F488787
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1039 | 443 | 2078 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10271102|Ga0157378_102711022 |
| Length | 296 |
| Sequence | MKHSPVMAGLVPAIHVSMVAILQDVDARDKRGHDDREAERQDMPRLAGKTAIVTGGAKGIGRHYSQALAAEGARVMIADIADGRELAEEIAGRHGADSVASLKFDVSEEKAVKNLVAQTIDRFGQIDVLVNNAAYYATLKPRNFNEWDTETWDRVMAINVRGPYLMVRHVAPHMMARRTGKIINIASGAAYKGVPRMLPYVTSKGAMLAFTRSLSRELGEYGIAVNSLSPGYILSDTGLENATHVEEERVPVRNSRAFKRDAYPEDLLGALVFLASSDSDFVTGQSLVVDGGSVNN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 27 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 104 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 106 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 144 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 145 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 146 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 147 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 148 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 149 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 166 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 248 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 256 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 259 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 260 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 261 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 262 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 264 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 287 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 303 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 304 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 305 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 306 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 307 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 308 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 309 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 412 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 413 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 423 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 428 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 430 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 431 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 432 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 433 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 434 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 437 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 440 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 441 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 442 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 443 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.98 |
| Nodule | 0 |
| Rhizoplane | 5.2 |
| Rhizosphere | 90.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10271102 | 3300013297 | Bacteria | 1632 |
| 2 | SwRhRL2b_contig_416179 | 2162886007 | Bacteria | 1140 |
| 3 | 2214772996 | 2209111006 | Bacteria | 11536 |
| 4 | 2214822979 | 2209111006 | Bacteria | 1858 |
| 5 | ARSoilYngRDRAFT_c00480 | 3300000042 | Bacteria | 4764 |
| 6 | ARcpr5yngRDRAFT_c000101 | 3300000043 | Bacteria | 13551 |
| 7 | ARSoilOldRDRAFT_c000111 | 3300000044 | Bacteria | 14542 |
| 8 | ARCol0oldRDRAFT_c00749 | 3300000045 | Bacteria | 2750 |
| 9 | ARCol0yngRDRAFT_1000021 | 3300000652 | Bacteria | 30221 |
| 10 | JGI24741J21665_1005090 | 3300001915 | Bacteria | 2808 |
| 11 | JGI24752J21851_1000948 | 3300001976 | Bacteria | 3964 |
| 12 | JGI24746J21847_1000005 | 3300001977 | Bacteria | 23312 |
| 13 | JGI24747J21853_1000105 | 3300001978 | Bacteria | 3807 |
| 14 | JGI24739J22299_10004819 | 3300001989 | Bacteria | 5143 |
| 15 | JGI24737J22298_10000939 | 3300001990 | Bacteria | 10324 |
| 16 | JGI24737J22298_10001279 | 3300001990 | Bacteria | 8910 |
| 17 | JGI24735J21928_10083976 | 3300002067 | Bacteria | 913 |
| 18 | JGI24750J21931_1000059 | 3300002070 | Bacteria | 15603 |
| 19 | JGI24745J21846_1000123 | 3300002073 | Bacteria | 5883 |
| 20 | JGI24738J21930_10000278 | 3300002075 | Bacteria | 14037 |
| 21 | JGI24749J21850_1001646 | 3300002076 | Bacteria | 3171 |
| 22 | JGI24744J21845_10000309 | 3300002077 | Bacteria | 8188 |
| 23 | JGI24033J26618_1000714 | 3300002155 | Bacteria | 3185 |
| 24 | JGI24033J26618_1000746 | 3300002155 | Bacteria | 3121 |
| 25 | JGI24034J26672_10000175 | 3300002239 | Bacteria | 8835 |
| 26 | JGI24742J22300_10000270 | 3300002244 | Bacteria | 7778 |
| 27 | JGI24751J29686_10010562 | 3300002459 | Bacteria | 1903 |
| 28 | Ga0055540_1006346 | 3300003792 | Bacteria | 4715 |
| 29 | Ga0065717_1002043 | 3300005276 | Bacteria | 3312 |
| 30 | Ga0065716_1001534 | 3300005277 | Bacteria | 8611 |
| 31 | Ga0065704_10117421 | 3300005289 | Bacteria | 1834 |
| 32 | Ga0065712_10071326 | 3300005290 | Bacteria | 5337 |
| 33 | Ga0065712_10081593 | 3300005290 | Bacteria | 2993 |
| 34 | Ga0065715_10000270 | 3300005293 | Bacteria | 17149 |
| 35 | Ga0065715_10000725 | 3300005293 | Bacteria | 9426 |
| 36 | Ga0070658_10006794 | 3300005327 | Bacteria | 9255 |
| 37 | Ga0070658_10056361 | 3300005327 | Bacteria | 3193 |
| 38 | Ga0070676_10000194 | 3300005328 | Bacteria | 25376 |
| 39 | Ga0070683_100001461 | 3300005329 | Bacteria | 18165 |
| 40 | Ga0070690_100002052 | 3300005330 | Bacteria | 10748 |
| 41 | Ga0070690_100043408 | 3300005330 | Bacteria | 2851 |
| 42 | Ga0070690_100093548 | 3300005330 | Bacteria | 1983 |
| 43 | Ga0070670_100032641 | 3300005331 | Bacteria | 4484 |
| 44 | Ga0070670_100214306 | 3300005331 | Bacteria | 1675 |
| 45 | Ga0070670_100216991 | 3300005331 | Bacteria | 1664 |
| 46 | Ga0070670_100360240 | 3300005331 | Bacteria | 1279 |
| 47 | Ga0070677_10000223 | 3300005333 | Bacteria | 19560 |
| 48 | Ga0068869_100000910 | 3300005334 | Bacteria | 17020 |
| 49 | Ga0068869_100023605 | 3300005334 | Bacteria | 4251 |
| 50 | Ga0068869_100463744 | 3300005334 | Bacteria | 1052 |
| 51 | Ga0070666_10006822 | 3300005335 | Bacteria | 7036 |
| 52 | Ga0070666_10020841 | 3300005335 | Bacteria | 4242 |
| 53 | Ga0070680_100066929 | 3300005336 | Bacteria | 2946 |
| 54 | Ga0070680_100135455 | 3300005336 | Bacteria | 2063 |
| 55 | Ga0070680_100311108 | 3300005336 | Bacteria | 1336 |
| 56 | Ga0070680_100498419 | 3300005336 | Bacteria | 1042 |
| 57 | Ga0070682_100000411 | 3300005337 | Bacteria | 27934 |
| 58 | Ga0070682_100019450 | 3300005337 | Bacteria | 3983 |
| 59 | Ga0070682_100055448 | 3300005337 | Bacteria | 2489 |
| 60 | Ga0068868_100002658 | 3300005338 | Bacteria | 12396 |
| 61 | Ga0068868_100007347 | 3300005338 | Bacteria | 7845 |
| 62 | Ga0068868_100230442 | 3300005338 | Bacteria | 1554 |
| 63 | Ga0070660_100004007 | 3300005339 | Bacteria | 10167 |
| 64 | Ga0070660_100079850 | 3300005339 | Bacteria | 2567 |
| 65 | Ga0070660_100134212 | 3300005339 | Bacteria | 1983 |
| 66 | Ga0070689_100001606 | 3300005340 | Bacteria | 14434 |
| 67 | Ga0070689_100021640 | 3300005340 | Bacteria | 4790 |
| 68 | Ga0070689_100025073 | 3300005340 | Bacteria | 4478 |
| 69 | Ga0070691_10001869 | 3300005341 | Bacteria | 9200 |
| 70 | Ga0070691_10029804 | 3300005341 | Bacteria | 2554 |
| 71 | Ga0070691_10040466 | 3300005341 | Bacteria | 2203 |
| 72 | Ga0070687_100000727 | 3300005343 | Bacteria | 10925 |
| 73 | Ga0070687_100013975 | 3300005343 | Bacteria | 3595 |
| 74 | Ga0070661_100001236 | 3300005344 | Bacteria | 17965 |
| 75 | Ga0070661_100010430 | 3300005344 | Bacteria | 6461 |
| 76 | Ga0070661_100022480 | 3300005344 | Bacteria | 4515 |
| 77 | Ga0070661_100164490 | 3300005344 | Bacteria | 1682 |
| 78 | Ga0070661_100470507 | 3300005344 | Bacteria | 1002 |
| 79 | Ga0070692_10208867 | 3300005345 | Bacteria | 1148 |
| 80 | Ga0070668_100002586 | 3300005347 | Bacteria | 13300 |
| 81 | Ga0070668_100229342 | 3300005347 | Bacteria | 1534 |
| 82 | Ga0070669_100002152 | 3300005353 | Bacteria | 14248 |
| 83 | Ga0070669_100170824 | 3300005353 | Bacteria | 1695 |
| 84 | Ga0070675_100002725 | 3300005354 | Bacteria | 13279 |
| 85 | Ga0070675_100016211 | 3300005354 | Bacteria | 5911 |
| 86 | Ga0070671_100000400 | 3300005355 | Bacteria | 29909 |
| 87 | Ga0070671_100012085 | 3300005355 | Bacteria | 6946 |
| 88 | Ga0070671_100093671 | 3300005355 | Bacteria | 2517 |
| 89 | Ga0070674_100001765 | 3300005356 | Bacteria | 11732 |
| 90 | Ga0070674_100098169 | 3300005356 | Bacteria | 2129 |
| 91 | Ga0070673_100000169 | 3300005364 | Bacteria | 31478 |
| 92 | Ga0070673_100026672 | 3300005364 | Bacteria | 4271 |
| 93 | Ga0070673_100142818 | 3300005364 | Bacteria | 2021 |
| 94 | Ga0070673_100464043 | 3300005364 | Bacteria | 1141 |
| 95 | Ga0070688_100000757 | 3300005365 | Bacteria | 15949 |
| 96 | Ga0070688_100002817 | 3300005365 | Bacteria | 8852 |
| 97 | Ga0070688_100003731 | 3300005365 | Bacteria | 7883 |
| 98 | Ga0070659_100001586 | 3300005366 | Bacteria | 16387 |
| 99 | Ga0070659_100008020 | 3300005366 | Bacteria | 7697 |
| 100 | Ga0070667_100001596 | 3300005367 | Bacteria | 20275 |
| 101 | Ga0070667_100022988 | 3300005367 | Bacteria | 5169 |
| 102 | Ga0070667_100027904 | 3300005367 | Bacteria | 4697 |
| 103 | Ga0070667_100140344 | 3300005367 | Bacteria | 2116 |
| 104 | Ga0070667_100146861 | 3300005367 | Bacteria | 2069 |
| 105 | Ga0070703_10001184 | 3300005406 | Bacteria | 8031 |
| 106 | Ga0070703_10031370 | 3300005406 | Bacteria | 1607 |
| 107 | Ga0070709_10015216 | 3300005434 | Bacteria | 4371 |
| 108 | Ga0070709_10023786 | 3300005434 | Bacteria | 3602 |
| 109 | Ga0070709_10024550 | 3300005434 | Bacteria | 3549 |
| 110 | Ga0070709_10156577 | 3300005434 | Bacteria | 1580 |
| 111 | Ga0070714_100041579 | 3300005435 | Bacteria | 3880 |
| 112 | Ga0070714_100064394 | 3300005435 | Bacteria | 3155 |
| 113 | Ga0070714_100172166 | 3300005435 | Bacteria | 1965 |
| 114 | Ga0070714_100192732 | 3300005435 | Bacteria | 1861 |
| 115 | Ga0070714_100204716 | 3300005435 | Bacteria | 1807 |
| 116 | Ga0070713_100009260 | 3300005436 | Bacteria | 7037 |
| 117 | Ga0070713_100014412 | 3300005436 | Bacteria | 5872 |
| 118 | Ga0070713_100040260 | 3300005436 | Bacteria | 3798 |
| 119 | Ga0070713_100053207 | 3300005436 | Bacteria | 3354 |
| 120 | Ga0070713_100081827 | 3300005436 | Bacteria | 2756 |
| 121 | Ga0070710_10021260 | 3300005437 | Bacteria | 3378 |
| 122 | Ga0070710_10031294 | 3300005437 | Bacteria | 2871 |
| 123 | Ga0070710_10042657 | 3300005437 | Bacteria | 2509 |
| 124 | Ga0070710_10088546 | 3300005437 | Bacteria | 1822 |
| 125 | Ga0070701_10000774 | 3300005438 | Bacteria | 11424 |
| 126 | Ga0070701_10010118 | 3300005438 | Bacteria | 4160 |
| 127 | Ga0070711_100008564 | 3300005439 | Bacteria | 6271 |
| 128 | Ga0070711_100154133 | 3300005439 | Bacteria | 1735 |
| 129 | Ga0070711_100312166 | 3300005439 | Bacteria | 1253 |
| 130 | Ga0070705_100001954 | 3300005440 | Bacteria | 10554 |
| 131 | Ga0070705_100039207 | 3300005440 | Bacteria | 2686 |
| 132 | Ga0070705_100340380 | 3300005440 | Bacteria | 1090 |
| 133 | Ga0070700_100001821 | 3300005441 | Bacteria | 10759 |
| 134 | Ga0070700_100003523 | 3300005441 | Bacteria | 8072 |
| 135 | Ga0070694_100001416 | 3300005444 | Bacteria | 14051 |
| 136 | Ga0070694_100025720 | 3300005444 | Bacteria | 3809 |
| 137 | Ga0070694_100162063 | 3300005444 | Bacteria | 1642 |
| 138 | Ga0070708_100080726 | 3300005445 | Bacteria | 2943 |
| 139 | Ga0070663_100000593 | 3300005455 | Bacteria | 19280 |
| 140 | Ga0070663_100039355 | 3300005455 | Bacteria | 3303 |
| 141 | Ga0070663_100202315 | 3300005455 | Bacteria | 1550 |
| 142 | Ga0070678_100058246 | 3300005456 | Bacteria | 2835 |
| 143 | Ga0070662_100001940 | 3300005457 | Bacteria | 12717 |
| 144 | Ga0070662_100076740 | 3300005457 | Bacteria | 2477 |
| 145 | Ga0070681_10014859 | 3300005458 | Bacteria | 7740 |
| 146 | Ga0070681_10024101 | 3300005458 | Bacteria | 6126 |
| 147 | Ga0070681_10030328 | 3300005458 | Bacteria | 5426 |
| 148 | Ga0070681_10047915 | 3300005458 | Bacteria | 4271 |
| 149 | Ga0070681_10207931 | 3300005458 | Bacteria | 1874 |
| 150 | Ga0068867_100002072 | 3300005459 | Bacteria | 14049 |
| 151 | Ga0068867_100110461 | 3300005459 | Bacteria | 2112 |
| 152 | Ga0070685_10002853 | 3300005466 | Bacteria | 8834 |
| 153 | Ga0070685_10008779 | 3300005466 | Bacteria | 5204 |
| 154 | Ga0070685_10272552 | 3300005466 | Bacteria | 1130 |
| 155 | Ga0070679_100012097 | 3300005530 | Bacteria | 8243 |
| 156 | Ga0070679_100016794 | 3300005530 | Bacteria | 7074 |
| 157 | Ga0070679_100022903 | 3300005530 | Bacteria | 6109 |
| 158 | Ga0070679_100108103 | 3300005530 | Bacteria | 2767 |
| 159 | Ga0070679_100121517 | 3300005530 | Bacteria | 2596 |
| 160 | Ga0070679_100143037 | 3300005530 | Bacteria | 2371 |
| 161 | Ga0070679_100162213 | 3300005530 | Bacteria | 2209 |
| 162 | Ga0070679_100344734 | 3300005530 | Bacteria | 1438 |
| 163 | Ga0070684_100005903 | 3300005535 | Bacteria | 9430 |
| 164 | Ga0070684_100048855 | 3300005535 | Bacteria | 3671 |
| 165 | Ga0070684_100056083 | 3300005535 | Bacteria | 3437 |
| 166 | Ga0070697_100047335 | 3300005536 | Bacteria | 3487 |
| 167 | Ga0068853_100009652 | 3300005539 | Bacteria | 7778 |
| 168 | Ga0068853_100257584 | 3300005539 | Bacteria | 1603 |
| 169 | Ga0070672_100000611 | 3300005543 | Bacteria | 21001 |
| 170 | Ga0070686_100001276 | 3300005544 | Bacteria | 14248 |
| 171 | Ga0070686_100010093 | 3300005544 | Bacteria | 5314 |
| 172 | Ga0070686_100034929 | 3300005544 | Bacteria | 3101 |
| 173 | Ga0070695_100002233 | 3300005545 | Bacteria | 11088 |
| 174 | Ga0070695_100002508 | 3300005545 | Bacteria | 10579 |
| 175 | Ga0070696_100004688 | 3300005546 | Bacteria | 9139 |
| 176 | Ga0070696_100115027 | 3300005546 | Bacteria | 1941 |
| 177 | Ga0070696_100132168 | 3300005546 | Bacteria | 1817 |
| 178 | Ga0070696_100352615 | 3300005546 | Bacteria | 1140 |
| 179 | Ga0070693_100001538 | 3300005547 | Bacteria | 10416 |
| 180 | Ga0070693_100084622 | 3300005547 | Bacteria | 1899 |
| 181 | Ga0070693_100284995 | 3300005547 | Bacteria | 1108 |
| 182 | Ga0070665_100023186 | 3300005548 | Bacteria | 6252 |
| 183 | Ga0070665_100177668 | 3300005548 | Bacteria | 2130 |
| 184 | Ga0070704_100001853 | 3300005549 | Bacteria | 11658 |
| 185 | Ga0070704_100005239 | 3300005549 | Bacteria | 7550 |
| 186 | Ga0068855_100002375 | 3300005563 | Bacteria | 23200 |
| 187 | Ga0068855_100011650 | 3300005563 | Bacteria | 10627 |
| 188 | Ga0068855_100090552 | 3300005563 | Bacteria | 3530 |
| 189 | Ga0068855_100458546 | 3300005563 | Bacteria | 1390 |
| 190 | Ga0068855_100629801 | 3300005563 | Bacteria | 1154 |
| 191 | Ga0070664_100055670 | 3300005564 | Bacteria | 3359 |
| 192 | Ga0070664_100094085 | 3300005564 | Bacteria | 2598 |
| 193 | Ga0068857_100003420 | 3300005577 | Bacteria | 13238 |
| 194 | Ga0068857_100145713 | 3300005577 | Bacteria | 2143 |
| 195 | Ga0068857_100174187 | 3300005577 | Bacteria | 1957 |
| 196 | Ga0068857_100761023 | 3300005577 | Bacteria | 923 |
| 197 | Ga0068854_100001082 | 3300005578 | Bacteria | 16400 |
| 198 | Ga0068854_100111603 | 3300005578 | Bacteria | 2063 |
| 199 | Ga0068854_100151684 | 3300005578 | Bacteria | 1788 |
| 200 | Ga0068856_100006654 | 3300005614 | Bacteria | 11325 |
| 201 | Ga0068856_100070095 | 3300005614 | Bacteria | 3468 |
| 202 | Ga0068856_100073321 | 3300005614 | Bacteria | 3389 |
| 203 | Ga0068856_100219530 | 3300005614 | Bacteria | 1916 |
| 204 | Ga0068856_100936245 | 3300005614 | Bacteria | 885 |
| 205 | Ga0070702_100010472 | 3300005615 | Bacteria | 4568 |
| 206 | Ga0070702_100023452 | 3300005615 | Bacteria | 3278 |
| 207 | Ga0068852_100003054 | 3300005616 | Bacteria | 11648 |
| 208 | Ga0068852_100058122 | 3300005616 | Bacteria | 3348 |
| 209 | Ga0068852_100296450 | 3300005616 | Bacteria | 1564 |
| 210 | Ga0068859_100006509 | 3300005617 | Bacteria | 11858 |
| 211 | Ga0068859_100013118 | 3300005617 | Bacteria | 8327 |
| 212 | Ga0068859_100035698 | 3300005617 | Bacteria | 4988 |
| 213 | Ga0068859_100299994 | 3300005617 | Bacteria | 1700 |
| 214 | Ga0068864_100001244 | 3300005618 | Bacteria | 21163 |
| 215 | Ga0068864_100024235 | 3300005618 | Bacteria | 5103 |
| 216 | Ga0068864_100078011 | 3300005618 | Bacteria | 2898 |
| 217 | Ga0068866_10000500 | 3300005718 | Bacteria | 18096 |
| 218 | Ga0068861_100003449 | 3300005719 | Bacteria | 10495 |
| 219 | Ga0068861_100128476 | 3300005719 | Bacteria | 2054 |
| 220 | Ga0068870_10000015 | 3300005840 | Bacteria | 63346 |
| 221 | Ga0068863_100003914 | 3300005841 | Bacteria | 14708 |
| 222 | Ga0068863_100079596 | 3300005841 | Bacteria | 3103 |
| 223 | Ga0068863_100142176 | 3300005841 | Bacteria | 2294 |
| 224 | Ga0068863_100182590 | 3300005841 | Bacteria | 2014 |
| 225 | Ga0068858_100004772 | 3300005842 | Bacteria | 13275 |
| 226 | Ga0068858_100017902 | 3300005842 | Bacteria | 6635 |
| 227 | Ga0068858_100121572 | 3300005842 | Bacteria | 2442 |
| 228 | Ga0068860_100003116 | 3300005843 | Bacteria | 17138 |
| 229 | Ga0068860_100016258 | 3300005843 | Bacteria | 7255 |
| 230 | Ga0068860_100049182 | 3300005843 | Bacteria | 4017 |
| 231 | Ga0068862_100003903 | 3300005844 | Bacteria | 12673 |
| 232 | Ga0068862_100290312 | 3300005844 | Bacteria | 1502 |
| 233 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 234 | Ga0081455_10007043 | 3300005937 | Bacteria | 11938 |
| 235 | Ga0081455_10021572 | 3300005937 | Bacteria | 6038 |
| 236 | Ga0081455_10059440 | 3300005937 | Bacteria | 3227 |
| 237 | Ga0081455_10399209 | 3300005937 | Bacteria | 955 |
| 238 | Ga0081540_1015610 | 3300005983 | Bacteria | 4801 |
| 239 | Ga0081540_1024952 | 3300005983 | Bacteria | 3455 |
| 240 | Ga0081539_10011918 | 3300005985 | Bacteria | 6785 |
| 241 | Ga0081539_10021758 | 3300005985 | Bacteria | 4269 |
| 242 | Ga0070717_10014273 | 3300006028 | Bacteria | 6110 |
| 243 | Ga0070717_10140757 | 3300006028 | Bacteria | 2081 |
| 244 | Ga0070717_10145314 | 3300006028 | Bacteria | 2048 |
| 245 | Ga0070717_10413250 | 3300006028 | Bacteria | 1213 |
| 246 | Ga0075365_10223865 | 3300006038 | Bacteria | 1320 |
| 247 | Ga0075368_10037148 | 3300006042 | Bacteria | 1904 |
| 248 | Ga0075364_10229300 | 3300006051 | Bacteria | 1261 |
| 249 | Ga0075364_10241731 | 3300006051 | Bacteria | 1226 |
| 250 | Ga0075432_10003205 | 3300006058 | Bacteria | 5520 |
| 251 | Ga0070715_10043719 | 3300006163 | Bacteria | 1890 |
| 252 | Ga0070715_10045304 | 3300006163 | Bacteria | 1864 |
| 253 | Ga0070716_100016329 | 3300006173 | Bacteria | 3828 |
| 254 | Ga0070716_100025148 | 3300006173 | Bacteria | 3174 |
| 255 | Ga0070716_100029037 | 3300006173 | Bacteria | 2986 |
| 256 | Ga0070716_100230949 | 3300006173 | Bacteria | 1249 |
| 257 | Ga0070712_100059229 | 3300006175 | Bacteria | 2696 |
| 258 | Ga0070712_100066936 | 3300006175 | Bacteria | 2555 |
| 259 | Ga0070712_100208649 | 3300006175 | Bacteria | 1539 |
| 260 | Ga0070712_100273696 | 3300006175 | Bacteria | 1358 |
| 261 | Ga0070712_100405473 | 3300006175 | Bacteria | 1127 |
| 262 | Ga0070712_100414090 | 3300006175 | Bacteria | 1116 |
| 263 | Ga0070712_100470299 | 3300006175 | Bacteria | 1049 |
| 264 | Ga0075362_10014929 | 3300006177 | Bacteria | 3148 |
| 265 | Ga0075362_10108061 | 3300006177 | Bacteria | 1307 |
| 266 | Ga0075367_10299330 | 3300006178 | Bacteria | 1012 |
| 267 | Ga0075427_10001025 | 3300006194 | Bacteria | 3482 |
| 268 | Ga0075366_10139001 | 3300006195 | Bacteria | 1468 |
| 269 | Ga0097621_100001400 | 3300006237 | Bacteria | 16606 |
| 270 | Ga0097621_100045055 | 3300006237 | Bacteria | 3562 |
| 271 | Ga0068871_100000359 | 3300006358 | Bacteria | 31822 |
| 272 | Ga0068871_100003972 | 3300006358 | Bacteria | 10218 |
| 273 | Ga0068871_100040962 | 3300006358 | Bacteria | 3712 |
| 274 | Ga0075428_100002359 | 3300006844 | Bacteria | 20499 |
| 275 | Ga0075430_100000424 | 3300006846 | Bacteria | 31568 |
| 276 | Ga0075431_100001606 | 3300006847 | Bacteria | 21079 |
| 277 | Ga0075433_10000012 | 3300006852 | Bacteria | 71065 |
| 278 | Ga0075433_10009420 | 3300006852 | Bacteria | 7806 |
| 279 | Ga0075433_10079512 | 3300006852 | Bacteria | 2889 |
| 280 | Ga0075433_10090009 | 3300006852 | Bacteria | 2712 |
| 281 | Ga0075433_10103780 | 3300006852 | Bacteria | 2519 |
| 282 | Ga0075434_100000692 | 3300006871 | Bacteria | 26317 |
| 283 | Ga0075434_100000760 | 3300006871 | Bacteria | 25464 |
| 284 | Ga0075434_100125358 | 3300006871 | Bacteria | 2585 |
| 285 | Ga0075434_100344335 | 3300006871 | Bacteria | 1512 |
| 286 | Ga0075434_100681748 | 3300006871 | Bacteria | 1045 |
| 287 | Ga0075429_100000558 | 3300006880 | Bacteria | 28507 |
| 288 | Ga0068865_100000439 | 3300006881 | Bacteria | 23089 |
| 289 | Ga0068865_100019171 | 3300006881 | Bacteria | 4425 |
| 290 | Ga0068865_100086972 | 3300006881 | Bacteria | 2258 |
| 291 | Ga0068865_100114659 | 3300006881 | Bacteria | 1994 |
| 292 | Ga0075436_100032032 | 3300006914 | Bacteria | 3623 |
| 293 | Ga0075436_100126854 | 3300006914 | Bacteria | 1788 |
| 294 | Ga0097620_100006509 | 3300006931 | Bacteria | 11858 |
| 295 | Ga0097620_100013118 | 3300006931 | Bacteria | 8327 |
| 296 | Ga0097620_100035701 | 3300006931 | Bacteria | 4988 |
| 297 | Ga0097620_100300013 | 3300006931 | Bacteria | 1700 |
| 298 | Ga0075435_100003228 | 3300007076 | Bacteria | 11037 |
| 299 | Ga0075435_100023822 | 3300007076 | Bacteria | 4741 |
| 300 | Ga0075435_100029711 | 3300007076 | Bacteria | 4292 |
| 301 | Ga0075435_100161447 | 3300007076 | Bacteria | 1888 |
| 302 | Ga0105250_10019334 | 3300009092 | Bacteria | 2754 |
| 303 | Ga0105240_10048416 | 3300009093 | Bacteria | 5372 |
| 304 | Ga0105240_10158832 | 3300009093 | Bacteria | 2687 |
| 305 | Ga0105240_10548538 | 3300009093 | Bacteria | 1279 |
| 306 | Ga0111539_10003218 | 3300009094 | Bacteria | 21598 |
| 307 | Ga0111539_10007371 | 3300009094 | Bacteria | 14093 |
| 308 | Ga0111539_10007413 | 3300009094 | Bacteria | 14057 |
| 309 | Ga0111539_10084379 | 3300009094 | Bacteria | 3735 |
| 310 | Ga0105245_10001227 | 3300009098 | Bacteria | 23145 |
| 311 | Ga0105245_10118066 | 3300009098 | Bacteria | 2475 |
| 312 | Ga0105247_10003194 | 3300009101 | Bacteria | 10802 |
| 313 | Ga0105247_10018479 | 3300009101 | Bacteria | 4182 |
| 314 | Ga0105247_10199545 | 3300009101 | Bacteria | 1343 |
| 315 | Ga0114129_10000803 | 3300009147 | Bacteria | 40282 |
| 316 | Ga0114129_10131394 | 3300009147 | Bacteria | 3438 |
| 317 | Ga0105243_10001341 | 3300009148 | Bacteria | 21936 |
| 318 | Ga0105243_10006861 | 3300009148 | Bacteria | 8778 |
| 319 | Ga0105243_10018182 | 3300009148 | Bacteria | 5321 |
| 320 | Ga0105243_10079988 | 3300009148 | Bacteria | 2665 |
| 321 | Ga0105241_10002078 | 3300009174 | Bacteria | 15128 |
| 322 | Ga0105241_10022392 | 3300009174 | Bacteria | 4680 |
| 323 | Ga0105241_10056494 | 3300009174 | Bacteria | 3009 |
| 324 | Ga0105241_10070608 | 3300009174 | Bacteria | 2710 |
| 325 | Ga0105242_10000411 | 3300009176 | Bacteria | 34068 |
| 326 | Ga0105242_10058209 | 3300009176 | Bacteria | 3167 |
| 327 | Ga0105242_10064496 | 3300009176 | Bacteria | 3020 |
| 328 | Ga0105248_10009088 | 3300009177 | Bacteria | 10930 |
| 329 | Ga0105248_10010917 | 3300009177 | Bacteria | 10021 |
| 330 | Ga0105248_10080299 | 3300009177 | Bacteria | 3665 |
| 331 | Ga0105248_10164937 | 3300009177 | Bacteria | 2498 |
| 332 | Ga0105237_10012158 | 3300009545 | Bacteria | 9081 |
| 333 | Ga0105237_10057375 | 3300009545 | Bacteria | 3897 |
| 334 | Ga0105237_10174591 | 3300009545 | Bacteria | 2149 |
| 335 | Ga0105238_10032313 | 3300009551 | Bacteria | 5325 |
| 336 | Ga0105238_10042135 | 3300009551 | Bacteria | 4623 |
| 337 | Ga0105238_10146738 | 3300009551 | Bacteria | 2335 |
| 338 | Ga0105238_10812502 | 3300009551 | Bacteria | 951 |
| 339 | Ga0105249_10003261 | 3300009553 | Bacteria | 14057 |
| 340 | Ga0105249_10007504 | 3300009553 | Bacteria | 9514 |
| 341 | Ga0105249_10087597 | 3300009553 | Bacteria | 2906 |
| 342 | Ga0105239_10006472 | 3300010375 | Bacteria | 13584 |
| 343 | Ga0105239_10008469 | 3300010375 | Bacteria | 11691 |
| 344 | Ga0105239_10073861 | 3300010375 | Bacteria | 3749 |
| 345 | Ga0105239_10371844 | 3300010375 | Bacteria | 1615 |
| 346 | Ga0105246_10000384 | 3300011119 | Bacteria | 23571 |
| 347 | Ga0105246_10068461 | 3300011119 | Bacteria | 2490 |
| 348 | Ga0105246_10492462 | 3300011119 | Bacteria | 1039 |
| 349 | Ga0157321_1000730 | 3300012487 | Bacteria | 1539 |
| 350 | Ga0157341_1001737 | 3300012494 | Bacteria | 1361 |
| 351 | Ga0157345_1002402 | 3300012498 | Bacteria | 1323 |
| 352 | Ga0157314_1002090 | 3300012500 | Bacteria | 1384 |
| 353 | Ga0157347_1001068 | 3300012502 | Bacteria | 2048 |
| 354 | Ga0157326_1001707 | 3300012513 | Bacteria | 2398 |
| 355 | Ga0157338_1003558 | 3300012515 | Bacteria | 1300 |
| 356 | Ga0157373_10064919 | 3300013100 | Bacteria | 2584 |
| 357 | Ga0157371_10009572 | 3300013102 | Bacteria | 7620 |
| 358 | Ga0157371_10026051 | 3300013102 | Bacteria | 4255 |
| 359 | Ga0157370_10119228 | 3300013104 | Bacteria | 2464 |
| 360 | Ga0157370_10331035 | 3300013104 | Bacteria | 1404 |
| 361 | Ga0157370_10364986 | 3300013104 | Bacteria | 1331 |
| 362 | Ga0157374_10023594 | 3300013296 | Bacteria | 5504 |
| 363 | Ga0157374_10096669 | 3300013296 | Bacteria | 2825 |
| 364 | Ga0157374_10475451 | 3300013296 | Bacteria | 1252 |
| 365 | Ga0157378_10005961 | 3300013297 | Bacteria | 10682 |
| 366 | Ga0157378_10126471 | 3300013297 | Bacteria | 2361 |
| 367 | Ga0163162_10001455 | 3300013306 | Bacteria | 22021 |
| 368 | Ga0163162_10005169 | 3300013306 | Bacteria | 12585 |
| 369 | Ga0163162_10117044 | 3300013306 | Bacteria | 2766 |
| 370 | Ga0157372_10059126 | 3300013307 | Bacteria | 4286 |
| 371 | Ga0157372_11039961 | 3300013307 | Bacteria | 948 |
| 372 | Ga0157375_10005043 | 3300013308 | Bacteria | 11469 |
| 373 | Ga0157375_10026190 | 3300013308 | Bacteria | 5431 |
| 374 | Ga0157375_10194416 | 3300013308 | Bacteria | 2184 |
| 375 | Ga0163163_10011894 | 3300014325 | Bacteria | 7916 |
| 376 | Ga0163163_10098114 | 3300014325 | Bacteria | 2951 |
| 377 | Ga0163163_10624088 | 3300014325 | Bacteria | 1141 |
| 378 | Ga0157380_10003014 | 3300014326 | Bacteria | 11472 |
| 379 | Ga0157380_10157828 | 3300014326 | Bacteria | 1968 |
| 380 | Ga0157377_10000224 | 3300014745 | Bacteria | 29648 |
| 381 | Ga0157379_10002183 | 3300014968 | Bacteria | 16272 |
| 382 | Ga0157379_10024465 | 3300014968 | Bacteria | 5360 |
| 383 | Ga0157379_10115774 | 3300014968 | Bacteria | 2410 |
| 384 | Ga0157379_10195893 | 3300014968 | Bacteria | 1826 |
| 385 | Ga0157376_10001879 | 3300014969 | Bacteria | 14015 |
| 386 | Ga0163161_10000471 | 3300017792 | Bacteria | 33465 |
| 387 | Ga0163161_10018737 | 3300017792 | Bacteria | 4852 |
| 388 | Ga0206356_10495441 | 3300020070 | Bacteria | 2899 |
| 389 | Ga0206354_11118322 | 3300020081 | Bacteria | 1169 |
| 390 | Ga0213876_10016881 | 3300021384 | Bacteria | 3857 |
| 391 | Ga0213876_10082617 | 3300021384 | Bacteria | 1700 |
| 392 | Ga0209233_1012835 | 3300025261 | Bacteria | 2412 |
| 393 | Ga0207666_1000074 | 3300025271 | Bacteria | 16511 |
| 394 | Ga0207666_1000672 | 3300025271 | Bacteria | 4096 |
| 395 | Ga0207673_1000705 | 3300025290 | Bacteria | 3571 |
| 396 | Ga0209758_1000125 | 3300025297 | Bacteria | 189869 |
| 397 | Ga0209051_1000202 | 3300025303 | Bacteria | 106010 |
| 398 | Ga0207697_10001234 | 3300025315 | Bacteria | 14009 |
| 399 | Ga0207697_10003525 | 3300025315 | Bacteria | 7716 |
| 400 | Ga0207713_1016905 | 3300025735 | Bacteria | 3685 |
| 401 | Ga0207653_10003354 | 3300025885 | Bacteria | 5054 |
| 402 | Ga0207653_10014922 | 3300025885 | Bacteria | 2439 |
| 403 | Ga0207682_10000169 | 3300025893 | Bacteria | 30010 |
| 404 | Ga0207692_10015843 | 3300025898 | Bacteria | 3325 |
| 405 | Ga0207692_10034506 | 3300025898 | Bacteria | 2450 |
| 406 | Ga0207692_10062657 | 3300025898 | Bacteria | 1931 |
| 407 | Ga0207692_10077529 | 3300025898 | Unclassified | 1768 |
| 408 | Ga0207642_10000791 | 3300025899 | Bacteria | 9810 |
| 409 | Ga0207710_10003179 | 3300025900 | Bacteria | 7350 |
| 410 | Ga0207688_10000157 | 3300025901 | Bacteria | 29271 |
| 411 | Ga0207688_10024551 | 3300025901 | Bacteria | 3307 |
| 412 | Ga0207680_10008866 | 3300025903 | Bacteria | 4958 |
| 413 | Ga0207647_10001770 | 3300025904 | Bacteria | 16576 |
| 414 | Ga0207647_10004978 | 3300025904 | Bacteria | 9793 |
| 415 | Ga0207685_10007358 | 3300025905 | Bacteria | 3064 |
| 416 | Ga0207685_10125748 | 3300025905 | Bacteria | 1132 |
| 417 | Ga0207699_10018563 | 3300025906 | Bacteria | 3688 |
| 418 | Ga0207699_10032606 | 3300025906 | Bacteria | 2936 |
| 419 | Ga0207699_10080391 | 3300025906 | Bacteria | 2020 |
| 420 | Ga0207699_10110498 | 3300025906 | Bacteria | 1761 |
| 421 | Ga0207699_10156137 | 3300025906 | Bacteria | 1514 |
| 422 | Ga0207699_10319110 | 3300025906 | Bacteria | 1089 |
| 423 | Ga0207645_10003164 | 3300025907 | Bacteria | 12604 |
| 424 | Ga0207645_10029098 | 3300025907 | Bacteria | 3562 |
| 425 | Ga0207645_10031653 | 3300025907 | Bacteria | 3403 |
| 426 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 427 | Ga0207705_10163500 | 3300025909 | Bacteria | 1673 |
| 428 | Ga0207654_10001412 | 3300025911 | Bacteria | 12738 |
| 429 | Ga0207654_10099776 | 3300025911 | Bacteria | 1787 |
| 430 | Ga0207707_10000992 | 3300025912 | Bacteria | 27254 |
| 431 | Ga0207707_10027076 | 3300025912 | Bacteria | 5012 |
| 432 | Ga0207707_10080223 | 3300025912 | Bacteria | 2849 |
| 433 | Ga0207671_10035650 | 3300025914 | Bacteria | 3690 |
| 434 | Ga0207671_10073632 | 3300025914 | Bacteria | 2552 |
| 435 | Ga0207693_10022760 | 3300025915 | Bacteria | 4976 |
| 436 | Ga0207693_10022992 | 3300025915 | Bacteria | 4950 |
| 437 | Ga0207693_10043509 | 3300025915 | Bacteria | 3533 |
| 438 | Ga0207693_10094240 | 3300025915 | Unclassified | 2347 |
| 439 | Ga0207693_10125732 | 3300025915 | Bacteria | 2015 |
| 440 | Ga0207663_10069197 | 3300025916 | Bacteria | 2270 |
| 441 | Ga0207663_10173909 | 3300025916 | Bacteria | 1532 |
| 442 | Ga0207660_10110151 | 3300025917 | Bacteria | 2071 |
| 443 | Ga0207660_10162843 | 3300025917 | Bacteria | 1722 |
| 444 | Ga0207660_10260224 | 3300025917 | Bacteria | 1372 |
| 445 | Ga0207662_10000850 | 3300025918 | Bacteria | 14080 |
| 446 | Ga0207662_10004200 | 3300025918 | Bacteria | 7549 |
| 447 | Ga0207662_10025915 | 3300025918 | Bacteria | 3380 |
| 448 | Ga0207657_10002203 | 3300025919 | Bacteria | 21123 |
| 449 | Ga0207657_10008189 | 3300025919 | Bacteria | 10651 |
| 450 | Ga0207657_10147912 | 3300025919 | Bacteria | 1915 |
| 451 | Ga0207657_10170678 | 3300025919 | Bacteria | 1762 |
| 452 | Ga0207657_10217872 | 3300025919 | Bacteria | 1530 |
| 453 | Ga0207657_10232350 | 3300025919 | Bacteria | 1474 |
| 454 | Ga0207649_10001352 | 3300025920 | Bacteria | 14567 |
| 455 | Ga0207649_10057400 | 3300025920 | Bacteria | 2434 |
| 456 | Ga0207649_10077848 | 3300025920 | Bacteria | 2138 |
| 457 | Ga0207649_10236248 | 3300025920 | Bacteria | 1310 |
| 458 | Ga0207652_10002958 | 3300025921 | Bacteria | 14201 |
| 459 | Ga0207652_10012285 | 3300025921 | Bacteria | 6916 |
| 460 | Ga0207652_10120911 | 3300025921 | Bacteria | 2330 |
| 461 | Ga0207652_10131500 | 3300025921 | Bacteria | 2232 |
| 462 | Ga0207652_10223696 | 3300025921 | Bacteria | 1696 |
| 463 | Ga0207681_10001165 | 3300025923 | Bacteria | 16949 |
| 464 | Ga0207694_10024528 | 3300025924 | Bacteria | 4581 |
| 465 | Ga0207694_10101619 | 3300025924 | Bacteria | 2279 |
| 466 | Ga0207694_10149087 | 3300025924 | Bacteria | 1884 |
| 467 | Ga0207650_10007784 | 3300025925 | Bacteria | 7304 |
| 468 | Ga0207650_10031598 | 3300025925 | Bacteria | 3825 |
| 469 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 470 | Ga0207659_10436094 | 3300025926 | Bacteria | 1101 |
| 471 | Ga0207687_10000966 | 3300025927 | Bacteria | 19517 |
| 472 | Ga0207687_10005917 | 3300025927 | Bacteria | 8089 |
| 473 | Ga0207687_10268164 | 3300025927 | Bacteria | 1364 |
| 474 | Ga0207700_10004193 | 3300025928 | Bacteria | 8461 |
| 475 | Ga0207700_10007862 | 3300025928 | Bacteria | 6559 |
| 476 | Ga0207700_10137798 | 3300025928 | Bacteria | 2001 |
| 477 | Ga0207700_10225725 | 3300025928 | Bacteria | 1590 |
| 478 | Ga0207664_10084597 | 3300025929 | Bacteria | 2588 |
| 479 | Ga0207664_10106790 | 3300025929 | Bacteria | 2322 |
| 480 | Ga0207664_10178527 | 3300025929 | Bacteria | 1822 |
| 481 | Ga0207664_10286426 | 3300025929 | Bacteria | 1447 |
| 482 | Ga0207644_10002653 | 3300025931 | Bacteria | 11522 |
| 483 | Ga0207644_10031676 | 3300025931 | Bacteria | 3685 |
| 484 | Ga0207690_10000805 | 3300025932 | Bacteria | 20116 |
| 485 | Ga0207690_10184763 | 3300025932 | Bacteria | 1572 |
| 486 | Ga0207690_10279152 | 3300025932 | Bacteria | 1300 |
| 487 | Ga0207706_10003945 | 3300025933 | Bacteria | 14055 |
| 488 | Ga0207706_10004195 | 3300025933 | Bacteria | 13568 |
| 489 | Ga0207706_10206227 | 3300025933 | Bacteria | 1724 |
| 490 | Ga0207686_10001021 | 3300025934 | Bacteria | 16572 |
| 491 | Ga0207686_10009204 | 3300025934 | Bacteria | 5357 |
| 492 | Ga0207686_10014291 | 3300025934 | Bacteria | 4415 |
| 493 | Ga0207709_10000645 | 3300025935 | Bacteria | 28329 |
| 494 | Ga0207709_10010819 | 3300025935 | Bacteria | 5025 |
| 495 | Ga0207709_10027585 | 3300025935 | Bacteria | 3273 |
| 496 | Ga0207670_10001354 | 3300025936 | Bacteria | 12918 |
| 497 | Ga0207670_10029682 | 3300025936 | Bacteria | 3486 |
| 498 | Ga0207669_10000063 | 3300025937 | Bacteria | 53494 |
| 499 | Ga0207704_10000540 | 3300025938 | Bacteria | 16845 |
| 500 | Ga0207704_10028204 | 3300025938 | Bacteria | 3111 |
| 501 | Ga0207665_10002733 | 3300025939 | Bacteria | 11833 |
| 502 | Ga0207665_10012974 | 3300025939 | Bacteria | 5478 |
| 503 | Ga0207665_10049564 | 3300025939 | Bacteria | 2822 |
| 504 | Ga0207665_10090316 | 3300025939 | Bacteria | 2122 |
| 505 | Ga0207691_10004163 | 3300025940 | Bacteria | 14055 |
| 506 | Ga0207711_10002693 | 3300025941 | Bacteria | 15699 |
| 507 | Ga0207711_10010594 | 3300025941 | Bacteria | 7665 |
| 508 | Ga0207711_10020036 | 3300025941 | Bacteria | 5574 |
| 509 | Ga0207689_10001462 | 3300025942 | Bacteria | 22616 |
| 510 | Ga0207689_10008666 | 3300025942 | Bacteria | 8853 |
| 511 | Ga0207661_10001037 | 3300025944 | Bacteria | 18451 |
| 512 | Ga0207661_10127843 | 3300025944 | Bacteria | 2172 |
| 513 | Ga0207679_10000673 | 3300025945 | Bacteria | 22925 |
| 514 | Ga0207679_10057438 | 3300025945 | Bacteria | 2878 |
| 515 | Ga0207679_10086488 | 3300025945 | Bacteria | 2412 |
| 516 | Ga0207667_10020248 | 3300025949 | Bacteria | 7403 |
| 517 | Ga0207667_10162312 | 3300025949 | Bacteria | 2298 |
| 518 | Ga0207667_10232547 | 3300025949 | Bacteria | 1887 |
| 519 | Ga0207667_10549227 | 3300025949 | Bacteria | 1168 |
| 520 | Ga0207651_10000116 | 3300025960 | Bacteria | 33936 |
| 521 | Ga0207651_10040253 | 3300025960 | Bacteria | 3090 |
| 522 | Ga0207651_10153826 | 3300025960 | Bacteria | 1794 |
| 523 | Ga0207712_10002012 | 3300025961 | Bacteria | 13339 |
| 524 | Ga0207712_10004960 | 3300025961 | Bacteria | 8417 |
| 525 | Ga0207712_10137446 | 3300025961 | Bacteria | 1871 |
| 526 | Ga0207712_10203850 | 3300025961 | Bacteria | 1570 |
| 527 | Ga0207668_10000300 | 3300025972 | Bacteria | 32440 |
| 528 | Ga0207640_10000435 | 3300025981 | Bacteria | 25481 |
| 529 | Ga0207640_10035983 | 3300025981 | Bacteria | 3104 |
| 530 | Ga0207658_10002963 | 3300025986 | Bacteria | 12149 |
| 531 | Ga0207658_10082822 | 3300025986 | Bacteria | 2464 |
| 532 | Ga0207658_10263665 | 3300025986 | Bacteria | 1469 |
| 533 | Ga0207677_10000587 | 3300026023 | Bacteria | 22685 |
| 534 | Ga0207677_10008808 | 3300026023 | Bacteria | 5655 |
| 535 | Ga0207703_10002543 | 3300026035 | Bacteria | 15752 |
| 536 | Ga0207703_10007244 | 3300026035 | Bacteria | 8821 |
| 537 | Ga0207639_10002760 | 3300026041 | Bacteria | 11797 |
| 538 | Ga0207639_10167627 | 3300026041 | Bacteria | 1857 |
| 539 | Ga0207678_10001349 | 3300026067 | Bacteria | 22608 |
| 540 | Ga0207678_10022212 | 3300026067 | Bacteria | 5559 |
| 541 | Ga0207678_10022878 | 3300026067 | Bacteria | 5471 |
| 542 | Ga0207678_10044108 | 3300026067 | Bacteria | 3858 |
| 543 | Ga0207678_10099514 | 3300026067 | Bacteria | 2484 |
| 544 | Ga0207708_10002313 | 3300026075 | Bacteria | 14009 |
| 545 | Ga0207708_10015894 | 3300026075 | Bacteria | 5651 |
| 546 | Ga0207708_10021050 | 3300026075 | Bacteria | 4921 |
| 547 | Ga0207702_10005132 | 3300026078 | Bacteria | 11518 |
| 548 | Ga0207702_10231671 | 3300026078 | Bacteria | 1726 |
| 549 | Ga0207641_10002690 | 3300026088 | Bacteria | 16219 |
| 550 | Ga0207641_10115486 | 3300026088 | Bacteria | 2387 |
| 551 | Ga0207641_10201193 | 3300026088 | Bacteria | 1836 |
| 552 | Ga0207648_10004670 | 3300026089 | Bacteria | 14009 |
| 553 | Ga0207648_10078279 | 3300026089 | Bacteria | 2884 |
| 554 | Ga0207676_10001465 | 3300026095 | Bacteria | 17525 |
| 555 | Ga0207676_10005579 | 3300026095 | Bacteria | 8902 |
| 556 | Ga0207674_10005769 | 3300026116 | Bacteria | 14687 |
| 557 | Ga0207674_10449960 | 3300026116 | Bacteria | 1245 |
| 558 | Ga0207674_10455538 | 3300026116 | Bacteria | 1236 |
| 559 | Ga0207675_100004143 | 3300026118 | Bacteria | 14034 |
| 560 | Ga0207683_10000138 | 3300026121 | Bacteria | 60113 |
| 561 | Ga0207683_10005177 | 3300026121 | Bacteria | 11195 |
| 562 | Ga0207683_10019940 | 3300026121 | Bacteria | 5730 |
| 563 | Ga0207698_10000568 | 3300026142 | Bacteria | 21530 |
| 564 | Ga0207698_10094055 | 3300026142 | Bacteria | 2463 |
| 565 | Ga0207698_10312360 | 3300026142 | Bacteria | 1468 |
| 566 | Ga0209983_1005339 | 3300027665 | Bacteria | 2667 |
| 567 | Ga0209966_1000683 | 3300027695 | Bacteria | 7385 |
| 568 | Ga0209966_1013511 | 3300027695 | Bacteria | 1513 |
| 569 | Ga0209998_10005729 | 3300027717 | Bacteria | 2590 |
| 570 | Ga0209813_10015831 | 3300027866 | Bacteria | 2050 |
| 571 | Ga0209974_10014734 | 3300027876 | Bacteria | 2597 |
| 572 | Ga0209974_10015935 | 3300027876 | Bacteria | 2496 |
| 573 | Ga0209974_10085960 | 3300027876 | Bacteria | 1087 |
| 574 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 575 | Ga0207428_10000501 | 3300027907 | Bacteria | 46798 |
| 576 | Ga0207428_10001016 | 3300027907 | Bacteria | 31079 |
| 577 | Ga0268266_10001262 | 3300028379 | Bacteria | 30924 |
| 578 | Ga0268266_10043177 | 3300028379 | Bacteria | 3852 |
| 579 | Ga0268265_10001141 | 3300028380 | Bacteria | 23422 |
| 580 | Ga0268264_10001321 | 3300028381 | Bacteria | 23341 |
| 581 | Ga0268264_10059854 | 3300028381 | Bacteria | 3192 |
| 582 | Ga0268264_10382346 | 3300028381 | Bacteria | 1348 |
| 583 | Ga0265337_1001142 | 3300028556 | Bacteria | 13567 |
| 584 | Ga0265338_10015318 | 3300028800 | Bacteria | 8436 |
| 585 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 586 | Ga0265325_10025728 | 3300031241 | Bacteria | 3194 |
| 587 | Ga0265325_10027013 | 3300031241 | Bacteria | 3105 |
| 588 | Ga0265340_10003699 | 3300031247 | Bacteria | 8612 |
| 589 | Ga0265339_10005245 | 3300031249 | Bacteria | 8651 |
| 590 | Ga0265339_10021781 | 3300031249 | Bacteria | 3722 |
| 591 | Ga0265331_10051174 | 3300031250 | Bacteria | 1978 |
| 592 | Ga0265313_10000716 | 3300031595 | Bacteria | 34149 |
| 593 | Ga0265313_10002686 | 3300031595 | Bacteria | 15066 |
| 594 | Ga0265313_10004206 | 3300031595 | Bacteria | 11162 |
| 595 | Ga0265313_10015566 | 3300031595 | Bacteria | 4420 |
| 596 | Ga0265313_10019973 | 3300031595 | Bacteria | 3711 |
| 597 | Ga0265313_10049063 | 3300031595 | Bacteria | 2034 |
| 598 | Ga0265314_10010751 | 3300031711 | Bacteria | 7613 |
| 599 | Ga0265342_10000940 | 3300031712 | Bacteria | 28973 |
| 600 | Ga0307409_100558437 | 3300031995 | Bacteria | 1125 |
| 601 | Ga0316583_10000745 | 3300032133 | Bacteria | 10169 |
| 602 | Ga0373930_0000459 | 3300034816 | Bacteria | 5482 |
| 603 | Ga0373930_0005738 | 3300034816 | Bacteria | 2073 |
| 604 | Ga0373950_0000303 | 3300034818 | Bacteria | 6211 |
| 605 | Ga0373958_0000140 | 3300034819 | Bacteria | 8144 |
| 606 | Ga0373958_0011105 | 3300034819 | Bacteria | 1515 |
| 607 | Ga0373959_0000674 | 3300034820 | Bacteria | 5846 |
| 608 | Ga0373938_0000040 | 3300034957 | Bacteria | 17014 |
| 609 | Ga0373938_0030275 | 3300034957 | Bacteria | 1154 |
| 610 | Ga0373926_0019950 | 3300035083 | Bacteria | 2313 |
| 611 | Ga0373928_0002996 | 3300035084 | Bacteria | 3250 |
| 612 | Ga0373929_0002689 | 3300035085 | Bacteria | 3244 |
| 613 | Ga0373929_0002731 | 3300035085 | Bacteria | 3221 |
| 614 | Ga0373929_0041922 | 3300035085 | Unclassified | 1019 |
| 615 | Ga0373934_0016112 | 3300035086 | Bacteria | 2840 |
| 616 | Ga0373940_0000108 | 3300035088 | Bacteria | 10198 |
| 617 | Ga0373940_0005706 | 3300035088 | Bacteria | 2715 |
| 618 | Ga0373944_0000384 | 3300035089 | Bacteria | 10012 |
| 619 | Ga0373949_0000806 | 3300035090 | Bacteria | 9999 |
| 620 | Ga0373949_0002522 | 3300035090 | Bacteria | 4665 |
| 621 | Ga0373949_0015680 | 3300035090 | Bacteria | 1694 |
| 622 | Ga0373951_0002034 | 3300035091 | Bacteria | 5179 |
| 623 | Ga0373951_0002329 | 3300035091 | Bacteria | 4820 |
| 624 | Ga0373952_0000124 | 3300035092 | Bacteria | 10815 |
| 625 | Ga0373952_0001569 | 3300035092 | Bacteria | 4171 |
| 626 | Ga0373952_0002931 | 3300035092 | Bacteria | 3084 |
| 627 | Ga0373923_0002096 | 3300035111 | Bacteria | 6041 |
| 628 | Ga0373923_0025139 | 3300035111 | Bacteria | 2357 |
| 629 | Ga0373932_0000365 | 3300035112 | Bacteria | 13963 |
| 630 | Ga0373932_0007207 | 3300035112 | Bacteria | 2643 |
| 631 | Ga0373932_0011452 | 3300035112 | Bacteria | 2167 |
| 632 | Ga0373936_0001108 | 3300035113 | Bacteria | 9647 |
| 633 | Ga0373936_0058909 | 3300035113 | Bacteria | 1564 |
| 634 | Ga0373939_0000233 | 3300035114 | Bacteria | 15177 |
| 635 | Ga0373939_0000324 | 3300035114 | Bacteria | 12388 |
| 636 | Ga0373939_0018869 | 3300035114 | Bacteria | 1854 |
| 637 | Ga0373941_0000133 | 3300035115 | Bacteria | 13100 |
| 638 | Ga0373941_0001631 | 3300035115 | Bacteria | 4781 |
| 639 | Ga0373941_0023149 | 3300035115 | Bacteria | 1770 |
| 640 | Ga0373945_0021431 | 3300035116 | Bacteria | 2220 |
| 641 | Ga0373953_0004410 | 3300035117 | Bacteria | 4487 |
| 642 | Ga0373954_0004472 | 3300035118 | Bacteria | 6018 |
| 643 | Ga0373954_0004727 | 3300035118 | Bacteria | 5870 |
| 644 | Ga0373954_0137924 | 3300035118 | Bacteria | 1189 |
| 645 | Ga0373956_0020277 | 3300035119 | Bacteria | 2827 |
| 646 | Ga0373956_0028710 | 3300035119 | Bacteria | 2422 |
| 647 | Ga0373956_0065690 | 3300035119 | Unclassified | 1649 |
| 648 | Ga0373957_0080294 | 3300035120 | Bacteria | 1287 |
| 649 | Ga0373960_0000182 | 3300035121 | Bacteria | 11201 |
| 650 | Ga0373960_0002468 | 3300035121 | Bacteria | 4156 |
| 651 | Ga0373943_0067107 | 3300035170 | Bacteria | 1808 |
| 652 | Ga0373946_0003601 | 3300035171 | Bacteria | 5492 |
| 653 | Ga0373946_0021682 | 3300035171 | Bacteria | 2493 |
| 654 | Ga0373946_0108417 | 3300035171 | Bacteria | 1254 |
| 655 | Ga0373955_0001653 | 3300035172 | Bacteria | 9540 |
| 656 | Ga0373955_0005592 | 3300035172 | Bacteria | 5651 |
| 657 | Ga0373955_0045827 | 3300035172 | Bacteria | 2361 |
| 658 | Ga0373955_0113186 | 3300035172 | Bacteria | 1570 |
| 659 | Ga0373942_0001391 | 3300035207 | Bacteria | 6256 |
| 660 | Ga0373942_0010812 | 3300035207 | Bacteria | 2152 |
| 661 | Ga0373961_0001666 | 3300035241 | Bacteria | 6201 |
| 662 | Ga0373961_0006955 | 3300035241 | Bacteria | 2724 |
| 663 | Ga0373961_0011700 | 3300035241 | Bacteria | 2181 |
| 664 | Ga0373962_0000986 | 3300035242 | Bacteria | 6572 |
| 665 | Ga0373962_0001963 | 3300035242 | Bacteria | 4906 |
| 666 | Ga0373962_0003879 | 3300035242 | Bacteria | 3600 |
| 667 | Ga0373924_0013348 | 3300035410 | Bacteria | 3085 |
| 668 | Ga0373931_0000201 | 3300035691 | Bacteria | 25484 |
| 669 | Ga0373931_0009536 | 3300035691 | Bacteria | 4641 |
| 670 | Ga0373931_0023268 | 3300035691 | Bacteria | 3126 |
| 671 | Ga0373935_0011849 | 3300035692 | Bacteria | 5238 |
| 672 | Ga0373935_0040078 | 3300035692 | Bacteria | 2939 |
| 673 | Ga0373935_0187488 | 3300035692 | Bacteria | 1423 |
| 674 | Ga0373927_0004308 | 3300035695 | Bacteria | 9985 |
| 675 | Ga0373927_0036059 | 3300035695 | Bacteria | 3217 |
| 676 | Ga0373927_0036801 | 3300035695 | Bacteria | 3181 |
| 677 | Ga0373927_0135116 | 3300035695 | Bacteria | 1612 |
| 678 | Ga0373933_0008719 | 3300035724 | Bacteria | 5529 |
| 679 | Ga0373933_0010415 | 3300035724 | Bacteria | 5097 |
| 680 | Ga0373933_0025751 | 3300035724 | Bacteria | 3375 |
| 681 | Ga0373947_0001864 | 3300035725 | Bacteria | 12846 |
| 682 | Ga0373947_0009738 | 3300035725 | Bacteria | 5514 |
| 683 | Ga0373947_0202253 | 3300035725 | Bacteria | 1300 |
| 684 | Ga0373937_0003235 | 3300036401 | Bacteria | 13654 |
| 685 | Ga0373937_0006672 | 3300036401 | Bacteria | 9965 |
| 686 | Ga0373937_0033316 | 3300036401 | Bacteria | 4677 |
| 687 | Ga0373937_0098699 | 3300036401 | Bacteria | 2709 |
| 688 | Ga0373937_0222342 | 3300036401 | Bacteria | 1777 |
| 689 | Ga0373925_0011314 | 3300037068 | Bacteria | 6475 |
| 690 | Ga0373925_0179187 | 3300037068 | Bacteria | 1676 |
| 691 | Ga0395899_0012727 | 3300037312 | Bacteria | 6445 |
| 692 | Ga0395900_0009953 | 3300037418 | Bacteria | 9735 |
| 693 | Ga0395900_0113681 | 3300037418 | Bacteria | 2778 |
| 694 | Ga0395898_0011214 | 3300037466 | Bacteria | 9329 |
| 695 | Ga0395898_0026605 | 3300037466 | Bacteria | 5818 |
| 696 | Ga0395898_0062209 | 3300037466 | Bacteria | 3625 |
| 697 | Ga0395898_0077282 | 3300037466 | Bacteria | 3214 |
| 698 | Ga0395898_0312852 | 3300037466 | Bacteria | 1498 |
| 699 | Ga0436364_0051540 | 3300037853 | Bacteria | 1106 |
| 700 | Ga0436364_0768336 | 3300037853 | Bacteria | 935 |
| 701 | Ga0395901_0668936 | 3300038443 | Bacteria | 1039 |
| 702 | Ga0436365_0076921 | 3300039437 | Bacteria | 40502 |
| 703 | Ga0436365_0973066 | 3300039437 | Bacteria | 1859 |
| 704 | Ga0436365_1658016 | 3300039437 | Bacteria | 2105 |
| 705 | Ga0436360_0611710 | 3300039438 | Bacteria | 1222 |
| 706 | Ga0436360_1087568 | 3300039438 | Bacteria | 1939 |
| 707 | Ga0439455_0047020 | 3300042012 | Bacteria | 1119 |
| 708 | Ga0439459_0024351 | 3300042438 | Bacteria | 1187 |
| 709 | Ga0466961_0084132 | 3300044693 | Bacteria | 2012 |
| 710 | Ga0453684_0127658 | 3300044712 | Bacteria | 3058 |
| 711 | Ga0466957_0017316 | 3300044842 | Bacteria | 4218 |
| 712 | Ga0466957_0029088 | 3300044842 | Bacteria | 3293 |
| 713 | Ga0466959_0049111 | 3300045049 | Bacteria | 3100 |
| 714 | Ga0451576_0005476 | 3300045051 | Bacteria | 15900 |
| 715 | Ga0466958_0094533 | 3300045836 | Bacteria | 1852 |
| 716 | Ga0466967_0025195 | 3300045976 | Bacteria | 4902 |
| 717 | Ga0495592_0039290 | 3300046454 | Bacteria | 3555 |
| 718 | Ga0495603_0005452 | 3300046455 | Bacteria | 7594 |
| 719 | Ga0495603_0094916 | 3300046455 | Bacteria | 1742 |
| 720 | Ga0495629_0000753 | 3300046459 | Bacteria | 26186 |
| 721 | Ga0495629_0007785 | 3300046459 | Bacteria | 7883 |
| 722 | Ga0495629_0209754 | 3300046459 | Bacteria | 1346 |
| 723 | Ga0495641_0006263 | 3300046461 | Bacteria | 7752 |
| 724 | Ga0495641_0058555 | 3300046461 | Unclassified | 1743 |
| 725 | Ga0495641_0070007 | 3300046461 | Bacteria | 1576 |
| 726 | Ga0495651_0001426 | 3300046462 | Bacteria | 18541 |
| 727 | Ga0495651_0003365 | 3300046462 | Bacteria | 12271 |
| 728 | Ga0495653_0007190 | 3300046463 | Bacteria | 9126 |
| 729 | Ga0495653_0020780 | 3300046463 | Bacteria | 5318 |
| 730 | Ga0495653_0049797 | 3300046463 | Bacteria | 3225 |
| 731 | Ga0495653_0231219 | 3300046463 | Bacteria | 1237 |
| 732 | Ga0495580_0018331 | 3300046472 | Bacteria | 5212 |
| 733 | Ga0495582_0004350 | 3300046473 | Bacteria | 7967 |
| 734 | Ga0495639_0003382 | 3300046475 | Bacteria | 6912 |
| 735 | Ga0495662_0005339 | 3300046476 | Bacteria | 6436 |
| 736 | Ga0495662_0159423 | 3300046476 | Bacteria | 1111 |
| 737 | Ga0495664_0001065 | 3300046477 | Bacteria | 14177 |
| 738 | Ga0495664_0001159 | 3300046477 | Bacteria | 13701 |
| 739 | Ga0495664_0043178 | 3300046477 | Bacteria | 2671 |
| 740 | Ga0495664_0056993 | 3300046477 | Bacteria | 2324 |
| 741 | Ga0495584_0040539 | 3300046491 | Bacteria | 2352 |
| 742 | Ga0495585_0010864 | 3300046492 | Bacteria | 5409 |
| 743 | Ga0495594_0005356 | 3300046499 | Bacteria | 6592 |
| 744 | Ga0495594_0033058 | 3300046499 | Bacteria | 2810 |
| 745 | Ga0495594_0057114 | 3300046499 | Bacteria | 2155 |
| 746 | Ga0495607_0183992 | 3300046501 | Bacteria | 1045 |
| 747 | Ga0495608_0022600 | 3300046511 | Bacteria | 4313 |
| 748 | Ga0495608_0023926 | 3300046511 | Bacteria | 4178 |
| 749 | Ga0495608_0032140 | 3300046511 | Bacteria | 3547 |
| 750 | Ga0495608_0055708 | 3300046511 | Bacteria | 2613 |
| 751 | Ga0495616_0106930 | 3300046513 | Bacteria | 1304 |
| 752 | Ga0495618_0002569 | 3300046514 | Bacteria | 11628 |
| 753 | Ga0495618_0038119 | 3300046514 | Bacteria | 3019 |
| 754 | Ga0495628_0028666 | 3300046516 | Bacteria | 4521 |
| 755 | Ga0495628_0040170 | 3300046516 | Bacteria | 3739 |
| 756 | Ga0495628_0077727 | 3300046516 | Bacteria | 2581 |
| 757 | Ga0495630_0020198 | 3300046517 | Bacteria | 4908 |
| 758 | Ga0495631_0076757 | 3300046518 | Bacteria | 1442 |
| 759 | Ga0495643_0000251 | 3300046522 | Bacteria | 78874 |
| 760 | Ga0495666_0002611 | 3300046526 | Bacteria | 8967 |
| 761 | Ga0495652_0010251 | 3300046529 | Bacteria | 8498 |
| 762 | Ga0495652_0015185 | 3300046529 | Bacteria | 6895 |
| 763 | Ga0495652_0055249 | 3300046529 | Bacteria | 3377 |
| 764 | Ga0495652_0123276 | 3300046529 | Bacteria | 2063 |
| 765 | Ga0495665_0000227 | 3300046531 | Bacteria | 28192 |
| 766 | Ga0495640_0075178 | 3300046533 | Bacteria | 2256 |
| 767 | Ga0495640_0161840 | 3300046533 | Bacteria | 1433 |
| 768 | Ga0495586_0002283 | 3300046535 | Bacteria | 10431 |
| 769 | Ga0495586_0185241 | 3300046535 | Bacteria | 1178 |
| 770 | Ga0495587_0005444 | 3300046536 | Bacteria | 8302 |
| 771 | Ga0495587_0021805 | 3300046536 | Bacteria | 3952 |
| 772 | Ga0495587_0030054 | 3300046536 | Bacteria | 3296 |
| 773 | Ga0495587_0030701 | 3300046536 | Bacteria | 3259 |
| 774 | Ga0495645_0001416 | 3300046543 | Bacteria | 16149 |
| 775 | Ga0495645_0012537 | 3300046543 | Bacteria | 5975 |
| 776 | Ga0495645_0014693 | 3300046543 | Bacteria | 5559 |
| 777 | Ga0495667_0001271 | 3300046559 | Bacteria | 16533 |
| 778 | Ga0495667_0004444 | 3300046559 | Bacteria | 9458 |
| 779 | Ga0495667_0009931 | 3300046559 | Bacteria | 6447 |
| 780 | Ga0495667_0013435 | 3300046559 | Bacteria | 5544 |
| 781 | Ga0495667_0034261 | 3300046559 | Bacteria | 3395 |
| 782 | Ga0495656_0000293 | 3300046615 | Bacteria | 17434 |
| 783 | Ga0495634_0050091 | 3300046642 | Bacteria | 2806 |
| 784 | Ga0495634_0120091 | 3300046642 | Bacteria | 1683 |
| 785 | Ga0495635_0004545 | 3300046663 | Bacteria | 9615 |
| 786 | Ga0495635_0014865 | 3300046663 | Bacteria | 5446 |
| 787 | Ga0495635_0025815 | 3300046663 | Bacteria | 4091 |
| 788 | Ga0495635_0060012 | 3300046663 | Bacteria | 2615 |
| 789 | Ga0495635_0088488 | 3300046663 | Bacteria | 2119 |
| 790 | Ga0495635_0210381 | 3300046663 | Unclassified | 1317 |
| 791 | Ga0495659_0003705 | 3300046664 | Bacteria | 4857 |
| 792 | Ga0495588_0000908 | 3300046674 | Bacteria | 12964 |
| 793 | Ga0495588_0024883 | 3300046674 | Bacteria | 2978 |
| 794 | Ga0495657_0016368 | 3300046675 | Bacteria | 5403 |
| 795 | Ga0495657_0029876 | 3300046675 | Bacteria | 3820 |
| 796 | Ga0495599_0010444 | 3300046678 | Bacteria | 5681 |
| 797 | Ga0495599_0031081 | 3300046678 | Bacteria | 3351 |
| 798 | Ga0495623_0016534 | 3300046679 | Bacteria | 4766 |
| 799 | Ga0495623_0092679 | 3300046679 | Bacteria | 1851 |
| 800 | Ga0495623_0125954 | 3300046679 | Unclassified | 1538 |
| 801 | Ga0495646_0017562 | 3300046680 | Bacteria | 4536 |
| 802 | Ga0495646_0020862 | 3300046680 | Bacteria | 4143 |
| 803 | Ga0495647_0002458 | 3300046681 | Bacteria | 5848 |
| 804 | Ga0495647_0003258 | 3300046681 | Bacteria | 5196 |
| 805 | Ga0495658_0006858 | 3300046683 | Bacteria | 5612 |
| 806 | Ga0495658_0013676 | 3300046683 | Bacteria | 4134 |
| 807 | Ga0495658_0056454 | 3300046683 | Bacteria | 2239 |
| 808 | Ga0495669_0011633 | 3300046684 | Bacteria | 3741 |
| 809 | Ga0495613_0016237 | 3300046689 | Bacteria | 5547 |
| 810 | Ga0495613_0019456 | 3300046689 | Bacteria | 5060 |
| 811 | Ga0495624_0004400 | 3300046690 | Bacteria | 10307 |
| 812 | Ga0495670_0001083 | 3300046691 | Bacteria | 13211 |
| 813 | Ga0495600_0003990 | 3300046809 | Bacteria | 8772 |
| 814 | Ga0495600_0006118 | 3300046809 | Bacteria | 7289 |
| 815 | Ga0495581_0026504 | 3300047315 | Bacteria | 3360 |
| 816 | Ga0495581_0129143 | 3300047315 | Bacteria | 1472 |
| 817 | Ga0495604_0002693 | 3300047317 | Bacteria | 14247 |
| 818 | Ga0495604_0003959 | 3300047317 | Bacteria | 11793 |
| 819 | Ga0495604_0012806 | 3300047317 | Bacteria | 6679 |
| 820 | Ga0495604_0047064 | 3300047317 | Bacteria | 3361 |
| 821 | Ga0495604_0105136 | 3300047317 | Unclassified | 2067 |
| 822 | Ga0495604_0147008 | 3300047317 | Bacteria | 1679 |
| 823 | Ga0495674_0022419 | 3300047319 | Bacteria | 5824 |
| 824 | Ga0495674_0061562 | 3300047319 | Bacteria | 3270 |
| 825 | Ga0495674_0079807 | 3300047319 | Bacteria | 2809 |
| 826 | Ga0495674_0098800 | 3300047319 | Bacteria | 2485 |
| 827 | Ga0495674_0377009 | 3300047319 | Unclassified | 1148 |
| 828 | Ga0495676_0017396 | 3300047321 | Bacteria | 6359 |
| 829 | Ga0495676_0056354 | 3300047321 | Bacteria | 3108 |
| 830 | Ga0495676_0074179 | 3300047321 | Bacteria | 2606 |
| 831 | Ga0495680_0007465 | 3300047322 | Bacteria | 10018 |
| 832 | Ga0495680_0016138 | 3300047322 | Bacteria | 6422 |
| 833 | Ga0495680_0023079 | 3300047322 | Bacteria | 5178 |
| 834 | Ga0495680_0039844 | 3300047322 | Bacteria | 3745 |
| 835 | Ga0495680_0079122 | 3300047322 | Bacteria | 2486 |
| 836 | Ga0495680_0101664 | 3300047322 | Bacteria | 2141 |
| 837 | Ga0495675_0004039 | 3300047444 | Bacteria | 8897 |
| 838 | Ga0495675_0005632 | 3300047444 | Bacteria | 7649 |
| 839 | Ga0495675_0008738 | 3300047444 | Bacteria | 6288 |
| 840 | Ga0495675_0040810 | 3300047444 | Bacteria | 2958 |
| 841 | Ga0495679_020313 | 3300047446 | Bacteria | 2315 |
| 842 | Ga0495684_0031018 | 3300047471 | Bacteria | 4103 |
| 843 | Ga0495684_0196104 | 3300047471 | Bacteria | 1490 |
| 844 | Ga0495684_0240061 | 3300047471 | Bacteria | 1322 |
| 845 | Ga0495684_0373808 | 3300047471 | Bacteria | 1007 |
| 846 | Ga0495593_0010986 | 3300047673 | Bacteria | 5212 |
| 847 | Ga0495593_0100093 | 3300047673 | Bacteria | 1487 |
| 848 | Ga0495602_0000307 | 3300048088 | Bacteria | 45339 |
| 849 | Ga0495602_0041449 | 3300048088 | Bacteria | 4205 |
| 850 | Ga0495614_0012038 | 3300048089 | Bacteria | 3800 |
| 851 | Ga0496100_0000326 | 3300048903 | Bacteria | 23445 |
| 852 | Ga0496100_0022596 | 3300048903 | Bacteria | 3807 |
| 853 | Ga0496100_0115377 | 3300048903 | Bacteria | 1872 |
| 854 | Ga0496101_0010563 | 3300048904 | Bacteria | 6098 |
| 855 | Ga0496101_0045005 | 3300048904 | Bacteria | 3159 |
| 856 | Ga0496101_0210097 | 3300048904 | Bacteria | 1507 |
| 857 | Ga0496102_0001315 | 3300048905 | Bacteria | 22296 |
| 858 | Ga0496102_0018733 | 3300048905 | Bacteria | 6088 |
| 859 | Ga0496102_0077484 | 3300048905 | Bacteria | 3059 |
| 860 | Ga0496102_0106082 | 3300048905 | Bacteria | 2614 |
| 861 | Ga0496103_0002237 | 3300048906 | Bacteria | 12250 |
| 862 | Ga0496103_0017710 | 3300048906 | Bacteria | 4265 |
| 863 | Ga0496103_0060704 | 3300048906 | Bacteria | 2350 |
| 864 | Ga0496103_0190298 | 3300048906 | Bacteria | 1319 |
| 865 | Ga0496104_0036713 | 3300048907 | Bacteria | 4581 |
| 866 | Ga0496104_0079646 | 3300048907 | Bacteria | 3122 |
| 867 | Ga0496104_0109552 | 3300048907 | Bacteria | 2647 |
| 868 | Ga0496104_0170982 | 3300048907 | Bacteria | 2084 |
| 869 | Ga0496105_0004088 | 3300048908 | Bacteria | 10929 |
| 870 | Ga0496105_0067103 | 3300048908 | Bacteria | 2962 |
| 871 | Ga0496105_0209874 | 3300048908 | Bacteria | 1587 |
| 872 | Ga0496106_0005158 | 3300048909 | Bacteria | 9679 |
| 873 | Ga0496106_0011103 | 3300048909 | Bacteria | 6662 |
| 874 | Ga0496106_0026287 | 3300048909 | Bacteria | 4333 |
| 875 | Ga0496106_0104517 | 3300048909 | Bacteria | 2199 |
| 876 | Ga0496107_0002339 | 3300048910 | Bacteria | 12240 |
| 877 | Ga0496107_0004092 | 3300048910 | Bacteria | 9822 |
| 878 | Ga0496107_0059305 | 3300048910 | Bacteria | 2769 |
| 879 | Ga0496107_0067025 | 3300048910 | Bacteria | 2603 |
| 880 | Ga0496108_0011465 | 3300048911 | Bacteria | 7204 |
| 881 | Ga0496108_0274481 | 3300048911 | Bacteria | 1467 |
| 882 | Ga0496109_0000409 | 3300048912 | Bacteria | 38172 |
| 883 | Ga0496109_0036297 | 3300048912 | Bacteria | 4448 |
| 884 | Ga0496109_0079499 | 3300048912 | Bacteria | 3021 |
| 885 | Ga0496110_0054514 | 3300048913 | Bacteria | 3517 |
| 886 | Ga0496110_0145526 | 3300048913 | Bacteria | 2143 |
| 887 | Ga0496110_0190604 | 3300048913 | Bacteria | 1862 |
| 888 | Ga0496111_0009332 | 3300048914 | Bacteria | 6542 |
| 889 | Ga0496111_0018080 | 3300048914 | Bacteria | 4877 |
| 890 | Ga0496111_0068354 | 3300048914 | Bacteria | 2582 |
| 891 | Ga0496111_0122934 | 3300048914 | Bacteria | 1917 |
| 892 | Ga0496112_0004892 | 3300048915 | Bacteria | 11458 |
| 893 | Ga0496112_0023217 | 3300048915 | Bacteria | 5922 |
| 894 | Ga0496112_0107004 | 3300048915 | Bacteria | 2766 |
| 895 | Ga0496113_0001989 | 3300048916 | Bacteria | 11709 |
| 896 | Ga0496114_0002505 | 3300048917 | Bacteria | 14023 |
| 897 | Ga0496114_0024049 | 3300048917 | Bacteria | 4971 |
| 898 | Ga0496114_0040268 | 3300048917 | Bacteria | 3867 |
| 899 | Ga0496114_0059721 | 3300048917 | Bacteria | 3186 |
| 900 | Ga0496114_0507418 | 3300048917 | Bacteria | 1067 |
| 901 | Ga0496115_0047311 | 3300048918 | Bacteria | 3439 |
| 902 | Ga0496115_0071252 | 3300048918 | Bacteria | 2819 |
| 903 | Ga0496115_0208678 | 3300048918 | Bacteria | 1613 |
| 904 | Ga0496115_0295210 | 3300048918 | Bacteria | 1328 |
| 905 | Ga0501032_0049588 | 3300049569 | Bacteria | 2832 |
| 906 | Ga0501033_0028588 | 3300049570 | Bacteria | 4188 |
| 907 | Ga0501033_0383614 | 3300049570 | Bacteria | 981 |
| 908 | Ga0501034_0060215 | 3300049571 | Bacteria | 3814 |
| 909 | Ga0501034_0153546 | 3300049571 | Bacteria | 2277 |
| 910 | Ga0501034_0212650 | 3300049571 | Bacteria | 1888 |
| 911 | Ga0501034_0248591 | 3300049571 | Bacteria | 1723 |
| 912 | Ga0501036_0029441 | 3300049572 | Bacteria | 4638 |
| 913 | Ga0501036_0271273 | 3300049572 | Bacteria | 1420 |
| 914 | Ga0501036_0367109 | 3300049572 | Bacteria | 1201 |
| 915 | Ga0501037_0012035 | 3300049573 | Bacteria | 6371 |
| 916 | Ga0501037_0079295 | 3300049573 | Bacteria | 2383 |
| 917 | Ga0501037_0130519 | 3300049573 | Bacteria | 1802 |
| 918 | Ga0501038_0017141 | 3300049574 | Bacteria | 6550 |
| 919 | Ga0501038_0065910 | 3300049574 | Bacteria | 3085 |
| 920 | Ga0501039_0217974 | 3300049575 | Bacteria | 1500 |
| 921 | Ga0501043_0097779 | 3300049579 | Bacteria | 2307 |
| 922 | Ga0501043_0315984 | 3300049579 | Bacteria | 1191 |
| 923 | Ga0501043_0322171 | 3300049579 | Bacteria | 1178 |
| 924 | Ga0501047_0039056 | 3300049581 | Bacteria | 4592 |
| 925 | Ga0501047_0061726 | 3300049581 | Bacteria | 3616 |
| 926 | Ga0501047_0139289 | 3300049581 | Bacteria | 2305 |
| 927 | Ga0501047_0180845 | 3300049581 | Bacteria | 1975 |
| 928 | Ga0501047_0385117 | 3300049581 | Bacteria | 1236 |
| 929 | Ga0501068_0056853 | 3300049584 | Bacteria | 2371 |
| 930 | Ga0501069_0040364 | 3300049585 | Bacteria | 2579 |
| 931 | Ga0501069_0041325 | 3300049585 | Bacteria | 2549 |
| 932 | Ga0501070_0002780 | 3300049586 | Bacteria | 15272 |
| 933 | Ga0501070_0013624 | 3300049586 | Bacteria | 6853 |
| 934 | Ga0501070_0252766 | 3300049586 | Bacteria | 1441 |
| 935 | Ga0501070_0308841 | 3300049586 | Bacteria | 1287 |
| 936 | Ga0501070_0312647 | 3300049586 | Bacteria | 1279 |
| 937 | Ga0501070_0584362 | 3300049586 | Bacteria | 892 |
| 938 | Ga0501071_0290511 | 3300049587 | Bacteria | 1238 |
| 939 | Ga0501071_0352319 | 3300049587 | Bacteria | 1120 |
| 940 | Ga0501072_0108317 | 3300049588 | Bacteria | 2211 |
| 941 | Ga0501072_0157156 | 3300049588 | Bacteria | 1813 |
| 942 | Ga0501073_0045253 | 3300049589 | Bacteria | 3100 |
| 943 | Ga0501074_0056198 | 3300049590 | Bacteria | 2836 |
| 944 | Ga0501075_0021327 | 3300049591 | Bacteria | 4721 |
| 945 | Ga0501076_0011054 | 3300049592 | Bacteria | 6713 |
| 946 | Ga0501076_0181126 | 3300049592 | Bacteria | 1718 |
| 947 | Ga0501079_0098472 | 3300049741 | Bacteria | 2266 |
| 948 | Ga0501080_0020779 | 3300049742 | Bacteria | 6078 |
| 949 | Ga0501080_0133794 | 3300049742 | Bacteria | 2295 |
| 950 | Ga0501080_0186002 | 3300049742 | Bacteria | 1910 |
| 951 | Ga0501080_0314227 | 3300049742 | Bacteria | 1419 |
| 952 | Ga0501081_0003721 | 3300049743 | Bacteria | 9775 |
| 953 | Ga0501081_0356690 | 3300049743 | Bacteria | 1078 |
| 954 | Ga0501083_0062482 | 3300049744 | Bacteria | 2485 |
| 955 | Ga0501083_0127608 | 3300049744 | Bacteria | 1667 |
| 956 | Ga0501083_0137509 | 3300049744 | Bacteria | 1600 |
| 957 | Ga0501035_0053535 | 3300049822 | Bacteria | 3608 |
| 958 | Ga0501035_0073490 | 3300049822 | Bacteria | 3025 |
| 959 | Ga0501044_0040173 | 3300049823 | Bacteria | 4877 |
| 960 | Ga0501044_0106591 | 3300049823 | Bacteria | 2814 |
| 961 | Ga0501044_0214480 | 3300049823 | Bacteria | 1878 |
| 962 | Ga0501044_0448258 | 3300049823 | Bacteria | 1197 |
| 963 | nmdc:mga03683_26697_c1 | 3300050489 | Bacteria | 2280 |
| 964 | nmdc:mga03683_78865_c1 | 3300050489 | Bacteria | 1419 |
| 965 | nmdc:mga00v17_251005_c1 | 3300050491 | Bacteria | 1147 |
| 966 | nmdc:mga0yw44_107628_c1 | 3300050492 | Bacteria | 1783 |
| 967 | nmdc:mga0k408_99574_c1 | 3300050493 | Bacteria | 1713 |
| 968 | nmdc:mga04h51_18269_c1 | 3300050495 | Bacteria | 2063 |
| 969 | nmdc:mga05p37_14826_c1 | 3300050507 | Bacteria | 9359 |
| 970 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 971 | nmdc:mga09592_1181_c1 | 3300050508 | Bacteria | 20837 |
| 972 | nmdc:mga0qj67_341_c1 | 3300050509 | Bacteria | 32144 |
| 973 | nmdc:mga06r32_404_c1 | 3300050510 | Bacteria | 36414 |
| 974 | nmdc:mga08y16_615_c1 | 3300050511 | Bacteria | 33272 |
| 975 | nmdc:mga08y16_865_c1 | 3300050511 | Bacteria | 29154 |
| 976 | nmdc:mga08y16_992_c1 | 3300050511 | Bacteria | 27676 |
| 977 | nmdc:mga0n895_1104_c1 | 3300050512 | Bacteria | 19751 |
| 978 | nmdc:mga0n895_118010_c1 | 3300050512 | Bacteria | 2673 |
| 979 | nmdc:mga0n895_320835_c1 | 3300050512 | Bacteria | 1570 |
| 980 | nmdc:mga0n895_374245_c1 | 3300050512 | Bacteria | 1442 |
| 981 | nmdc:mga0n895_9873_c1 | 3300050512 | Bacteria | 8395 |
| 982 | nmdc:mga0rr50_2041_c1 | 3300050513 | Bacteria | 11255 |
| 983 | nmdc:mga0rr50_22669_c1 | 3300050513 | Bacteria | 4314 |
| 984 | nmdc:mga0rr50_92636_c1 | 3300050513 | Bacteria | 2356 |
| 985 | nmdc:mga08x19_128522_c1 | 3300050514 | Bacteria | 1703 |
| 986 | nmdc:mga0a205_1819_c1 | 3300050515 | Bacteria | 18459 |
| 987 | nmdc:mga0a205_413392_c1 | 3300050515 | Bacteria | 1212 |
| 988 | nmdc:mga0a205_44463_c1 | 3300050515 | Bacteria | 4281 |
| 989 | nmdc:mga0a205_970_c1 | 3300050515 | Bacteria | 23704 |
| 990 | nmdc:mga0sz30_14457_c1 | 3300050516 | Bacteria | 2463 |
| 991 | Ga0495601_0000747 | 3300053077 | Bacteria | 17471 |
| 992 | Ga0495601_0001780 | 3300053077 | Bacteria | 11947 |
| 993 | Ga0495601_0002068 | 3300053077 | Bacteria | 11262 |
| 994 | Ga0495601_0010220 | 3300053077 | Bacteria | 5579 |
| 995 | Ga0495601_0012739 | 3300053077 | Bacteria | 5046 |
| 996 | Ga0495601_0016350 | 3300053077 | Bacteria | 4495 |
| 997 | Ga0495601_0027330 | 3300053077 | Bacteria | 3527 |
| 998 | Ga0495601_0033020 | 3300053077 | Bacteria | 3223 |
| 999 | Ga0495601_0322678 | 3300053077 | Unclassified | 1005 |
| 1000 | Ga0495612_0000959 | 3300053078 | Bacteria | 11843 |
| 1001 | Ga0495612_0005327 | 3300053078 | Bacteria | 5313 |
| 1002 | Ga0495612_0010028 | 3300053078 | Bacteria | 3835 |
| 1003 | Ga0495612_0011721 | 3300053078 | Bacteria | 3533 |
| 1004 | Ga0495612_0046718 | 3300053078 | Bacteria | 1773 |
| 1005 | Ga0495595_0001402 | 3300053084 | Bacteria | 9364 |
| 1006 | Ga0495595_0001527 | 3300053084 | Bacteria | 9022 |
| 1007 | Ga0495595_0003748 | 3300053084 | Bacteria | 6044 |
| 1008 | Ga0495595_0187007 | 3300053084 | Bacteria | 1028 |
| 1009 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 1010 | Ga0495619_0000388 | 3300053085 | Bacteria | 30051 |
| 1011 | Ga0495619_0005237 | 3300053085 | Bacteria | 8219 |
| 1012 | Ga0495619_0009768 | 3300053085 | Bacteria | 6050 |
| 1013 | Ga0495619_0010675 | 3300053085 | Bacteria | 5782 |
| 1014 | Ga0495619_0033759 | 3300053085 | Bacteria | 3323 |
| 1015 | Ga0495619_0035168 | 3300053085 | Bacteria | 3258 |
| 1016 | Ga0495619_0036315 | 3300053085 | Bacteria | 3208 |
| 1017 | Ga0495619_0455935 | 3300053085 | Bacteria | 881 |
| 1018 | Ga0500643_005413 | 3300053087 | Bacteria | 5503 |
| 1019 | Ga0500644_0004585 | 3300053088 | Bacteria | 3463 |
| 1020 | Ga0500651_0053940 | 3300053093 | Bacteria | 2521 |
| 1021 | Ga0500566_0233428 | 3300053094 | Unclassified | 906 |
| 1022 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1023 | Ga0500652_036004 | 3300053131 | Bacteria | 1968 |
| 1024 | Ga0500655_021889 | 3300053133 | Bacteria | 1201 |
| 1025 | Ga0500577_0144418 | 3300053142 | Bacteria | 1006 |
| 1026 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1027 | Ga0500616_0004868 | 3300053153 | Bacteria | 9353 |
| 1028 | Ga0500645_000324 | 3300053730 | Bacteria | 33824 |
| 1029 | Ga0501084_0014827 | 3300054114 | Bacteria | 6463 |
| 1030 | Ga0501084_0159484 | 3300054114 | Bacteria | 1903 |
| 1031 | Ga0501082_0030855 | 3300060353 | Bacteria | 4620 |
| 1032 | Ga0501082_0066643 | 3300060353 | Bacteria | 3101 |
| 1033 | Ga0501082_0166137 | 3300060353 | Bacteria | 1918 |
| 1034 | Ga0501082_0257009 | 3300060353 | Bacteria | 1520 |
| 1035 | Ga0466962_0044576 | 3300061719 | Bacteria | 2122 |
| 1036 | 2643757331 | 2643221547 | Bacteria | 4740017 |
| 1037 | 2644104968 | 2643221618 | Bacteria | 7717186 |
| 1038 | 2644307510 | 2643221655 | Bacteria | 7722067 |
| 1039 | 2644613594 | 2643221712 | Bacteria | 7729434 |
| 1040 | Ga0157378_10271102 | |||
| 1041 | SwRhRL2b_contig_416179 | |||
| 1042 | 2214772996 | |||
| 1043 | 2214822979 | |||
| 1044 | ARSoilYngRDRAFT_c00480 | |||
| 1045 | ARcpr5yngRDRAFT_c000101 | |||
| 1046 | ARSoilOldRDRAFT_c000111 | |||
| 1047 | ARCol0oldRDRAFT_c00749 | |||
| 1048 | ARCol0yngRDRAFT_1000021 | |||
| 1049 | JGI24741J21665_1005090 | |||
| 1050 | JGI24752J21851_1000948 | |||
| 1051 | JGI24746J21847_1000005 | |||
| 1052 | JGI24747J21853_1000105 | |||
| 1053 | JGI24739J22299_10004819 | |||
| 1054 | JGI24737J22298_10000939 | |||
| 1055 | JGI24737J22298_10001279 | |||
| 1056 | JGI24735J21928_10083976 | |||
| 1057 | JGI24750J21931_1000059 | |||
| 1058 | JGI24745J21846_1000123 | |||
| 1059 | JGI24738J21930_10000278 | |||
| 1060 | JGI24749J21850_1001646 | |||
| 1061 | JGI24744J21845_10000309 | |||
| 1062 | JGI24033J26618_1000714 | |||
| 1063 | JGI24033J26618_1000746 | |||
| 1064 | JGI24034J26672_10000175 | |||
| 1065 | JGI24742J22300_10000270 | |||
| 1066 | JGI24751J29686_10010562 | |||
| 1067 | Ga0055540_1006346 | |||
| 1068 | Ga0065717_1002043 | |||
| 1069 | Ga0065716_1001534 | |||
| 1070 | Ga0065704_10117421 | |||
| 1071 | Ga0065712_10071326 | |||
| 1072 | Ga0065712_10081593 | |||
| 1073 | Ga0065715_10000270 | |||
| 1074 | Ga0065715_10000725 | |||
| 1075 | Ga0070658_10006794 | |||
| 1076 | Ga0070658_10056361 | |||
| 1077 | Ga0070676_10000194 | |||
| 1078 | Ga0070683_100001461 | |||
| 1079 | Ga0070690_100002052 | |||
| 1080 | Ga0070690_100043408 | |||
| 1081 | Ga0070690_100093548 | |||
| 1082 | Ga0070670_100032641 | |||
| 1083 | Ga0070670_100214306 | |||
| 1084 | Ga0070670_100216991 | |||
| 1085 | Ga0070670_100360240 | |||
| 1086 | Ga0070677_10000223 | |||
| 1087 | Ga0068869_100000910 | |||
| 1088 | Ga0068869_100023605 | |||
| 1089 | Ga0068869_100463744 | |||
| 1090 | Ga0070666_10006822 | |||
| 1091 | Ga0070666_10020841 | |||
| 1092 | Ga0070680_100066929 | |||
| 1093 | Ga0070680_100135455 | |||
| 1094 | Ga0070680_100311108 | |||
| 1095 | Ga0070680_100498419 | |||
| 1096 | Ga0070682_100000411 | |||
| 1097 | Ga0070682_100019450 | |||
| 1098 | Ga0070682_100055448 | |||
| 1099 | Ga0068868_100002658 | |||
| 1100 | Ga0068868_100007347 | |||
| 1101 | Ga0068868_100230442 | |||
| 1102 | Ga0070660_100004007 | |||
| 1103 | Ga0070660_100079850 | |||
| 1104 | Ga0070660_100134212 | |||
| 1105 | Ga0070689_100001606 | |||
| 1106 | Ga0070689_100021640 | |||
| 1107 | Ga0070689_100025073 | |||
| 1108 | Ga0070691_10001869 | |||
| 1109 | Ga0070691_10029804 | |||
| 1110 | Ga0070691_10040466 | |||
| 1111 | Ga0070687_100000727 | |||
| 1112 | Ga0070687_100013975 | |||
| 1113 | Ga0070661_100001236 | |||
| 1114 | Ga0070661_100010430 | |||
| 1115 | Ga0070661_100022480 | |||
| 1116 | Ga0070661_100164490 | |||
| 1117 | Ga0070661_100470507 | |||
| 1118 | Ga0070692_10208867 | |||
| 1119 | Ga0070668_100002586 | |||
| 1120 | Ga0070668_100229342 | |||
| 1121 | Ga0070669_100002152 | |||
| 1122 | Ga0070669_100170824 | |||
| 1123 | Ga0070675_100002725 | |||
| 1124 | Ga0070675_100016211 | |||
| 1125 | Ga0070671_100000400 | |||
| 1126 | Ga0070671_100012085 | |||
| 1127 | Ga0070671_100093671 | |||
| 1128 | Ga0070674_100001765 | |||
| 1129 | Ga0070674_100098169 | |||
| 1130 | Ga0070673_100000169 | |||
| 1131 | Ga0070673_100026672 | |||
| 1132 | Ga0070673_100142818 | |||
| 1133 | Ga0070673_100464043 | |||
| 1134 | Ga0070688_100000757 | |||
| 1135 | Ga0070688_100002817 | |||
| 1136 | Ga0070688_100003731 | |||
| 1137 | Ga0070659_100001586 | |||
| 1138 | Ga0070659_100008020 | |||
| 1139 | Ga0070667_100001596 | |||
| 1140 | Ga0070667_100022988 | |||
| 1141 | Ga0070667_100027904 | |||
| 1142 | Ga0070667_100140344 | |||
| 1143 | Ga0070667_100146861 | |||
| 1144 | Ga0070703_10001184 | |||
| 1145 | Ga0070703_10031370 | |||
| 1146 | Ga0070709_10015216 | |||
| 1147 | Ga0070709_10023786 | |||
| 1148 | Ga0070709_10024550 | |||
| 1149 | Ga0070709_10156577 | |||
| 1150 | Ga0070714_100041579 | |||
| 1151 | Ga0070714_100064394 | |||
| 1152 | Ga0070714_100172166 | |||
| 1153 | Ga0070714_100192732 | |||
| 1154 | Ga0070714_100204716 | |||
| 1155 | Ga0070713_100009260 | |||
| 1156 | Ga0070713_100014412 | |||
| 1157 | Ga0070713_100040260 | |||
| 1158 | Ga0070713_100053207 | |||
| 1159 | Ga0070713_100081827 | |||
| 1160 | Ga0070710_10021260 | |||
| 1161 | Ga0070710_10031294 | |||
| 1162 | Ga0070710_10042657 | |||
| 1163 | Ga0070710_10088546 | |||
| 1164 | Ga0070701_10000774 | |||
| 1165 | Ga0070701_10010118 | |||
| 1166 | Ga0070711_100008564 | |||
| 1167 | Ga0070711_100154133 | |||
| 1168 | Ga0070711_100312166 | |||
| 1169 | Ga0070705_100001954 | |||
| 1170 | Ga0070705_100039207 | |||
| 1171 | Ga0070705_100340380 | |||
| 1172 | Ga0070700_100001821 | |||
| 1173 | Ga0070700_100003523 | |||
| 1174 | Ga0070694_100001416 | |||
| 1175 | Ga0070694_100025720 | |||
| 1176 | Ga0070694_100162063 | |||
| 1177 | Ga0070708_100080726 | |||
| 1178 | Ga0070663_100000593 | |||
| 1179 | Ga0070663_100039355 | |||
| 1180 | Ga0070663_100202315 | |||
| 1181 | Ga0070678_100058246 | |||
| 1182 | Ga0070662_100001940 | |||
| 1183 | Ga0070662_100076740 | |||
| 1184 | Ga0070681_10014859 | |||
| 1185 | Ga0070681_10024101 | |||
| 1186 | Ga0070681_10030328 | |||
| 1187 | Ga0070681_10047915 | |||
| 1188 | Ga0070681_10207931 | |||
| 1189 | Ga0068867_100002072 | |||
| 1190 | Ga0068867_100110461 | |||
| 1191 | Ga0070685_10002853 | |||
| 1192 | Ga0070685_10008779 | |||
| 1193 | Ga0070685_10272552 | |||
| 1194 | Ga0070679_100012097 | |||
| 1195 | Ga0070679_100016794 | |||
| 1196 | Ga0070679_100022903 | |||
| 1197 | Ga0070679_100108103 | |||
| 1198 | Ga0070679_100121517 | |||
| 1199 | Ga0070679_100143037 | |||
| 1200 | Ga0070679_100162213 | |||
| 1201 | Ga0070679_100344734 | |||
| 1202 | Ga0070684_100005903 | |||
| 1203 | Ga0070684_100048855 | |||
| 1204 | Ga0070684_100056083 | |||
| 1205 | Ga0070697_100047335 | |||
| 1206 | Ga0068853_100009652 | |||
| 1207 | Ga0068853_100257584 | |||
| 1208 | Ga0070672_100000611 | |||
| 1209 | Ga0070686_100001276 | |||
| 1210 | Ga0070686_100010093 | |||
| 1211 | Ga0070686_100034929 | |||
| 1212 | Ga0070695_100002233 | |||
| 1213 | Ga0070695_100002508 | |||
| 1214 | Ga0070696_100004688 | |||
| 1215 | Ga0070696_100115027 | |||
| 1216 | Ga0070696_100132168 | |||
| 1217 | Ga0070696_100352615 | |||
| 1218 | Ga0070693_100001538 | |||
| 1219 | Ga0070693_100084622 | |||
| 1220 | Ga0070693_100284995 | |||
| 1221 | Ga0070665_100023186 | |||
| 1222 | Ga0070665_100177668 | |||
| 1223 | Ga0070704_100001853 | |||
| 1224 | Ga0070704_100005239 | |||
| 1225 | Ga0068855_100002375 | |||
| 1226 | Ga0068855_100011650 | |||
| 1227 | Ga0068855_100090552 | |||
| 1228 | Ga0068855_100458546 | |||
| 1229 | Ga0068855_100629801 | |||
| 1230 | Ga0070664_100055670 | |||
| 1231 | Ga0070664_100094085 | |||
| 1232 | Ga0068857_100003420 | |||
| 1233 | Ga0068857_100145713 | |||
| 1234 | Ga0068857_100174187 | |||
| 1235 | Ga0068857_100761023 | |||
| 1236 | Ga0068854_100001082 | |||
| 1237 | Ga0068854_100111603 | |||
| 1238 | Ga0068854_100151684 | |||
| 1239 | Ga0068856_100006654 | |||
| 1240 | Ga0068856_100070095 | |||
| 1241 | Ga0068856_100073321 | |||
| 1242 | Ga0068856_100219530 | |||
| 1243 | Ga0068856_100936245 | |||
| 1244 | Ga0070702_100010472 | |||
| 1245 | Ga0070702_100023452 | |||
| 1246 | Ga0068852_100003054 | |||
| 1247 | Ga0068852_100058122 | |||
| 1248 | Ga0068852_100296450 | |||
| 1249 | Ga0068859_100006509 | |||
| 1250 | Ga0068859_100013118 | |||
| 1251 | Ga0068859_100035698 | |||
| 1252 | Ga0068859_100299994 | |||
| 1253 | Ga0068864_100001244 | |||
| 1254 | Ga0068864_100024235 | |||
| 1255 | Ga0068864_100078011 | |||
| 1256 | Ga0068866_10000500 | |||
| 1257 | Ga0068861_100003449 | |||
| 1258 | Ga0068861_100128476 | |||
| 1259 | Ga0068870_10000015 | |||
| 1260 | Ga0068863_100003914 | |||
| 1261 | Ga0068863_100079596 | |||
| 1262 | Ga0068863_100142176 | |||
| 1263 | Ga0068863_100182590 | |||
| 1264 | Ga0068858_100004772 | |||
| 1265 | Ga0068858_100017902 | |||
| 1266 | Ga0068858_100121572 | |||
| 1267 | Ga0068860_100003116 | |||
| 1268 | Ga0068860_100016258 | |||
| 1269 | Ga0068860_100049182 | |||
| 1270 | Ga0068862_100003903 | |||
| 1271 | Ga0068862_100290312 | |||
| 1272 | Ga0081455_10000081 | |||
| 1273 | Ga0081455_10007043 | |||
| 1274 | Ga0081455_10021572 | |||
| 1275 | Ga0081455_10059440 | |||
| 1276 | Ga0081455_10399209 | |||
| 1277 | Ga0081540_1015610 | |||
| 1278 | Ga0081540_1024952 | |||
| 1279 | Ga0081539_10011918 | |||
| 1280 | Ga0081539_10021758 | |||
| 1281 | Ga0070717_10014273 | |||
| 1282 | Ga0070717_10140757 | |||
| 1283 | Ga0070717_10145314 | |||
| 1284 | Ga0070717_10413250 | |||
| 1285 | Ga0075365_10223865 | |||
| 1286 | Ga0075368_10037148 | |||
| 1287 | Ga0075364_10229300 | |||
| 1288 | Ga0075364_10241731 | |||
| 1289 | Ga0075432_10003205 | |||
| 1290 | Ga0070715_10043719 | |||
| 1291 | Ga0070715_10045304 | |||
| 1292 | Ga0070716_100016329 | |||
| 1293 | Ga0070716_100025148 | |||
| 1294 | Ga0070716_100029037 | |||
| 1295 | Ga0070716_100230949 | |||
| 1296 | Ga0070712_100059229 | |||
| 1297 | Ga0070712_100066936 | |||
| 1298 | Ga0070712_100208649 | |||
| 1299 | Ga0070712_100273696 | |||
| 1300 | Ga0070712_100405473 | |||
| 1301 | Ga0070712_100414090 | |||
| 1302 | Ga0070712_100470299 | |||
| 1303 | Ga0075362_10014929 | |||
| 1304 | Ga0075362_10108061 | |||
| 1305 | Ga0075367_10299330 | |||
| 1306 | Ga0075427_10001025 | |||
| 1307 | Ga0075366_10139001 | |||
| 1308 | Ga0097621_100001400 | |||
| 1309 | Ga0097621_100045055 | |||
| 1310 | Ga0068871_100000359 | |||
| 1311 | Ga0068871_100003972 | |||
| 1312 | Ga0068871_100040962 | |||
| 1313 | Ga0075428_100002359 | |||
| 1314 | Ga0075430_100000424 | |||
| 1315 | Ga0075431_100001606 | |||
| 1316 | Ga0075433_10000012 | |||
| 1317 | Ga0075433_10009420 | |||
| 1318 | Ga0075433_10079512 | |||
| 1319 | Ga0075433_10090009 | |||
| 1320 | Ga0075433_10103780 | |||
| 1321 | Ga0075434_100000692 | |||
| 1322 | Ga0075434_100000760 | |||
| 1323 | Ga0075434_100125358 | |||
| 1324 | Ga0075434_100344335 | |||
| 1325 | Ga0075434_100681748 | |||
| 1326 | Ga0075429_100000558 | |||
| 1327 | Ga0068865_100000439 | |||
| 1328 | Ga0068865_100019171 | |||
| 1329 | Ga0068865_100086972 | |||
| 1330 | Ga0068865_100114659 | |||
| 1331 | Ga0075436_100032032 | |||
| 1332 | Ga0075436_100126854 | |||
| 1333 | Ga0097620_100006509 | |||
| 1334 | Ga0097620_100013118 | |||
| 1335 | Ga0097620_100035701 | |||
| 1336 | Ga0097620_100300013 | |||
| 1337 | Ga0075435_100003228 | |||
| 1338 | Ga0075435_100023822 | |||
| 1339 | Ga0075435_100029711 | |||
| 1340 | Ga0075435_100161447 | |||
| 1341 | Ga0105250_10019334 | |||
| 1342 | Ga0105240_10048416 | |||
| 1343 | Ga0105240_10158832 | |||
| 1344 | Ga0105240_10548538 | |||
| 1345 | Ga0111539_10003218 | |||
| 1346 | Ga0111539_10007371 | |||
| 1347 | Ga0111539_10007413 | |||
| 1348 | Ga0111539_10084379 | |||
| 1349 | Ga0105245_10001227 | |||
| 1350 | Ga0105245_10118066 | |||
| 1351 | Ga0105247_10003194 | |||
| 1352 | Ga0105247_10018479 | |||
| 1353 | Ga0105247_10199545 | |||
| 1354 | Ga0114129_10000803 | |||
| 1355 | Ga0114129_10131394 | |||
| 1356 | Ga0105243_10001341 | |||
| 1357 | Ga0105243_10006861 | |||
| 1358 | Ga0105243_10018182 | |||
| 1359 | Ga0105243_10079988 | |||
| 1360 | Ga0105241_10002078 | |||
| 1361 | Ga0105241_10022392 | |||
| 1362 | Ga0105241_10056494 | |||
| 1363 | Ga0105241_10070608 | |||
| 1364 | Ga0105242_10000411 | |||
| 1365 | Ga0105242_10058209 | |||
| 1366 | Ga0105242_10064496 | |||
| 1367 | Ga0105248_10009088 | |||
| 1368 | Ga0105248_10010917 | |||
| 1369 | Ga0105248_10080299 | |||
| 1370 | Ga0105248_10164937 | |||
| 1371 | Ga0105237_10012158 | |||
| 1372 | Ga0105237_10057375 | |||
| 1373 | Ga0105237_10174591 | |||
| 1374 | Ga0105238_10032313 | |||
| 1375 | Ga0105238_10042135 | |||
| 1376 | Ga0105238_10146738 | |||
| 1377 | Ga0105238_10812502 | |||
| 1378 | Ga0105249_10003261 | |||
| 1379 | Ga0105249_10007504 | |||
| 1380 | Ga0105249_10087597 | |||
| 1381 | Ga0105239_10006472 | |||
| 1382 | Ga0105239_10008469 | |||
| 1383 | Ga0105239_10073861 | |||
| 1384 | Ga0105239_10371844 | |||
| 1385 | Ga0105246_10000384 | |||
| 1386 | Ga0105246_10068461 | |||
| 1387 | Ga0105246_10492462 | |||
| 1388 | Ga0157321_1000730 | |||
| 1389 | Ga0157341_1001737 | |||
| 1390 | Ga0157345_1002402 | |||
| 1391 | Ga0157314_1002090 | |||
| 1392 | Ga0157347_1001068 | |||
| 1393 | Ga0157326_1001707 | |||
| 1394 | Ga0157338_1003558 | |||
| 1395 | Ga0157373_10064919 | |||
| 1396 | Ga0157371_10009572 | |||
| 1397 | Ga0157371_10026051 | |||
| 1398 | Ga0157370_10119228 | |||
| 1399 | Ga0157370_10331035 | |||
| 1400 | Ga0157370_10364986 | |||
| 1401 | Ga0157374_10023594 | |||
| 1402 | Ga0157374_10096669 | |||
| 1403 | Ga0157374_10475451 | |||
| 1404 | Ga0157378_10005961 | |||
| 1405 | Ga0157378_10126471 | |||
| 1406 | Ga0163162_10001455 | |||
| 1407 | Ga0163162_10005169 | |||
| 1408 | Ga0163162_10117044 | |||
| 1409 | Ga0157372_10059126 | |||
| 1410 | Ga0157372_11039961 | |||
| 1411 | Ga0157375_10005043 | |||
| 1412 | Ga0157375_10026190 | |||
| 1413 | Ga0157375_10194416 | |||
| 1414 | Ga0163163_10011894 | |||
| 1415 | Ga0163163_10098114 | |||
| 1416 | Ga0163163_10624088 | |||
| 1417 | Ga0157380_10003014 | |||
| 1418 | Ga0157380_10157828 | |||
| 1419 | Ga0157377_10000224 | |||
| 1420 | Ga0157379_10002183 | |||
| 1421 | Ga0157379_10024465 | |||
| 1422 | Ga0157379_10115774 | |||
| 1423 | Ga0157379_10195893 | |||
| 1424 | Ga0157376_10001879 | |||
| 1425 | Ga0163161_10000471 | |||
| 1426 | Ga0163161_10018737 | |||
| 1427 | Ga0206356_10495441 | |||
| 1428 | Ga0206354_11118322 | |||
| 1429 | Ga0213876_10016881 | |||
| 1430 | Ga0213876_10082617 | |||
| 1431 | Ga0209233_1012835 | |||
| 1432 | Ga0207666_1000074 | |||
| 1433 | Ga0207666_1000672 | |||
| 1434 | Ga0207673_1000705 | |||
| 1435 | Ga0209758_1000125 | |||
| 1436 | Ga0209051_1000202 | |||
| 1437 | Ga0207697_10001234 | |||
| 1438 | Ga0207697_10003525 | |||
| 1439 | Ga0207713_1016905 | |||
| 1440 | Ga0207653_10003354 | |||
| 1441 | Ga0207653_10014922 | |||
| 1442 | Ga0207682_10000169 | |||
| 1443 | Ga0207692_10015843 | |||
| 1444 | Ga0207692_10034506 | |||
| 1445 | Ga0207692_10062657 | |||
| 1446 | Ga0207692_10077529 | |||
| 1447 | Ga0207642_10000791 | |||
| 1448 | Ga0207710_10003179 | |||
| 1449 | Ga0207688_10000157 | |||
| 1450 | Ga0207688_10024551 | |||
| 1451 | Ga0207680_10008866 | |||
| 1452 | Ga0207647_10001770 | |||
| 1453 | Ga0207647_10004978 | |||
| 1454 | Ga0207685_10007358 | |||
| 1455 | Ga0207685_10125748 | |||
| 1456 | Ga0207699_10018563 | |||
| 1457 | Ga0207699_10032606 | |||
| 1458 | Ga0207699_10080391 | |||
| 1459 | Ga0207699_10110498 | |||
| 1460 | Ga0207699_10156137 | |||
| 1461 | Ga0207699_10319110 | |||
| 1462 | Ga0207645_10003164 | |||
| 1463 | Ga0207645_10029098 | |||
| 1464 | Ga0207645_10031653 | |||
| 1465 | Ga0207643_10000004 | |||
| 1466 | Ga0207705_10163500 | |||
| 1467 | Ga0207654_10001412 | |||
| 1468 | Ga0207654_10099776 | |||
| 1469 | Ga0207707_10000992 | |||
| 1470 | Ga0207707_10027076 | |||
| 1471 | Ga0207707_10080223 | |||
| 1472 | Ga0207671_10035650 | |||
| 1473 | Ga0207671_10073632 | |||
| 1474 | Ga0207693_10022760 | |||
| 1475 | Ga0207693_10022992 | |||
| 1476 | Ga0207693_10043509 | |||
| 1477 | Ga0207693_10094240 | |||
| 1478 | Ga0207693_10125732 | |||
| 1479 | Ga0207663_10069197 | |||
| 1480 | Ga0207663_10173909 | |||
| 1481 | Ga0207660_10110151 | |||
| 1482 | Ga0207660_10162843 | |||
| 1483 | Ga0207660_10260224 | |||
| 1484 | Ga0207662_10000850 | |||
| 1485 | Ga0207662_10004200 | |||
| 1486 | Ga0207662_10025915 | |||
| 1487 | Ga0207657_10002203 | |||
| 1488 | Ga0207657_10008189 | |||
| 1489 | Ga0207657_10147912 | |||
| 1490 | Ga0207657_10170678 | |||
| 1491 | Ga0207657_10217872 | |||
| 1492 | Ga0207657_10232350 | |||
| 1493 | Ga0207649_10001352 | |||
| 1494 | Ga0207649_10057400 | |||
| 1495 | Ga0207649_10077848 | |||
| 1496 | Ga0207649_10236248 | |||
| 1497 | Ga0207652_10002958 | |||
| 1498 | Ga0207652_10012285 | |||
| 1499 | Ga0207652_10120911 | |||
| 1500 | Ga0207652_10131500 | |||
| 1501 | Ga0207652_10223696 | |||
| 1502 | Ga0207681_10001165 | |||
| 1503 | Ga0207694_10024528 | |||
| 1504 | Ga0207694_10101619 | |||
| 1505 | Ga0207694_10149087 | |||
| 1506 | Ga0207650_10007784 | |||
| 1507 | Ga0207650_10031598 | |||
| 1508 | Ga0207659_10000038 | |||
| 1509 | Ga0207659_10436094 | |||
| 1510 | Ga0207687_10000966 | |||
| 1511 | Ga0207687_10005917 | |||
| 1512 | Ga0207687_10268164 | |||
| 1513 | Ga0207700_10004193 | |||
| 1514 | Ga0207700_10007862 | |||
| 1515 | Ga0207700_10137798 | |||
| 1516 | Ga0207700_10225725 | |||
| 1517 | Ga0207664_10084597 | |||
| 1518 | Ga0207664_10106790 | |||
| 1519 | Ga0207664_10178527 | |||
| 1520 | Ga0207664_10286426 | |||
| 1521 | Ga0207644_10002653 | |||
| 1522 | Ga0207644_10031676 | |||
| 1523 | Ga0207690_10000805 | |||
| 1524 | Ga0207690_10184763 | |||
| 1525 | Ga0207690_10279152 | |||
| 1526 | Ga0207706_10003945 | |||
| 1527 | Ga0207706_10004195 | |||
| 1528 | Ga0207706_10206227 | |||
| 1529 | Ga0207686_10001021 | |||
| 1530 | Ga0207686_10009204 | |||
| 1531 | Ga0207686_10014291 | |||
| 1532 | Ga0207709_10000645 | |||
| 1533 | Ga0207709_10010819 | |||
| 1534 | Ga0207709_10027585 | |||
| 1535 | Ga0207670_10001354 | |||
| 1536 | Ga0207670_10029682 | |||
| 1537 | Ga0207669_10000063 | |||
| 1538 | Ga0207704_10000540 | |||
| 1539 | Ga0207704_10028204 | |||
| 1540 | Ga0207665_10002733 | |||
| 1541 | Ga0207665_10012974 | |||
| 1542 | Ga0207665_10049564 | |||
| 1543 | Ga0207665_10090316 | |||
| 1544 | Ga0207691_10004163 | |||
| 1545 | Ga0207711_10002693 | |||
| 1546 | Ga0207711_10010594 | |||
| 1547 | Ga0207711_10020036 | |||
| 1548 | Ga0207689_10001462 | |||
| 1549 | Ga0207689_10008666 | |||
| 1550 | Ga0207661_10001037 | |||
| 1551 | Ga0207661_10127843 | |||
| 1552 | Ga0207679_10000673 | |||
| 1553 | Ga0207679_10057438 | |||
| 1554 | Ga0207679_10086488 | |||
| 1555 | Ga0207667_10020248 | |||
| 1556 | Ga0207667_10162312 | |||
| 1557 | Ga0207667_10232547 | |||
| 1558 | Ga0207667_10549227 | |||
| 1559 | Ga0207651_10000116 | |||
| 1560 | Ga0207651_10040253 | |||
| 1561 | Ga0207651_10153826 | |||
| 1562 | Ga0207712_10002012 | |||
| 1563 | Ga0207712_10004960 | |||
| 1564 | Ga0207712_10137446 | |||
| 1565 | Ga0207712_10203850 | |||
| 1566 | Ga0207668_10000300 | |||
| 1567 | Ga0207640_10000435 | |||
| 1568 | Ga0207640_10035983 | |||
| 1569 | Ga0207658_10002963 | |||
| 1570 | Ga0207658_10082822 | |||
| 1571 | Ga0207658_10263665 | |||
| 1572 | Ga0207677_10000587 | |||
| 1573 | Ga0207677_10008808 | |||
| 1574 | Ga0207703_10002543 | |||
| 1575 | Ga0207703_10007244 | |||
| 1576 | Ga0207639_10002760 | |||
| 1577 | Ga0207639_10167627 | |||
| 1578 | Ga0207678_10001349 | |||
| 1579 | Ga0207678_10022212 | |||
| 1580 | Ga0207678_10022878 | |||
| 1581 | Ga0207678_10044108 | |||
| 1582 | Ga0207678_10099514 | |||
| 1583 | Ga0207708_10002313 | |||
| 1584 | Ga0207708_10015894 | |||
| 1585 | Ga0207708_10021050 | |||
| 1586 | Ga0207702_10005132 | |||
| 1587 | Ga0207702_10231671 | |||
| 1588 | Ga0207641_10002690 | |||
| 1589 | Ga0207641_10115486 | |||
| 1590 | Ga0207641_10201193 | |||
| 1591 | Ga0207648_10004670 | |||
| 1592 | Ga0207648_10078279 | |||
| 1593 | Ga0207676_10001465 | |||
| 1594 | Ga0207676_10005579 | |||
| 1595 | Ga0207674_10005769 | |||
| 1596 | Ga0207674_10449960 | |||
| 1597 | Ga0207674_10455538 | |||
| 1598 | Ga0207675_100004143 | |||
| 1599 | Ga0207683_10000138 | |||
| 1600 | Ga0207683_10005177 | |||
| 1601 | Ga0207683_10019940 | |||
| 1602 | Ga0207698_10000568 | |||
| 1603 | Ga0207698_10094055 | |||
| 1604 | Ga0207698_10312360 | |||
| 1605 | Ga0209983_1005339 | |||
| 1606 | Ga0209966_1000683 | |||
| 1607 | Ga0209966_1013511 | |||
| 1608 | Ga0209998_10005729 | |||
| 1609 | Ga0209813_10015831 | |||
| 1610 | Ga0209974_10014734 | |||
| 1611 | Ga0209974_10015935 | |||
| 1612 | Ga0209974_10085960 | |||
| 1613 | Ga0207428_10000137 | |||
| 1614 | Ga0207428_10000501 | |||
| 1615 | Ga0207428_10001016 | |||
| 1616 | Ga0268266_10001262 | |||
| 1617 | Ga0268266_10043177 | |||
| 1618 | Ga0268265_10001141 | |||
| 1619 | Ga0268264_10001321 | |||
| 1620 | Ga0268264_10059854 | |||
| 1621 | Ga0268264_10382346 | |||
| 1622 | Ga0265337_1001142 | |||
| 1623 | Ga0265338_10015318 | |||
| 1624 | Ga0265325_10000073 | |||
| 1625 | Ga0265325_10025728 | |||
| 1626 | Ga0265325_10027013 | |||
| 1627 | Ga0265340_10003699 | |||
| 1628 | Ga0265339_10005245 | |||
| 1629 | Ga0265339_10021781 | |||
| 1630 | Ga0265331_10051174 | |||
| 1631 | Ga0265313_10000716 | |||
| 1632 | Ga0265313_10002686 | |||
| 1633 | Ga0265313_10004206 | |||
| 1634 | Ga0265313_10015566 | |||
| 1635 | Ga0265313_10019973 | |||
| 1636 | Ga0265313_10049063 | |||
| 1637 | Ga0265314_10010751 | |||
| 1638 | Ga0265342_10000940 | |||
| 1639 | Ga0307409_100558437 | |||
| 1640 | Ga0316583_10000745 | |||
| 1641 | Ga0373930_0000459 | |||
| 1642 | Ga0373930_0005738 | |||
| 1643 | Ga0373950_0000303 | |||
| 1644 | Ga0373958_0000140 | |||
| 1645 | Ga0373958_0011105 | |||
| 1646 | Ga0373959_0000674 | |||
| 1647 | Ga0373938_0000040 | |||
| 1648 | Ga0373938_0030275 | |||
| 1649 | Ga0373926_0019950 | |||
| 1650 | Ga0373928_0002996 | |||
| 1651 | Ga0373929_0002689 | |||
| 1652 | Ga0373929_0002731 | |||
| 1653 | Ga0373929_0041922 | |||
| 1654 | Ga0373934_0016112 | |||
| 1655 | Ga0373940_0000108 | |||
| 1656 | Ga0373940_0005706 | |||
| 1657 | Ga0373944_0000384 | |||
| 1658 | Ga0373949_0000806 | |||
| 1659 | Ga0373949_0002522 | |||
| 1660 | Ga0373949_0015680 | |||
| 1661 | Ga0373951_0002034 | |||
| 1662 | Ga0373951_0002329 | |||
| 1663 | Ga0373952_0000124 | |||
| 1664 | Ga0373952_0001569 | |||
| 1665 | Ga0373952_0002931 | |||
| 1666 | Ga0373923_0002096 | |||
| 1667 | Ga0373923_0025139 | |||
| 1668 | Ga0373932_0000365 | |||
| 1669 | Ga0373932_0007207 | |||
| 1670 | Ga0373932_0011452 | |||
| 1671 | Ga0373936_0001108 | |||
| 1672 | Ga0373936_0058909 | |||
| 1673 | Ga0373939_0000233 | |||
| 1674 | Ga0373939_0000324 | |||
| 1675 | Ga0373939_0018869 | |||
| 1676 | Ga0373941_0000133 | |||
| 1677 | Ga0373941_0001631 | |||
| 1678 | Ga0373941_0023149 | |||
| 1679 | Ga0373945_0021431 | |||
| 1680 | Ga0373953_0004410 | |||
| 1681 | Ga0373954_0004472 | |||
| 1682 | Ga0373954_0004727 | |||
| 1683 | Ga0373954_0137924 | |||
| 1684 | Ga0373956_0020277 | |||
| 1685 | Ga0373956_0028710 | |||
| 1686 | Ga0373956_0065690 | |||
| 1687 | Ga0373957_0080294 | |||
| 1688 | Ga0373960_0000182 | |||
| 1689 | Ga0373960_0002468 | |||
| 1690 | Ga0373943_0067107 | |||
| 1691 | Ga0373946_0003601 | |||
| 1692 | Ga0373946_0021682 | |||
| 1693 | Ga0373946_0108417 | |||
| 1694 | Ga0373955_0001653 | |||
| 1695 | Ga0373955_0005592 | |||
| 1696 | Ga0373955_0045827 | |||
| 1697 | Ga0373955_0113186 | |||
| 1698 | Ga0373942_0001391 | |||
| 1699 | Ga0373942_0010812 | |||
| 1700 | Ga0373961_0001666 | |||
| 1701 | Ga0373961_0006955 | |||
| 1702 | Ga0373961_0011700 | |||
| 1703 | Ga0373962_0000986 | |||
| 1704 | Ga0373962_0001963 | |||
| 1705 | Ga0373962_0003879 | |||
| 1706 | Ga0373924_0013348 | |||
| 1707 | Ga0373931_0000201 | |||
| 1708 | Ga0373931_0009536 | |||
| 1709 | Ga0373931_0023268 | |||
| 1710 | Ga0373935_0011849 | |||
| 1711 | Ga0373935_0040078 | |||
| 1712 | Ga0373935_0187488 | |||
| 1713 | Ga0373927_0004308 | |||
| 1714 | Ga0373927_0036059 | |||
| 1715 | Ga0373927_0036801 | |||
| 1716 | Ga0373927_0135116 | |||
| 1717 | Ga0373933_0008719 | |||
| 1718 | Ga0373933_0010415 | |||
| 1719 | Ga0373933_0025751 | |||
| 1720 | Ga0373947_0001864 | |||
| 1721 | Ga0373947_0009738 | |||
| 1722 | Ga0373947_0202253 | |||
| 1723 | Ga0373937_0003235 | |||
| 1724 | Ga0373937_0006672 | |||
| 1725 | Ga0373937_0033316 | |||
| 1726 | Ga0373937_0098699 | |||
| 1727 | Ga0373937_0222342 | |||
| 1728 | Ga0373925_0011314 | |||
| 1729 | Ga0373925_0179187 | |||
| 1730 | Ga0395899_0012727 | |||
| 1731 | Ga0395900_0009953 | |||
| 1732 | Ga0395900_0113681 | |||
| 1733 | Ga0395898_0011214 | |||
| 1734 | Ga0395898_0026605 | |||
| 1735 | Ga0395898_0062209 | |||
| 1736 | Ga0395898_0077282 | |||
| 1737 | Ga0395898_0312852 | |||
| 1738 | Ga0436364_0051540 | |||
| 1739 | Ga0436364_0768336 | |||
| 1740 | Ga0395901_0668936 | |||
| 1741 | Ga0436365_0076921 | |||
| 1742 | Ga0436365_0973066 | |||
| 1743 | Ga0436365_1658016 | |||
| 1744 | Ga0436360_0611710 | |||
| 1745 | Ga0436360_1087568 | |||
| 1746 | Ga0439455_0047020 | |||
| 1747 | Ga0439459_0024351 | |||
| 1748 | Ga0466961_0084132 | |||
| 1749 | Ga0453684_0127658 | |||
| 1750 | Ga0466957_0017316 | |||
| 1751 | Ga0466957_0029088 | |||
| 1752 | Ga0466959_0049111 | |||
| 1753 | Ga0451576_0005476 | |||
| 1754 | Ga0466958_0094533 | |||
| 1755 | Ga0466967_0025195 | |||
| 1756 | Ga0495592_0039290 | |||
| 1757 | Ga0495603_0005452 | |||
| 1758 | Ga0495603_0094916 | |||
| 1759 | Ga0495629_0000753 | |||
| 1760 | Ga0495629_0007785 | |||
| 1761 | Ga0495629_0209754 | |||
| 1762 | Ga0495641_0006263 | |||
| 1763 | Ga0495641_0058555 | |||
| 1764 | Ga0495641_0070007 | |||
| 1765 | Ga0495651_0001426 | |||
| 1766 | Ga0495651_0003365 | |||
| 1767 | Ga0495653_0007190 | |||
| 1768 | Ga0495653_0020780 | |||
| 1769 | Ga0495653_0049797 | |||
| 1770 | Ga0495653_0231219 | |||
| 1771 | Ga0495580_0018331 | |||
| 1772 | Ga0495582_0004350 | |||
| 1773 | Ga0495639_0003382 | |||
| 1774 | Ga0495662_0005339 | |||
| 1775 | Ga0495662_0159423 | |||
| 1776 | Ga0495664_0001065 | |||
| 1777 | Ga0495664_0001159 | |||
| 1778 | Ga0495664_0043178 | |||
| 1779 | Ga0495664_0056993 | |||
| 1780 | Ga0495584_0040539 | |||
| 1781 | Ga0495585_0010864 | |||
| 1782 | Ga0495594_0005356 | |||
| 1783 | Ga0495594_0033058 | |||
| 1784 | Ga0495594_0057114 | |||
| 1785 | Ga0495607_0183992 | |||
| 1786 | Ga0495608_0022600 | |||
| 1787 | Ga0495608_0023926 | |||
| 1788 | Ga0495608_0032140 | |||
| 1789 | Ga0495608_0055708 | |||
| 1790 | Ga0495616_0106930 | |||
| 1791 | Ga0495618_0002569 | |||
| 1792 | Ga0495618_0038119 | |||
| 1793 | Ga0495628_0028666 | |||
| 1794 | Ga0495628_0040170 | |||
| 1795 | Ga0495628_0077727 | |||
| 1796 | Ga0495630_0020198 | |||
| 1797 | Ga0495631_0076757 | |||
| 1798 | Ga0495643_0000251 | |||
| 1799 | Ga0495666_0002611 | |||
| 1800 | Ga0495652_0010251 | |||
| 1801 | Ga0495652_0015185 | |||
| 1802 | Ga0495652_0055249 | |||
| 1803 | Ga0495652_0123276 | |||
| 1804 | Ga0495665_0000227 | |||
| 1805 | Ga0495640_0075178 | |||
| 1806 | Ga0495640_0161840 | |||
| 1807 | Ga0495586_0002283 | |||
| 1808 | Ga0495586_0185241 | |||
| 1809 | Ga0495587_0005444 | |||
| 1810 | Ga0495587_0021805 | |||
| 1811 | Ga0495587_0030054 | |||
| 1812 | Ga0495587_0030701 | |||
| 1813 | Ga0495645_0001416 | |||
| 1814 | Ga0495645_0012537 | |||
| 1815 | Ga0495645_0014693 | |||
| 1816 | Ga0495667_0001271 | |||
| 1817 | Ga0495667_0004444 | |||
| 1818 | Ga0495667_0009931 | |||
| 1819 | Ga0495667_0013435 | |||
| 1820 | Ga0495667_0034261 | |||
| 1821 | Ga0495656_0000293 | |||
| 1822 | Ga0495634_0050091 | |||
| 1823 | Ga0495634_0120091 | |||
| 1824 | Ga0495635_0004545 | |||
| 1825 | Ga0495635_0014865 | |||
| 1826 | Ga0495635_0025815 | |||
| 1827 | Ga0495635_0060012 | |||
| 1828 | Ga0495635_0088488 | |||
| 1829 | Ga0495635_0210381 | |||
| 1830 | Ga0495659_0003705 | |||
| 1831 | Ga0495588_0000908 | |||
| 1832 | Ga0495588_0024883 | |||
| 1833 | Ga0495657_0016368 | |||
| 1834 | Ga0495657_0029876 | |||
| 1835 | Ga0495599_0010444 | |||
| 1836 | Ga0495599_0031081 | |||
| 1837 | Ga0495623_0016534 | |||
| 1838 | Ga0495623_0092679 | |||
| 1839 | Ga0495623_0125954 | |||
| 1840 | Ga0495646_0017562 | |||
| 1841 | Ga0495646_0020862 | |||
| 1842 | Ga0495647_0002458 | |||
| 1843 | Ga0495647_0003258 | |||
| 1844 | Ga0495658_0006858 | |||
| 1845 | Ga0495658_0013676 | |||
| 1846 | Ga0495658_0056454 | |||
| 1847 | Ga0495669_0011633 | |||
| 1848 | Ga0495613_0016237 | |||
| 1849 | Ga0495613_0019456 | |||
| 1850 | Ga0495624_0004400 | |||
| 1851 | Ga0495670_0001083 | |||
| 1852 | Ga0495600_0003990 | |||
| 1853 | Ga0495600_0006118 | |||
| 1854 | Ga0495581_0026504 | |||
| 1855 | Ga0495581_0129143 | |||
| 1856 | Ga0495604_0002693 | |||
| 1857 | Ga0495604_0003959 | |||
| 1858 | Ga0495604_0012806 | |||
| 1859 | Ga0495604_0047064 | |||
| 1860 | Ga0495604_0105136 | |||
| 1861 | Ga0495604_0147008 | |||
| 1862 | Ga0495674_0022419 | |||
| 1863 | Ga0495674_0061562 | |||
| 1864 | Ga0495674_0079807 | |||
| 1865 | Ga0495674_0098800 | |||
| 1866 | Ga0495674_0377009 | |||
| 1867 | Ga0495676_0017396 | |||
| 1868 | Ga0495676_0056354 | |||
| 1869 | Ga0495676_0074179 | |||
| 1870 | Ga0495680_0007465 | |||
| 1871 | Ga0495680_0016138 | |||
| 1872 | Ga0495680_0023079 | |||
| 1873 | Ga0495680_0039844 | |||
| 1874 | Ga0495680_0079122 | |||
| 1875 | Ga0495680_0101664 | |||
| 1876 | Ga0495675_0004039 | |||
| 1877 | Ga0495675_0005632 | |||
| 1878 | Ga0495675_0008738 | |||
| 1879 | Ga0495675_0040810 | |||
| 1880 | Ga0495679_020313 | |||
| 1881 | Ga0495684_0031018 | |||
| 1882 | Ga0495684_0196104 | |||
| 1883 | Ga0495684_0240061 | |||
| 1884 | Ga0495684_0373808 | |||
| 1885 | Ga0495593_0010986 | |||
| 1886 | Ga0495593_0100093 | |||
| 1887 | Ga0495602_0000307 | |||
| 1888 | Ga0495602_0041449 | |||
| 1889 | Ga0495614_0012038 | |||
| 1890 | Ga0496100_0000326 | |||
| 1891 | Ga0496100_0022596 | |||
| 1892 | Ga0496100_0115377 | |||
| 1893 | Ga0496101_0010563 | |||
| 1894 | Ga0496101_0045005 | |||
| 1895 | Ga0496101_0210097 | |||
| 1896 | Ga0496102_0001315 | |||
| 1897 | Ga0496102_0018733 | |||
| 1898 | Ga0496102_0077484 | |||
| 1899 | Ga0496102_0106082 | |||
| 1900 | Ga0496103_0002237 | |||
| 1901 | Ga0496103_0017710 | |||
| 1902 | Ga0496103_0060704 | |||
| 1903 | Ga0496103_0190298 | |||
| 1904 | Ga0496104_0036713 | |||
| 1905 | Ga0496104_0079646 | |||
| 1906 | Ga0496104_0109552 | |||
| 1907 | Ga0496104_0170982 | |||
| 1908 | Ga0496105_0004088 | |||
| 1909 | Ga0496105_0067103 | |||
| 1910 | Ga0496105_0209874 | |||
| 1911 | Ga0496106_0005158 | |||
| 1912 | Ga0496106_0011103 | |||
| 1913 | Ga0496106_0026287 | |||
| 1914 | Ga0496106_0104517 | |||
| 1915 | Ga0496107_0002339 | |||
| 1916 | Ga0496107_0004092 | |||
| 1917 | Ga0496107_0059305 | |||
| 1918 | Ga0496107_0067025 | |||
| 1919 | Ga0496108_0011465 | |||
| 1920 | Ga0496108_0274481 | |||
| 1921 | Ga0496109_0000409 | |||
| 1922 | Ga0496109_0036297 | |||
| 1923 | Ga0496109_0079499 | |||
| 1924 | Ga0496110_0054514 | |||
| 1925 | Ga0496110_0145526 | |||
| 1926 | Ga0496110_0190604 | |||
| 1927 | Ga0496111_0009332 | |||
| 1928 | Ga0496111_0018080 | |||
| 1929 | Ga0496111_0068354 | |||
| 1930 | Ga0496111_0122934 | |||
| 1931 | Ga0496112_0004892 | |||
| 1932 | Ga0496112_0023217 | |||
| 1933 | Ga0496112_0107004 | |||
| 1934 | Ga0496113_0001989 | |||
| 1935 | Ga0496114_0002505 | |||
| 1936 | Ga0496114_0024049 | |||
| 1937 | Ga0496114_0040268 | |||
| 1938 | Ga0496114_0059721 | |||
| 1939 | Ga0496114_0507418 | |||
| 1940 | Ga0496115_0047311 | |||
| 1941 | Ga0496115_0071252 | |||
| 1942 | Ga0496115_0208678 | |||
| 1943 | Ga0496115_0295210 | |||
| 1944 | Ga0501032_0049588 | |||
| 1945 | Ga0501033_0028588 | |||
| 1946 | Ga0501033_0383614 | |||
| 1947 | Ga0501034_0060215 | |||
| 1948 | Ga0501034_0153546 | |||
| 1949 | Ga0501034_0212650 | |||
| 1950 | Ga0501034_0248591 | |||
| 1951 | Ga0501036_0029441 | |||
| 1952 | Ga0501036_0271273 | |||
| 1953 | Ga0501036_0367109 | |||
| 1954 | Ga0501037_0012035 | |||
| 1955 | Ga0501037_0079295 | |||
| 1956 | Ga0501037_0130519 | |||
| 1957 | Ga0501038_0017141 | |||
| 1958 | Ga0501038_0065910 | |||
| 1959 | Ga0501039_0217974 | |||
| 1960 | Ga0501043_0097779 | |||
| 1961 | Ga0501043_0315984 | |||
| 1962 | Ga0501043_0322171 | |||
| 1963 | Ga0501047_0039056 | |||
| 1964 | Ga0501047_0061726 | |||
| 1965 | Ga0501047_0139289 | |||
| 1966 | Ga0501047_0180845 | |||
| 1967 | Ga0501047_0385117 | |||
| 1968 | Ga0501068_0056853 | |||
| 1969 | Ga0501069_0040364 | |||
| 1970 | Ga0501069_0041325 | |||
| 1971 | Ga0501070_0002780 | |||
| 1972 | Ga0501070_0013624 | |||
| 1973 | Ga0501070_0252766 | |||
| 1974 | Ga0501070_0308841 | |||
| 1975 | Ga0501070_0312647 | |||
| 1976 | Ga0501070_0584362 | |||
| 1977 | Ga0501071_0290511 | |||
| 1978 | Ga0501071_0352319 | |||
| 1979 | Ga0501072_0108317 | |||
| 1980 | Ga0501072_0157156 | |||
| 1981 | Ga0501073_0045253 | |||
| 1982 | Ga0501074_0056198 | |||
| 1983 | Ga0501075_0021327 | |||
| 1984 | Ga0501076_0011054 | |||
| 1985 | Ga0501076_0181126 | |||
| 1986 | Ga0501079_0098472 | |||
| 1987 | Ga0501080_0020779 | |||
| 1988 | Ga0501080_0133794 | |||
| 1989 | Ga0501080_0186002 | |||
| 1990 | Ga0501080_0314227 | |||
| 1991 | Ga0501081_0003721 | |||
| 1992 | Ga0501081_0356690 | |||
| 1993 | Ga0501083_0062482 | |||
| 1994 | Ga0501083_0127608 | |||
| 1995 | Ga0501083_0137509 | |||
| 1996 | Ga0501035_0053535 | |||
| 1997 | Ga0501035_0073490 | |||
| 1998 | Ga0501044_0040173 | |||
| 1999 | Ga0501044_0106591 | |||
| 2000 | Ga0501044_0214480 | |||
| 2001 | Ga0501044_0448258 | |||
| 2002 | nmdc:mga03683_26697_c1 | |||
| 2003 | nmdc:mga03683_78865_c1 | |||
| 2004 | nmdc:mga00v17_251005_c1 | |||
| 2005 | nmdc:mga0yw44_107628_c1 | |||
| 2006 | nmdc:mga0k408_99574_c1 | |||
| 2007 | nmdc:mga04h51_18269_c1 | |||
| 2008 | nmdc:mga05p37_14826_c1 | |||
| 2009 | nmdc:mga05p37_66_c1 | |||
| 2010 | nmdc:mga09592_1181_c1 | |||
| 2011 | nmdc:mga0qj67_341_c1 | |||
| 2012 | nmdc:mga06r32_404_c1 | |||
| 2013 | nmdc:mga08y16_615_c1 | |||
| 2014 | nmdc:mga08y16_865_c1 | |||
| 2015 | nmdc:mga08y16_992_c1 | |||
| 2016 | nmdc:mga0n895_1104_c1 | |||
| 2017 | nmdc:mga0n895_118010_c1 | |||
| 2018 | nmdc:mga0n895_320835_c1 | |||
| 2019 | nmdc:mga0n895_374245_c1 | |||
| 2020 | nmdc:mga0n895_9873_c1 | |||
| 2021 | nmdc:mga0rr50_2041_c1 | |||
| 2022 | nmdc:mga0rr50_22669_c1 | |||
| 2023 | nmdc:mga0rr50_92636_c1 | |||
| 2024 | nmdc:mga08x19_128522_c1 | |||
| 2025 | nmdc:mga0a205_1819_c1 | |||
| 2026 | nmdc:mga0a205_413392_c1 | |||
| 2027 | nmdc:mga0a205_44463_c1 | |||
| 2028 | nmdc:mga0a205_970_c1 | |||
| 2029 | nmdc:mga0sz30_14457_c1 | |||
| 2030 | Ga0495601_0000747 | |||
| 2031 | Ga0495601_0001780 | |||
| 2032 | Ga0495601_0002068 | |||
| 2033 | Ga0495601_0010220 | |||
| 2034 | Ga0495601_0012739 | |||
| 2035 | Ga0495601_0016350 | |||
| 2036 | Ga0495601_0027330 | |||
| 2037 | Ga0495601_0033020 | |||
| 2038 | Ga0495601_0322678 | |||
| 2039 | Ga0495612_0000959 | |||
| 2040 | Ga0495612_0005327 | |||
| 2041 | Ga0495612_0010028 | |||
| 2042 | Ga0495612_0011721 | |||
| 2043 | Ga0495612_0046718 | |||
| 2044 | Ga0495595_0001402 | |||
| 2045 | Ga0495595_0001527 | |||
| 2046 | Ga0495595_0003748 | |||
| 2047 | Ga0495595_0187007 | |||
| 2048 | Ga0495619_0000045 | |||
| 2049 | Ga0495619_0000388 | |||
| 2050 | Ga0495619_0005237 | |||
| 2051 | Ga0495619_0009768 | |||
| 2052 | Ga0495619_0010675 | |||
| 2053 | Ga0495619_0033759 | |||
| 2054 | Ga0495619_0035168 | |||
| 2055 | Ga0495619_0036315 | |||
| 2056 | Ga0495619_0455935 | |||
| 2057 | Ga0500643_005413 | |||
| 2058 | Ga0500644_0004585 | |||
| 2059 | Ga0500651_0053940 | |||
| 2060 | Ga0500566_0233428 | |||
| 2061 | Ga0500595_000002 | |||
| 2062 | Ga0500652_036004 | |||
| 2063 | Ga0500655_021889 | |||
| 2064 | Ga0500577_0144418 | |||
| 2065 | Ga0500616_0000002 | |||
| 2066 | Ga0500616_0004868 | |||
| 2067 | Ga0500645_000324 | |||
| 2068 | Ga0501084_0014827 | |||
| 2069 | Ga0501084_0159484 | |||
| 2070 | Ga0501082_0030855 | |||
| 2071 | Ga0501082_0066643 | |||
| 2072 | Ga0501082_0166137 | |||
| 2073 | Ga0501082_0257009 | |||
| 2074 | Ga0466962_0044576 | |||
| 2075 | 2643757331 | |||
| 2076 | 2644104968 | |||
| 2077 | 2644307510 | |||
| 2078 | 2644613594 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7djs-assembly1.cif.gz_C | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.9603 | 4 | 254 |
| 4ni5-assembly1.cif.gz_B | crystal structure of a short chain dehydrogenase from brucella suis | 0.9586 | 3 | 254 |
| 4ni5-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase from brucella suis | 0.958 | 3 | 254 |
| 6ixm-assembly1.cif.gz_B | crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad | 0.9567 | 4 | 251 |
| 4yxf-assembly1.cif.gz_A | mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis | 0.9541 | 7 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.958 | 3 | 254 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9567 | 4 | 251 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9532 | 4 | 185 | 3.40.50.720 |
| af_P9WGQ9_1_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9516 | 4 | 254 | 3.40.50.720 |
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9498 | 3 | 254 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5FGB3-F1-model_v4 | SDR family oxidoreductase | 0.9938 | 1 | 254 |
GO:0016616
|
| AF-A0A6L5FGB3-F1-model_v4 | SDR family oxidoreductase | 0.9899 | 1 | 254 |
GO:0016616
|
| AF-A0A537SNP6-F1-model_v4 | SDR family oxidoreductase | 0.9898 | 1 | 155 |
|
| AF-A0A439LSN5-F1-model_v4 | SDR family oxidoreductase | 0.9897 | 1 | 253 |
GO:0016616
|
| AF-A0A2D8PNU8-F1-model_v4 | Dehydrogenase | 0.9869 | 1 | 251 |
GO:0016616
|