 3300035113 Bacteria 1136
567 Ga0373936_0575465 3300035113 Bacteria 528
568 Ga0373945_0000077 3300035116 Bacteria 22256
569 Ga0373953_0000055 3300035117 Bacteria 28969
570 Ga0373953_0004490 3300035117 Bacteria 4453
571 Ga0373953_0065531 3300035117 Bacteria 1491
572 Ga0373953_0088400 3300035117 Bacteria 1294
573 Ga0373954_0017825 3300035118 Bacteria 3193
574 Ga0373954_0022397 3300035118 Bacteria 2865
575 Ga0373956_0000141 3300035119 Bacteria 26025
576 Ga0373956_0009695 3300035119 Bacteria 3921
577 Ga0373956_0080785 3300035119 Bacteria 1491
578 Ga0373956_0281782 3300035119 Bacteria 791
579 Ga0373957_0000093 3300035120 Bacteria 21429
580 Ga0373957_0055231 3300035120 Bacteria 1526
581 Ga0373957_0075711 3300035120 Bacteria 1322
582 Ga0373957_0083588 3300035120 Bacteria 1262
583 Ga0373957_0219676 3300035120 Bacteria 795
584 Ga0373960_0223487 3300035121 Bacteria 674
585 Ga0373960_0432631 3300035121 Bacteria 513
586 Ga0373943_0000164 3300035170 Bacteria 25955
587 Ga0373943_0003174 3300035170 Bacteria 7462
588 Ga0373943_0029808 3300035170 Bacteria 2579
589 Ga0373943_0128150 3300035170 Bacteria 1356
590 Ga0373943_0136585 3300035170 Bacteria 1317
591 Ga0373946_0002495 3300035171 Bacteria 6499
592 Ga0373946_0047922 3300035171 Bacteria 1776
593 Ga0373946_0163571 3300035171 Bacteria 1046
594 Ga0373946_0224305 3300035171 Bacteria 908
595 Ga0373955_0000207 3300035172 Bacteria 24476
596 Ga0373955_0007999 3300035172 Bacteria 4887
597 Ga0373955_0035209 3300035172 Bacteria 2650
598 Ga0373955_0093255 3300035172 Bacteria 1719
599 Ga0373955_0158483 3300035172 Bacteria 1334
600 Ga0373955_0185549 3300035172 Bacteria 1235
601 Ga0373955_0307549 3300035172 Bacteria 956
602 Ga0373955_0369416 3300035172 Bacteria 870
603 Ga0373962_0021488 3300035242 Bacteria 1703
604 Ga0316574_0302297 3300035398 Bacteria 1017
605 Ga0373924_0000073 3300035410 Bacteria 26960
606 Ga0373924_0002275 3300035410 Bacteria 6445
607 Ga0373924_0012047 3300035410 Bacteria 3223
608 Ga0373924_0107036 3300035410 Bacteria 1206
609 Ga0373931_0152396 3300035691 Bacteria 1348
610 Ga0373931_0694686 3300035691 Bacteria 671
611 Ga0373935_0003332 3300035692 Bacteria 9301
612 Ga0373935_0054728 3300035692 Bacteria 2542
613 Ga0373935_0096262 3300035692 Bacteria 1945
614 Ga0373935_0149126 3300035692 Bacteria 1585
615 Ga0373935_0215500 3300035692 Bacteria 1332
616 Ga0373935_0285805 3300035692 Bacteria 1162
617 Ga0373935_0446732 3300035692 Bacteria 933
618 Ga0373935_0532100 3300035692 Bacteria 855
619 Ga0373927_0021656 3300035695 Bacteria 4212
620 Ga0373927_0027321 3300035695 Bacteria 3726
621 Ga0373927_0035125 3300035695 Bacteria 3259
622 Ga0373927_0421948 3300035695 Bacteria 880
623 Ga0373933_0000054 3300035724 Bacteria 69499
624 Ga0373933_0003898 3300035724 Bacteria 8231
625 Ga0373933_0011093 3300035724 Bacteria 4953
626 Ga0373933_0052269 3300035724 Bacteria 2444
627 Ga0373933_0058689 3300035724 Bacteria 2315
628 Ga0373933_0086847 3300035724 Bacteria 1925
629 Ga0373933_0120493 3300035724 Bacteria 1643
630 Ga0373947_0001093 3300035725 Bacteria 16622
631 Ga0373947_0001602 3300035725 Bacteria 13873
632 Ga0373947_0046346 3300035725 Bacteria 2603
633 Ga0373947_0098208 3300035725 Bacteria 1837
634 Ga0373947_0169858 3300035725 Bacteria 1414
635 Ga0373947_0278132 3300035725 Bacteria 1112
636 Ga0373937_0000002 3300036401 Bacteria 304133
637 Ga0373937_0010001 3300036401 Bacteria 8272
638 Ga0373937_0047793 3300036401 Bacteria 3916
639 Ga0373937_0135146 3300036401 Bacteria 2305
640 Ga0373937_0219618 3300036401 Bacteria 1789
641 Ga0373937_0249817 3300036401 Bacteria 1672
642 Ga0373937_0274263 3300036401 Bacteria 1592
643 Ga0373937_0327105 3300036401 Bacteria 1450
644 Ga0373925_0005625 3300037068 Bacteria 9322
645 Ga0373925_0009741 3300037068 Bacteria 6979
646 Ga0373925_0083149 3300037068 Bacteria 2437
647 Ga0373925_0109779 3300037068 Bacteria 2129
648 Ga0373925_0249717 3300037068 Bacteria 1422
649 Ga0373925_0250750 3300037068 Bacteria 1419
650 Ga0373925_0325529 3300037068 Bacteria 1244
651 Ga0373925_0358227 3300037068 Bacteria 1185
652 Ga0373925_0516956 3300037068 Bacteria 981
653 Ga0373925_0866629 3300037068 Bacteria 744
654 Ga0395899_0004263 3300037312 Bacteria 11193
655 Ga0395900_0272449 3300037418 Bacteria 1687
656 Ga0436364_0021886 3300037853 Bacteria 1460
657 Ga0436364_0669885 3300037853 Bacteria 2675
658 Ga0436364_0769079 3300037853 Bacteria 1747
659 Ga0436364_0872343 3300037853 Bacteria 586
660 Ga0436364_1084539 3300037853 Bacteria 1167
661 Ga0436364_1262394 3300037853 Bacteria 14344
662 Ga0436364_1401376 3300037853 Bacteria 69007
663 Ga0436365_0222628 3300039437 Bacteria 6155
664 Ga0436365_0416340 3300039437 Bacteria 991
665 Ga0436365_1293463 3300039437 Bacteria 1618
666 Ga0436361_0158863 3300039447 Bacteria 695
667 Ga0436363_0530596 3300039450 Bacteria 1255
668 Ga0436363_1105940 3300039450 Bacteria 1190
669 Ga0436363_1174765 3300039450 Bacteria 2856
670 Ga0436363_1265393 3300039450 Bacteria 2418
671 Ga0436362_0624818 3300039453 Bacteria 960
672 Ga0436362_0727893 3300039453 Bacteria 1011
673 Ga0451789_0553388 3300041443 Bacteria 732
674 Ga0451791_1593630 3300041451 Bacteria 1354
675 Ga0451804_0297973 3300041463 Bacteria 632
676 Ga0451841_1052420 3300041498 Bacteria 631
677 Ga0466972_0009324 3300044658 Bacteria 4934
678 Ga0466965_0138559 3300044683 Bacteria 1265
679 Ga0466965_0146249 3300044683 Bacteria 1233
680 Ga0466966_0004664 3300044684 Bacteria 9025
681 Ga0466961_0171244 3300044693 Bacteria 1350
682 Ga0466961_0438935 3300044693 Bacteria 790
683 Ga0466961_0439757 3300044693 Bacteria 790
684 Ga0466963_0002427 3300044694 Bacteria 10422
685 Ga0466963_0036568 3300044694 Bacteria 3203
686 Ga0466963_0414536 3300044694 Bacteria 950
687 Ga0466963_0825694 3300044694 Bacteria 654
688 Ga0466964_0732108 3300044706 Bacteria 554
689 Ga0466971_0097029 3300044719 Bacteria 1352
690 Ga0466970_0053321 3300044765 Bacteria 2159
691 Ga0466957_0288507 3300044842 Bacteria 1100
692 Ga0466957_0931384 3300044842 Bacteria 622
693 Ga0466960_0001547 3300044901 Bacteria 8411
694 Ga0466960_0288304 3300044901 Bacteria 922
695 Ga0466959_0127852 3300045049 Bacteria 1802
696 Ga0466959_0833734 3300045049 Bacteria 616
697 Ga0466958_0000849 3300045836 Bacteria 13568
698 Ga0466958_0228027 3300045836 Bacteria 1189
699 Ga0466967_0005545 3300045976 Bacteria 8762
700 Ga0466967_0129109 3300045976 Bacteria 2345
701 Ga0466967_0159286 3300045976 Bacteria 2117
702 Ga0466967_0186235 3300045976 Bacteria 1960
703 Ga0466967_0203012 3300045976 Bacteria 1878
704 Ga0466967_0515435 3300045976 Bacteria 1175
705 Ga0495592_0000003 3300046454 Bacteria 200744
706 Ga0495592_0033887 3300046454 Bacteria 3851
707 Ga0495592_0044826 3300046454 Bacteria 3302
708 Ga0495592_0051815 3300046454 Bacteria 3048
709 Ga0495592_0191623 3300046454 Bacteria 1385
710 Ga0495592_0251608 3300046454 Bacteria 1167
711 Ga0495592_0745992 3300046454 Bacteria 585
712 Ga0495603_0000661 3300046455 Bacteria 19477
713 Ga0495603_0074227 3300046455 Bacteria 1997
714 Ga0495629_0001950 3300046459 Bacteria 16079
715 Ga0495629_0012811 3300046459 Bacteria 6069
716 Ga0495629_0179260 3300046459 Bacteria 1469
717 Ga0495629_0282370 3300046459 Bacteria 1139
718 Ga0495641_0001407 3300046461 Bacteria 20458
719 Ga0495641_0006055 3300046461 Bacteria 7956
720 Ga0495641_0035357 3300046461 Bacteria 2356
721 Ga0495641_0071193 3300046461 Bacteria 1561
722 Ga0495641_0091529 3300046461 Bacteria 1359
723 Ga0495651_0000036 3300046462 Bacteria 97779
724 Ga0495651_0003222 3300046462 Bacteria 12534
725 Ga0495651_0023674 3300046462 Bacteria 4775
726 Ga0495651_0055381 3300046462 Bacteria 3047
727 Ga0495651_0159182 3300046462 Bacteria 1619
728 Ga0495651_0223151 3300046462 Bacteria 1303
729 Ga0495651_0246141 3300046462 Bacteria 1223
730 Ga0495651_0267202 3300046462 Bacteria 1161
731 Ga0495651_0942881 3300046462 Bacteria 526
732 Ga0495653_0000406 3300046463 Bacteria 34551
733 Ga0495653_0002880 3300046463 Bacteria 13761
734 Ga0495653_0007981 3300046463 Bacteria 8668
735 Ga0495653_0038555 3300046463 Bacteria 3750
736 Ga0495653_0038923 3300046463 Bacteria 3729
737 Ga0495653_0093534 3300046463 Bacteria 2192
738 Ga0495653_0112727 3300046463 Bacteria 1951
739 Ga0495653_0443474 3300046463 Bacteria 818
740 Ga0495650_0030915 3300046471 Bacteria 2418
741 Ga0495580_0006551 3300046472 Bacteria 9468
742 Ga0495580_0110900 3300046472 Bacteria 1905
743 Ga0495582_0002623 3300046473 Bacteria 10014
744 Ga0495582_0020254 3300046473 Bacteria 3640
745 Ga0495582_0037471 3300046473 Bacteria 2667
746 Ga0495582_0200431 3300046473 Bacteria 1140
747 Ga0495639_0007269 3300046475 Bacteria 4753
748 Ga0495639_0042136 3300046475 Bacteria 2058
749 Ga0495639_0328258 3300046475 Bacteria 766
750 Ga0495662_0001838 3300046476 Bacteria 10636
751 Ga0495662_0007893 3300046476 Bacteria 5240
752 Ga0495662_0044581 3300046476 Bacteria 2141
753 Ga0495662_0384469 3300046476 Bacteria 689
754 Ga0495664_0000454 3300046477 Bacteria 20119
755 Ga0495664_0101383 3300046477 Bacteria 1734
756 Ga0495664_0121215 3300046477 Bacteria 1582
757 Ga0495664_0229500 3300046477 Bacteria 1123
758 Ga0495664_0264956 3300046477 Bacteria 1038
759 Ga0495594_0031228 3300046499 Bacteria 2887
760 Ga0495608_0000018 3300046511 Bacteria 192512
761 Ga0495608_0026583 3300046511 Bacteria 3943
762 Ga0495608_0027027 3300046511 Bacteria 3907
763 Ga0495608_0034497 3300046511 Bacteria 3415
764 Ga0495608_0040428 3300046511 Bacteria 3124
765 Ga0495608_0041557 3300046511 Bacteria 3076
766 Ga0495618_0007128 3300046514 Bacteria 6762
767 Ga0495618_0015896 3300046514 Bacteria 4594
768 Ga0495618_0017974 3300046514 Bacteria 4338
769 Ga0495618_0028819 3300046514 Bacteria 3461
770 Ga0495618_0066107 3300046514 Bacteria 2298
771 Ga0495618_0078881 3300046514 Bacteria 2099
772 Ga0495618_0204714 3300046514 Bacteria 1248
773 Ga0495628_0000020 3300046516 Bacteria 148606
774 Ga0495628_0110010 3300046516 Bacteria 2120
775 Ga0495628_0240404 3300046516 Bacteria 1354
776 Ga0495628_0253609 3300046516 Bacteria 1313
777 Ga0495630_0036754 3300046517 Bacteria 3660
778 Ga0495630_0052195 3300046517 Bacteria 3061
779 Ga0495630_0075463 3300046517 Bacteria 2540
780 Ga0495630_0096775 3300046517 Bacteria 2231
781 Ga0495630_0449417 3300046517 Bacteria 987
782 Ga0495630_0501692 3300046517 Bacteria 930
783 Ga0495666_0016042 3300046526 Bacteria 3730
784 Ga0495666_0022892 3300046526 Bacteria 3092
785 Ga0495666_0095277 3300046526 Bacteria 1404
786 Ga0495652_0000013 3300046529 Bacteria 238164
787 Ga0495652_0022788 3300046529 Bacteria 5556
788 Ga0495652_0030281 3300046529 Bacteria 4747
789 Ga0495652_0064510 3300046529 Bacteria 3080
790 Ga0495652_0147376 3300046529 Bacteria 1843
791 Ga0495652_0213570 3300046529 Bacteria 1454
792 Ga0495652_0417320 3300046529 Bacteria 946
793 Ga0495665_0001556 3300046531 Bacteria 12246
794 Ga0495665_0019771 3300046531 Bacteria 3622
795 Ga0495665_0050849 3300046531 Bacteria 2196
796 Ga0495665_0086485 3300046531 Bacteria 1647
797 Ga0495640_0016167 3300046533 Bacteria 5586
798 Ga0495640_0023151 3300046533 Bacteria 4533
799 Ga0495640_0031284 3300046533 Bacteria 3799
800 Ga0495640_0031362 3300046533 Bacteria 3793
801 Ga0495640_0034696 3300046533 Bacteria 3574
802 Ga0495640_0161476 3300046533 Bacteria 1435
803 Ga0495640_0842393 3300046533 Bacteria 545
804 Ga0495586_0006621 3300046535 Bacteria 6187
805 Ga0495586_0608161 3300046535 Bacteria 631
806 Ga0495587_0000014 3300046536 Bacteria 192100
807 Ga0495587_0005895 3300046536 Bacteria 7985
808 Ga0495587_0009225 3300046536 Bacteria 6331
809 Ga0495587_0020632 3300046536 Bacteria 4064
810 Ga0495587_0184951 3300046536 Bacteria 1180
811 Ga0495587_0252984 3300046536 Bacteria 990
812 Ga0495645_0030955 3300046543 Bacteria 3897
813 Ga0495645_0060069 3300046543 Bacteria 2755
814 Ga0495645_0072510 3300046543 Bacteria 2481
815 Ga0495645_0121834 3300046543 Bacteria 1835
816 Ga0495645_0138630 3300046543 Bacteria 1699
817 Ga0495645_0168638 3300046543 Bacteria 1508
818 Ga0495645_0200172 3300046543 Bacteria 1355
819 Ga0495622_0121609 3300046557 Bacteria 1192
820 Ga0495667_0000014 3300046559 Bacteria 200767
821 Ga0495667_0000302 3300046559 Bacteria 31369
822 Ga0495667_0016888 3300046559 Bacteria 4928
823 Ga0495667_0037809 3300046559 Bacteria 3215
824 Ga0495667_0097605 3300046559 Bacteria 1902
825 Ga0495667_0180565 3300046559 Bacteria 1354
826 Ga0495668_0699492 3300046616 Bacteria 561
827 Ga0495634_0029290 3300046642 Bacteria 3812
828 Ga0495634_0059420 3300046642 Bacteria 2546
829 Ga0495634_0078856 3300046642 Bacteria 2157
830 Ga0495634_0091725 3300046642 Bacteria 1971
831 Ga0495634_0180104 3300046642 Bacteria 1323
832 Ga0495634_0211029 3300046642 Bacteria 1202
833 Ga0495634_0288652 3300046642 Bacteria 994
834 Ga0495634_0346534 3300046642 Bacteria 890
835 Ga0495635_0000462 3300046663 Bacteria 25695
836 Ga0495635_0002746 3300046663 Bacteria 12067
837 Ga0495635_0004499 3300046663 Bacteria 9661
838 Ga0495635_0014871 3300046663 Bacteria 5445
839 Ga0495635_0033200 3300046663 Bacteria 3579
840 Ga0495635_0247775 3300046663 Bacteria 1201
841 Ga0495635_0443740 3300046663 Bacteria 858
842 Ga0495635_0545769 3300046663 Bacteria 760
843 Ga0495588_0033859 3300046674 Bacteria 2583
844 Ga0495588_0135331 3300046674 Bacteria 1301
845 Ga0495657_0000012 3300046675 Bacteria 197154
846 Ga0495657_0006514 3300046675 Bacteria 9129
847 Ga0495657_0016259 3300046675 Bacteria 5423
848 Ga0495657_0042494 3300046675 Bacteria 3103
849 Ga0495657_0047516 3300046675 Bacteria 2900
850 Ga0495657_0105784 3300046675 Bacteria 1787
851 Ga0495657_0109632 3300046675 Bacteria 1750
852 Ga0495599_0000037 3300046678 Bacteria 101892
853 Ga0495599_0011715 3300046678 Bacteria 5389
854 Ga0495599_0012101 3300046678 Bacteria 5311
855 Ga0495599_0029683 3300046678 Bacteria 3428
856 Ga0495623_0000079 3300046679 Bacteria 57590
857 Ga0495623_0009073 3300046679 Bacteria 6451
858 Ga0495623_0027788 3300046679 Bacteria 3642
859 Ga0495623_0129241 3300046679 Bacteria 1514
860 Ga0495646_0009352 3300046680 Bacteria 6217
861 Ga0495646_0011733 3300046680 Bacteria 5571
862 Ga0495646_0055454 3300046680 Bacteria 2380
863 Ga0495646_0075783 3300046680 Bacteria 1971
864 Ga0495646_0097127 3300046680 Bacteria 1693
865 Ga0495646_0282562 3300046680 Bacteria 881
866 Ga0495647_0001069 3300046681 Bacteria 8346
867 Ga0495647_0120664 3300046681 Bacteria 1102
868 Ga0495658_0002199 3300046683 Bacteria 9868
869 Ga0495613_0006714 3300046689 Bacteria 8590
870 Ga0495613_0220434 3300046689 Bacteria 1332
871 Ga0495613_0689318 3300046689 Bacteria 673
872 Ga0495624_0005490 3300046690 Bacteria 9129
873 Ga0495624_0008133 3300046690 Bacteria 7341
874 Ga0495624_0124468 3300046690 Bacteria 1582
875 Ga0495624_0127217 3300046690 Bacteria 1563
876 Ga0495624_0177773 3300046690 Bacteria 1297
877 Ga0495600_0003734 3300046809 Bacteria 9005
878 Ga0495600_0009438 3300046809 Bacteria 6027
879 Ga0495600_0013917 3300046809 Bacteria 5068
880 Ga0495600_0016008 3300046809 Bacteria 4753
881 Ga0495600_0029865 3300046809 Bacteria 3531
882 Ga0495600_0091649 3300046809 Bacteria 1982
883 Ga0495600_0289005 3300046809 Bacteria 1036
884 Ga0495581_0009902 3300047315 Bacteria 5513
885 Ga0495581_0023893 3300047315 Bacteria 3542
886 Ga0495581_0026782 3300047315 Bacteria 3342
887 Ga0495604_0005054 3300047317 Bacteria 10439
888 Ga0495604_0011248 3300047317 Bacteria 7105
889 Ga0495604_0083032 3300047317 Bacteria 2395
890 Ga0495604_0089914 3300047317 Bacteria 2281
891 Ga0495604_0325045 3300047317 Bacteria 1027
892 Ga0495604_0434846 3300047317 Bacteria 859
893 Ga0495674_0000831 3300047319 Bacteria 29544
894 Ga0495674_0001543 3300047319 Bacteria 22531
895 Ga0495674_0013670 3300047319 Bacteria 7627
896 Ga0495674_0019229 3300047319 Bacteria 6344
897 Ga0495674_0160542 3300047319 Bacteria 1881
898 Ga0495674_0326244 3300047319 Bacteria 1249
899 Ga0495674_1186184 3300047319 Bacteria 578
900 Ga0495676_0020252 3300047321 Bacteria 5841
901 Ga0495676_0064180 3300047321 Bacteria 2858
902 Ga0495676_0081429 3300047321 Bacteria 2454
903 Ga0495676_0124368 3300047321 Bacteria 1871
904 Ga0495676_0216123 3300047321 Bacteria 1323
905 Ga0495680_0000003 3300047322 Bacteria 172246
906 Ga0495680_0001454 3300047322 Bacteria 25547
907 Ga0495680_0002953 3300047322 Bacteria 17014
908 Ga0495680_0010156 3300047322 Bacteria 8415
909 Ga0495680_0029953 3300047322 Bacteria 4449
910 Ga0495680_0040311 3300047322 Bacteria 3721
911 Ga0495680_0055123 3300047322 Bacteria 3084
912 Ga0495680_0226762 3300047322 Bacteria 1331
913 Ga0495680_0270927 3300047322 Bacteria 1199
914 Ga0495680_0343029 3300047322 Bacteria 1041
915 Ga0495675_0000389 3300047444 Bacteria 30325
916 Ga0495675_0020998 3300047444 Bacteria 4157
917 Ga0495675_0033719 3300047444 Bacteria 3267
918 Ga0495675_0200844 3300047444 Bacteria 1213
919 Ga0495675_0236250 3300047444 Bacteria 1101
920 Ga0495684_0003199 3300047471 Bacteria 12839
921 Ga0495684_0005821 3300047471 Bacteria 9583
922 Ga0495684_0007526 3300047471 Bacteria 8429
923 Ga0495684_0011571 3300047471 Bacteria 6812
924 Ga0495684_0023304 3300047471 Bacteria 4760
925 Ga0495684_0070188 3300047471 Bacteria 2663
926 Ga0495684_0148010 3300047471 Bacteria 1757
927 Ga0495684_0612170 3300047471 Bacteria 733
928 Ga0495593_0000847 3300047673 Bacteria 17762
929 Ga0495593_0006911 3300047673 Bacteria 6644
930 Ga0495593_0011275 3300047673 Bacteria 5137
931 Ga0495593_0020492 3300047673 Bacteria 3703
932 Ga0495602_0000014 3300048088 Bacteria 193335
933 Ga0495602_0025497 3300048088 Bacteria 5722
934 Ga0495602_0035056 3300048088 Bacteria 4684
935 Ga0495602_0143675 3300048088 Bacteria 1885
936 Ga0495602_0430876 3300048088 Bacteria 934
937 Ga0495602_0496886 3300048088 Bacteria 853
938 Ga0495602_0843037 3300048088 Bacteria 613
939 Ga0495614_0007195 3300048089 Bacteria 4960
940 Ga0495614_0018832 3300048089 Bacteria 2990
941 Ga0496100_0035899 3300048903 Bacteria 3122
942 Ga0496100_0524411 3300048903 Bacteria 914
943 Ga0496100_1388527 3300048903 Bacteria 554
944 Ga0496101_0131946 3300048904 Bacteria 1897
945 Ga0496101_0183692 3300048904 Bacteria 1611
946 Ga0496101_0527917 3300048904 Bacteria 933
947 Ga0496101_0722039 3300048904 Bacteria 787
948 Ga0496101_1088408 3300048904 Bacteria 628
949 Ga0496102_0099513 3300048905 Bacteria 2699
950 Ga0496102_0630173 3300048905 Bacteria 995
951 Ga0496102_1000742 3300048905 Bacteria 756
952 Ga0496104_0011893 3300048907 Bacteria 7809
953 Ga0496104_0044853 3300048907 Bacteria 4155
954 Ga0496104_0319358 3300048907 Bacteria 1466
955 Ga0496104_0473072 3300048907 Bacteria 1164
956 Ga0496104_0539499 3300048907 Bacteria 1077
957 Ga0496104_0559544 3300048907 Bacteria 1054
958 Ga0496105_0007062 3300048908 Bacteria 8655
959 Ga0496105_0115103 3300048908 Bacteria 2218
960 Ga0496105_0118728 3300048908 Bacteria 2181
961 Ga0496106_0098764 3300048909 Bacteria 2262
962 Ga0496106_0235487 3300048909 Bacteria 1462
963 Ga0496106_0269701 3300048909 Bacteria 1363
964 Ga0496107_0119312 3300048910 Bacteria 1942
965 Ga0496108_0013691 3300048911 Bacteria 6621
966 Ga0496108_0020748 3300048911 Bacteria 5401
967 Ga0496108_0193286 3300048911 Bacteria 1764
968 Ga0496108_0343762 3300048911 Bacteria 1302
969 Ga0496108_0373805 3300048911 Bacteria 1244
970 Ga0496108_0751444 3300048911 Bacteria 843
971 Ga0496108_1134217 3300048911 Bacteria 663
972 Ga0496109_0158665 3300048912 Bacteria 2119
973 Ga0496109_0492128 3300048912 Bacteria 1157
974 Ga0496109_0603886 3300048912 Bacteria 1033
975 Ga0496109_0657349 3300048912 Bacteria 985
976 Ga0496109_0867615 3300048912 Bacteria 840
977 Ga0496109_1257270 3300048912 Bacteria 676
978 Ga0496109_1790130 3300048912 Bacteria 547
979 Ga0496110_0188692 3300048913 Bacteria 1872
980 Ga0496110_0383501 3300048913 Bacteria 1281
981 Ga0496110_1203410 3300048913 Bacteria 666
982 Ga0496111_0030158 3300048914 Bacteria 3856
983 Ga0496111_0063187 3300048914 Bacteria 2685
984 Ga0496111_0202624 3300048914 Bacteria 1475
985 Ga0496111_0659560 3300048914 Bacteria 763
986 Ga0496112_0003525 3300048915 Bacteria 12975
987 Ga0496112_0060274 3300048915 Bacteria 3739
988 Ga0496112_0136605 3300048915 Bacteria 2422
989 Ga0496112_0212460 3300048915 Bacteria 1891
990 Ga0496112_0616351 3300048915 Bacteria 1016
991 Ga0496112_0712307 3300048915 Bacteria 931
992 Ga0496113_0043438 3300048916 Bacteria 3326
993 Ga0496113_0557376 3300048916 Bacteria 919
994 Ga0496113_0761417 3300048916 Bacteria 770
995 Ga0496113_1048068 3300048916 Bacteria 641
996 Ga0496113_1118277 3300048916 Bacteria 617
997 Ga0496114_0154195 3300048917 Bacteria 1994
998 Ga0496114_0458472 3300048917 Bacteria 1128
999 Ga0496115_0010698 3300048918 Bacteria 6862
1000 Ga0496115_0113190 3300048918 Bacteria 2229
1001 Ga0501039_1018652 3300049575 Unclassified 643
1002 Ga0501042_0044911 3300049578 Bacteria 3148
1003 Ga0501043_1056319 3300049579 Bacteria 576
1004 Ga0501072_0380399 3300049588 Bacteria 1120
1005 Ga0501079_0386773 3300049741 Bacteria 1097
1006 Ga0501081_0439842 3300049743 Bacteria 968
1007 nmdc:mga08y16_127207_c1 3300050511 Bacteria 2650
1008 nmdc:mga08y16_859458_c1 3300050511 Bacteria 896
1009 nmdc:mga0n895_5920_c1 3300050512 Bacteria 10282
1010 nmdc:mga0n895_65382_c1 3300050512 Bacteria 3600
1011 nmdc:mga0n895_889796_c1 3300050512 Bacteria 876
1012 nmdc:mga0rr50_1314241_c1 3300050513 Bacteria 613
1013 nmdc:mga0rr50_14871_c1 3300050513 Bacteria 5121
1014 nmdc:mga0rr50_54822_c1 3300050513 Bacteria 2972
1015 nmdc:mga0rr50_826443_c1 3300050513 Bacteria 790
1016 nmdc:mga08x19_16182_c1 3300050514 Bacteria 4545
1017 nmdc:mga08x19_893659_c1 3300050514 Bacteria 631
1018 nmdc:mga0a205_49641_c1 3300050515 Bacteria 4051
1019 nmdc:mga0a205_720479_c1 3300050515 Bacteria 847
1020 Ga0495601_0015583 3300053077 Bacteria 4594
1021 Ga0495601_0023159 3300053077 Bacteria 3815
1022 Ga0495601_0028281 3300053077 Bacteria 3472
1023 Ga0495612_0005770 3300053078 Bacteria 5111
1024 Ga0495595_0001199 3300053084 Bacteria 10074
1025 Ga0495595_0012038 3300053084 Bacteria 3627
1026 Ga0495595_0014508 3300053084 Bacteria 3345
1027 Ga0495619_0019205 3300053085 Bacteria 4343
1028 Ga0495619_0296007 3300053085 Bacteria 1121
1029 Ga0495619_0305932 3300053085 Bacteria 1101
1030 Ga0495619_0673468 3300053085 Bacteria 704
1031 Ga0587062_031234 3300059639 Bacteria 817
1032 Ga0466962_0004801 3300061719 Bacteria 6506

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0093255 Ga0373955_0093255_1308_1703 127
2 3300032005 Ga0307411_10368746 Ga0307411_103687462 130
3 3300006871 Ga0075434_101772673 Ga0075434_1017726732 131
4 3300046689 Ga0495613_0220434 Ga0495613_0220434_191_607 134
5 3300046689 Ga0495613_0689318 Ga0495613_0689318_31_441 135
6 3300047322 Ga0495680_0010156 Ga0495680_0010156_7972_8382 135
7 3300048915 Ga0496112_0616351 Ga0496112_0616351_561_989 137
8 3300048916 Ga0496113_1118277 Ga0496113_1118277_17_445 137
9 3300005539 Ga0068853_100309321 Ga0068853_1003093212 140
10 3300005548 Ga0070665_100698090 Ga0070665_1006980902 140
11 3300012502 Ga0157347_1008417 Ga0157347_10084172 140
12 3300026041 Ga0207639_10839814 Ga0207639_108398142 140
13 3300031995 Ga0307409_100850988 Ga0307409_1008509881 140
14 3300035086 Ga0373934_0137968 Ga0373934_0137968_140_586 140
15 3300035113 Ga0373936_0012075 Ga0373936_0012075_1994_2440 140
16 3300035118 Ga0373954_0017825 Ga0373954_0017825_761_1207 140
17 3300035119 Ga0373956_0281782 Ga0373956_0281782_179_625 140
18 3300035120 Ga0373957_0075711 Ga0373957_0075711_802_1248 140
19 3300035172 Ga0373955_0158483 Ga0373955_0158483_24_470 140
20 3300035692 Ga0373935_0054728 Ga0373935_0054728_203_649 140
21 3300035724 Ga0373933_0058689 Ga0373933_0058689_1168_1614 140
22 3300036401 Ga0373937_0047793 Ga0373937_0047793_3014_3460 140
23 3300046459 Ga0495629_0179260 Ga0495629_0179260_126_572 140
24 3300046461 Ga0495641_0091529 Ga0495641_0091529_704_1150 140
25 3300046462 Ga0495651_0246141 Ga0495651_0246141_356_802 140
26 3300046463 Ga0495653_0093534 Ga0495653_0093534_1176_1622 140
27 3300046511 Ga0495608_0034497 Ga0495608_0034497_2597_3043 140
28 3300046514 Ga0495618_0078881 Ga0495618_0078881_1352_1798 140
29 3300046516 Ga0495628_0253609 Ga0495628_0253609_736_1182 140
30 3300046529 Ga0495652_0147376 Ga0495652_0147376_477_923 140
31 3300046536 Ga0495587_0184951 Ga0495587_0184951_308_754 140
32 3300046559 Ga0495667_0037809 Ga0495667_0037809_1876_2322 140
33 3300046642 Ga0495634_0078856 Ga0495634_0078856_1136_1582 140
34 3300046663 Ga0495635_0014871 Ga0495635_0014871_1880_2326 140
35 3300046675 Ga0495657_0109632 Ga0495657_0109632_547_993 140
36 3300046809 Ga0495600_0091649 Ga0495600_0091649_676_1122 140
37 3300047317 Ga0495604_0083032 Ga0495604_0083032_963_1409 140
38 3300047319 Ga0495674_0160542 Ga0495674_0160542_468_914 140
39 3300047322 Ga0495680_0002953 Ga0495680_0002953_1234_1680 140
40 3300047471 Ga0495684_0070188 Ga0495684_0070188_1201_1647 140
41 iso_pu_bacteria 2915358134 2915362645 140
42 iso_pu_bacteria 8054472261 8054475115 140
43 3300031852 Ga0307410_10294707 Ga0307410_102947072 141
44 3300032004 Ga0307414_10157537 Ga0307414_101575371 141
45 3300032005 Ga0307411_10439682 Ga0307411_104396822 141
46 3300032126 Ga0307415_100041407 Ga0307415_1000414073 141
47 3300044683 Ga0466965_0146249 Ga0466965_0146249_538_969 141
48 3300044693 Ga0466961_0171244 Ga0466961_0171244_64_528 141
49 iso_pu_bacteria 2808606700 2810363650 141
50 3300005435 Ga0070714_100282170 Ga0070714_1002821702 142
51 3300005437 Ga0070710_10224077 Ga0070710_102240772 142
52 3300005437 Ga0070710_10250867 Ga0070710_102508672 142
53 3300005439 Ga0070711_100445242 Ga0070711_1004452422 142
54 3300005518 Ga0070699_100516626 Ga0070699_1005166262 142
55 3300006028 Ga0070717_10861681 Ga0070717_108616812 142
56 3300006175 Ga0070712_101139784 Ga0070712_1011397842 142
57 3300024227 Ga0228598_1071779 Ga0228598_10717792 142
58 3300025916 Ga0207663_10131176 Ga0207663_101311762 142
59 3300025929 Ga0207664_10223400 Ga0207664_102234002 142
60 3300035085 Ga0373929_0140969 Ga0373929_0140969_123_575 142
61 3300035111 Ga0373923_0025669 Ga0373923_0025669_1804_2259 142
62 3300035172 Ga0373955_0307549 Ga0373955_0307549_275_727 142
63 3300035692 Ga0373935_0532100 Ga0373935_0532100_385_837 142
64 3300035724 Ga0373933_0086847 Ga0373933_0086847_578_1030 142
65 3300037068 Ga0373925_0866629 Ga0373925_0866629_90_545 142
66 3300037312 Ga0395899_0004263 Ga0395899_0004263_525_956 142
67 3300044842 Ga0466957_0931384 Ga0466957_0931384_141_590 142
68 3300045976 Ga0466967_0129109 Ga0466967_0129109_1221_1670 142
69 3300046454 Ga0495592_0251608 Ga0495592_0251608_167_619 142
70 3300046462 Ga0495651_0159182 Ga0495651_0159182_725_1177 142
71 3300046471 Ga0495650_0030915 Ga0495650_0030915_604_1032 142
72 3300046477 Ga0495664_0264956 Ga0495664_0264956_151_603 142
73 3300046514 Ga0495618_0204714 Ga0495618_0204714_513_965 142
74 3300046529 Ga0495652_0417320 Ga0495652_0417320_127_579 142
75 3300046536 Ga0495587_0252984 Ga0495587_0252984_339_791 142
76 3300046543 Ga0495645_0072510 Ga0495645_0072510_333_785 142
77 3300046642 Ga0495634_0180104 Ga0495634_0180104_237_698 142
78 3300046675 Ga0495657_0016259 Ga0495657_0016259_3628_4080 142
79 3300047317 Ga0495604_0325045 Ga0495604_0325045_53_514 142
80 3300047322 Ga0495680_0343029 Ga0495680_0343029_485_937 142
81 3300047444 Ga0495675_0236250 Ga0495675_0236250_100_552 142
82 3300047471 Ga0495684_0148010 Ga0495684_0148010_151_603 142
83 3300048088 Ga0495602_0430876 Ga0495602_0430876_16_468 142
84 3300048904 Ga0496101_0722039 Ga0496101_0722039_232_687 142
85 3300049575 Ga0501039_1018652 Ga0501039_1018652_168_605 142
86 3300049588 Ga0501072_0380399 Ga0501072_0380399_211_648 142
87 3300049741 Ga0501079_0386773 Ga0501079_0386773_601_1038 142
88 3300049743 Ga0501081_0439842 Ga0501081_0439842_482_919 142
89 3300053085 Ga0495619_0673468 Ga0495619_0673468_214_666 142
90 iso_pu_bacteria 2818991458 2819668105 142
91 iso_pu_bacteria 2870782633 2870788794 142
92 3300003659 JGI25404J52841_10011177 JGI25404J52841_100111771 143
93 3300005347 Ga0070668_100139024 Ga0070668_1001390242 143
94 3300005355 Ga0070671_100288097 Ga0070671_1002880972 143
95 3300005364 Ga0070673_100121492 Ga0070673_1001214922 143
96 3300005441 Ga0070700_100136296 Ga0070700_1001362962 143
97 3300005444 Ga0070694_100085169 Ga0070694_1000851693 143
98 3300005467 Ga0070706_100934721 Ga0070706_1009347211 143
99 3300005535 Ga0070684_100328046 Ga0070684_1003280461 143
100 3300005547 Ga0070693_100187885 Ga0070693_1001878852 143
101 3300005563 Ga0068855_102102916 Ga0068855_1021029161 143
102 3300005983 Ga0081540_1001418 Ga0081540_100141825 143
103 3300006163 Ga0070715_10032347 Ga0070715_100323472 143
104 3300009011 Ga0105251_10054880 Ga0105251_100548802 143
105 3300009093 Ga0105240_11234018 Ga0105240_112340182 143
106 3300010159 Ga0099796_10053526 Ga0099796_100535261 143
107 3300020070 Ga0206356_10642078 Ga0206356_106420782 143
108 3300025900 Ga0207710_10079641 Ga0207710_100796412 143
109 3300025901 Ga0207688_10007772 Ga0207688_100077726 143
110 3300025904 Ga0207647_10256929 Ga0207647_102569292 143
111 3300025906 Ga0207699_10079456 Ga0207699_100794562 143
112 3300025911 Ga0207654_11189221 Ga0207654_111892212 143
113 3300025929 Ga0207664_11824816 Ga0207664_118248161 143
114 3300025945 Ga0207679_11077229 Ga0207679_110772292 143
115 3300025949 Ga0207667_11069387 Ga0207667_110693872 143
116 3300025960 Ga0207651_10607282 Ga0207651_106072822 143
117 3300026078 Ga0207702_10132402 Ga0207702_101324023 143
118 3300026121 Ga0207683_10209191 Ga0207683_102091911 143
119 3300035084 Ga0373928_0022469 Ga0373928_0022469_237_677 143
120 3300035086 Ga0373934_0421338 Ga0373934_0421338_101_538 143
121 3300035089 Ga0373944_0153117 Ga0373944_0153117_69_524 143
122 3300035089 Ga0373944_0310731 Ga0373944_0310731_65_511 143
123 3300035111 Ga0373923_0217771 Ga0373923_0217771_156_593 143
124 3300035112 Ga0373932_0333493 Ga0373932_0333493_122_562 143
125 3300035120 Ga0373957_0219676 Ga0373957_0219676_196_633 143
126 3300035170 Ga0373943_0128150 Ga0373943_0128150_162_608 143
127 3300035172 Ga0373955_0369416 Ga0373955_0369416_74_511 143
128 3300035410 Ga0373924_0107036 Ga0373924_0107036_721_1158 143
129 3300035692 Ga0373935_0149126 Ga0373935_0149126_200_670 143
130 3300035724 Ga0373933_0052269 Ga0373933_0052269_98_535 143
131 3300036401 Ga0373937_0135146 Ga0373937_0135146_1128_1565 143
132 3300036401 Ga0373937_0219618 Ga0373937_0219618_1045_1491 143
133 3300037068 Ga0373925_0009741 Ga0373925_0009741_3228_3677 143
134 3300037068 Ga0373925_0250750 Ga0373925_0250750_853_1302 143
135 3300037068 Ga0373925_0358227 Ga0373925_0358227_202_657 143
136 3300039450 Ga0436363_1265393 Ga0436363_1265393_895_1335 143
137 3300046454 Ga0495592_0051815 Ga0495592_0051815_2475_2912 143
138 3300046454 Ga0495592_0745992 Ga0495592_0745992_26_472 143
139 3300046462 Ga0495651_0003222 Ga0495651_0003222_4638_5075 143
140 3300046462 Ga0495651_0942881 Ga0495651_0942881_14_469 143
141 3300046463 Ga0495653_0002880 Ga0495653_0002880_10961_11398 143
142 3300046463 Ga0495653_0443474 Ga0495653_0443474_27_473 143
143 3300046475 Ga0495639_0328258 Ga0495639_0328258_161_619 143
144 3300046477 Ga0495664_0121215 Ga0495664_0121215_283_729 143
145 3300046511 Ga0495608_0041557 Ga0495608_0041557_1029_1466 143
146 3300046514 Ga0495618_0015896 Ga0495618_0015896_2599_3036 143
147 3300046516 Ga0495628_0110010 Ga0495628_0110010_1614_2060 143
148 3300046517 Ga0495630_0501692 Ga0495630_0501692_167_613 143
149 3300046529 Ga0495652_0022788 Ga0495652_0022788_250_687 143
150 3300046529 Ga0495652_0064510 Ga0495652_0064510_913_1359 143
151 3300046533 Ga0495640_0023151 Ga0495640_0023151_361_807 143
152 3300046533 Ga0495640_0031362 Ga0495640_0031362_103_540 143
153 3300046536 Ga0495587_0020632 Ga0495587_0020632_741_1178 143
154 3300046543 Ga0495645_0121834 Ga0495645_0121834_22_459 143
155 3300046559 Ga0495667_0000302 Ga0495667_0000302_28036_28473 143
156 3300046642 Ga0495634_0211029 Ga0495634_0211029_378_824 143
157 3300046663 Ga0495635_0004499 Ga0495635_0004499_769_1206 143
158 3300046663 Ga0495635_0247775 Ga0495635_0247775_288_734 143
159 3300046675 Ga0495657_0006514 Ga0495657_0006514_3548_3985 143
160 3300046679 Ga0495623_0027788 Ga0495623_0027788_278_715 143
161 3300046680 Ga0495646_0009352 Ga0495646_0009352_4140_4577 143
162 3300046680 Ga0495646_0055454 Ga0495646_0055454_954_1400 143
163 3300046680 Ga0495646_0282562 Ga0495646_0282562_415_870 143
164 3300046690 Ga0495624_0127217 Ga0495624_0127217_10_456 143
165 3300046809 Ga0495600_0009438 Ga0495600_0009438_2886_3323 143
166 3300047317 Ga0495604_0434846 Ga0495604_0434846_387_833 143
167 3300047319 Ga0495674_0001543 Ga0495674_0001543_11712_12158 143
168 3300047319 Ga0495674_0019229 Ga0495674_0019229_2886_3323 143
169 3300047321 Ga0495676_0081429 Ga0495676_0081429_1447_1893 143
170 3300047322 Ga0495680_0001454 Ga0495680_0001454_2929_3366 143
171 3300047322 Ga0495680_0270927 Ga0495680_0270927_667_1113 143
172 3300047444 Ga0495675_0020998 Ga0495675_0020998_458_895 143
173 3300047471 Ga0495684_0003199 Ga0495684_0003199_7850_8287 143
174 3300048088 Ga0495602_0035056 Ga0495602_0035056_1346_1783 143
175 3300048088 Ga0495602_0496886 Ga0495602_0496886_397_843 143
176 3300048905 Ga0496102_1000742 Ga0496102_1000742_194_634 143
177 3300048907 Ga0496104_0473072 Ga0496104_0473072_431_871 143
178 3300048908 Ga0496105_0115103 Ga0496105_0115103_1552_1992 143
179 3300048911 Ga0496108_0751444 Ga0496108_0751444_289_729 143
180 3300048912 Ga0496109_0492128 Ga0496109_0492128_586_1026 143
181 3300048913 Ga0496110_1203410 Ga0496110_1203410_123_563 143
182 3300048915 Ga0496112_0212460 Ga0496112_0212460_1386_1826 143
183 3300048916 Ga0496113_0761417 Ga0496113_0761417_114_554 143
184 3300053077 Ga0495601_0028281 Ga0495601_0028281_2558_2995 143
185 3300053084 Ga0495595_0014508 Ga0495595_0014508_1770_2207 143
186 3300053085 Ga0495619_0296007 Ga0495619_0296007_249_686 143
187 3300053085 Ga0495619_0305932 Ga0495619_0305932_113_559 143
188 iso_pu_bacteria 2558860112 2558912312 143
189 3300002067 JGI24735J21928_10088676 JGI24735J21928_100886762 144
190 3300005327 Ga0070658_10104305 Ga0070658_101043052 144
191 3300005328 Ga0070676_10061481 Ga0070676_100614813 144
192 3300005329 Ga0070683_100010133 Ga0070683_10001013310 144
193 3300005329 Ga0070683_100164581 Ga0070683_1001645811 144
194 3300005329 Ga0070683_101075843 Ga0070683_1010758432 144
195 3300005329 Ga0070683_101556590 Ga0070683_1015565901 144
196 3300005330 Ga0070690_101526229 Ga0070690_1015262291 144
197 3300005331 Ga0070670_100214632 Ga0070670_1002146322 144
198 3300005331 Ga0070670_100385794 Ga0070670_1003857942 144
199 3300005334 Ga0068869_100048457 Ga0068869_1000484571 144
200 3300005334 Ga0068869_100080265 Ga0068869_1000802654 144
201 3300005334 Ga0068869_100194027 Ga0068869_1001940273 144
202 3300005334 Ga0068869_100959253 Ga0068869_1009592531 144
203 3300005335 Ga0070666_10326768 Ga0070666_103267682 144
204 3300005336 Ga0070680_100219269 Ga0070680_1002192691 144
205 3300005337 Ga0070682_100045590 Ga0070682_1000455903 144
206 3300005337 Ga0070682_100170657 Ga0070682_1001706572 144
207 3300005337 Ga0070682_100239092 Ga0070682_1002390922 144
208 3300005337 Ga0070682_100414165 Ga0070682_1004141652 144
209 3300005338 Ga0068868_100043012 Ga0068868_1000430121 144
210 3300005338 Ga0068868_100073280 Ga0068868_1000732803 144
211 3300005338 Ga0068868_100672822 Ga0068868_1006728221 144
212 3300005338 Ga0068868_101312291 Ga0068868_1013122911 144
213 3300005339 Ga0070660_100145004 Ga0070660_1001450042 144
214 3300005339 Ga0070660_100424222 Ga0070660_1004242222 144
215 3300005340 Ga0070689_100231932 Ga0070689_1002319322 144
216 3300005340 Ga0070689_100284504 Ga0070689_1002845042 144
217 3300005343 Ga0070687_100072860 Ga0070687_1000728602 144
218 3300005343 Ga0070687_100126729 Ga0070687_1001267292 144
219 3300005343 Ga0070687_100629113 Ga0070687_1006291131 144
220 3300005344 Ga0070661_100112341 Ga0070661_1001123413 144
221 3300005345 Ga0070692_10106524 Ga0070692_101065242 144
222 3300005345 Ga0070692_11368045 Ga0070692_113680451 144
223 3300005347 Ga0070668_100115767 Ga0070668_1001157672 144
224 3300005347 Ga0070668_100959467 Ga0070668_1009594671 144
225 3300005347 Ga0070668_101217430 Ga0070668_1012174302 144
226 3300005353 Ga0070669_100128058 Ga0070669_1001280582 144
227 3300005354 Ga0070675_100409654 Ga0070675_1004096542 144
228 3300005354 Ga0070675_100426706 Ga0070675_1004267062 144
229 3300005355 Ga0070671_100006613 Ga0070671_1000066133 144
230 3300005356 Ga0070674_100051392 Ga0070674_1000513923 144
231 3300005356 Ga0070674_100073178 Ga0070674_1000731781 144
232 3300005356 Ga0070674_101383304 Ga0070674_1013833041 144
233 3300005365 Ga0070688_100666547 Ga0070688_1006665471 144
234 3300005366 Ga0070659_100130430 Ga0070659_1001304302 144
235 3300005366 Ga0070659_100178220 Ga0070659_1001782202 144
236 3300005367 Ga0070667_100238828 Ga0070667_1002388282 144
237 3300005367 Ga0070667_100373763 Ga0070667_1003737632 144
238 3300005367 Ga0070667_100434140 Ga0070667_1004341402 144
239 3300005434 Ga0070709_10089746 Ga0070709_100897463 144
240 3300005434 Ga0070709_10195797 Ga0070709_101957972 144
241 3300005434 Ga0070709_10266605 Ga0070709_102666052 144
242 3300005435 Ga0070714_100010968 Ga0070714_1000109682 144
243 3300005435 Ga0070714_100219711 Ga0070714_1002197112 144
244 3300005435 Ga0070714_100343810 Ga0070714_1003438102 144
245 3300005435 Ga0070714_100456387 Ga0070714_1004563871 144
246 3300005435 Ga0070714_100484702 Ga0070714_1004847022 144
247 3300005435 Ga0070714_100745686 Ga0070714_1007456862 144
248 3300005435 Ga0070714_100897474 Ga0070714_1008974742 144
249 3300005436 Ga0070713_100066279 Ga0070713_1000662793 144
250 3300005436 Ga0070713_100097647 Ga0070713_1000976472 144
251 3300005436 Ga0070713_100324547 Ga0070713_1003245472 144
252 3300005436 Ga0070713_100443980 Ga0070713_1004439802 144
253 3300005436 Ga0070713_100547427 Ga0070713_1005474272 144
254 3300005436 Ga0070713_100714225 Ga0070713_1007142252 144
255 3300005436 Ga0070713_100886238 Ga0070713_1008862382 144
256 3300005437 Ga0070710_10010220 Ga0070710_100102206 144
257 3300005437 Ga0070710_10038180 Ga0070710_100381803 144
258 3300005437 Ga0070710_10123243 Ga0070710_101232432 144
259 3300005437 Ga0070710_10259639 Ga0070710_102596392 144
260 3300005437 Ga0070710_11085554 Ga0070710_110855541 144
261 3300005438 Ga0070701_10057036 Ga0070701_100570362 144
262 3300005438 Ga0070701_10094393 Ga0070701_100943931 144
263 3300005439 Ga0070711_100093981 Ga0070711_1000939813 144
264 3300005439 Ga0070711_100378670 Ga0070711_1003786701 144
265 3300005439 Ga0070711_100836482 Ga0070711_1008364821 144
266 3300005439 Ga0070711_100950369 Ga0070711_1009503692 144
267 3300005440 Ga0070705_100756102 Ga0070705_1007561021 144
268 3300005441 Ga0070700_100301955 Ga0070700_1003019551 144
269 3300005441 Ga0070700_100637938 Ga0070700_1006379381 144
270 3300005445 Ga0070708_100067758 Ga0070708_1000677582 144
271 3300005445 Ga0070708_100282789 Ga0070708_1002827891 144
272 3300005445 Ga0070708_100344647 Ga0070708_1003446472 144
273 3300005445 Ga0070708_100770854 Ga0070708_1007708542 144
274 3300005445 Ga0070708_101327390 Ga0070708_1013273902 144
275 3300005455 Ga0070663_100071242 Ga0070663_1000712423 144
276 3300005455 Ga0070663_100084123 Ga0070663_1000841233 144
277 3300005456 Ga0070678_100058826 Ga0070678_1000588262 144
278 3300005466 Ga0070685_10081386 Ga0070685_100813862 144
279 3300005466 Ga0070685_10125327 Ga0070685_101253271 144
280 3300005466 Ga0070685_10293079 Ga0070685_102930792 144
281 3300005466 Ga0070685_10359573 Ga0070685_103595732 144
282 3300005467 Ga0070706_100014528 Ga0070706_1000145284 144
283 3300005467 Ga0070706_100020291 Ga0070706_1000202916 144
284 3300005467 Ga0070706_100061918 Ga0070706_1000619183 144
285 3300005467 Ga0070706_100121825 Ga0070706_1001218253 144
286 3300005467 Ga0070706_100508414 Ga0070706_1005084141 144
287 3300005468 Ga0070707_100008637 Ga0070707_1000086374 144
288 3300005468 Ga0070707_100032225 Ga0070707_1000322254 144
289 3300005468 Ga0070707_100063807 Ga0070707_1000638072 144
290 3300005468 Ga0070707_100574495 Ga0070707_1005744951 144
291 3300005468 Ga0070707_100855700 Ga0070707_1008557002 144
292 3300005468 Ga0070707_100868332 Ga0070707_1008683322 144
293 3300005468 Ga0070707_100905693 Ga0070707_1009056932 144
294 3300005471 Ga0070698_100101305 Ga0070698_1001013053 144
295 3300005471 Ga0070698_100164232 Ga0070698_1001642323 144
296 3300005471 Ga0070698_100189813 Ga0070698_1001898132 144
297 3300005471 Ga0070698_100214794 Ga0070698_1002147941 144
298 3300005471 Ga0070698_100348892 Ga0070698_1003488922 144
299 3300005471 Ga0070698_100551986 Ga0070698_1005519862 144
300 3300005518 Ga0070699_100293372 Ga0070699_1002933722 144
301 3300005518 Ga0070699_100447674 Ga0070699_1004476742 144
302 3300005518 Ga0070699_100784151 Ga0070699_1007841512 144
303 3300005518 Ga0070699_101124410 Ga0070699_1011244101 144
304 3300005530 Ga0070679_100306096 Ga0070679_1003060962 144
305 3300005535 Ga0070684_100570997 Ga0070684_1005709972 144
306 3300005535 Ga0070684_101299886 Ga0070684_1012998862 144
307 3300005535 Ga0070684_101410953 Ga0070684_1014109531 144
308 3300005536 Ga0070697_100004980 Ga0070697_1000049802 144
309 3300005536 Ga0070697_100005122 Ga0070697_1000051221 144
310 3300005536 Ga0070697_101253910 Ga0070697_1012539101 144
311 3300005539 Ga0068853_100197362 Ga0068853_1001973621 144
312 3300005539 Ga0068853_101578733 Ga0068853_1015787332 144
313 3300005543 Ga0070672_100585599 Ga0070672_1005855992 144
314 3300005544 Ga0070686_100067208 Ga0070686_1000672082 144
315 3300005544 Ga0070686_100112399 Ga0070686_1001123993 144
316 3300005544 Ga0070686_100214821 Ga0070686_1002148212 144
317 3300005546 Ga0070696_100093758 Ga0070696_1000937582 144
318 3300005546 Ga0070696_100097333 Ga0070696_1000973332 144
319 3300005547 Ga0070693_100270120 Ga0070693_1002701201 144
320 3300005547 Ga0070693_100527194 Ga0070693_1005271942 144
321 3300005548 Ga0070665_100015619 Ga0070665_1000156192 144
322 3300005548 Ga0070665_100366743 Ga0070665_1003667431 144
323 3300005548 Ga0070665_100472572 Ga0070665_1004725722 144
324 3300005548 Ga0070665_100480081 Ga0070665_1004800812 144
325 3300005548 Ga0070665_100752493 Ga0070665_1007524932 144
326 3300005548 Ga0070665_100903229 Ga0070665_1009032292 144
327 3300005548 Ga0070665_101214992 Ga0070665_1012149922 144
328 3300005549 Ga0070704_100166852 Ga0070704_1001668522 144
329 3300005563 Ga0068855_100315232 Ga0068855_1003152322 144
330 3300005564 Ga0070664_100058853 Ga0070664_1000588535 144
331 3300005564 Ga0070664_100393262 Ga0070664_1003932622 144
332 3300005564 Ga0070664_101563227 Ga0070664_1015632272 144
333 3300005577 Ga0068857_100146134 Ga0068857_1001461343 144
334 3300005577 Ga0068857_101723658 Ga0068857_1017236581 144
335 3300005578 Ga0068854_100067452 Ga0068854_1000674523 144
336 3300005578 Ga0068854_100188554 Ga0068854_1001885542 144
337 3300005614 Ga0068856_100089102 Ga0068856_1000891023 144
338 3300005614 Ga0068856_100208657 Ga0068856_1002086572 144
339 3300005614 Ga0068856_100380665 Ga0068856_1003806652 144
340 3300005614 Ga0068856_100553582 Ga0068856_1005535822 144
341 3300005614 Ga0068856_101680397 Ga0068856_1016803972 144
342 3300005615 Ga0070702_100098795 Ga0070702_1000987952 144
343 3300005616 Ga0068852_100023215 Ga0068852_1000232152 144
344 3300005616 Ga0068852_100727427 Ga0068852_1007274271 144
345 3300005617 Ga0068859_100090223 Ga0068859_1000902232 144
346 3300005618 Ga0068864_100259012 Ga0068864_1002590122 144
347 3300005618 Ga0068864_100338043 Ga0068864_1003380432 144
348 3300005618 Ga0068864_100426400 Ga0068864_1004264002 144
349 3300005618 Ga0068864_100849294 Ga0068864_1008492941 144
350 3300005718 Ga0068866_10034753 Ga0068866_100347532 144
351 3300005719 Ga0068861_100144239 Ga0068861_1001442392 144
352 3300005719 Ga0068861_101188824 Ga0068861_1011888242 144
353 3300005834 Ga0068851_10076079 Ga0068851_100760793 144
354 3300005840 Ga0068870_10064193 Ga0068870_100641932 144
355 3300005840 Ga0068870_10088250 Ga0068870_100882502 144
356 3300005840 Ga0068870_10290919 Ga0068870_102909192 144
357 3300005841 Ga0068863_100050833 Ga0068863_1000508333 144
358 3300005841 Ga0068863_100151463 Ga0068863_1001514633 144
359 3300005841 Ga0068863_100267518 Ga0068863_1002675182 144
360 3300005841 Ga0068863_101476785 Ga0068863_1014767851 144
361 3300005842 Ga0068858_100141636 Ga0068858_1001416363 144
362 3300005842 Ga0068858_100203922 Ga0068858_1002039222 144
363 3300005843 Ga0068860_100053636 Ga0068860_1000536362 144
364 3300005843 Ga0068860_100536568 Ga0068860_1005365682 144
365 3300005843 Ga0068860_102601993 Ga0068860_1026019931 144
366 3300005844 Ga0068862_100198562 Ga0068862_1001985623 144
367 3300005844 Ga0068862_101111707 Ga0068862_1011117071 144
368 3300006028 Ga0070717_10004588 Ga0070717_100045882 144
369 3300006028 Ga0070717_10118622 Ga0070717_101186224 144
370 3300006028 Ga0070717_10297442 Ga0070717_102974422 144
371 3300006028 Ga0070717_10385994 Ga0070717_103859942 144
372 3300006028 Ga0070717_10391053 Ga0070717_103910532 144
373 3300006028 Ga0070717_10486228 Ga0070717_104862282 144
374 3300006028 Ga0070717_10557928 Ga0070717_105579282 144
375 3300006028 Ga0070717_11891003 Ga0070717_118910032 144
376 3300006058 Ga0075432_10143774 Ga0075432_101437741 144
377 3300006163 Ga0070715_10007549 Ga0070715_100075493 144
378 3300006163 Ga0070715_10061303 Ga0070715_100613032 144
379 3300006173 Ga0070716_100027939 Ga0070716_1000279393 144
380 3300006175 Ga0070712_100046024 Ga0070712_1000460244 144
381 3300006175 Ga0070712_100571476 Ga0070712_1005714762 144
382 3300006237 Ga0097621_100084496 Ga0097621_1000844963 144
383 3300006237 Ga0097621_100313178 Ga0097621_1003131782 144
384 3300006237 Ga0097621_100360564 Ga0097621_1003605642 144
385 3300006358 Ga0068871_100099025 Ga0068871_1000990253 144
386 3300006358 Ga0068871_100223692 Ga0068871_1002236922 144
387 3300006852 Ga0075433_10035089 Ga0075433_100350892 144
388 3300006852 Ga0075433_10584660 Ga0075433_105846602 144
389 3300006852 Ga0075433_10649805 Ga0075433_106498052 144
390 3300006871 Ga0075434_100036726 Ga0075434_1000367264 144
391 3300006871 Ga0075434_100103356 Ga0075434_1001033561 144
392 3300006881 Ga0068865_100143391 Ga0068865_1001433912 144
393 3300006914 Ga0075436_100019486 Ga0075436_1000194867 144
394 3300006914 Ga0075436_100849045 Ga0075436_1008490452 144
395 3300006914 Ga0075436_101314648 Ga0075436_1013146481 144
396 3300006931 Ga0097620_100090221 Ga0097620_1000902212 144
397 3300007076 Ga0075435_100042367 Ga0075435_1000423672 144
398 3300007076 Ga0075435_100044934 Ga0075435_1000449345 144
399 3300007076 Ga0075435_101343885 Ga0075435_1013438851 144
400 3300007265 Ga0099794_10124513 Ga0099794_101245132 144
401 3300009093 Ga0105240_10654932 Ga0105240_106549322 144
402 3300009094 Ga0111539_10276078 Ga0111539_102760782 144
403 3300009094 Ga0111539_10307871 Ga0111539_103078712 144
404 3300009094 Ga0111539_11437839 Ga0111539_114378392 144
405 3300009098 Ga0105245_10084613 Ga0105245_100846133 144
406 3300009098 Ga0105245_10327120 Ga0105245_103271203 144
407 3300009098 Ga0105245_10939064 Ga0105245_109390641 144
408 3300009101 Ga0105247_10115558 Ga0105247_101155582 144
409 3300009101 Ga0105247_10305072 Ga0105247_103050722 144
410 3300009101 Ga0105247_10428711 Ga0105247_104287112 144
411 3300009148 Ga0105243_10972136 Ga0105243_109721362 144
412 3300009174 Ga0105241_10145741 Ga0105241_101457412 144
413 3300009174 Ga0105241_11388256 Ga0105241_113882562 144
414 3300009177 Ga0105248_11611908 Ga0105248_116119081 144
415 3300009177 Ga0105248_12166737 Ga0105248_121667372 144
416 3300009545 Ga0105237_10213237 Ga0105237_102132372 144
417 3300009545 Ga0105237_10822384 Ga0105237_108223841 144
418 3300009551 Ga0105238_10129854 Ga0105238_101298542 144
419 3300009553 Ga0105249_10041106 Ga0105249_100411062 144
420 3300009553 Ga0105249_10496493 Ga0105249_104964932 144
421 3300009553 Ga0105249_12533046 Ga0105249_125330461 144
422 3300010375 Ga0105239_10259912 Ga0105239_102599123 144
423 3300010375 Ga0105239_10528798 Ga0105239_105287982 144
424 3300010375 Ga0105239_10957648 Ga0105239_109576482 144
425 3300011119 Ga0105246_10077914 Ga0105246_100779143 144
426 3300011119 Ga0105246_10728530 Ga0105246_107285301 144
427 3300011119 Ga0105246_11690965 Ga0105246_116909651 144
428 3300011119 Ga0105246_11897251 Ga0105246_118972511 144
429 3300012488 Ga0157343_1005703 Ga0157343_10057032 144
430 3300012500 Ga0157314_1005099 Ga0157314_10050991 144
431 3300012503 Ga0157313_1015068 Ga0157313_10150682 144
432 3300012510 Ga0157316_1021675 Ga0157316_10216752 144
433 3300012515 Ga0157338_1007878 Ga0157338_10078782 144
434 3300013100 Ga0157373_10103326 Ga0157373_101033262 144
435 3300013102 Ga0157371_10039209 Ga0157371_100392091 144
436 3300013102 Ga0157371_10210603 Ga0157371_102106032 144
437 3300013105 Ga0157369_10039494 Ga0157369_100394941 144
438 3300013105 Ga0157369_10219124 Ga0157369_102191241 144
439 3300013105 Ga0157369_10846810 Ga0157369_108468102 144
440 3300013105 Ga0157369_10851300 Ga0157369_108513002 144
441 3300013105 Ga0157369_10869402 Ga0157369_108694022 144
442 3300013296 Ga0157374_11015790 Ga0157374_110157902 144
443 3300013297 Ga0157378_10965584 Ga0157378_109655842 144
444 3300013297 Ga0157378_12044892 Ga0157378_120448921 144
445 3300013306 Ga0163162_10258861 Ga0163162_102588612 144
446 3300013306 Ga0163162_11027732 Ga0163162_110277321 144
447 3300013307 Ga0157372_10311525 Ga0157372_103115252 144
448 3300013308 Ga0157375_10304650 Ga0157375_103046502 144
449 3300013308 Ga0157375_10620938 Ga0157375_106209381 144
450 3300013308 Ga0157375_10959864 Ga0157375_109598641 144
451 3300013308 Ga0157375_11735641 Ga0157375_117356411 144
452 3300013308 Ga0157375_11754759 Ga0157375_117547591 144
453 3300014325 Ga0163163_10080889 Ga0163163_100808893 144
454 3300014325 Ga0163163_10445921 Ga0163163_104459212 144
455 3300014325 Ga0163163_10446241 Ga0163163_104462412 144
456 3300014325 Ga0163163_12411555 Ga0163163_124115552 144
457 3300014325 Ga0163163_12918918 Ga0163163_129189181 144
458 3300014326 Ga0157380_10019892 Ga0157380_100198925 144
459 3300014326 Ga0157380_10918064 Ga0157380_109180642 144
460 3300014745 Ga0157377_10042907 Ga0157377_100429073 144
461 3300014968 Ga0157379_10363521 Ga0157379_103635212 144
462 3300014968 Ga0157379_10410016 Ga0157379_104100162 144
463 3300014968 Ga0157379_11161452 Ga0157379_111614521 144
464 3300014969 Ga0157376_10997969 Ga0157376_109979692 144
465 3300014969 Ga0157376_11043053 Ga0157376_110430531 144
466 3300017792 Ga0163161_10053874 Ga0163161_100538744 144
467 3300020081 Ga0206354_10265570 Ga0206354_102655701 144
468 3300020081 Ga0206354_10793134 Ga0206354_107931342 144
469 3300020082 Ga0206353_11413974 Ga0206353_114139742 144
470 3300021361 Ga0213872_10234874 Ga0213872_102348742 144
471 3300021377 Ga0213874_10045451 Ga0213874_100454512 144
472 3300021377 Ga0213874_10211796 Ga0213874_102117962 144
473 3300021384 Ga0213876_10036362 Ga0213876_100363622 144
474 3300021388 Ga0213875_10045334 Ga0213875_100453343 144
475 3300021388 Ga0213875_10052591 Ga0213875_100525912 144
476 3300021388 Ga0213875_10058196 Ga0213875_100581963 144
477 3300022467 Ga0224712_10233497 Ga0224712_102334971 144
478 3300024227 Ga0228598_1018484 Ga0228598_10184842 144
479 3300025885 Ga0207653_10010804 Ga0207653_100108041 144
480 3300025898 Ga0207692_10004053 Ga0207692_100040536 144
481 3300025898 Ga0207692_10071650 Ga0207692_100716502 144
482 3300025899 Ga0207642_10073402 Ga0207642_100734022 144
483 3300025901 Ga0207688_10045836 Ga0207688_100458362 144
484 3300025901 Ga0207688_10157397 Ga0207688_101573972 144
485 3300025903 Ga0207680_10784292 Ga0207680_107842922 144
486 3300025904 Ga0207647_10057589 Ga0207647_100575892 144
487 3300025906 Ga0207699_10044202 Ga0207699_100442022 144
488 3300025906 Ga0207699_10180052 Ga0207699_101800522 144
489 3300025906 Ga0207699_10429931 Ga0207699_104299312 144
490 3300025906 Ga0207699_10845814 Ga0207699_108458141 144
491 3300025907 Ga0207645_10013813 Ga0207645_100138132 144
492 3300025907 Ga0207645_10053173 Ga0207645_100531733 144
493 3300025908 Ga0207643_10076171 Ga0207643_100761712 144
494 3300025908 Ga0207643_10383788 Ga0207643_103837881 144
495 3300025910 Ga0207684_10003200 Ga0207684_100032006 144
496 3300025910 Ga0207684_10020102 Ga0207684_100201025 144
497 3300025910 Ga0207684_10077003 Ga0207684_100770033 144
498 3300025910 Ga0207684_10094850 Ga0207684_100948502 144
499 3300025910 Ga0207684_10606029 Ga0207684_106060292 144
500 3300025911 Ga0207654_10800665 Ga0207654_108006651 144
501 3300025911 Ga0207654_10897858 Ga0207654_108978582 144
502 3300025912 Ga0207707_10101703 Ga0207707_101017033 144
503 3300025914 Ga0207671_10963621 Ga0207671_109636211 144
504 3300025915 Ga0207693_10056576 Ga0207693_100565763 144
505 3300025915 Ga0207693_10059120 Ga0207693_100591202 144
506 3300025916 Ga0207663_10144604 Ga0207663_101446042 144
507 3300025916 Ga0207663_10190152 Ga0207663_101901522 144
508 3300025916 Ga0207663_10347975 Ga0207663_103479752 144
509 3300025916 Ga0207663_10847353 Ga0207663_108473532 144
510 3300025917 Ga0207660_10192159 Ga0207660_101921592 144
511 3300025918 Ga0207662_10002144 Ga0207662_100021441 144
512 3300025918 Ga0207662_10045119 Ga0207662_100451193 144
513 3300025919 Ga0207657_10015479 Ga0207657_100154794 144
514 3300025919 Ga0207657_10023888 Ga0207657_100238882 144
515 3300025920 Ga0207649_10406832 Ga0207649_104068321 144
516 3300025922 Ga0207646_10005011 Ga0207646_100050116 144
517 3300025922 Ga0207646_10112534 Ga0207646_101125342 144
518 3300025922 Ga0207646_10271339 Ga0207646_102713392 144
519 3300025922 Ga0207646_10396792 Ga0207646_103967921 144
520 3300025922 Ga0207646_10400802 Ga0207646_104008022 144
521 3300025922 Ga0207646_10481015 Ga0207646_104810152 144
522 3300025922 Ga0207646_10545398 Ga0207646_105453982 144
523 3300025923 Ga0207681_10132749 Ga0207681_101327492 144
524 3300025926 Ga0207659_10333269 Ga0207659_103332692 144
525 3300025926 Ga0207659_11039468 Ga0207659_110394681 144
526 3300025927 Ga0207687_10045231 Ga0207687_100452312 144
527 3300025927 Ga0207687_10276077 Ga0207687_102760772 144
528 3300025928 Ga0207700_10135686 Ga0207700_101356862 144
529 3300025928 Ga0207700_10224393 Ga0207700_102243931 144
530 3300025928 Ga0207700_10226535 Ga0207700_102265352 144
531 3300025928 Ga0207700_10234458 Ga0207700_102344582 144
532 3300025928 Ga0207700_10305846 Ga0207700_103058462 144
533 3300025928 Ga0207700_10577756 Ga0207700_105777562 144
534 3300025928 Ga0207700_10689956 Ga0207700_106899562 144
535 3300025928 Ga0207700_10854659 Ga0207700_108546592 144
536 3300025928 Ga0207700_10871614 Ga0207700_108716142 144
537 3300025929 Ga0207664_10042704 Ga0207664_100427045 144
538 3300025929 Ga0207664_10045230 Ga0207664_100452303 144
539 3300025929 Ga0207664_10460867 Ga0207664_104608671 144
540 3300025929 Ga0207664_10921506 Ga0207664_109215061 144
541 3300025931 Ga0207644_10013700 Ga0207644_100137005 144
542 3300025931 Ga0207644_10218922 Ga0207644_102189222 144
543 3300025931 Ga0207644_10886441 Ga0207644_108864412 144
544 3300025932 Ga0207690_11457995 Ga0207690_114579951 144
545 3300025933 Ga0207706_10014518 Ga0207706_100145187 144
546 3300025933 Ga0207706_10020900 Ga0207706_100209007 144
547 3300025935 Ga0207709_10338926 Ga0207709_103389262 144
548 3300025937 Ga0207669_10529025 Ga0207669_105290252 144
549 3300025937 Ga0207669_11132866 Ga0207669_111328661 144
550 3300025938 Ga0207704_11144556 Ga0207704_111445562 144
551 3300025939 Ga0207665_10023191 Ga0207665_100231912 144
552 3300025940 Ga0207691_10063086 Ga0207691_100630862 144
553 3300025940 Ga0207691_10144081 Ga0207691_101440813 144
554 3300025941 Ga0207711_10648251 Ga0207711_106482512 144
555 3300025942 Ga0207689_10005167 Ga0207689_100051672 144
556 3300025942 Ga0207689_10092506 Ga0207689_100925063 144
557 3300025942 Ga0207689_10287121 Ga0207689_102871211 144
558 3300025944 Ga0207661_10876822 Ga0207661_108768222 144
559 3300025945 Ga0207679_10034943 Ga0207679_100349433 144
560 3300025949 Ga0207667_10100747 Ga0207667_101007472 144
561 3300025960 Ga0207651_10334335 Ga0207651_103343352 144
562 3300025961 Ga0207712_10886559 Ga0207712_108865592 144
563 3300025972 Ga0207668_10770099 Ga0207668_107700991 144
564 3300025972 Ga0207668_11511063 Ga0207668_115110631 144
565 3300025981 Ga0207640_10198576 Ga0207640_101985762 144
566 3300025981 Ga0207640_10311143 Ga0207640_103111432 144
567 3300025986 Ga0207658_10091859 Ga0207658_100918592 144
568 3300025986 Ga0207658_10871532 Ga0207658_108715322 144
569 3300026023 Ga0207677_10421295 Ga0207677_104212951 144
570 3300026023 Ga0207677_10907012 Ga0207677_109070122 144
571 3300026035 Ga0207703_10885744 Ga0207703_108857442 144
572 3300026041 Ga0207639_10331386 Ga0207639_103313861 144
573 3300026067 Ga0207678_10016013 Ga0207678_100160133 144
574 3300026067 Ga0207678_10112718 Ga0207678_101127182 144
575 3300026075 Ga0207708_10017813 Ga0207708_100178136 144
576 3300026075 Ga0207708_10032843 Ga0207708_100328433 144
577 3300026075 Ga0207708_11276017 Ga0207708_112760172 144
578 3300026078 Ga0207702_10228150 Ga0207702_102281502 144
579 3300026078 Ga0207702_10426448 Ga0207702_104264482 144
580 3300026088 Ga0207641_10027486 Ga0207641_100274863 144
581 3300026088 Ga0207641_10640357 Ga0207641_106403572 144
582 3300026088 Ga0207641_11298905 Ga0207641_112989051 144
583 3300026089 Ga0207648_10089701 Ga0207648_100897014 144
584 3300026089 Ga0207648_10871823 Ga0207648_108718232 144
585 3300026089 Ga0207648_11790044 Ga0207648_117900441 144
586 3300026095 Ga0207676_10418403 Ga0207676_104184032 144
587 3300026095 Ga0207676_12175077 Ga0207676_121750771 144
588 3300026116 Ga0207674_10009354 Ga0207674_100093542 144
589 3300026116 Ga0207674_10257954 Ga0207674_102579542 144
590 3300026116 Ga0207674_10540600 Ga0207674_105406002 144
591 3300026116 Ga0207674_10595912 Ga0207674_105959122 144
592 3300026118 Ga0207675_100019761 Ga0207675_1000197613 144
593 3300026118 Ga0207675_100024633 Ga0207675_1000246333 144
594 3300026121 Ga0207683_10003875 Ga0207683_1000387516 144
595 3300026121 Ga0207683_10055388 Ga0207683_100553882 144
596 3300026121 Ga0207683_10944602 Ga0207683_109446022 144
597 3300026121 Ga0207683_11268424 Ga0207683_112684242 144
598 3300026142 Ga0207698_10252216 Ga0207698_102522162 144
599 3300027907 Ga0207428_10088366 Ga0207428_100883662 144
600 3300027907 Ga0207428_10732624 Ga0207428_107326241 144
601 3300028379 Ga0268266_10045907 Ga0268266_100459075 144
602 3300028379 Ga0268266_10421736 Ga0268266_104217361 144
603 3300028379 Ga0268266_10542530 Ga0268266_105425302 144
604 3300028379 Ga0268266_10798690 Ga0268266_107986901 144
605 3300028380 Ga0268265_11187905 Ga0268265_111879052 144
606 3300028380 Ga0268265_11413055 Ga0268265_114130552 144
607 3300028381 Ga0268264_10170508 Ga0268264_101705082 144
608 3300028381 Ga0268264_10388922 Ga0268264_103889222 144
609 3300028381 Ga0268264_11535869 Ga0268264_115358691 144
610 3300031852 Ga0307410_10368141 Ga0307410_103681412 144
611 3300031903 Ga0307407_10717815 Ga0307407_107178151 144
612 3300032005 Ga0307411_10195843 Ga0307411_101958432 144
613 3300034817 Ga0373948_0003687 Ga0373948_0003687_915_1352 144
614 3300034817 Ga0373948_0053412 Ga0373948_0053412_135_587 144
615 3300034818 Ga0373950_0088072 Ga0373950_0088072_177_614 144
616 3300034819 Ga0373958_0176063 Ga0373958_0176063_56_493 144
617 3300034957 Ga0373938_0039601 Ga0373938_0039601_327_785 144
618 3300035083 Ga0373926_0002520 Ga0373926_0002520_1595_2068 144
619 3300035086 Ga0373934_0000065 Ga0373934_0000065_12777_13214 144
620 3300035086 Ga0373934_0042856 Ga0373934_0042856_1043_1516 144
621 3300035086 Ga0373934_0044329 Ga0373934_0044329_988_1425 144
622 3300035088 Ga0373940_0001960 Ga0373940_0001960_897_1334 144
623 3300035088 Ga0373940_0059107 Ga0373940_0059107_394_852 144
624 3300035089 Ga0373944_0001897 Ga0373944_0001897_1043_1516 144
625 3300035089 Ga0373944_0024453 Ga0373944_0024453_697_1134 144
626 3300035089 Ga0373944_0093564 Ga0373944_0093564_547_984 144
627 3300035092 Ga0373952_0099451 Ga0373952_0099451_200_637 144
628 3300035111 Ga0373923_0058965 Ga0373923_0058965_450_887 144
629 3300035111 Ga0373923_0082972 Ga0373923_0082972_213_650 144
630 3300035113 Ga0373936_0021757 Ga0373936_0021757_492_965 144
631 3300035113 Ga0373936_0116916 Ga0373936_0116916_397_834 144
632 3300035113 Ga0373936_0575465 Ga0373936_0575465_73_510 144
633 3300035117 Ga0373953_0000055 Ga0373953_0000055_12959_13396 144
634 3300035117 Ga0373953_0004490 Ga0373953_0004490_3617_4090 144
635 3300035117 Ga0373953_0065531 Ga0373953_0065531_286_723 144
636 3300035118 Ga0373954_0022397 Ga0373954_0022397_2364_2801 144
637 3300035119 Ga0373956_0000141 Ga0373956_0000141_7340_7777 144
638 3300035119 Ga0373956_0009695 Ga0373956_0009695_2674_3111 144
639 3300035119 Ga0373956_0080785 Ga0373956_0080785_605_1078 144
640 3300035120 Ga0373957_0000093 Ga0373957_0000093_7966_8403 144
641 3300035120 Ga0373957_0055231 Ga0373957_0055231_467_940 144
642 3300035120 Ga0373957_0083588 Ga0373957_0083588_175_612 144
643 3300035121 Ga0373960_0223487 Ga0373960_0223487_133_591 144
644 3300035170 Ga0373943_0003174 Ga0373943_0003174_3577_4050 144
645 3300035170 Ga0373943_0029808 Ga0373943_0029808_759_1196 144
646 3300035171 Ga0373946_0047922 Ga0373946_0047922_627_1064 144
647 3300035171 Ga0373946_0163571 Ga0373946_0163571_236_673 144
648 3300035171 Ga0373946_0224305 Ga0373946_0224305_439_897 144
649 3300035172 Ga0373955_0000207 Ga0373955_0000207_19145_19582 144
650 3300035172 Ga0373955_0007999 Ga0373955_0007999_2238_2711 144
651 3300035172 Ga0373955_0035209 Ga0373955_0035209_756_1193 144
652 3300035172 Ga0373955_0185549 Ga0373955_0185549_328_765 144
653 3300035242 Ga0373962_0021488 Ga0373962_0021488_483_920 144
654 3300035410 Ga0373924_0000073 Ga0373924_0000073_5964_6401 144
655 3300035410 Ga0373924_0002275 Ga0373924_0002275_4210_4683 144
656 3300035410 Ga0373924_0012047 Ga0373924_0012047_2336_2773 144
657 3300035691 Ga0373931_0152396 Ga0373931_0152396_84_542 144
658 3300035691 Ga0373931_0694686 Ga0373931_0694686_26_463 144
659 3300035692 Ga0373935_0215500 Ga0373935_0215500_293_730 144
660 3300035692 Ga0373935_0285805 Ga0373935_0285805_528_986 144
661 3300035692 Ga0373935_0446732 Ga0373935_0446732_313_750 144
662 3300035695 Ga0373927_0027321 Ga0373927_0027321_2501_2938 144
663 3300035695 Ga0373927_0035125 Ga0373927_0035125_2744_3217 144
664 3300035695 Ga0373927_0421948 Ga0373927_0421948_383_820 144
665 3300035724 Ga0373933_0000054 Ga0373933_0000054_56113_56550 144
666 3300035724 Ga0373933_0003898 Ga0373933_0003898_2624_3061 144
667 3300035724 Ga0373933_0011093 Ga0373933_0011093_284_757 144
668 3300035725 Ga0373947_0001093 Ga0373947_0001093_15797_16270 144
669 3300035725 Ga0373947_0046346 Ga0373947_0046346_781_1218 144
670 3300035725 Ga0373947_0098208 Ga0373947_0098208_1055_1513 144
671 3300035725 Ga0373947_0169858 Ga0373947_0169858_706_1143 144
672 3300036401 Ga0373937_0000002 Ga0373937_0000002_195831_196268 144
673 3300036401 Ga0373937_0010001 Ga0373937_0010001_989_1426 144
674 3300036401 Ga0373937_0274263 Ga0373937_0274263_1060_1497 144
675 3300036401 Ga0373937_0327105 Ga0373937_0327105_563_1036 144
676 3300037068 Ga0373925_0083149 Ga0373925_0083149_112_585 144
677 3300037068 Ga0373925_0109779 Ga0373925_0109779_1638_2075 144
678 3300037068 Ga0373925_0249717 Ga0373925_0249717_509_967 144
679 3300037068 Ga0373925_0516956 Ga0373925_0516956_481_918 144
680 3300037853 Ga0436364_0021886 Ga0436364_0021886_879_1322 144
681 3300037853 Ga0436364_0769079 Ga0436364_0769079_995_1432 144
682 3300037853 Ga0436364_1084539 Ga0436364_1084539_694_1137 144
683 3300037853 Ga0436364_1262394 Ga0436364_1262394_691_1128 144
684 3300039437 Ga0436365_0222628 Ga0436365_0222628_4259_4699 144
685 3300039437 Ga0436365_1293463 Ga0436365_1293463_1086_1523 144
686 3300039447 Ga0436361_0158863 Ga0436361_0158863_157_594 144
687 3300039450 Ga0436363_0530596 Ga0436363_0530596_245_682 144
688 3300039450 Ga0436363_1174765 Ga0436363_1174765_870_1307 144
689 3300039453 Ga0436362_0727893 Ga0436362_0727893_18_476 144
690 3300041443 Ga0451789_0553388 Ga0451789_0553388_82_522 144
691 3300041451 Ga0451791_1593630 Ga0451791_1593630_91_540 144
692 3300041498 Ga0451841_1052420 Ga0451841_1052420_103_543 144
693 3300044658 Ga0466972_0009324 Ga0466972_0009324_1591_2028 144
694 3300044693 Ga0466961_0439757 Ga0466961_0439757_164_601 144
695 3300044765 Ga0466970_0053321 Ga0466970_0053321_1062_1499 144
696 3300044842 Ga0466957_0288507 Ga0466957_0288507_277_714 144
697 3300044901 Ga0466960_0001547 Ga0466960_0001547_6693_7130 144
698 3300045976 Ga0466967_0159286 Ga0466967_0159286_736_1191 144
699 3300045976 Ga0466967_0186235 Ga0466967_0186235_677_1114 144
700 3300045976 Ga0466967_0515435 Ga0466967_0515435_129_566 144
701 3300046454 Ga0495592_0000003 Ga0495592_0000003_92471_92908 144
702 3300046454 Ga0495592_0033887 Ga0495592_0033887_2655_3092 144
703 3300046454 Ga0495592_0044826 Ga0495592_0044826_653_1126 144
704 3300046454 Ga0495592_0191623 Ga0495592_0191623_740_1177 144
705 3300046455 Ga0495603_0000661 Ga0495603_0000661_7046_7519 144
706 3300046455 Ga0495603_0074227 Ga0495603_0074227_779_1216 144
707 3300046459 Ga0495629_0001950 Ga0495629_0001950_12543_13016 144
708 3300046459 Ga0495629_0012811 Ga0495629_0012811_4748_5185 144
709 3300046459 Ga0495629_0282370 Ga0495629_0282370_33_470 144
710 3300046461 Ga0495641_0001407 Ga0495641_0001407_7548_8021 144
711 3300046461 Ga0495641_0035357 Ga0495641_0035357_1012_1449 144
712 3300046461 Ga0495641_0071193 Ga0495641_0071193_284_721 144
713 3300046462 Ga0495651_0000036 Ga0495651_0000036_92490_92927 144
714 3300046462 Ga0495651_0023674 Ga0495651_0023674_3951_4424 144
715 3300046462 Ga0495651_0055381 Ga0495651_0055381_1749_2186 144
716 3300046462 Ga0495651_0267202 Ga0495651_0267202_135_572 144
717 3300046463 Ga0495653_0000406 Ga0495653_0000406_10720_11157 144
718 3300046463 Ga0495653_0038555 Ga0495653_0038555_2628_3065 144
719 3300046463 Ga0495653_0038923 Ga0495653_0038923_2485_2922 144
720 3300046463 Ga0495653_0112727 Ga0495653_0112727_1064_1537 144
721 3300046472 Ga0495580_0006551 Ga0495580_0006551_670_1143 144
722 3300046472 Ga0495580_0110900 Ga0495580_0110900_758_1195 144
723 3300046473 Ga0495582_0002623 Ga0495582_0002623_5166_5639 144
724 3300046473 Ga0495582_0020254 Ga0495582_0020254_2609_3046 144
725 3300046473 Ga0495582_0037471 Ga0495582_0037471_779_1216 144
726 3300046475 Ga0495639_0007269 Ga0495639_0007269_3912_4385 144
727 3300046476 Ga0495662_0001838 Ga0495662_0001838_3847_4320 144
728 3300046476 Ga0495662_0007893 Ga0495662_0007893_574_1011 144
729 3300046476 Ga0495662_0384469 Ga0495662_0384469_199_636 144
730 3300046477 Ga0495664_0101383 Ga0495664_0101383_914_1351 144
731 3300046477 Ga0495664_0229500 Ga0495664_0229500_202_660 144
732 3300046499 Ga0495594_0031228 Ga0495594_0031228_2316_2789 144
733 3300046511 Ga0495608_0000018 Ga0495608_0000018_92467_92904 144
734 3300046511 Ga0495608_0026583 Ga0495608_0026583_3123_3560 144
735 3300046511 Ga0495608_0027027 Ga0495608_0027027_785_1258 144
736 3300046514 Ga0495618_0007128 Ga0495618_0007128_1571_2008 144
737 3300046514 Ga0495618_0017974 Ga0495618_0017974_467_940 144
738 3300046514 Ga0495618_0066107 Ga0495618_0066107_1083_1520 144
739 3300046516 Ga0495628_0000020 Ga0495628_0000020_57560_57997 144
740 3300046516 Ga0495628_0240404 Ga0495628_0240404_467_940 144
741 3300046517 Ga0495630_0036754 Ga0495630_0036754_353_826 144
742 3300046517 Ga0495630_0075463 Ga0495630_0075463_1325_1762 144
743 3300046517 Ga0495630_0096775 Ga0495630_0096775_1306_1743 144
744 3300046517 Ga0495630_0449417 Ga0495630_0449417_54_506 144
745 3300046526 Ga0495666_0016042 Ga0495666_0016042_2389_2826 144
746 3300046526 Ga0495666_0022892 Ga0495666_0022892_2542_3015 144
747 3300046529 Ga0495652_0000013 Ga0495652_0000013_101357_101794 144
748 3300046529 Ga0495652_0030281 Ga0495652_0030281_3875_4348 144
749 3300046529 Ga0495652_0213570 Ga0495652_0213570_179_616 144
750 3300046531 Ga0495665_0001556 Ga0495665_0001556_7767_8240 144
751 3300046531 Ga0495665_0050849 Ga0495665_0050849_1511_1948 144
752 3300046531 Ga0495665_0086485 Ga0495665_0086485_1103_1540 144
753 3300046533 Ga0495640_0016167 Ga0495640_0016167_2238_2711 144
754 3300046533 Ga0495640_0031284 Ga0495640_0031284_1246_1683 144
755 3300046533 Ga0495640_0161476 Ga0495640_0161476_137_574 144
756 3300046533 Ga0495640_0842393 Ga0495640_0842393_83_520 144
757 3300046535 Ga0495586_0006621 Ga0495586_0006621_1320_1793 144
758 3300046535 Ga0495586_0608161 Ga0495586_0608161_93_530 144
759 3300046536 Ga0495587_0000014 Ga0495587_0000014_92455_92892 144
760 3300046536 Ga0495587_0005895 Ga0495587_0005895_3313_3750 144
761 3300046536 Ga0495587_0009225 Ga0495587_0009225_1988_2461 144
762 3300046543 Ga0495645_0030955 Ga0495645_0030955_686_1123 144
763 3300046543 Ga0495645_0060069 Ga0495645_0060069_1324_1797 144
764 3300046543 Ga0495645_0168638 Ga0495645_0168638_454_891 144
765 3300046543 Ga0495645_0200172 Ga0495645_0200172_183_620 144
766 3300046557 Ga0495622_0121609 Ga0495622_0121609_45_503 144
767 3300046559 Ga0495667_0000014 Ga0495667_0000014_107845_108282 144
768 3300046559 Ga0495667_0097605 Ga0495667_0097605_307_744 144
769 3300046559 Ga0495667_0180565 Ga0495667_0180565_415_888 144
770 3300046616 Ga0495668_0699492 Ga0495668_0699492_37_477 144
771 3300046642 Ga0495634_0059420 Ga0495634_0059420_1339_1776 144
772 3300046642 Ga0495634_0091725 Ga0495634_0091725_583_1056 144
773 3300046642 Ga0495634_0288652 Ga0495634_0288652_396_833 144
774 3300046642 Ga0495634_0346534 Ga0495634_0346534_429_866 144
775 3300046663 Ga0495635_0002746 Ga0495635_0002746_1981_2454 144
776 3300046663 Ga0495635_0033200 Ga0495635_0033200_2709_3146 144
777 3300046663 Ga0495635_0443740 Ga0495635_0443740_182_634 144
778 3300046663 Ga0495635_0545769 Ga0495635_0545769_139_576 144
779 3300046674 Ga0495588_0033859 Ga0495588_0033859_1829_2302 144
780 3300046674 Ga0495588_0135331 Ga0495588_0135331_214_651 144
781 3300046675 Ga0495657_0000012 Ga0495657_0000012_105284_105721 144
782 3300046675 Ga0495657_0047516 Ga0495657_0047516_321_794 144
783 3300046675 Ga0495657_0105784 Ga0495657_0105784_839_1276 144
784 3300046678 Ga0495599_0000037 Ga0495599_0000037_70888_71325 144
785 3300046678 Ga0495599_0011715 Ga0495599_0011715_3875_4348 144
786 3300046678 Ga0495599_0029683 Ga0495599_0029683_307_744 144
787 3300046679 Ga0495623_0000079 Ga0495623_0000079_4795_5232 144
788 3300046679 Ga0495623_0009073 Ga0495623_0009073_5805_6242 144
789 3300046679 Ga0495623_0129241 Ga0495623_0129241_553_1026 144
790 3300046680 Ga0495646_0011733 Ga0495646_0011733_2779_3216 144
791 3300046680 Ga0495646_0075783 Ga0495646_0075783_779_1216 144
792 3300046681 Ga0495647_0001069 Ga0495647_0001069_4802_5275 144
793 3300046681 Ga0495647_0120664 Ga0495647_0120664_209_646 144
794 3300046683 Ga0495658_0002199 Ga0495658_0002199_912_1385 144
795 3300046689 Ga0495613_0006714 Ga0495613_0006714_2076_2549 144
796 3300046690 Ga0495624_0005490 Ga0495624_0005490_4782_5255 144
797 3300046690 Ga0495624_0124468 Ga0495624_0124468_516_953 144
798 3300046690 Ga0495624_0177773 Ga0495624_0177773_810_1247 144
799 3300046809 Ga0495600_0003734 Ga0495600_0003734_3954_4391 144
800 3300046809 Ga0495600_0013917 Ga0495600_0013917_1530_1967 144
801 3300046809 Ga0495600_0016008 Ga0495600_0016008_657_1130 144
802 3300046809 Ga0495600_0289005 Ga0495600_0289005_428_865 144
803 3300047315 Ga0495581_0009902 Ga0495581_0009902_2803_3276 144
804 3300047315 Ga0495581_0023893 Ga0495581_0023893_1209_1646 144
805 3300047317 Ga0495604_0005054 Ga0495604_0005054_9545_9982 144
806 3300047317 Ga0495604_0011248 Ga0495604_0011248_4502_4975 144
807 3300047317 Ga0495604_0089914 Ga0495604_0089914_686_1123 144
808 3300047319 Ga0495674_0013670 Ga0495674_0013670_6387_6824 144
809 3300047319 Ga0495674_0326244 Ga0495674_0326244_583_1056 144
810 3300047319 Ga0495674_1186184 Ga0495674_1186184_101_538 144
811 3300047321 Ga0495676_0020252 Ga0495676_0020252_3004_3477 144
812 3300047321 Ga0495676_0124368 Ga0495676_0124368_279_716 144
813 3300047321 Ga0495676_0216123 Ga0495676_0216123_656_1093 144
814 3300047322 Ga0495680_0000003 Ga0495680_0000003_70386_70823 144
815 3300047322 Ga0495680_0029953 Ga0495680_0029953_353_826 144
816 3300047322 Ga0495680_0055123 Ga0495680_0055123_1115_1552 144
817 3300047322 Ga0495680_0226762 Ga0495680_0226762_117_554 144
818 3300047444 Ga0495675_0000389 Ga0495675_0000389_10037_10474 144
819 3300047444 Ga0495675_0033719 Ga0495675_0033719_1768_2205 144
820 3300047444 Ga0495675_0200844 Ga0495675_0200844_197_670 144
821 3300047471 Ga0495684_0005821 Ga0495684_0005821_785_1258 144
822 3300047471 Ga0495684_0007526 Ga0495684_0007526_6655_7092 144
823 3300047471 Ga0495684_0011571 Ga0495684_0011571_5818_6255 144
824 3300047471 Ga0495684_0612170 Ga0495684_0612170_168_635 144
825 3300047673 Ga0495593_0000847 Ga0495593_0000847_15437_15910 144
826 3300047673 Ga0495593_0006911 Ga0495593_0006911_4929_5366 144
827 3300047673 Ga0495593_0020492 Ga0495593_0020492_2862_3299 144
828 3300048088 Ga0495602_0000014 Ga0495602_0000014_91484_91921 144
829 3300048088 Ga0495602_0025497 Ga0495602_0025497_2989_3426 144
830 3300048088 Ga0495602_0143675 Ga0495602_0143675_366_839 144
831 3300048088 Ga0495602_0843037 Ga0495602_0843037_42_479 144
832 3300048089 Ga0495614_0007195 Ga0495614_0007195_180_638 144
833 3300048089 Ga0495614_0018832 Ga0495614_0018832_990_1427 144
834 3300048903 Ga0496100_0035899 Ga0496100_0035899_1861_2298 144
835 3300048903 Ga0496100_0524411 Ga0496100_0524411_24_461 144
836 3300048903 Ga0496100_1388527 Ga0496100_1388527_18_458 144
837 3300048904 Ga0496101_0131946 Ga0496101_0131946_1129_1566 144
838 3300048904 Ga0496101_0183692 Ga0496101_0183692_992_1429 144
839 3300048904 Ga0496101_0527917 Ga0496101_0527917_243_683 144
840 3300048905 Ga0496102_0099513 Ga0496102_0099513_434_871 144
841 3300048905 Ga0496102_0630173 Ga0496102_0630173_105_542 144
842 3300048907 Ga0496104_0011893 Ga0496104_0011893_2179_2616 144
843 3300048907 Ga0496104_0044853 Ga0496104_0044853_209_646 144
844 3300048907 Ga0496104_0319358 Ga0496104_0319358_842_1282 144
845 3300048907 Ga0496104_0559544 Ga0496104_0559544_313_750 144
846 3300048908 Ga0496105_0007062 Ga0496105_0007062_5400_5837 144
847 3300048908 Ga0496105_0118728 Ga0496105_0118728_1029_1466 144
848 3300048909 Ga0496106_0098764 Ga0496106_0098764_1401_1859 144
849 3300048909 Ga0496106_0235487 Ga0496106_0235487_671_1108 144
850 3300048909 Ga0496106_0269701 Ga0496106_0269701_591_1031 144
851 3300048910 Ga0496107_0119312 Ga0496107_0119312_746_1183 144
852 3300048911 Ga0496108_0013691 Ga0496108_0013691_2127_2564 144
853 3300048911 Ga0496108_0020748 Ga0496108_0020748_1265_1702 144
854 3300048911 Ga0496108_0193286 Ga0496108_0193286_795_1229 144
855 3300048911 Ga0496108_0373805 Ga0496108_0373805_419_859 144
856 3300048912 Ga0496109_0158665 Ga0496109_0158665_1236_1673 144
857 3300048912 Ga0496109_0603886 Ga0496109_0603886_449_889 144
858 3300048912 Ga0496109_0657349 Ga0496109_0657349_29_466 144
859 3300048912 Ga0496109_1257270 Ga0496109_1257270_132_590 144
860 3300048912 Ga0496109_1790130 Ga0496109_1790130_76_513 144
861 3300048913 Ga0496110_0188692 Ga0496110_0188692_1225_1662 144
862 3300048914 Ga0496111_0030158 Ga0496111_0030158_1761_2219 144
863 3300048914 Ga0496111_0063187 Ga0496111_0063187_617_1057 144
864 3300048914 Ga0496111_0202624 Ga0496111_0202624_765_1199 144
865 3300048914 Ga0496111_0659560 Ga0496111_0659560_74_511 144
866 3300048915 Ga0496112_0003525 Ga0496112_0003525_2819_3256 144
867 3300048915 Ga0496112_0060274 Ga0496112_0060274_1822_2280 144
868 3300048915 Ga0496112_0136605 Ga0496112_0136605_1131_1571 144
869 3300048916 Ga0496113_0043438 Ga0496113_0043438_595_1032 144
870 3300048917 Ga0496114_0154195 Ga0496114_0154195_356_793 144
871 3300048917 Ga0496114_0458472 Ga0496114_0458472_265_702 144
872 3300048918 Ga0496115_0010698 Ga0496115_0010698_4553_4990 144
873 3300048918 Ga0496115_0113190 Ga0496115_0113190_1079_1516 144
874 3300049578 Ga0501042_0044911 Ga0501042_0044911_1335_1778 144
875 3300050511 nmdc:mga08y16_127207_c1 nmdc:mga08y16_127207_c1_360_800 144
876 3300050511 nmdc:mga08y16_859458_c1 nmdc:mga08y16_859458_c1_288_725 144
877 3300050512 nmdc:mga0n895_5920_c1 nmdc:mga0n895_5920_c1_8319_8756 144
878 3300050512 nmdc:mga0n895_65382_c1 nmdc:mga0n895_65382_c1_1433_1870 144
879 3300050513 nmdc:mga0rr50_14871_c1 nmdc:mga0rr50_14871_c1_3840_4277 144
880 3300050513 nmdc:mga0rr50_54822_c1 nmdc:mga0rr50_54822_c1_1518_1955 144
881 3300050513 nmdc:mga0rr50_826443_c1 nmdc:mga0rr50_826443_c1_170_607 144
882 3300050514 nmdc:mga08x19_16182_c1 nmdc:mga08x19_16182_c1_2001_2438 144
883 3300050514 nmdc:mga08x19_893659_c1 nmdc:mga08x19_893659_c1_20_478 144
884 3300050515 nmdc:mga0a205_49641_c1 nmdc:mga0a205_49641_c1_3302_3739 144
885 3300050515 nmdc:mga0a205_720479_c1 nmdc:mga0a205_720479_c1_211_669 144
886 3300053077 Ga0495601_0015583 Ga0495601_0015583_1169_1606 144
887 3300053077 Ga0495601_0023159 Ga0495601_0023159_3192_3665 144
888 3300053078 Ga0495612_0005770 Ga0495612_0005770_3576_4049 144
889 3300053084 Ga0495595_0001199 Ga0495595_0001199_6453_6890 144
890 3300053084 Ga0495595_0012038 Ga0495595_0012038_511_948 144
891 3300053085 Ga0495619_0019205 Ga0495619_0019205_3477_3950 144
892 3300059639 Ga0587062_031234 Ga0587062_031234_323_763 144
893 3300005337 Ga0070682_100388346 Ga0070682_1003883462 145
894 3300005435 Ga0070714_100085432 Ga0070714_1000854323 145
895 3300005437 Ga0070710_10025021 Ga0070710_100250212 145
896 3300005445 Ga0070708_100235526 Ga0070708_1002355262 145
897 3300005467 Ga0070706_100369843 Ga0070706_1003698432 145
898 3300005467 Ga0070706_100375891 Ga0070706_1003758911 145
899 3300005471 Ga0070698_100000308 Ga0070698_10000030829 145
900 3300005535 Ga0070684_101073271 Ga0070684_1010732711 145
901 3300005548 Ga0070665_100308847 Ga0070665_1003088472 145
902 3300005841 Ga0068863_100425178 Ga0068863_1004251782 145
903 3300006175 Ga0070712_100180523 Ga0070712_1001805233 145
904 3300006237 Ga0097621_100533450 Ga0097621_1005334502 145
905 3300013105 Ga0157369_11083434 Ga0157369_110834342 145
906 3300014325 Ga0163163_10421235 Ga0163163_104212352 145
907 3300021388 Ga0213875_10001142 Ga0213875_1000114210 145
908 3300022467 Ga0224712_10061690 Ga0224712_100616902 145
909 3300025898 Ga0207692_10040924 Ga0207692_100409242 145
910 3300025906 Ga0207699_10073928 Ga0207699_100739282 145
911 3300025910 Ga0207684_10885432 Ga0207684_108854322 145
912 3300025915 Ga0207693_10011756 Ga0207693_100117568 145
913 3300025916 Ga0207663_10114576 Ga0207663_101145762 145
914 3300025928 Ga0207700_10334989 Ga0207700_103349892 145
915 3300025929 Ga0207664_10014609 Ga0207664_100146094 145
916 3300025929 Ga0207664_10022615 Ga0207664_100226153 145
917 3300025939 Ga0207665_10017424 Ga0207665_100174242 145
918 3300025944 Ga0207661_10623231 Ga0207661_106232312 145
919 3300026095 Ga0207676_10650781 Ga0207676_106507812 145
920 3300028379 Ga0268266_10256942 Ga0268266_102569422 145
921 3300035083 Ga0373926_0004166 Ga0373926_0004166_688_1152 145
922 3300035089 Ga0373944_0000553 Ga0373944_0000553_357_821 145
923 3300035111 Ga0373923_0112828 Ga0373923_0112828_659_1123 145
924 3300035113 Ga0373936_0002649 Ga0373936_0002649_4811_5275 145
925 3300035116 Ga0373945_0000077 Ga0373945_0000077_3671_4135 145
926 3300035117 Ga0373953_0088400 Ga0373953_0088400_688_1152 145
927 3300035170 Ga0373943_0000164 Ga0373943_0000164_559_1023 145
928 3300035170 Ga0373943_0136585 Ga0373943_0136585_672_1115 145
929 3300035171 Ga0373946_0002495 Ga0373946_0002495_5359_5823 145
930 3300035692 Ga0373935_0003332 Ga0373935_0003332_5686_6150 145
931 3300035692 Ga0373935_0096262 Ga0373935_0096262_866_1339 145
932 3300035695 Ga0373927_0021656 Ga0373927_0021656_2647_3111 145
933 3300035724 Ga0373933_0120493 Ga0373933_0120493_295_759 145
934 3300035725 Ga0373947_0001602 Ga0373947_0001602_5555_6019 145
935 3300035725 Ga0373947_0278132 Ga0373947_0278132_584_1027 145
936 3300036401 Ga0373937_0249817 Ga0373937_0249817_1070_1534 145
937 3300037068 Ga0373925_0005625 Ga0373925_0005625_300_764 145
938 3300037068 Ga0373925_0325529 Ga0373925_0325529_77_520 145
939 3300037853 Ga0436364_0669885 Ga0436364_0669885_201_650 145
940 3300037853 Ga0436364_0872343 Ga0436364_0872343_126_575 145
941 3300037853 Ga0436364_1401376 Ga0436364_1401376_47182_47625 145
942 3300039453 Ga0436362_0624818 Ga0436362_0624818_99_542 145
943 3300041463 Ga0451804_0297973 Ga0451804_0297973_29_469 145
944 3300044683 Ga0466965_0138559 Ga0466965_0138559_75_512 145
945 3300044684 Ga0466966_0004664 Ga0466966_0004664_7142_7579 145
946 3300044693 Ga0466961_0438935 Ga0466961_0438935_76_513 145
947 3300044694 Ga0466963_0002427 Ga0466963_0002427_6638_7075 145
948 3300044694 Ga0466963_0036568 Ga0466963_0036568_2105_2545 145
949 3300044694 Ga0466963_0414536 Ga0466963_0414536_76_516 145
950 3300044694 Ga0466963_0825694 Ga0466963_0825694_55_501 145
951 3300044706 Ga0466964_0732108 Ga0466964_0732108_78_518 145
952 3300044719 Ga0466971_0097029 Ga0466971_0097029_882_1319 145
953 3300045049 Ga0466959_0127852 Ga0466959_0127852_1296_1733 145
954 3300045049 Ga0466959_0833734 Ga0466959_0833734_166_606 145
955 3300045836 Ga0466958_0000849 Ga0466958_0000849_12981_13418 145
956 3300045836 Ga0466958_0228027 Ga0466958_0228027_648_1088 145
957 3300045976 Ga0466967_0005545 Ga0466967_0005545_3859_4296 145
958 3300046461 Ga0495641_0006055 Ga0495641_0006055_5335_5799 145
959 3300046462 Ga0495651_0223151 Ga0495651_0223151_117_581 145
960 3300046463 Ga0495653_0007981 Ga0495653_0007981_7679_8143 145
961 3300046475 Ga0495639_0042136 Ga0495639_0042136_622_1086 145
962 3300046476 Ga0495662_0044581 Ga0495662_0044581_990_1454 145
963 3300046477 Ga0495664_0000454 Ga0495664_0000454_17078_17542 145
964 3300046511 Ga0495608_0040428 Ga0495608_0040428_414_878 145
965 3300046514 Ga0495618_0028819 Ga0495618_0028819_447_911 145
966 3300046517 Ga0495630_0052195 Ga0495630_0052195_2376_2840 145
967 3300046526 Ga0495666_0095277 Ga0495666_0095277_23_487 145
968 3300046531 Ga0495665_0019771 Ga0495665_0019771_2528_2992 145
969 3300046533 Ga0495640_0034696 Ga0495640_0034696_2061_2525 145
970 3300046543 Ga0495645_0138630 Ga0495645_0138630_597_1061 145
971 3300046559 Ga0495667_0016888 Ga0495667_0016888_3670_4134 145
972 3300046642 Ga0495634_0029290 Ga0495634_0029290_136_600 145
973 3300046663 Ga0495635_0000462 Ga0495635_0000462_8190_8654 145
974 3300046675 Ga0495657_0042494 Ga0495657_0042494_2234_2698 145
975 3300046678 Ga0495599_0012101 Ga0495599_0012101_3660_4124 145
976 3300046680 Ga0495646_0097127 Ga0495646_0097127_1184_1648 145
977 3300046690 Ga0495624_0008133 Ga0495624_0008133_1324_1788 145
978 3300046809 Ga0495600_0029865 Ga0495600_0029865_115_579 145
979 3300047315 Ga0495581_0026782 Ga0495581_0026782_72_536 145
980 3300047319 Ga0495674_0000831 Ga0495674_0000831_16970_17434 145
981 3300047321 Ga0495676_0064180 Ga0495676_0064180_2265_2729 145
982 3300047322 Ga0495680_0040311 Ga0495680_0040311_309_773 145
983 3300047471 Ga0495684_0023304 Ga0495684_0023304_597_1061 145
984 3300047673 Ga0495593_0011275 Ga0495593_0011275_3486_3950 145
985 3300048911 Ga0496108_1134217 Ga0496108_1134217_95_544 145
986 3300048915 Ga0496112_0712307 Ga0496112_0712307_215_679 145
987 3300048916 Ga0496113_0557376 Ga0496113_0557376_130_579 145
988 3300049579 Ga0501043_1056319 Ga0501043_1056319_94_540 145
989 3300050512 nmdc:mga0n895_889796_c1 nmdc:mga0n895_889796_c1_401_850 145
990 3300050513 nmdc:mga0rr50_1314241_c1 nmdc:mga0rr50_1314241_c1_43_507 145
991 3300061719 Ga0466962_0004801 Ga0466962_0004801_637_1074 145
992 3300007076 Ga0075435_101242608 Ga0075435_1012426082 146
993 3300031548 Ga0307408_100230070 Ga0307408_1002300702 146
994 3300039450 Ga0436363_1105940 Ga0436363_1105940_180_632 146
995 3300044901 Ga0466960_0288304 Ga0466960_0288304_422_871 146
996 3300048904 Ga0496101_1088408 Ga0496101_1088408_142_597 146
997 3300048907 Ga0496104_0539499 Ga0496104_0539499_347_802 146
998 3300048912 Ga0496109_0867615 Ga0496109_0867615_23_478 146
999 3300048916 Ga0496113_1048068 Ga0496113_1048068_78_533 146
1000 iso_pu_bacteria 2816332139 2816505362 146
1001 3300013307 Ga0157372_11945606 Ga0157372_119456062 147
1002 3300031456 Ga0307513_10159162 Ga0307513_101591622 147
1003 3300031852 Ga0307410_10624912 Ga0307410_106249122 147
1004 3300005327 Ga0070658_11199661 Ga0070658_111996611 148
1005 3300014497 Ga0182008_10311211 Ga0182008_103112111 148
1006 3300035398 Ga0316574_0302297 Ga0316574_0302297_510_974 148
1007 3300037418 Ga0395900_0272449 Ga0395900_0272449_119_577 148
1008 3300045976 Ga0466967_0203012 Ga0466967_0203012_1307_1756 148
1009 3300048911 Ga0496108_0343762 Ga0496108_0343762_582_1028 148
1010 3300012500 Ga0157314_1004845 Ga0157314_10048452 149
1011 3300012507 Ga0157342_1004643 Ga0157342_10046432 149
1012 3300035121 Ga0373960_0432631 Ga0373960_0432631_23_475 149
1013 3300048913 Ga0496110_0383501 Ga0496110_0383501_679_1128 149
1014 3300005337 Ga0070682_100017777 Ga0070682_1000177774 150
1015 3300005356 Ga0070674_100960786 Ga0070674_1009607861 150
1016 3300005457 Ga0070662_101194932 Ga0070662_1011949321 150
1017 3300005578 Ga0068854_100123082 Ga0068854_1001230822 150
1018 3300005840 Ga0068870_10395839 Ga0068870_103958391 150
1019 3300013105 Ga0157369_10187760 Ga0157369_101877602 150
1020 3300013307 Ga0157372_10075612 Ga0157372_100756123 150
1021 3300014745 Ga0157377_10126583 Ga0157377_101265832 150
1022 3300014968 Ga0157379_10933670 Ga0157379_109336702 150
1023 3300025899 Ga0207642_10303438 Ga0207642_103034382 150
1024 3300025909 Ga0207705_10121471 Ga0207705_101214713 150
1025 3300025933 Ga0207706_10749861 Ga0207706_107498611 150
1026 3300025937 Ga0207669_10822733 Ga0207669_108227331 150
1027 3300025981 Ga0207640_10283131 Ga0207640_102831312 150
1028 3300028381 Ga0268264_11624319 Ga0268264_116243191 150
1029 3300046473 Ga0495582_0200431 Ga0495582_0200431_128_610 150
1030 3300000549 LJQas_1003654 LJQas_10036543 151
1031 3300005334 Ga0068869_101324989 Ga0068869_1013249891 151
1032 3300005455 Ga0070663_101133845 Ga0070663_1011338451 151
1033 3300005564 Ga0070664_100498746 Ga0070664_1004987461 151
1034 3300005614 Ga0068856_100385112 Ga0068856_1003851122 151
1035 3300005834 Ga0068851_10337054 Ga0068851_103370542 151
1036 3300014969 Ga0157376_11453371 Ga0157376_114533711 151
1037 3300025934 Ga0207686_10545499 Ga0207686_105454992 151
1038 3300025942 Ga0207689_10734424 Ga0207689_107344242 151
1039 3300039437 Ga0436365_0416340 Ga0436365_0416340_389_883 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02657

SufE

Fe-S metabolism associated domain

16

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wlo-assembly1.cif.gz_A solution structure of the hypothetical protein from thermus thermophilus hb8 0.8824 9 148
1wlo-assembly1.cif.gz_A solution structure of the hypothetical protein from thermus thermophilus hb8 0.8644 9 148
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.8324 12 146
5eep-assembly1.cif.gz_A crystal structure of e. coli csde 0.8189 15 146
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.7946 12 146
ID Description Score Start End Superfamily
af_P9WGC3_6_142_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9291 9 147 3.90.1010.10
af_P9WGC3_6_142_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9226 9 147 3.90.1010.10
1wloA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8824 9 148 3.90.1010.10
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8782 25 148 3.90.1010.10
1wloA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8644 9 148 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A399YKW3-F1-model_v4 Cysteine desulfuration protein SufE 0.9836 10 148
AF-A0A292Z179-F1-model_v4 Sulfur acceptor protein SufE 0.9825 7 149
AF-A0A292Z179-F1-model_v4 Sulfur acceptor protein SufE 0.9757 7 149
AF-A0A7X6H7T2-F1-model_v4 deleted 0.973 24 148
AF-A0A7Y4HWS9-F1-model_v4 SufE family protein 0.9725 9 146

Feature Viewer

pLDDT pTM Quality
92.62 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map