F488802

General Info

Members Datasets Scaffolds Average Seq Length
1039 538 2078 451

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0052702|Ga0501034_0052702_1042_2565
Length 507
Sequence MRGADGRSRVGRLPSEAVAVRDEIGRTARRQTPPTTASPTRQPMRTGTPPVLLDHSDPVVTADDSVIAGLDHWRTLEAKQQPAWPDADAARVAAEELATLPPLVFAGEVDQLRARMAAAAQGRAFLLQGGDCAETFAGATADQIRNRVKTVLQMAVVLTYGASVPVIKMGRMAGQFAKPRSSDTETRGEVSLPAYRGDMVNGYDFTPESRRADPRRLVQGYHTAASTLNLIRAFTQGGFADLREVHSWNRGFAQNPANQRYERLAREIDRAIKFMQAAGADFDELKRVEFYSSHEGLLMDYERAMTRIDSRTGTPYNTSAHFIWIGERTRQIDGAHVDFLSRVRNPIGVKLGPTTSADDMFRLIDKLDPTREPGRLTFITRMGAGKIRDALPPLLEAIKGHGATPLWVSDPMHGNGLTTPNGYKTRRFDDVVDEVKGFFEAHRDAGTIPGGIHVELTGDEVTECLGGSEHIDEATLATRYESLCDPRLNHMQSLELAFLVAEELGAR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
230 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
235 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
238 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
357 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
375 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
376 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
377 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
378 2643221546 Microbacterium sp. Root53 Isolate Unclassified
379 2643221549 Agromyces sp. Root1464 Isolate Unclassified
380 2643221553 Microbacterium sp. Root553 Isolate Unclassified
381 2643221566 Microbacterium sp. Root166 Isolate Unclassified
382 2643221572 Leifsonia sp. Root60 Isolate Unclassified
383 2643221575 Microbacterium sp. Root61 Isolate Unclassified
384 2643221597 Microbacterium sp. Root180 Isolate Unclassified
385 2643221613 Oerskovia sp. Root22 Isolate Unclassified
386 2643221616 Leifsonia sp. Root227 Isolate Unclassified
387 2643221619 Agromyces sp. Root81 Isolate Unclassified
388 2643221630 Microbacterium sp. Root322 Isolate Unclassified
389 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
390 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
391 2643221649 Leifsonia sp. Root4 Isolate Unclassified
392 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
393 2643221721 Oerskovia sp. Root918 Isolate Unclassified
394 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
395 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
396 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
397 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
398 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
399 2738543013 Variovorax sp. BT01 Isolate Unclassified
400 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
401 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
402 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
403 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
404 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
405 2773857759 Microbacterium sp. 1294 Isolate Unclassified
406 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
407 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
408 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
409 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
410 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
411 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
412 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
413 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
414 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
415 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
416 2808606372 Agromyces sp. 23-23 Isolate Unclassified
417 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
418 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
419 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
420 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
421 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
422 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
423 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
424 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
425 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
426 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
427 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
428 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
429 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
430 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
431 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
432 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
433 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
434 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
435 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
436 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
437 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
438 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
439 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
440 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
441 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
442 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
443 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
444 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
445 2858868258 Micromonospora sp. MH33 Isolate Unclassified
446 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
447 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
448 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
449 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
450 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
451 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
452 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
453 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
454 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
455 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
456 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
457 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
458 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
459 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
460 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
461 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
462 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
463 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
464 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
465 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
466 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
467 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
468 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
469 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
470 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
471 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
472 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
473 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
474 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
475 2919069694 Microbacterium sp. 1154 Isolate Unclassified
476 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
477 2919395869 Microbacterium resistens 2980 Isolate Unclassified
478 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
479 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
480 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
481 2920879853 Kocuria salina CV6 Isolate Unclassified
482 2928070936 Variovorax gossypii 1167 Isolate Unclassified
483 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
484 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
485 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
486 2928153084 Leifsonia sp. 563 Isolate Unclassified
487 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
488 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
489 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
490 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
491 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
492 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
493 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
494 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
495 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
496 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
497 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
498 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
499 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
500 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
501 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
502 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
503 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
504 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
505 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
506 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
507 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
508 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
509 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
510 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
511 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
512 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
513 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
514 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
515 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
516 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
517 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
518 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
519 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
520 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
521 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
522 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
523 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
524 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
525 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
526 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
527 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
528 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
529 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
530 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
531 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
532 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
533 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
534 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
535 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
536 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
537 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
538 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.77
Metatranscriptomes 1.35
Isolates 15.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 7.31
Nodule 0
Rhizoplane 6.93
Rhizosphere 70.16
Stem 0
Stem Tuber 0.1
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0052702 3300049571 Bacteria 4098
2 JGI24735J21928_10006502 3300002067 Bacteria 3845
3 JGI24735J21928_10013802 3300002067 Bacteria 2534
4 JGI25154J39366_1002688 3300002738 Bacteria 4344
5 JGI25164J39214_1000379 3300002772 Bacteria 26416
6 JGI25165J46597_1000004 3300003214 Bacteria 667510
7 Ga0006562J51391_1021896 3300003578 Bacteria 2328
8 Ga0006562J51391_1082829 3300003578 Bacteria 5917
9 Ga0006562J51391_1131020 3300003578 Bacteria 7120
10 Ga0006562J51391_1131021 3300003578 Bacteria 6500
11 Ga0055539_1000005 3300003752 Bacteria 609598
12 Ga0055539_1002881 3300003752 Bacteria 2512
13 Ga0055533_1000001 3300003756 Bacteria 1863437
14 Ga0055525_1000297 3300003759 Bacteria 42949
15 Ga0055527_1000001 3300003760 Bacteria 850044
16 Ga0055529_1000019 3300003763 Bacteria 332786
17 Ga0055534_1002138 3300003784 Bacteria 7076
18 Ga0055541_1001174 3300003841 Bacteria 5847
19 Ga0065714_10010373 3300005288 Bacteria 3932
20 Ga0070658_10000616 3300005327 Bacteria 30727
21 Ga0070658_10009207 3300005327 Bacteria 7938
22 Ga0070658_10015628 3300005327 Bacteria 6071
23 Ga0070658_10015836 3300005327 Bacteria 6029
24 Ga0070683_100019962 3300005329 Bacteria 5956
25 Ga0068869_100001475 3300005334 Bacteria 13926
26 Ga0068869_100071046 3300005334 Bacteria 2577
27 Ga0070666_10020796 3300005335 Bacteria 4245
28 Ga0070666_10022178 3300005335 Bacteria 4121
29 Ga0070680_100005277 3300005336 Bacteria 9772
30 Ga0070680_100031263 3300005336 Bacteria 4280
31 Ga0070682_100010564 3300005337 Bacteria 5240
32 Ga0070682_100031338 3300005337 Bacteria 3215
33 Ga0068868_100005820 3300005338 Bacteria 8691
34 Ga0068868_100133319 3300005338 Bacteria 2035
35 Ga0070660_100088778 3300005339 Bacteria 2435
36 Ga0070689_100070071 3300005340 Bacteria 2736
37 Ga0070661_100050100 3300005344 Bacteria 3056
38 Ga0070669_100022907 3300005353 Bacteria 4467
39 Ga0070675_100014554 3300005354 Bacteria 6205
40 Ga0070671_100001939 3300005355 Bacteria 15867
41 Ga0070671_100074945 3300005355 Bacteria 2827
42 Ga0070659_100089072 3300005366 Bacteria 2472
43 Ga0070667_100007740 3300005367 Bacteria 8907
44 Ga0070667_100023777 3300005367 Bacteria 5087
45 Ga0070667_100077303 3300005367 Bacteria 2842
46 Ga0070709_10000696 3300005434 Bacteria 19120
47 Ga0070709_10011808 3300005434 Bacteria 4878
48 Ga0070709_10014114 3300005434 Bacteria 4511
49 Ga0070714_100000012 3300005435 Bacteria 226258
50 Ga0070714_100088519 3300005435 Bacteria 2709
51 Ga0070713_100031187 3300005436 Bacteria 4243
52 Ga0070710_10010715 3300005437 Bacteria 4508
53 Ga0070710_10041043 3300005437 Bacteria 2552
54 Ga0070711_100004803 3300005439 Bacteria 8013
55 Ga0070711_100038991 3300005439 Bacteria 3197
56 Ga0070711_100118850 3300005439 Bacteria 1951
57 Ga0070694_100051329 3300005444 Bacteria 2783
58 Ga0070708_100169119 3300005445 Bacteria 2040
59 Ga0070663_100003790 3300005455 Bacteria 8789
60 Ga0070663_100061352 3300005455 Bacteria 2708
61 Ga0070678_100016087 3300005456 Bacteria 4773
62 Ga0070681_10003063 3300005458 Bacteria 15501
63 Ga0070685_10035272 3300005466 Bacteria 2821
64 Ga0070707_100074225 3300005468 Bacteria 3280
65 Ga0070707_100139666 3300005468 Bacteria 2358
66 Ga0070699_100205298 3300005518 Bacteria 1753
67 Ga0070679_100002341 3300005530 Bacteria 17150
68 Ga0070684_100002989 3300005535 Bacteria 12583
69 Ga0068853_100032173 3300005539 Bacteria 4442
70 Ga0070672_100017136 3300005543 Bacteria 5208
71 Ga0070672_100216357 3300005543 Bacteria 1606
72 Ga0070672_100225304 3300005543 Bacteria 1573
73 Ga0070686_100039003 3300005544 Bacteria 2957
74 Ga0070695_100105702 3300005545 Bacteria 1903
75 Ga0070693_100003762 3300005547 Bacteria 7105
76 Ga0070693_100012396 3300005547 Bacteria 4313
77 Ga0070665_100000914 3300005548 Bacteria 37867
78 Ga0070665_100161395 3300005548 Bacteria 2244
79 Ga0070704_100111012 3300005549 Bacteria 2086
80 Ga0068855_100006610 3300005563 Bacteria 14085
81 Ga0068855_100007387 3300005563 Bacteria 13303
82 Ga0068855_100009838 3300005563 Bacteria 11535
83 Ga0068855_100064424 3300005563 Bacteria 4274
84 Ga0068855_100065057 3300005563 Bacteria 4251
85 Ga0068855_100161710 3300005563 Bacteria 2540
86 Ga0068855_100289162 3300005563 Bacteria 1817
87 Ga0070664_100010089 3300005564 Bacteria 7657
88 Ga0070664_100189924 3300005564 Bacteria 1830
89 Ga0068857_100001825 3300005577 Bacteria 17126
90 Ga0068857_100238892 3300005577 Bacteria 1663
91 Ga0068854_100012597 3300005578 Bacteria 5540
92 Ga0068856_100017394 3300005614 Bacteria 6968
93 Ga0068856_100029350 3300005614 Bacteria 5373
94 Ga0068856_100067818 3300005614 Bacteria 3526
95 Ga0068856_100069229 3300005614 Bacteria 3489
96 Ga0068856_100098280 3300005614 Bacteria 2917
97 Ga0068856_100126398 3300005614 Bacteria 2560
98 Ga0070702_100000113 3300005615 Bacteria 24389
99 Ga0068852_100004374 3300005616 Bacteria 9982
100 Ga0068852_100009980 3300005616 Bacteria 7065
101 Ga0068852_100070643 3300005616 Bacteria 3064
102 Ga0068859_100048050 3300005617 Bacteria 4287
103 Ga0068859_100094165 3300005617 Bacteria 3047
104 Ga0068864_100023109 3300005618 Bacteria 5221
105 Ga0068866_10010899 3300005718 Bacteria 3914
106 Ga0068851_10000020 3300005834 Bacteria 133551
107 Ga0068863_100001414 3300005841 Bacteria 23780
108 Ga0068863_100065426 3300005841 Bacteria 3439
109 Ga0068858_100001345 3300005842 Bacteria 25360
110 Ga0068858_100023362 3300005842 Bacteria 5760
111 Ga0068858_100112997 3300005842 Bacteria 2536
112 Ga0068860_100000043 3300005843 Bacteria 225862
113 Ga0068860_100186769 3300005843 Bacteria 2005
114 Ga0081455_10025487 3300005937 Bacteria 5456
115 Ga0081455_10043090 3300005937 Bacteria 3953
116 Ga0081538_10000110 3300005981 Bacteria 81874
117 Ga0081540_1002596 3300005983 Bacteria 14676
118 Ga0081540_1003581 3300005983 Bacteria 12203
119 Ga0070717_10021333 3300006028 Bacteria 5102
120 Ga0070717_10039517 3300006028 Bacteria 3839
121 Ga0075365_10005491 3300006038 Bacteria 6843
122 Ga0075365_10024553 3300006038 Bacteria 3804
123 Ga0075365_10148524 3300006038 Bacteria 1630
124 Ga0075363_100079023 3300006048 Bacteria 1797
125 Ga0075364_10011400 3300006051 Bacteria 5401
126 Ga0075364_10011888 3300006051 Bacteria 5303
127 Ga0075364_10129890 3300006051 Bacteria 1690
128 Ga0075432_10004784 3300006058 Bacteria 4606
129 Ga0070716_100026138 3300006173 Bacteria 3123
130 Ga0070716_100038720 3300006173 Bacteria 2641
131 Ga0070712_100009411 3300006175 Bacteria 6157
132 Ga0070712_100013737 3300006175 Bacteria 5180
133 Ga0075362_10000644 3300006177 Bacteria 10241
134 Ga0075362_10014314 3300006177 Bacteria 3198
135 Ga0075369_10002657 3300006186 Bacteria 6399
136 Ga0075369_10008071 3300006186 Bacteria 4037
137 Ga0075366_10010352 3300006195 Bacteria 5235
138 Ga0075370_10019588 3300006353 Bacteria 3687
139 Ga0068871_100087630 3300006358 Bacteria 2589
140 Ga0075433_10213221 3300006852 Bacteria 1716
141 Ga0075434_100042058 3300006871 Bacteria 4529
142 Ga0097620_100048049 3300006931 Bacteria 4287
143 Ga0097620_100094170 3300006931 Bacteria 3047
144 Ga0105244_10002101 3300009036 Bacteria 15315
145 Ga0105244_10017272 3300009036 Bacteria 4082
146 Ga0105240_10002778 3300009093 Bacteria 27669
147 Ga0105240_10016936 3300009093 Bacteria 9850
148 Ga0105240_10019688 3300009093 Bacteria 9015
149 Ga0105240_10139690 3300009093 Bacteria 2897
150 Ga0105240_10425251 3300009093 Bacteria 1491
151 Ga0111539_10001321 3300009094 Bacteria 33126
152 Ga0111539_10214696 3300009094 Bacteria 2241
153 Ga0105245_10006395 3300009098 Bacteria 10365
154 Ga0105245_10009353 3300009098 Bacteria 8549
155 Ga0105245_10017818 3300009098 Bacteria 6200
156 Ga0105245_10030291 3300009098 Bacteria 4784
157 Ga0105245_10052103 3300009098 Bacteria 3670
158 Ga0105245_10058674 3300009098 Bacteria 3464
159 Ga0105247_10012967 3300009101 Bacteria 4997
160 Ga0114129_10377364 3300009147 Bacteria 1873
161 Ga0105243_10007769 3300009148 Bacteria 8245
162 Ga0105243_10039114 3300009148 Bacteria 3696
163 Ga0105243_10093330 3300009148 Bacteria 2484
164 Ga0105243_10135954 3300009148 Bacteria 2091
165 Ga0105243_10174873 3300009148 Bacteria 1863
166 Ga0105241_10000285 3300009174 Bacteria 37695
167 Ga0105241_10021063 3300009174 Bacteria 4820
168 Ga0105241_10183247 3300009174 Bacteria 1738
169 Ga0105241_10239430 3300009174 Bacteria 1533
170 Ga0105242_10017332 3300009176 Bacteria 5610
171 Ga0105242_10018016 3300009176 Bacteria 5516
172 Ga0105248_10007135 3300009177 Bacteria 12249
173 Ga0105248_10262257 3300009177 Bacteria 1945
174 Ga0105237_10001300 3300009545 Bacteria 33250
175 Ga0105237_10076283 3300009545 Bacteria 3343
176 Ga0105237_10086749 3300009545 Bacteria 3120
177 Ga0105237_10155543 3300009545 Bacteria 2283
178 Ga0105238_10011322 3300009551 Bacteria 8973
179 Ga0105238_10186967 3300009551 Bacteria 2048
180 Ga0105249_10035707 3300009553 Bacteria 4507
181 Ga0105249_10104861 3300009553 Bacteria 2664
182 Ga0105249_10129544 3300009553 Bacteria 2407
183 Ga0105239_10006959 3300010375 Bacteria 13029
184 Ga0105239_10071813 3300010375 Bacteria 3803
185 Ga0105239_10170809 3300010375 Bacteria 2431
186 Ga0105239_10171609 3300010375 Bacteria 2425
187 Ga0105239_10336601 3300010375 Bacteria 1703
188 Ga0105246_10000311 3300011119 Bacteria 25825
189 Ga0105246_10000653 3300011119 Bacteria 19375
190 Ga0105246_10047159 3300011119 Bacteria 2941
191 Ga0157371_10002137 3300013102 Bacteria 19248
192 Ga0157371_10101690 3300013102 Bacteria 2039
193 Ga0157370_10001273 3300013104 Bacteria 31530
194 Ga0157370_10036533 3300013104 Bacteria 4767
195 Ga0157369_10003857 3300013105 Bacteria 17822
196 Ga0157369_10064865 3300013105 Bacteria 3932
197 Ga0157369_10094480 3300013105 Bacteria 3191
198 Ga0171462_1003 3300013250 Bacteria 853796
199 Ga0157374_10148599 3300013296 Bacteria 2277
200 Ga0157374_10243151 3300013296 Bacteria 1770
201 Ga0163162_10015489 3300013306 Bacteria 7452
202 Ga0163162_10054437 3300013306 Bacteria 4025
203 Ga0157372_10000025 3300013307 Bacteria 195491
204 Ga0157372_10109939 3300013307 Bacteria 3157
205 Ga0157375_10010156 3300013308 Bacteria 8282
206 Ga0157375_10083023 3300013308 Bacteria 3248
207 Ga0157375_10241795 3300013308 Bacteria 1965
208 Ga0157375_10348412 3300013308 Bacteria 1647
209 Ga0163163_10055231 3300014325 Bacteria 3925
210 Ga0163163_10100474 3300014325 Bacteria 2915
211 Ga0157377_10010797 3300014745 Bacteria 4533
212 Ga0157379_10020390 3300014968 Bacteria 5860
213 Ga0157379_10035121 3300014968 Bacteria 4470
214 Ga0157379_10046646 3300014968 Bacteria 3866
215 Ga0157379_10281069 3300014968 Bacteria 1515
216 Ga0183362_10010 3300015683 Bacteria 106392
217 Ga0163161_10023675 3300017792 Bacteria 4334
218 Ga0163161_10047901 3300017792 Bacteria 3086
219 Ga0197907_10914208 3300020069 Bacteria 2855
220 Ga0206354_11077811 3300020081 Bacteria 2521
221 Ga0206353_10393585 3300020082 Bacteria 21237
222 Ga0209566_100240 3300025225 Bacteria 52739
223 Ga0209674_100001 3300025226 Bacteria 4013750
224 Ga0209672_100006 3300025228 Bacteria 1004497
225 Ga0209147_103547 3300025229 Bacteria 2976
226 Ga0209563_100001 3300025230 Bacteria 4013775
227 Ga0209563_100215 3300025230 Bacteria 29781
228 Ga0207427_100010 3300025231 Bacteria 648610
229 Ga0209437_100216 3300025233 Bacteria 106353
230 Ga0209646_1000248 3300025246 Bacteria 54666
231 Ga0209677_100001 3300025253 Bacteria 4013787
232 Ga0209677_100951 3300025253 Bacteria 14103
233 Ga0209148_1000015 3300025254 Bacteria 850103
234 Ga0209148_1000731 3300025254 Bacteria 25734
235 Ga0209148_1006877 3300025254 Bacteria 2417
236 Ga0209233_1000001 3300025261 Bacteria 2992747
237 Ga0209455_1000013 3300025272 Bacteria 850103
238 Ga0209455_1001444 3300025272 Bacteria 10740
239 Ga0209130_1004326 3300025284 Bacteria 5458
240 Ga0209675_1010798 3300025291 Bacteria 3082
241 Ga0209676_1016487 3300025292 Bacteria 2663
242 Ga0207697_10001880 3300025315 Bacteria 11214
243 Ga0207697_10018919 3300025315 Bacteria 2822
244 Ga0207656_10000003 3300025321 Bacteria 771644
245 Ga0207655_1001340 3300025728 Bacteria 23144
246 Ga0207655_1013440 3300025728 Bacteria 4700
247 Ga0207655_1014313 3300025728 Bacteria 4492
248 Ga0207655_1023219 3300025728 Bacteria 3083
249 Ga0207655_1024469 3300025728 Bacteria 2958
250 Ga0207655_1035426 3300025728 Bacteria 2228
251 Ga0207710_10004994 3300025900 Bacteria 5746
252 Ga0207710_10049273 3300025900 Bacteria 1887
253 Ga0207688_10018777 3300025901 Bacteria 3761
254 Ga0207680_10015052 3300025903 Bacteria 4026
255 Ga0207647_10046217 3300025904 Bacteria 2713
256 Ga0207647_10046371 3300025904 Bacteria 2709
257 Ga0207645_10011404 3300025907 Bacteria 6070
258 Ga0207645_10108981 3300025907 Bacteria 1792
259 Ga0207643_10065782 3300025908 Bacteria 2077
260 Ga0207705_10000006 3300025909 Bacteria 657147
261 Ga0207705_10029732 3300025909 Bacteria 3895
262 Ga0207705_10097814 3300025909 Bacteria 2156
263 Ga0207654_10000003 3300025911 Bacteria 1030378
264 Ga0207654_10020288 3300025911 Bacteria 3521
265 Ga0207654_10053670 3300025911 Bacteria 2328
266 Ga0207654_10090465 3300025911 Bacteria 1864
267 Ga0207654_10098521 3300025911 Bacteria 1796
268 Ga0207707_10002791 3300025912 Bacteria 15576
269 Ga0207695_10001243 3300025913 Bacteria 43579
270 Ga0207695_10006991 3300025913 Bacteria 14485
271 Ga0207695_10060553 3300025913 Bacteria 3917
272 Ga0207671_10000002 3300025914 Bacteria 1144816
273 Ga0207671_10017364 3300025914 Bacteria 5551
274 Ga0207671_10038615 3300025914 Bacteria 3538
275 Ga0207671_10039960 3300025914 Bacteria 3473
276 Ga0207693_10002172 3300025915 Bacteria 17096
277 Ga0207693_10029023 3300025915 Bacteria 4372
278 Ga0207693_10185850 3300025915 Bacteria 1636
279 Ga0207660_10004954 3300025917 Bacteria 8675
280 Ga0207657_10010287 3300025919 Bacteria 9340
281 Ga0207657_10012590 3300025919 Bacteria 8338
282 Ga0207649_10006683 3300025920 Bacteria 6268
283 Ga0207652_10205837 3300025921 Bacteria 1771
284 Ga0207694_10000073 3300025924 Bacteria 118507
285 Ga0207694_10040301 3300025924 Bacteria 3595
286 Ga0207659_10004965 3300025926 Bacteria 8061
287 Ga0207687_10000517 3300025927 Bacteria 25969
288 Ga0207687_10005501 3300025927 Bacteria 8381
289 Ga0207687_10030771 3300025927 Bacteria 3622
290 Ga0207687_10046453 3300025927 Bacteria 3006
291 Ga0207664_10000003 3300025929 Bacteria 510966
292 Ga0207644_10033871 3300025931 Bacteria 3573
293 Ga0207644_10169578 3300025931 Bacteria 1703
294 Ga0207706_10031614 3300025933 Bacteria 4715
295 Ga0207706_10059806 3300025933 Bacteria 3355
296 Ga0207686_10021435 3300025934 Bacteria 3708
297 Ga0207709_10031539 3300025935 Bacteria 3096
298 Ga0207709_10038443 3300025935 Bacteria 2850
299 Ga0207709_10206223 3300025935 Bacteria 1407
300 Ga0207704_10062302 3300025938 Bacteria 2318
301 Ga0207665_10002334 3300025939 Bacteria 12818
302 Ga0207665_10037514 3300025939 Bacteria 3225
303 Ga0207665_10061257 3300025939 Bacteria 2550
304 Ga0207691_10010262 3300025940 Bacteria 8986
305 Ga0207691_10028775 3300025940 Bacteria 5200
306 Ga0207691_10194508 3300025940 Bacteria 1768
307 Ga0207711_10000352 3300025941 Bacteria 48788
308 Ga0207711_10015798 3300025941 Bacteria 6263
309 Ga0207689_10004967 3300025942 Bacteria 11979
310 Ga0207689_10012709 3300025942 Bacteria 7192
311 Ga0207661_10133637 3300025944 Bacteria 2128
312 Ga0207679_10053047 3300025945 Bacteria 2977
313 Ga0207679_10112492 3300025945 Bacteria 2152
314 Ga0207667_10004737 3300025949 Bacteria 16644
315 Ga0207712_10055698 3300025961 Bacteria 2783
316 Ga0207668_10027457 3300025972 Bacteria 3708
317 Ga0207658_10037729 3300025986 Bacteria 3475
318 Ga0207658_10145606 3300025986 Bacteria 1923
319 Ga0207658_10209832 3300025986 Bacteria 1631
320 Ga0207677_10011616 3300026023 Bacteria 5026
321 Ga0207677_10066786 3300026023 Bacteria 2516
322 Ga0207677_10172102 3300026023 Bacteria 1694
323 Ga0207703_10001586 3300026035 Bacteria 20579
324 Ga0207703_10018291 3300026035 Bacteria 5473
325 Ga0207639_10003804 3300026041 Bacteria 10163
326 Ga0207678_10005002 3300026067 Bacteria 11886
327 Ga0207702_10037241 3300026078 Bacteria 4071
328 Ga0207702_10041282 3300026078 Bacteria 3868
329 Ga0207702_10050239 3300026078 Bacteria 3520
330 Ga0207702_10122273 3300026078 Bacteria 2331
331 Ga0207702_10183678 3300026078 Bacteria 1927
332 Ga0207641_10006468 3300026088 Bacteria 9870
333 Ga0207641_10077654 3300026088 Bacteria 2874
334 Ga0207648_10119855 3300026089 Bacteria 2313
335 Ga0207676_10083152 3300026095 Bacteria 2606
336 Ga0207674_10001204 3300026116 Bacteria 33692
337 Ga0207674_10029619 3300026116 Bacteria 5763
338 Ga0207674_10091783 3300026116 Bacteria 3027
339 Ga0207675_100021179 3300026118 Bacteria 6057
340 Ga0207683_10003270 3300026121 Bacteria 14127
341 Ga0207683_10011750 3300026121 Bacteria 7472
342 Ga0207683_10019462 3300026121 Bacteria 5797
343 Ga0207698_10000464 3300026142 Bacteria 23539
344 Ga0207698_10002958 3300026142 Bacteria 10169
345 Ga0207698_10014721 3300026142 Bacteria 5210
346 Ga0268266_10001243 3300028379 Bacteria 31174
347 Ga0268266_10043615 3300028379 Bacteria 3834
348 Ga0268264_10000027 3300028381 Bacteria 440852
349 Ga0307515_10109140 3300028794 Bacteria 3253
350 Ga0265338_10000717 3300028800 Bacteria 56686
351 Ga0265338_10057924 3300028800 Bacteria 3424
352 Ga0265325_10004206 3300031241 Bacteria 9142
353 Ga0265325_10032071 3300031241 Bacteria 2807
354 Ga0265340_10001055 3300031247 Bacteria 15690
355 Ga0265339_10007115 3300031249 Bacteria 7265
356 Ga0265339_10042837 3300031249 Bacteria 2505
357 Ga0265331_10031328 3300031250 Bacteria 2643
358 Ga0307408_100007066 3300031548 Bacteria 7426
359 Ga0307408_100009782 3300031548 Bacteria 6322
360 Ga0307408_100016396 3300031548 Bacteria 4944
361 Ga0307408_100028312 3300031548 Bacteria 3871
362 Ga0307408_100086337 3300031548 Bacteria 2358
363 Ga0307408_100152480 3300031548 Bacteria 1826
364 Ga0265313_10052123 3300031595 Bacteria 1955
365 Ga0265314_10029009 3300031711 Bacteria 4118
366 Ga0265342_10056102 3300031712 Bacteria 2336
367 Ga0316576_10000350 3300031727 Bacteria 20732
368 Ga0316576_10057225 3300031727 Bacteria 2849
369 Ga0307405_10011887 3300031731 Bacteria 4583
370 Ga0307405_10023558 3300031731 Bacteria 3501
371 Ga0307405_10029133 3300031731 Bacteria 3224
372 Ga0307405_10049026 3300031731 Bacteria 2608
373 Ga0307405_10061709 3300031731 Bacteria 2370
374 Ga0307405_10154322 3300031731 Bacteria 1618
375 Ga0307405_10176173 3300031731 Bacteria 1530
376 Ga0307413_10010627 3300031824 Bacteria 4481
377 Ga0307413_10012529 3300031824 Bacteria 4224
378 Ga0307413_10016823 3300031824 Bacteria 3792
379 Ga0307413_10033043 3300031824 Bacteria 2940
380 Ga0307413_10185149 3300031824 Bacteria 1489
381 Ga0307410_10001736 3300031852 Bacteria 10074
382 Ga0307410_10016463 3300031852 Bacteria 4410
383 Ga0307410_10017646 3300031852 Bacteria 4292
384 Ga0307410_10022344 3300031852 Bacteria 3908
385 Ga0307410_10043132 3300031852 Bacteria 2987
386 Ga0307410_10050352 3300031852 Bacteria 2801
387 Ga0307410_10080877 3300031852 Bacteria 2281
388 Ga0307406_10000034 3300031901 Bacteria 83739
389 Ga0307406_10000392 3300031901 Bacteria 25311
390 Ga0307406_10012680 3300031901 Bacteria 4807
391 Ga0307406_10029468 3300031901 Bacteria 3324
392 Ga0307406_10052020 3300031901 Bacteria 2603
393 Ga0307407_10008616 3300031903 Bacteria 4696
394 Ga0307407_10017688 3300031903 Bacteria 3585
395 Ga0307407_10069558 3300031903 Bacteria 2090
396 Ga0307407_10100975 3300031903 Bacteria 1790
397 Ga0307412_10000868 3300031911 Bacteria 17366
398 Ga0307412_10016411 3300031911 Bacteria 4411
399 Ga0307412_10019627 3300031911 Bacteria 4098
400 Ga0307412_10030768 3300031911 Bacteria 3384
401 Ga0307412_10073137 3300031911 Bacteria 2344
402 Ga0307412_10126902 3300031911 Bacteria 1846
403 Ga0307409_100001350 3300031995 Bacteria 11931
404 Ga0307409_100009337 3300031995 Bacteria 6019
405 Ga0307409_100044601 3300031995 Bacteria 3341
406 Ga0307416_100019022 3300032002 Bacteria 4858
407 Ga0307416_100064227 3300032002 Bacteria 3010
408 Ga0307416_100066631 3300032002 Bacteria 2965
409 Ga0307416_100095294 3300032002 Bacteria 2569
410 Ga0307416_100124090 3300032002 Bacteria 2309
411 Ga0307416_100175645 3300032002 Bacteria 2000
412 Ga0307416_100206303 3300032002 Bacteria 1870
413 Ga0307416_100292020 3300032002 Bacteria 1614
414 Ga0307414_10049282 3300032004 Bacteria 2911
415 Ga0307411_10022784 3300032005 Bacteria 3696
416 Ga0307411_10060135 3300032005 Bacteria 2521
417 Ga0307415_100009626 3300032126 Bacteria 5431
418 Ga0373923_0036629 3300035111 Bacteria 2004
419 Ga0373953_0017287 3300035117 Bacteria 2649
420 Ga0373943_0024788 3300035170 Bacteria 2800
421 Ga0373942_0013218 3300035207 Bacteria 1982
422 Ga0316574_0024039 3300035398 Bacteria 3643
423 Ga0316574_0058518 3300035398 Bacteria 2414
424 Ga0373935_0082051 3300035692 Bacteria 2097
425 Ga0316584_0010630 3300036712 Bacteria 6441
426 Ga0395899_0031249 3300037312 Bacteria 4003
427 Ga0395899_0049616 3300037312 Bacteria 3119
428 Ga0395899_0052909 3300037312 Bacteria 3008
429 Ga0395899_0070876 3300037312 Bacteria 2551
430 Ga0395899_0097879 3300037312 Bacteria 2120
431 Ga0395900_0023442 3300037418 Bacteria 6317
432 Ga0395900_0027560 3300037418 Bacteria 5821
433 Ga0395900_0031146 3300037418 Bacteria 5479
434 Ga0395900_0048579 3300037418 Bacteria 4371
435 Ga0395900_0049354 3300037418 Bacteria 4336
436 Ga0395900_0194492 3300037418 Bacteria 2055
437 Ga0395898_0000015 3300037466 Bacteria 439819
438 Ga0395898_0008364 3300037466 Bacteria 10938
439 Ga0395898_0010700 3300037466 Bacteria 9586
440 Ga0395898_0021565 3300037466 Bacteria 6530
441 Ga0395898_0049208 3300037466 Bacteria 4130
442 Ga0395898_0102772 3300037466 Bacteria 2743
443 Ga0395898_0229308 3300037466 Bacteria 1771
444 Ga0395905_0071058 3300037471 Bacteria 3263
445 Ga0395901_0005712 3300038443 Bacteria 12595
446 Ga0395901_0014744 3300038443 Bacteria 7945
447 Ga0395901_0026196 3300038443 Bacteria 5985
448 Ga0395901_0033857 3300038443 Bacteria 5276
449 Ga0395901_0104971 3300038443 Bacteria 2965
450 Ga0395901_0121139 3300038443 Bacteria 2749
451 Ga0395901_0136118 3300038443 Bacteria 2582
452 Ga0395901_0193483 3300038443 Bacteria 2133
453 Ga0395901_0211518 3300038443 Bacteria 2029
454 Ga0395901_0265716 3300038443 Bacteria 1785
455 Ga0439436_0000191 3300041404 Bacteria 14540
456 Ga0439436_0009512 3300041404 Bacteria 2979
457 Ga0439436_0018571 3300041404 Bacteria 2079
458 Ga0439439_0004216 3300041406 Bacteria 3225
459 Ga0439439_0005898 3300041406 Bacteria 2819
460 Ga0439466_0009633 3300041411 Bacteria 3611
461 Ga0439465_0026069 3300041413 Bacteria 1847
462 Ga0451806_009371 3300041462 Bacteria 1876
463 Ga0451853_3313517 3300041512 Bacteria 1453
464 Ga0439442_000053 3300042002 Bacteria 26463
465 Ga0439442_000228 3300042002 Bacteria 13801
466 Ga0439442_004449 3300042002 Bacteria 2782
467 Ga0439442_007220 3300042002 Bacteria 2234
468 Ga0439445_0005744 3300042004 Bacteria 2835
469 Ga0439432_005896 3300042006 Bacteria 4397
470 Ga0439432_030422 3300042006 Bacteria 1751
471 Ga0439449_0000387 3300042007 Bacteria 16320
472 Ga0439449_0006234 3300042007 Bacteria 4556
473 Ga0439449_0011604 3300042007 Bacteria 3313
474 Ga0439452_003748 3300042010 Bacteria 5237
475 Ga0439457_001930 3300042014 Bacteria 6106
476 Ga0439457_005001 3300042014 Bacteria 3393
477 Ga0439457_009687 3300042014 Bacteria 2237
478 Ga0439462_0000865 3300042015 Bacteria 6353
479 Ga0439462_0005085 3300042015 Bacteria 3226
480 Ga0450911_001576 3300042115 Bacteria 5153
481 Ga0450919_000400 3300042121 Bacteria 5289
482 Ga0450920_001058 3300042122 Bacteria 4507
483 Ga0450907_000157 3300042146 Bacteria 25405
484 Ga0439446_0020098 3300042156 Bacteria 1879
485 Ga0450908_002011 3300042184 Bacteria 3983
486 Ga0450909_000232 3300042185 Bacteria 6627
487 Ga0439434_0000258 3300042435 Bacteria 15001
488 Ga0439434_0006980 3300042435 Bacteria 3298
489 Ga0450918_003717 3300042531 Bacteria 2823
490 Ga0450893_0008043 3300042532 Bacteria 1716
491 Ga0466969_0055206 3300044656 Bacteria 1944
492 Ga0466972_0002555 3300044658 Bacteria 9008
493 Ga0466965_0000015 3300044683 Bacteria 81629
494 Ga0466965_0038086 3300044683 Bacteria 2362
495 Ga0466965_0039178 3300044683 Bacteria 2329
496 Ga0466966_0000651 3300044684 Bacteria 22101
497 Ga0466966_0016602 3300044684 Bacteria 4863
498 Ga0466966_0043624 3300044684 Bacteria 2874
499 Ga0466966_0078915 3300044684 Bacteria 2052
500 Ga0466961_0002633 3300044693 Bacteria 11150
501 Ga0466961_0021649 3300044693 Bacteria 4136
502 Ga0466961_0029915 3300044693 Bacteria 3498
503 Ga0466961_0042614 3300044693 Bacteria 2909
504 Ga0466961_0062165 3300044693 Bacteria 2373
505 Ga0466961_0081472 3300044693 Bacteria 2047
506 Ga0466961_0086138 3300044693 Bacteria 1986
507 Ga0466963_0005450 3300044694 Bacteria 7453
508 Ga0466963_0008471 3300044694 Bacteria 6162
509 Ga0466963_0018106 3300044694 Bacteria 4398
510 Ga0466963_0049742 3300044694 Bacteria 2773
511 Ga0466963_0074712 3300044694 Bacteria 2287
512 Ga0466963_0094457 3300044694 Bacteria 2039
513 Ga0466971_0026081 3300044719 Bacteria 2610
514 Ga0466971_0101217 3300044719 Bacteria 1324
515 Ga0466970_0000004 3300044765 Bacteria 108620
516 Ga0466970_0041981 3300044765 Bacteria 2432
517 Ga0466970_0098058 3300044765 Bacteria 1595
518 Ga0466957_0026793 3300044842 Bacteria 3421
519 Ga0466957_0059420 3300044842 Bacteria 2343
520 Ga0466960_0005621 3300044901 Bacteria 4975
521 Ga0466959_0013199 3300045049 Bacteria 5984
522 Ga0466958_0010879 3300045836 Bacteria 5109
523 Ga0466967_0000729 3300045976 Bacteria 16846
524 Ga0466967_0015629 3300045976 Bacteria 5956
525 Ga0466967_0016226 3300045976 Bacteria 5864
526 Ga0466967_0048514 3300045976 Bacteria 3708
527 Ga0466967_0076530 3300045976 Bacteria 3010
528 Ga0466967_0122350 3300045976 Bacteria 2406
529 Ga0466967_0134998 3300045976 Bacteria 2294
530 Ga0466967_0181017 3300045976 Bacteria 1988
531 Ga0466967_0194649 3300045976 Bacteria 1917
532 Ga0466967_0353215 3300045976 Bacteria 1423
533 Ga0495627_004139 3300046453 Bacteria 6156
534 Ga0495590_0000279 3300046457 Bacteria 27525
535 Ga0495629_0009176 3300046459 Bacteria 7242
536 Ga0495651_0006649 3300046462 Bacteria 8838
537 Ga0495653_0030356 3300046463 Bacteria 4306
538 Ga0495653_0042128 3300046463 Bacteria 3558
539 Ga0495650_0000763 3300046471 Bacteria 39830
540 Ga0495582_0101864 3300046473 Bacteria 1608
541 Ga0495639_0009546 3300046475 Bacteria 4164
542 Ga0495662_0022647 3300046476 Bacteria 3033
543 Ga0495664_0048062 3300046477 Bacteria 2533
544 Ga0495594_0012572 3300046499 Bacteria 4412
545 Ga0495628_0052851 3300046516 Bacteria 3208
546 Ga0495630_0037997 3300046517 Bacteria 3600
547 Ga0495643_0040276 3300046522 Bacteria 2552
548 Ga0495665_0001619 3300046531 Bacteria 12045
549 Ga0495640_0036300 3300046533 Bacteria 3482
550 Ga0495586_0010858 3300046535 Bacteria 4837
551 Ga0495587_0006448 3300046536 Bacteria 7648
552 Ga0495621_0007740 3300046539 Bacteria 3192
553 Ga0495645_0000761 3300046543 Bacteria 21999
554 Ga0495645_0070863 3300046543 Bacteria 2515
555 Ga0495645_0130917 3300046543 Bacteria 1758
556 Ga0495667_0002112 3300046559 Bacteria 13215
557 Ga0495656_0000193 3300046615 Bacteria 21880
558 Ga0495659_0027434 3300046664 Bacteria 1965
559 Ga0495588_0000869 3300046674 Bacteria 13347
560 Ga0495588_0004339 3300046674 Bacteria 6262
561 Ga0495657_0014449 3300046675 Bacteria 5797
562 Ga0495623_0025154 3300046679 Bacteria 3835
563 Ga0495646_0025391 3300046680 Bacteria 3726
564 Ga0495647_0019961 3300046681 Bacteria 2402
565 Ga0495658_0028888 3300046683 Bacteria 2997
566 Ga0495613_0030212 3300046689 Bacteria 4025
567 Ga0495613_0066177 3300046689 Bacteria 2639
568 Ga0495670_0015905 3300046691 Bacteria 3697
569 Ga0495670_0062585 3300046691 Bacteria 1872
570 Ga0495670_0087896 3300046691 Bacteria 1588
571 Ga0495581_0021314 3300047315 Bacteria 3757
572 Ga0495581_0098279 3300047315 Bacteria 1700
573 Ga0495672_0036431 3300047320 Bacteria 3021
574 Ga0495680_0020771 3300047322 Bacteria 5513
575 Ga0495680_0028340 3300047322 Bacteria 4593
576 Ga0495675_0020962 3300047444 Bacteria 4160
577 Ga0495593_0013931 3300047673 Bacteria 4581
578 Ga0495593_0092425 3300047673 Bacteria 1557
579 Ga0496100_0067631 3300048903 Bacteria 2373
580 Ga0496101_0002802 3300048904 Bacteria 10698
581 Ga0496101_0023516 3300048904 Bacteria 4258
582 Ga0496101_0103536 3300048904 Bacteria 2133
583 Ga0496102_0000110 3300048905 Bacteria 117178
584 Ga0496102_0000602 3300048905 Bacteria 37524
585 Ga0496102_0034601 3300048905 Bacteria 4544
586 Ga0496102_0089803 3300048905 Bacteria 2843
587 Ga0496102_0216999 3300048905 Bacteria 1803
588 Ga0496103_0000135 3300048906 Bacteria 77221
589 Ga0496103_0006592 3300048906 Bacteria 6924
590 Ga0496103_0007234 3300048906 Bacteria 6616
591 Ga0496103_0020706 3300048906 Bacteria 3954
592 Ga0496103_0115191 3300048906 Bacteria 1709
593 Ga0496103_0129614 3300048906 Bacteria 1610
594 Ga0496103_0173792 3300048906 Bacteria 1384
595 Ga0496104_0000407 3300048907 Bacteria 37689
596 Ga0496104_0021197 3300048907 Bacteria 5964
597 Ga0496104_0089625 3300048907 Bacteria 2938
598 Ga0496104_0201576 3300048907 Bacteria 1902
599 Ga0496105_0000185 3300048908 Bacteria 41781
600 Ga0496105_0016507 3300048908 Bacteria 5896
601 Ga0496105_0027352 3300048908 Bacteria 4658
602 Ga0496105_0047628 3300048908 Bacteria 3537
603 Ga0496105_0072736 3300048908 Bacteria 2841
604 Ga0496105_0106265 3300048908 Bacteria 2317
605 Ga0496106_0020317 3300048909 Bacteria 4929
606 Ga0496106_0027839 3300048909 Bacteria 4208
607 Ga0496106_0085263 3300048909 Bacteria 2432
608 Ga0496107_0031322 3300048910 Bacteria 3794
609 Ga0496107_0128502 3300048910 Bacteria 1870
610 Ga0496108_0001727 3300048911 Bacteria 17341
611 Ga0496108_0003760 3300048911 Bacteria 12156
612 Ga0496108_0009615 3300048911 Bacteria 7837
613 Ga0496108_0045121 3300048911 Bacteria 3680
614 Ga0496108_0066626 3300048911 Bacteria 3037
615 Ga0496108_0143878 3300048911 Bacteria 2055
616 Ga0496109_0002285 3300048912 Bacteria 15933
617 Ga0496109_0032839 3300048912 Bacteria 4668
618 Ga0496109_0035481 3300048912 Bacteria 4499
619 Ga0496109_0173239 3300048912 Bacteria 2025
620 Ga0496109_0176417 3300048912 Bacteria 2006
621 Ga0496110_0004627 3300048913 Bacteria 10690
622 Ga0496110_0028626 3300048913 Bacteria 4788
623 Ga0496110_0032811 3300048913 Bacteria 4488
624 Ga0496110_0056922 3300048913 Bacteria 3440
625 Ga0496110_0063531 3300048913 Bacteria 3262
626 Ga0496110_0221381 3300048913 Bacteria 1721
627 Ga0496111_0000336 3300048914 Bacteria 23420
628 Ga0496111_0003011 3300048914 Bacteria 10320
629 Ga0496111_0014853 3300048914 Bacteria 5329
630 Ga0496111_0035211 3300048914 Bacteria 3577
631 Ga0496111_0125307 3300048914 Bacteria 1898
632 Ga0496111_0160602 3300048914 Bacteria 1668
633 Ga0496112_0003509 3300048915 Bacteria 12998
634 Ga0496112_0042923 3300048915 Bacteria 4426
635 Ga0496112_0114729 3300048915 Bacteria 2664
636 Ga0496112_0153118 3300048915 Bacteria 2273
637 Ga0496112_0259724 3300048915 Bacteria 1686
638 Ga0496113_0005179 3300048916 Bacteria 8108
639 Ga0496113_0030869 3300048916 Bacteria 3884
640 Ga0496113_0031659 3300048916 Bacteria 3840
641 Ga0496113_0079464 3300048916 Bacteria 2511
642 Ga0496113_0164574 3300048916 Bacteria 1754
643 Ga0496114_0003212 3300048917 Bacteria 12535
644 Ga0496114_0038389 3300048917 Bacteria 3962
645 Ga0496114_0061362 3300048917 Bacteria 3144
646 Ga0496114_0146526 3300048917 Bacteria 2047
647 Ga0496115_0031536 3300048918 Bacteria 4177
648 Ga0496115_0065590 3300048918 Bacteria 2933
649 Ga0496115_0088953 3300048918 Bacteria 2521
650 Ga0496116_0010627 3300048919 Bacteria 7697
651 Ga0496117_0000232 3300048920 Bacteria 105479
652 Ga0496117_0001383 3300048920 Bacteria 35268
653 Ga0496117_0002730 3300048920 Bacteria 21670
654 Ga0496117_0007872 3300048920 Bacteria 10249
655 Ga0496117_0008761 3300048920 Bacteria 9547
656 Ga0496117_0019357 3300048920 Bacteria 5595
657 Ga0496117_0064537 3300048920 Bacteria 2496
658 Ga0496118_0000134 3300048921 Bacteria 130991
659 Ga0496118_0010662 3300048921 Bacteria 9065
660 Ga0496118_0012064 3300048921 Bacteria 8343
661 Ga0496118_0018385 3300048921 Bacteria 6310
662 Ga0496119_0001043 3300048922 Bacteria 35409
663 Ga0496119_0001189 3300048922 Bacteria 32563
664 Ga0496119_0001941 3300048922 Bacteria 23565
665 Ga0496119_0002335 3300048922 Bacteria 20883
666 Ga0496119_0005825 3300048922 Bacteria 11646
667 Ga0496119_0010849 3300048922 Bacteria 7619
668 Ga0496119_0034272 3300048922 Bacteria 3349
669 Ga0496120_0001174 3300048923 Bacteria 33434
670 Ga0496120_0001282 3300048923 Bacteria 31373
671 Ga0496120_0003000 3300048923 Bacteria 16025
672 Ga0496120_0003591 3300048923 Bacteria 13944
673 Ga0496120_0004696 3300048923 Bacteria 11275
674 Ga0496120_0010259 3300048923 Bacteria 6556
675 Ga0496120_0033941 3300048923 Bacteria 3061
676 Ga0496120_0038940 3300048923 Bacteria 2809
677 Ga0496120_0054212 3300048923 Bacteria 2274
678 Ga0496120_0075384 3300048923 Bacteria 1841
679 Ga0496121_0000040 3300048924 Bacteria 348494
680 Ga0496121_0017339 3300048924 Bacteria 7365
681 Ga0496121_0021940 3300048924 Bacteria 6228
682 Ga0496121_0097641 3300048924 Bacteria 2276
683 Ga0496122_0000030 3300048925 Bacteria 331586
684 Ga0496122_0002594 3300048925 Bacteria 25336
685 Ga0496122_0002595 3300048925 Bacteria 25327
686 Ga0496122_0004089 3300048925 Bacteria 18484
687 Ga0496122_0028059 3300048925 Bacteria 4792
688 Ga0496122_0035512 3300048925 Bacteria 4053
689 Ga0496122_0103048 3300048925 Bacteria 1900
690 Ga0496123_0000024 3300048926 Bacteria 331587
691 Ga0496123_0000051 3300048926 Bacteria 237095
692 Ga0496123_0001071 3300048926 Bacteria 41360
693 Ga0496123_0002826 3300048926 Bacteria 20537
694 Ga0496123_0011351 3300048926 Bacteria 7734
695 Ga0496123_0041459 3300048926 Bacteria 3191
696 Ga0496124_0000134 3300048927 Bacteria 153436
697 Ga0496124_0001836 3300048927 Bacteria 29326
698 Ga0496124_0007705 3300048927 Bacteria 11387
699 Ga0496124_0027988 3300048927 Bacteria 5047
700 Ga0496124_0072879 3300048927 Bacteria 2843
701 Ga0496125_0000097 3300048928 Bacteria 204607
702 Ga0496125_0004040 3300048928 Bacteria 17201
703 Ga0496125_0013210 3300048928 Bacteria 8134
704 Ga0496125_0040465 3300048928 Bacteria 3998
705 Ga0496125_0054205 3300048928 Bacteria 3279
706 Ga0496125_0089027 3300048928 Bacteria 2323
707 Ga0496125_0124967 3300048928 Bacteria 1825
708 Ga0496126_0000022 3300048929 Bacteria 464393
709 Ga0496126_0000072 3300048929 Bacteria 238130
710 Ga0496126_0002454 3300048929 Bacteria 25035
711 Ga0496126_0008783 3300048929 Bacteria 10845
712 Ga0496126_0014995 3300048929 Bacteria 7812
713 Ga0496126_0017351 3300048929 Bacteria 7174
714 Ga0496126_0040234 3300048929 Bacteria 4334
715 Ga0496126_0042259 3300048929 Bacteria 4210
716 Ga0496126_0083190 3300048929 Bacteria 2825
717 Ga0496126_0122079 3300048929 Bacteria 2258
718 Ga0501317_002004 3300049533 Bacteria 1859
719 Ga0501317_002136 3300049533 Bacteria 1824
720 Ga0501318_001580 3300049534 Bacteria 1824
721 Ga0501320_002124 3300049536 Bacteria 1556
722 Ga0501321_001697 3300049537 Bacteria 1804
723 Ga0501325_000901 3300049541 Bacteria 1652
724 Ga0501031_0021945 3300049568 Bacteria 4160
725 Ga0501031_0038829 3300049568 Bacteria 3106
726 Ga0501031_0052797 3300049568 Bacteria 2648
727 Ga0501031_0135650 3300049568 Bacteria 1608
728 Ga0501032_0000415 3300049569 Bacteria 35219
729 Ga0501032_0003113 3300049569 Bacteria 12794
730 Ga0501032_0006209 3300049569 Bacteria 8789
731 Ga0501033_0000989 3300049570 Bacteria 25877
732 Ga0501033_0007497 3300049570 Bacteria 8491
733 Ga0501033_0007920 3300049570 Bacteria 8230
734 Ga0501033_0053638 3300049570 Bacteria 2985
735 Ga0501033_0135847 3300049570 Bacteria 1779
736 Ga0501034_0000080 3300049571 Bacteria 170742
737 Ga0501034_0000227 3300049571 Bacteria 106244
738 Ga0501034_0016744 3300049571 Bacteria 7516
739 Ga0501034_0024191 3300049571 Bacteria 6177
740 Ga0501034_0081913 3300049571 Bacteria 3229
741 Ga0501034_0133511 3300049571 Bacteria 2464
742 Ga0501034_0170385 3300049571 Bacteria 2145
743 Ga0501034_0263120 3300049571 Bacteria 1667
744 Ga0501034_0289088 3300049571 Bacteria 1578
745 Ga0501036_0018043 3300049572 Bacteria 5907
746 Ga0501036_0194717 3300049572 Bacteria 1705
747 Ga0501037_0005467 3300049573 Bacteria 9255
748 Ga0501037_0008612 3300049573 Bacteria 7480
749 Ga0501037_0009463 3300049573 Bacteria 7153
750 Ga0501037_0013666 3300049573 Bacteria 5981
751 Ga0501037_0028173 3300049573 Bacteria 4150
752 Ga0501037_0044709 3300049573 Bacteria 3252
753 Ga0501037_0044714 3300049573 Bacteria 3252
754 Ga0501037_0060855 3300049573 Bacteria 2754
755 Ga0501037_0087970 3300049573 Bacteria 2248
756 Ga0501038_0007892 3300049574 Bacteria 9810
757 Ga0501038_0008532 3300049574 Bacteria 9415
758 Ga0501038_0010191 3300049574 Bacteria 8599
759 Ga0501038_0011798 3300049574 Bacteria 7974
760 Ga0501038_0037561 3300049574 Bacteria 4246
761 Ga0501038_0042844 3300049574 Bacteria 3940
762 Ga0501038_0185895 3300049574 Bacteria 1674
763 Ga0501039_0069270 3300049575 Bacteria 2739
764 Ga0501039_0157216 3300049575 Bacteria 1786
765 Ga0501039_0165801 3300049575 Bacteria 1737
766 Ga0501042_0046735 3300049578 Bacteria 3086
767 Ga0501043_0011547 3300049579 Bacteria 6914
768 Ga0501043_0016668 3300049579 Bacteria 5758
769 Ga0501043_0021039 3300049579 Bacteria 5115
770 Ga0501043_0022980 3300049579 Bacteria 4890
771 Ga0501043_0028906 3300049579 Bacteria 4351
772 Ga0501043_0063050 3300049579 Bacteria 2911
773 Ga0501043_0067160 3300049579 Bacteria 2816
774 Ga0501043_0082894 3300049579 Bacteria 2521
775 Ga0501043_0188474 3300049579 Bacteria 1605
776 Ga0501046_0001194 3300049580 Bacteria 25255
777 Ga0501046_0001908 3300049580 Bacteria 19798
778 Ga0501046_0012399 3300049580 Bacteria 7257
779 Ga0501046_0023076 3300049580 Bacteria 5123
780 Ga0501047_0000309 3300049581 Bacteria 56264
781 Ga0501047_0004842 3300049581 Bacteria 12644
782 Ga0501047_0008056 3300049581 Bacteria 9943
783 Ga0501047_0011123 3300049581 Bacteria 8517
784 Ga0501047_0035420 3300049581 Bacteria 4822
785 Ga0501047_0043307 3300049581 Bacteria 4348
786 Ga0501047_0332526 3300049581 Bacteria 1358
787 Ga0501048_0060787 3300049582 Bacteria 2677
788 Ga0501048_0115066 3300049582 Bacteria 1900
789 Ga0501067_0024323 3300049583 Bacteria 3360
790 Ga0501067_0049109 3300049583 Bacteria 2339
791 Ga0501069_0081399 3300049585 Bacteria 1824
792 Ga0501070_0000786 3300049586 Bacteria 28832
793 Ga0501070_0001897 3300049586 Bacteria 18498
794 Ga0501070_0002246 3300049586 Bacteria 16969
795 Ga0501070_0017879 3300049586 Bacteria 5953
796 Ga0501070_0026745 3300049586 Bacteria 4839
797 Ga0501070_0039757 3300049586 Bacteria 3922
798 Ga0501070_0049973 3300049586 Bacteria 3472
799 Ga0501070_0067754 3300049586 Bacteria 2956
800 Ga0501070_0133691 3300049586 Bacteria 2048
801 Ga0501071_0067192 3300049587 Bacteria 2607
802 Ga0501071_0150567 3300049587 Bacteria 1735
803 Ga0501072_0014137 3300049588 Bacteria 6116
804 Ga0501073_0000940 3300049589 Bacteria 20936
805 Ga0501073_0041524 3300049589 Bacteria 3250
806 Ga0501073_0048987 3300049589 Bacteria 2963
807 Ga0501075_0037513 3300049591 Bacteria 3621
808 Ga0501077_0042366 3300049593 Bacteria 2895
809 Ga0501077_0129384 3300049593 Bacteria 1601
810 Ga0501080_0091627 3300049742 Bacteria 2823
811 Ga0501081_0096409 3300049743 Bacteria 2086
812 Ga0501083_0000027 3300049744 Bacteria 117605
813 Ga0501083_0014487 3300049744 Bacteria 5514
814 Ga0501035_0001774 3300049822 Bacteria 21783
815 Ga0501035_0041081 3300049822 Bacteria 4177
816 Ga0501035_0105764 3300049822 Bacteria 2467
817 Ga0501035_0138189 3300049822 Bacteria 2120
818 Ga0501035_0156852 3300049822 Bacteria 1972
819 Ga0501044_0000673 3300049823 Bacteria 41320
820 Ga0501044_0004313 3300049823 Bacteria 15948
821 Ga0501044_0004715 3300049823 Bacteria 15235
822 Ga0501044_0006429 3300049823 Bacteria 12982
823 Ga0501044_0066604 3300049823 Bacteria 3671
824 Ga0501044_0067096 3300049823 Bacteria 3656
825 Ga0501044_0074344 3300049823 Bacteria 3453
826 Ga0501044_0138223 3300049823 Bacteria 2426
827 Ga0501045_0170402 3300049824 Bacteria 1621
828 nmdc:mga03683_604_c1 3300050489 Bacteria 10322
829 nmdc:mga03n38_7434_c2 3300050490 Bacteria 1830
830 nmdc:mga00v17_21027_c1 3300050491 Bacteria 3747
831 nmdc:mga00v17_23467_c1 3300050491 Bacteria 3568
832 nmdc:mga0yw44_103570_c1 3300050492 Bacteria 1815
833 nmdc:mga0yw44_23090_c1 3300050492 Bacteria 2915
834 nmdc:mga0k408_18971_c1 3300050493 Bacteria 3840
835 nmdc:mga07m45_35367_c1 3300050496 Bacteria 2778
836 nmdc:mga0rr50_59796_c1 3300050513 Bacteria 2863
837 nmdc:mga0a205_198854_c1 3300050515 Bacteria 1895
838 nmdc:mga0sz30_58841_c1 3300050516 Bacteria 1639
839 Ga0495601_0045057 3300053077 Bacteria 2773
840 Ga0500635_0000028 3300053080 Bacteria 104398
841 Ga0495655_0000392 3300053083 Bacteria 7423
842 Ga0495619_0055392 3300053085 Bacteria 2626
843 Ga0495619_0126318 3300053085 Bacteria 1755
844 Ga0500643_000334 3300053087 Bacteria 37718
845 Ga0500643_000401 3300053087 Bacteria 33175
846 Ga0500651_0000407 3300053093 Bacteria 23283
847 Ga0500641_0000776 3300053096 Bacteria 11565
848 Ga0500556_0000001 3300053104 Bacteria 1135060
849 Ga0500556_0000204 3300053104 Bacteria 48558
850 Ga0500562_000228 3300053108 Bacteria 14753
851 Ga0500593_000685 3300053117 Bacteria 12903
852 Ga0500655_001594 3300053133 Bacteria 4279
853 Ga0500559_0000218 3300053136 Bacteria 46051
854 Ga0500559_0000606 3300053136 Bacteria 24406
855 Ga0500559_0004381 3300053136 Bacteria 6723
856 Ga0500568_0000016 3300053139 Bacteria 217194
857 Ga0500568_0001477 3300053139 Bacteria 15057
858 Ga0500568_0005422 3300053139 Bacteria 6593
859 Ga0500568_0018308 3300053139 Bacteria 3068
860 Ga0500568_0022522 3300053139 Bacteria 2693
861 Ga0500568_0051655 3300053139 Bacteria 1616
862 Ga0500573_0000059 3300053140 Bacteria 71066
863 Ga0500573_0001660 3300053140 Bacteria 10796
864 Ga0500573_0002098 3300053140 Bacteria 9815
865 Ga0500616_0000540 3300053153 Bacteria 47313
866 Ga0500616_0001498 3300053153 Bacteria 22063
867 Ga0500616_0011514 3300053153 Bacteria 5216
868 Ga0501084_0092110 3300054114 Bacteria 2545
869 Ga0587072_008701 3300059643 Bacteria 1612
870 Ga0501082_0017799 3300060353 Bacteria 6121
871 Ga0466962_0008462 3300061719 Bacteria 4929
872 Ga0466962_0010274 3300061719 Bacteria 4495
873 Ga0466962_0022320 3300061719 Bacteria 3041
874 Ga0466962_0026584 3300061719 Bacteria 2778
875 2537898746 2537561592 Bacteria 4348607
876 2587862507 2585428094 Bacteria 3604039
877 2588108174 2585428157 Bacteria 3018951
878 2643733328 2643221542 Bacteria 3563959
879 2643753550 2643221546 Bacteria 2910897
880 2643767400 2643221549 Bacteria 4042819
881 2643786183 2643221553 Bacteria 3544260
882 2643848042 2643221566 Bacteria 3460379
883 2643874981 2643221572 Bacteria 3614809
884 2643885069 2643221575 Bacteria 4022601
885 2643995575 2643221597 Bacteria 3347721
886 2644083167 2643221613 Bacteria 4622396
887 2644097067 2643221616 Bacteria 4066575
888 2644110621 2643221619 Bacteria 4158469
889 2644169902 2643221630 Bacteria 3601215
890 2644183677 2643221632 Bacteria 3406696
891 2644199437 2643221635 Bacteria 2632343
892 2644279244 2643221649 Bacteria 3867359
893 2644382037 2643221669 Bacteria 3611286
894 2644665724 2643221721 Bacteria 4486924
895 2644680576 2643221724 Bacteria 3593515
896 2691513552 2690315906 Bacteria 4517044
897 2723642410 2721755702 Bacteria 4373124
898 2729906079 2728369276 Bacteria 5610032
899 2730230036 2728369380 Bacteria 3620317
900 2739250440 2738543013 Bacteria 5618633
901 2739326768 2738543027 Bacteria 6409078
902 2747954742 2747842429 Bacteria 3914386
903 2758227216 2757320536 Bacteria 3629334
904 2768644313 2767802112 Bacteria 6465194
905 2774381619 2773857758 Bacteria 3592392
906 2774384748 2773857759 Bacteria 2963774
907 2774399860 2773857763 Bacteria 4180068
908 2775656127 2775506735 Bacteria 4556596
909 2784471962 2784132109 Bacteria 3141763
910 2808631474 2808606306 Bacteria 3608896
911 2808830807 2808606357 Bacteria 4466944
912 2808851995 2808606360 Bacteria 4404006
913 2808879693 2808606366 Bacteria 4415912
914 2808885368 2808606368 Bacteria 3174172
915 2808890738 2808606370 Bacteria 4942454
916 2808896018 2808606371 Bacteria 4251511
917 2808902396 2808606372 Bacteria 4649509
918 2809227120 2808606447 Bacteria 3572005
919 2810365508 2808606700 Bacteria 3482157
920 2812321640 2811994871 Bacteria 4497550
921 2812322801 2811994872 Bacteria 4121241
922 2812364942 2811994880 Bacteria 4147780
923 2817509409 2816332305 Bacteria 2697803
924 2821269677 2821268502 Bacteria 3750023
925 2833710624 2833709550 Bacteria 4008291
926 2835188613 2835188231 Bacteria 3476928
927 2839989006 2839986021 Bacteria 3685650
928 2844842767 2844841374 Bacteria 3917147
929 2844852379 2844849076 Bacteria 4091819
930 2844855277 2844852863 Bacteria 3849151
931 2848552312 2848551377 Bacteria 3720646
932 2852633499 2852632344 Bacteria 3463163
933 2852645313 2852643534 Bacteria 3013378
934 2852648737 2852646457 Bacteria 3408613
935 2852666890 2852663356 Bacteria 4090475
936 2852679525 2852677369 Bacteria 3768884
937 2857480455 2857479173 Bacteria 2469263
938 2857634099 2857632687 Bacteria 2448521
939 2857712844 2857710386 Bacteria 3186771
940 2857720527 2857720070 Bacteria 3189373
941 2857724241 2857723135 Bacteria 4217853
942 2857732489 2857729791 Bacteria 4040535
943 2857735479 2857733635 Bacteria 3532004
944 2857740089 2857737099 Bacteria 3104305
945 2857744406 2857740372 Bacteria 4782044
946 2858872689 2858868258 Bacteria 7683772
947 2862996476 2862993130 Bacteria 3860849
948 2867351286 2867346516 Bacteria 7608576
949 2870623306 2870622029 Bacteria 3643329
950 2870630043 2870628048 Bacteria 3696012
951 2870802262 2870801768 Bacteria 2710986
952 2870804344 2870804320 Bacteria 2552467
953 2884765741 2884763398 Bacteria 4091164
954 2884995706 2884994152 Bacteria 4492978
955 2887446400 2887443736 Bacteria 4426037
956 2893684754 2893684298 Bacteria 2897960
957 2895661106 2895660088 Bacteria 3782833
958 2897563556 2897561785 Bacteria 3256946
959 2904433199 2904430863 Bacteria 3486923
960 2904501069 2904497146 Bacteria 4731781
961 2904502679 2904501621 Bacteria 3401437
962 2904512725 2904509784 Bacteria 3520416
963 2904778055 2904776348 Bacteria 4658726
964 2905927024 2905926851 Bacteria 4423176
965 2906800178 2906799679 Bacteria 4031749
966 2908677638 2908674828 Bacteria 3382763
967 2908681277 2908678064 Bacteria 3482747
968 2909075211 2909074476 Bacteria 3436050
969 2910813041 2910809715 Bacteria 4982797
970 2919038858 2919034639 Bacteria 4763403
971 2919040624 2919039151 Bacteria 3391018
972 2919043589 2919042368 Bacteria 3905917
973 2919051654 2919051321 Bacteria 4210889
974 2919058468 2919055335 Bacteria 3875751
975 2919062830 2919059106 Bacteria 4991624
976 2919071441 2919069694 Bacteria 3622919
977 2919393370 2919391150 Bacteria 4884741
978 2919398276 2919395869 Bacteria 3704152
979 2919445897 2919443155 Bacteria 4072969
980 2919524851 2919523602 Bacteria 3788128
981 2919542591 2919538618 Bacteria 4677069
982 2920882396 2920879853 Bacteria 4216831
983 2928078310 2928070936 Bacteria 8062541
984 2928092389 2928090899 Bacteria 3158267
985 2928108487 2928104781 Bacteria 3877447
986 2928122830 2928121344 Bacteria 3972376
987 2928156238 2928153084 Bacteria 4020257
988 2928501551 2928500415 Bacteria 3384541
989 2932430519 2932426870 Bacteria 4547726
990 2932434859 2932431166 Bacteria 4215299
991 2933421690 2933418574 Bacteria 4476724
992 2935412791 2935409751 Bacteria 4179611
993 2935894675 2935890801 Bacteria 4593001
994 2939600117 2939598168 Bacteria 4687164
995 2939651096 2939647034 Bacteria 4681660
996 2939657740 2939657138 Bacteria 3740283
997 2939660921 2939660829 Bacteria 3784848
998 2939678862 2939674588 Bacteria 4844420
999 2945919506 2945916053 Bacteria 4555517
1000 2945920380 2945920336 Bacteria 4501603
1001 2945943681 2945941187 Bacteria 4682474
1002 2945958135 2945956166 Bacteria 5110334
1003 2946004122 2946003308 Bacteria 3857229
1004 2946025446 2946024296 Bacteria 3508095
1005 2946033423 2946033335 Bacteria 3835514
1006 2946039654 2946037020 Bacteria 4900426
1007 2946044662 2946041624 Bacteria 4191385
1008 2946063230 2946059875 Bacteria 4386623
1009 2946080568 2946080515 Bacteria 4310960
1010 2954000879 2953998280 Bacteria 4812144
1011 2964326857 2964326757 Bacteria 3290868
1012 2966923351 2966921586 Bacteria 3092803
1013 2966924696 2966924647 Bacteria 3268643
1014 2974297745 2974294766 Bacteria 3767688
1015 2974303148 2974302888 Bacteria 4369871
1016 2974326021 2974324384 Bacteria 3750535
1017 2977230984 2977228692 Bacteria 3450105
1018 2977239779 2977236895 Bacteria 3569373
1019 2977253669 2977251589 Bacteria 2952848
1020 2984545948 2984542743 Bacteria 3569378
1021 2984553808 2984551494 Bacteria 3877562
1022 2984580845 2984580707 Bacteria 3351387
1023 2990049420 2990044586 Bacteria 6603797
1024 2995728259 2995726249 Bacteria 3470435
1025 8002812870 8002811521 Bacteria 2942897
1026 8004024144 8004021418 Bacteria 4313954
1027 8004184814 8004182704 Bacteria 3391155
1028 8004214414 8004212874 Bacteria 2861420
1029 8008489510 8008485437 Bacteria 7198341
1030 8016257921 8016254467 Bacteria 3797036
1031 8025528914 8025524527 Bacteria 7197316
1032 8033684929 8033684223 Bacteria 6906479
1033 8045830851 8045830549 Bacteria 4444727
1034 8046356165 8046352972 Bacteria 3613806
1035 8055035722 8055034563 Bacteria 3562128
1036 8055038721 8055037949 Bacteria 3337834
1037 8056037791 8056037122 Bacteria 3854319
1038 8056583741 8056579771 Bacteria 5840325
1039 8057349076 8057345674 Bacteria 4160394
1040 Ga0501034_0052702
1041 JGI24735J21928_10006502
1042 JGI24735J21928_10013802
1043 JGI25154J39366_1002688
1044 JGI25164J39214_1000379
1045 JGI25165J46597_1000004
1046 Ga0006562J51391_1021896
1047 Ga0006562J51391_1082829
1048 Ga0006562J51391_1131020
1049 Ga0006562J51391_1131021
1050 Ga0055539_1000005
1051 Ga0055539_1002881
1052 Ga0055533_1000001
1053 Ga0055525_1000297
1054 Ga0055527_1000001
1055 Ga0055529_1000019
1056 Ga0055534_1002138
1057 Ga0055541_1001174
1058 Ga0065714_10010373
1059 Ga0070658_10000616
1060 Ga0070658_10009207
1061 Ga0070658_10015628
1062 Ga0070658_10015836
1063 Ga0070683_100019962
1064 Ga0068869_100001475
1065 Ga0068869_100071046
1066 Ga0070666_10020796
1067 Ga0070666_10022178
1068 Ga0070680_100005277
1069 Ga0070680_100031263
1070 Ga0070682_100010564
1071 Ga0070682_100031338
1072 Ga0068868_100005820
1073 Ga0068868_100133319
1074 Ga0070660_100088778
1075 Ga0070689_100070071
1076 Ga0070661_100050100
1077 Ga0070669_100022907
1078 Ga0070675_100014554
1079 Ga0070671_100001939
1080 Ga0070671_100074945
1081 Ga0070659_100089072
1082 Ga0070667_100007740
1083 Ga0070667_100023777
1084 Ga0070667_100077303
1085 Ga0070709_10000696
1086 Ga0070709_10011808
1087 Ga0070709_10014114
1088 Ga0070714_100000012
1089 Ga0070714_100088519
1090 Ga0070713_100031187
1091 Ga0070710_10010715
1092 Ga0070710_10041043
1093 Ga0070711_100004803
1094 Ga0070711_100038991
1095 Ga0070711_100118850
1096 Ga0070694_100051329
1097 Ga0070708_100169119
1098 Ga0070663_100003790
1099 Ga0070663_100061352
1100 Ga0070678_100016087
1101 Ga0070681_10003063
1102 Ga0070685_10035272
1103 Ga0070707_100074225
1104 Ga0070707_100139666
1105 Ga0070699_100205298
1106 Ga0070679_100002341
1107 Ga0070684_100002989
1108 Ga0068853_100032173
1109 Ga0070672_100017136
1110 Ga0070672_100216357
1111 Ga0070672_100225304
1112 Ga0070686_100039003
1113 Ga0070695_100105702
1114 Ga0070693_100003762
1115 Ga0070693_100012396
1116 Ga0070665_100000914
1117 Ga0070665_100161395
1118 Ga0070704_100111012
1119 Ga0068855_100006610
1120 Ga0068855_100007387
1121 Ga0068855_100009838
1122 Ga0068855_100064424
1123 Ga0068855_100065057
1124 Ga0068855_100161710
1125 Ga0068855_100289162
1126 Ga0070664_100010089
1127 Ga0070664_100189924
1128 Ga0068857_100001825
1129 Ga0068857_100238892
1130 Ga0068854_100012597
1131 Ga0068856_100017394
1132 Ga0068856_100029350
1133 Ga0068856_100067818
1134 Ga0068856_100069229
1135 Ga0068856_100098280
1136 Ga0068856_100126398
1137 Ga0070702_100000113
1138 Ga0068852_100004374
1139 Ga0068852_100009980
1140 Ga0068852_100070643
1141 Ga0068859_100048050
1142 Ga0068859_100094165
1143 Ga0068864_100023109
1144 Ga0068866_10010899
1145 Ga0068851_10000020
1146 Ga0068863_100001414
1147 Ga0068863_100065426
1148 Ga0068858_100001345
1149 Ga0068858_100023362
1150 Ga0068858_100112997
1151 Ga0068860_100000043
1152 Ga0068860_100186769
1153 Ga0081455_10025487
1154 Ga0081455_10043090
1155 Ga0081538_10000110
1156 Ga0081540_1002596
1157 Ga0081540_1003581
1158 Ga0070717_10021333
1159 Ga0070717_10039517
1160 Ga0075365_10005491
1161 Ga0075365_10024553
1162 Ga0075365_10148524
1163 Ga0075363_100079023
1164 Ga0075364_10011400
1165 Ga0075364_10011888
1166 Ga0075364_10129890
1167 Ga0075432_10004784
1168 Ga0070716_100026138
1169 Ga0070716_100038720
1170 Ga0070712_100009411
1171 Ga0070712_100013737
1172 Ga0075362_10000644
1173 Ga0075362_10014314
1174 Ga0075369_10002657
1175 Ga0075369_10008071
1176 Ga0075366_10010352
1177 Ga0075370_10019588
1178 Ga0068871_100087630
1179 Ga0075433_10213221
1180 Ga0075434_100042058
1181 Ga0097620_100048049
1182 Ga0097620_100094170
1183 Ga0105244_10002101
1184 Ga0105244_10017272
1185 Ga0105240_10002778
1186 Ga0105240_10016936
1187 Ga0105240_10019688
1188 Ga0105240_10139690
1189 Ga0105240_10425251
1190 Ga0111539_10001321
1191 Ga0111539_10214696
1192 Ga0105245_10006395
1193 Ga0105245_10009353
1194 Ga0105245_10017818
1195 Ga0105245_10030291
1196 Ga0105245_10052103
1197 Ga0105245_10058674
1198 Ga0105247_10012967
1199 Ga0114129_10377364
1200 Ga0105243_10007769
1201 Ga0105243_10039114
1202 Ga0105243_10093330
1203 Ga0105243_10135954
1204 Ga0105243_10174873
1205 Ga0105241_10000285
1206 Ga0105241_10021063
1207 Ga0105241_10183247
1208 Ga0105241_10239430
1209 Ga0105242_10017332
1210 Ga0105242_10018016
1211 Ga0105248_10007135
1212 Ga0105248_10262257
1213 Ga0105237_10001300
1214 Ga0105237_10076283
1215 Ga0105237_10086749
1216 Ga0105237_10155543
1217 Ga0105238_10011322
1218 Ga0105238_10186967
1219 Ga0105249_10035707
1220 Ga0105249_10104861
1221 Ga0105249_10129544
1222 Ga0105239_10006959
1223 Ga0105239_10071813
1224 Ga0105239_10170809
1225 Ga0105239_10171609
1226 Ga0105239_10336601
1227 Ga0105246_10000311
1228 Ga0105246_10000653
1229 Ga0105246_10047159
1230 Ga0157371_10002137
1231 Ga0157371_10101690
1232 Ga0157370_10001273
1233 Ga0157370_10036533
1234 Ga0157369_10003857
1235 Ga0157369_10064865
1236 Ga0157369_10094480
1237 Ga0171462_1003
1238 Ga0157374_10148599
1239 Ga0157374_10243151
1240 Ga0163162_10015489
1241 Ga0163162_10054437
1242 Ga0157372_10000025
1243 Ga0157372_10109939
1244 Ga0157375_10010156
1245 Ga0157375_10083023
1246 Ga0157375_10241795
1247 Ga0157375_10348412
1248 Ga0163163_10055231
1249 Ga0163163_10100474
1250 Ga0157377_10010797
1251 Ga0157379_10020390
1252 Ga0157379_10035121
1253 Ga0157379_10046646
1254 Ga0157379_10281069
1255 Ga0183362_10010
1256 Ga0163161_10023675
1257 Ga0163161_10047901
1258 Ga0197907_10914208
1259 Ga0206354_11077811
1260 Ga0206353_10393585
1261 Ga0209566_100240
1262 Ga0209674_100001
1263 Ga0209672_100006
1264 Ga0209147_103547
1265 Ga0209563_100001
1266 Ga0209563_100215
1267 Ga0207427_100010
1268 Ga0209437_100216
1269 Ga0209646_1000248
1270 Ga0209677_100001
1271 Ga0209677_100951
1272 Ga0209148_1000015
1273 Ga0209148_1000731
1274 Ga0209148_1006877
1275 Ga0209233_1000001
1276 Ga0209455_1000013
1277 Ga0209455_1001444
1278 Ga0209130_1004326
1279 Ga0209675_1010798
1280 Ga0209676_1016487
1281 Ga0207697_10001880
1282 Ga0207697_10018919
1283 Ga0207656_10000003
1284 Ga0207655_1001340
1285 Ga0207655_1013440
1286 Ga0207655_1014313
1287 Ga0207655_1023219
1288 Ga0207655_1024469
1289 Ga0207655_1035426
1290 Ga0207710_10004994
1291 Ga0207710_10049273
1292 Ga0207688_10018777
1293 Ga0207680_10015052
1294 Ga0207647_10046217
1295 Ga0207647_10046371
1296 Ga0207645_10011404
1297 Ga0207645_10108981
1298 Ga0207643_10065782
1299 Ga0207705_10000006
1300 Ga0207705_10029732
1301 Ga0207705_10097814
1302 Ga0207654_10000003
1303 Ga0207654_10020288
1304 Ga0207654_10053670
1305 Ga0207654_10090465
1306 Ga0207654_10098521
1307 Ga0207707_10002791
1308 Ga0207695_10001243
1309 Ga0207695_10006991
1310 Ga0207695_10060553
1311 Ga0207671_10000002
1312 Ga0207671_10017364
1313 Ga0207671_10038615
1314 Ga0207671_10039960
1315 Ga0207693_10002172
1316 Ga0207693_10029023
1317 Ga0207693_10185850
1318 Ga0207660_10004954
1319 Ga0207657_10010287
1320 Ga0207657_10012590
1321 Ga0207649_10006683
1322 Ga0207652_10205837
1323 Ga0207694_10000073
1324 Ga0207694_10040301
1325 Ga0207659_10004965
1326 Ga0207687_10000517
1327 Ga0207687_10005501
1328 Ga0207687_10030771
1329 Ga0207687_10046453
1330 Ga0207664_10000003
1331 Ga0207644_10033871
1332 Ga0207644_10169578
1333 Ga0207706_10031614
1334 Ga0207706_10059806
1335 Ga0207686_10021435
1336 Ga0207709_10031539
1337 Ga0207709_10038443
1338 Ga0207709_10206223
1339 Ga0207704_10062302
1340 Ga0207665_10002334
1341 Ga0207665_10037514
1342 Ga0207665_10061257
1343 Ga0207691_10010262
1344 Ga0207691_10028775
1345 Ga0207691_10194508
1346 Ga0207711_10000352
1347 Ga0207711_10015798
1348 Ga0207689_10004967
1349 Ga0207689_10012709
1350 Ga0207661_10133637
1351 Ga0207679_10053047
1352 Ga0207679_10112492
1353 Ga0207667_10004737
1354 Ga0207712_10055698
1355 Ga0207668_10027457
1356 Ga0207658_10037729
1357 Ga0207658_10145606
1358 Ga0207658_10209832
1359 Ga0207677_10011616
1360 Ga0207677_10066786
1361 Ga0207677_10172102
1362 Ga0207703_10001586
1363 Ga0207703_10018291
1364 Ga0207639_10003804
1365 Ga0207678_10005002
1366 Ga0207702_10037241
1367 Ga0207702_10041282
1368 Ga0207702_10050239
1369 Ga0207702_10122273
1370 Ga0207702_10183678
1371 Ga0207641_10006468
1372 Ga0207641_10077654
1373 Ga0207648_10119855
1374 Ga0207676_10083152
1375 Ga0207674_10001204
1376 Ga0207674_10029619
1377 Ga0207674_10091783
1378 Ga0207675_100021179
1379 Ga0207683_10003270
1380 Ga0207683_10011750
1381 Ga0207683_10019462
1382 Ga0207698_10000464
1383 Ga0207698_10002958
1384 Ga0207698_10014721
1385 Ga0268266_10001243
1386 Ga0268266_10043615
1387 Ga0268264_10000027
1388 Ga0307515_10109140
1389 Ga0265338_10000717
1390 Ga0265338_10057924
1391 Ga0265325_10004206
1392 Ga0265325_10032071
1393 Ga0265340_10001055
1394 Ga0265339_10007115
1395 Ga0265339_10042837
1396 Ga0265331_10031328
1397 Ga0307408_100007066
1398 Ga0307408_100009782
1399 Ga0307408_100016396
1400 Ga0307408_100028312
1401 Ga0307408_100086337
1402 Ga0307408_100152480
1403 Ga0265313_10052123
1404 Ga0265314_10029009
1405 Ga0265342_10056102
1406 Ga0316576_10000350
1407 Ga0316576_10057225
1408 Ga0307405_10011887
1409 Ga0307405_10023558
1410 Ga0307405_10029133
1411 Ga0307405_10049026
1412 Ga0307405_10061709
1413 Ga0307405_10154322
1414 Ga0307405_10176173
1415 Ga0307413_10010627
1416 Ga0307413_10012529
1417 Ga0307413_10016823
1418 Ga0307413_10033043
1419 Ga0307413_10185149
1420 Ga0307410_10001736
1421 Ga0307410_10016463
1422 Ga0307410_10017646
1423 Ga0307410_10022344
1424 Ga0307410_10043132
1425 Ga0307410_10050352
1426 Ga0307410_10080877
1427 Ga0307406_10000034
1428 Ga0307406_10000392
1429 Ga0307406_10012680
1430 Ga0307406_10029468
1431 Ga0307406_10052020
1432 Ga0307407_10008616
1433 Ga0307407_10017688
1434 Ga0307407_10069558
1435 Ga0307407_10100975
1436 Ga0307412_10000868
1437 Ga0307412_10016411
1438 Ga0307412_10019627
1439 Ga0307412_10030768
1440 Ga0307412_10073137
1441 Ga0307412_10126902
1442 Ga0307409_100001350
1443 Ga0307409_100009337
1444 Ga0307409_100044601
1445 Ga0307416_100019022
1446 Ga0307416_100064227
1447 Ga0307416_100066631
1448 Ga0307416_100095294
1449 Ga0307416_100124090
1450 Ga0307416_100175645
1451 Ga0307416_100206303
1452 Ga0307416_100292020
1453 Ga0307414_10049282
1454 Ga0307411_10022784
1455 Ga0307411_10060135
1456 Ga0307415_100009626
1457 Ga0373923_0036629
1458 Ga0373953_0017287
1459 Ga0373943_0024788
1460 Ga0373942_0013218
1461 Ga0316574_0024039
1462 Ga0316574_0058518
1463 Ga0373935_0082051
1464 Ga0316584_0010630
1465 Ga0395899_0031249
1466 Ga0395899_0049616
1467 Ga0395899_0052909
1468 Ga0395899_0070876
1469 Ga0395899_0097879
1470 Ga0395900_0023442
1471 Ga0395900_0027560
1472 Ga0395900_0031146
1473 Ga0395900_0048579
1474 Ga0395900_0049354
1475 Ga0395900_0194492
1476 Ga0395898_0000015
1477 Ga0395898_0008364
1478 Ga0395898_0010700
1479 Ga0395898_0021565
1480 Ga0395898_0049208
1481 Ga0395898_0102772
1482 Ga0395898_0229308
1483 Ga0395905_0071058
1484 Ga0395901_0005712
1485 Ga0395901_0014744
1486 Ga0395901_0026196
1487 Ga0395901_0033857
1488 Ga0395901_0104971
1489 Ga0395901_0121139
1490 Ga0395901_0136118
1491 Ga0395901_0193483
1492 Ga0395901_0211518
1493 Ga0395901_0265716
1494 Ga0439436_0000191
1495 Ga0439436_0009512
1496 Ga0439436_0018571
1497 Ga0439439_0004216
1498 Ga0439439_0005898
1499 Ga0439466_0009633
1500 Ga0439465_0026069
1501 Ga0451806_009371
1502 Ga0451853_3313517
1503 Ga0439442_000053
1504 Ga0439442_000228
1505 Ga0439442_004449
1506 Ga0439442_007220
1507 Ga0439445_0005744
1508 Ga0439432_005896
1509 Ga0439432_030422
1510 Ga0439449_0000387
1511 Ga0439449_0006234
1512 Ga0439449_0011604
1513 Ga0439452_003748
1514 Ga0439457_001930
1515 Ga0439457_005001
1516 Ga0439457_009687
1517 Ga0439462_0000865
1518 Ga0439462_0005085
1519 Ga0450911_001576
1520 Ga0450919_000400
1521 Ga0450920_001058
1522 Ga0450907_000157
1523 Ga0439446_0020098
1524 Ga0450908_002011
1525 Ga0450909_000232
1526 Ga0439434_0000258
1527 Ga0439434_0006980
1528 Ga0450918_003717
1529 Ga0450893_0008043
1530 Ga0466969_0055206
1531 Ga0466972_0002555
1532 Ga0466965_0000015
1533 Ga0466965_0038086
1534 Ga0466965_0039178
1535 Ga0466966_0000651
1536 Ga0466966_0016602
1537 Ga0466966_0043624
1538 Ga0466966_0078915
1539 Ga0466961_0002633
1540 Ga0466961_0021649
1541 Ga0466961_0029915
1542 Ga0466961_0042614
1543 Ga0466961_0062165
1544 Ga0466961_0081472
1545 Ga0466961_0086138
1546 Ga0466963_0005450
1547 Ga0466963_0008471
1548 Ga0466963_0018106
1549 Ga0466963_0049742
1550 Ga0466963_0074712
1551 Ga0466963_0094457
1552 Ga0466971_0026081
1553 Ga0466971_0101217
1554 Ga0466970_0000004
1555 Ga0466970_0041981
1556 Ga0466970_0098058
1557 Ga0466957_0026793
1558 Ga0466957_0059420
1559 Ga0466960_0005621
1560 Ga0466959_0013199
1561 Ga0466958_0010879
1562 Ga0466967_0000729
1563 Ga0466967_0015629
1564 Ga0466967_0016226
1565 Ga0466967_0048514
1566 Ga0466967_0076530
1567 Ga0466967_0122350
1568 Ga0466967_0134998
1569 Ga0466967_0181017
1570 Ga0466967_0194649
1571 Ga0466967_0353215
1572 Ga0495627_004139
1573 Ga0495590_0000279
1574 Ga0495629_0009176
1575 Ga0495651_0006649
1576 Ga0495653_0030356
1577 Ga0495653_0042128
1578 Ga0495650_0000763
1579 Ga0495582_0101864
1580 Ga0495639_0009546
1581 Ga0495662_0022647
1582 Ga0495664_0048062
1583 Ga0495594_0012572
1584 Ga0495628_0052851
1585 Ga0495630_0037997
1586 Ga0495643_0040276
1587 Ga0495665_0001619
1588 Ga0495640_0036300
1589 Ga0495586_0010858
1590 Ga0495587_0006448
1591 Ga0495621_0007740
1592 Ga0495645_0000761
1593 Ga0495645_0070863
1594 Ga0495645_0130917
1595 Ga0495667_0002112
1596 Ga0495656_0000193
1597 Ga0495659_0027434
1598 Ga0495588_0000869
1599 Ga0495588_0004339
1600 Ga0495657_0014449
1601 Ga0495623_0025154
1602 Ga0495646_0025391
1603 Ga0495647_0019961
1604 Ga0495658_0028888
1605 Ga0495613_0030212
1606 Ga0495613_0066177
1607 Ga0495670_0015905
1608 Ga0495670_0062585
1609 Ga0495670_0087896
1610 Ga0495581_0021314
1611 Ga0495581_0098279
1612 Ga0495672_0036431
1613 Ga0495680_0020771
1614 Ga0495680_0028340
1615 Ga0495675_0020962
1616 Ga0495593_0013931
1617 Ga0495593_0092425
1618 Ga0496100_0067631
1619 Ga0496101_0002802
1620 Ga0496101_0023516
1621 Ga0496101_0103536
1622 Ga0496102_0000110
1623 Ga0496102_0000602
1624 Ga0496102_0034601
1625 Ga0496102_0089803
1626 Ga0496102_0216999
1627 Ga0496103_0000135
1628 Ga0496103_0006592
1629 Ga0496103_0007234
1630 Ga0496103_0020706
1631 Ga0496103_0115191
1632 Ga0496103_0129614
1633 Ga0496103_0173792
1634 Ga0496104_0000407
1635 Ga0496104_0021197
1636 Ga0496104_0089625
1637 Ga0496104_0201576
1638 Ga0496105_0000185
1639 Ga0496105_0016507
1640 Ga0496105_0027352
1641 Ga0496105_0047628
1642 Ga0496105_0072736
1643 Ga0496105_0106265
1644 Ga0496106_0020317
1645 Ga0496106_0027839
1646 Ga0496106_0085263
1647 Ga0496107_0031322
1648 Ga0496107_0128502
1649 Ga0496108_0001727
1650 Ga0496108_0003760
1651 Ga0496108_0009615
1652 Ga0496108_0045121
1653 Ga0496108_0066626
1654 Ga0496108_0143878
1655 Ga0496109_0002285
1656 Ga0496109_0032839
1657 Ga0496109_0035481
1658 Ga0496109_0173239
1659 Ga0496109_0176417
1660 Ga0496110_0004627
1661 Ga0496110_0028626
1662 Ga0496110_0032811
1663 Ga0496110_0056922
1664 Ga0496110_0063531
1665 Ga0496110_0221381
1666 Ga0496111_0000336
1667 Ga0496111_0003011
1668 Ga0496111_0014853
1669 Ga0496111_0035211
1670 Ga0496111_0125307
1671 Ga0496111_0160602
1672 Ga0496112_0003509
1673 Ga0496112_0042923
1674 Ga0496112_0114729
1675 Ga0496112_0153118
1676 Ga0496112_0259724
1677 Ga0496113_0005179
1678 Ga0496113_0030869
1679 Ga0496113_0031659
1680 Ga0496113_0079464
1681 Ga0496113_0164574
1682 Ga0496114_0003212
1683 Ga0496114_0038389
1684 Ga0496114_0061362
1685 Ga0496114_0146526
1686 Ga0496115_0031536
1687 Ga0496115_0065590
1688 Ga0496115_0088953
1689 Ga0496116_0010627
1690 Ga0496117_0000232
1691 Ga0496117_0001383
1692 Ga0496117_0002730
1693 Ga0496117_0007872
1694 Ga0496117_0008761
1695 Ga0496117_0019357
1696 Ga0496117_0064537
1697 Ga0496118_0000134
1698 Ga0496118_0010662
1699 Ga0496118_0012064
1700 Ga0496118_0018385
1701 Ga0496119_0001043
1702 Ga0496119_0001189
1703 Ga0496119_0001941
1704 Ga0496119_0002335
1705 Ga0496119_0005825
1706 Ga0496119_0010849
1707 Ga0496119_0034272
1708 Ga0496120_0001174
1709 Ga0496120_0001282
1710 Ga0496120_0003000
1711 Ga0496120_0003591
1712 Ga0496120_0004696
1713 Ga0496120_0010259
1714 Ga0496120_0033941
1715 Ga0496120_0038940
1716 Ga0496120_0054212
1717 Ga0496120_0075384
1718 Ga0496121_0000040
1719 Ga0496121_0017339
1720 Ga0496121_0021940
1721 Ga0496121_0097641
1722 Ga0496122_0000030
1723 Ga0496122_0002594
1724 Ga0496122_0002595
1725 Ga0496122_0004089
1726 Ga0496122_0028059
1727 Ga0496122_0035512
1728 Ga0496122_0103048
1729 Ga0496123_0000024
1730 Ga0496123_0000051
1731 Ga0496123_0001071
1732 Ga0496123_0002826
1733 Ga0496123_0011351
1734 Ga0496123_0041459
1735 Ga0496124_0000134
1736 Ga0496124_0001836
1737 Ga0496124_0007705
1738 Ga0496124_0027988
1739 Ga0496124_0072879
1740 Ga0496125_0000097
1741 Ga0496125_0004040
1742 Ga0496125_0013210
1743 Ga0496125_0040465
1744 Ga0496125_0054205
1745 Ga0496125_0089027
1746 Ga0496125_0124967
1747 Ga0496126_0000022
1748 Ga0496126_0000072
1749 Ga0496126_0002454
1750 Ga0496126_0008783
1751 Ga0496126_0014995
1752 Ga0496126_0017351
1753 Ga0496126_0040234
1754 Ga0496126_0042259
1755 Ga0496126_0083190
1756 Ga0496126_0122079
1757 Ga0501317_002004
1758 Ga0501317_002136
1759 Ga0501318_001580
1760 Ga0501320_002124
1761 Ga0501321_001697
1762 Ga0501325_000901
1763 Ga0501031_0021945
1764 Ga0501031_0038829
1765 Ga0501031_0052797
1766 Ga0501031_0135650
1767 Ga0501032_0000415
1768 Ga0501032_0003113
1769 Ga0501032_0006209
1770 Ga0501033_0000989
1771 Ga0501033_0007497
1772 Ga0501033_0007920
1773 Ga0501033_0053638
1774 Ga0501033_0135847
1775 Ga0501034_0000080
1776 Ga0501034_0000227
1777 Ga0501034_0016744
1778 Ga0501034_0024191
1779 Ga0501034_0081913
1780 Ga0501034_0133511
1781 Ga0501034_0170385
1782 Ga0501034_0263120
1783 Ga0501034_0289088
1784 Ga0501036_0018043
1785 Ga0501036_0194717
1786 Ga0501037_0005467
1787 Ga0501037_0008612
1788 Ga0501037_0009463
1789 Ga0501037_0013666
1790 Ga0501037_0028173
1791 Ga0501037_0044709
1792 Ga0501037_0044714
1793 Ga0501037_0060855
1794 Ga0501037_0087970
1795 Ga0501038_0007892
1796 Ga0501038_0008532
1797 Ga0501038_0010191
1798 Ga0501038_0011798
1799 Ga0501038_0037561
1800 Ga0501038_0042844
1801 Ga0501038_0185895
1802 Ga0501039_0069270
1803 Ga0501039_0157216
1804 Ga0501039_0165801
1805 Ga0501042_0046735
1806 Ga0501043_0011547
1807 Ga0501043_0016668
1808 Ga0501043_0021039
1809 Ga0501043_0022980
1810 Ga0501043_0028906
1811 Ga0501043_0063050
1812 Ga0501043_0067160
1813 Ga0501043_0082894
1814 Ga0501043_0188474
1815 Ga0501046_0001194
1816 Ga0501046_0001908
1817 Ga0501046_0012399
1818 Ga0501046_0023076
1819 Ga0501047_0000309
1820 Ga0501047_0004842
1821 Ga0501047_0008056
1822 Ga0501047_0011123
1823 Ga0501047_0035420
1824 Ga0501047_0043307
1825 Ga0501047_0332526
1826 Ga0501048_0060787
1827 Ga0501048_0115066
1828 Ga0501067_0024323
1829 Ga0501067_0049109
1830 Ga0501069_0081399
1831 Ga0501070_0000786
1832 Ga0501070_0001897
1833 Ga0501070_0002246
1834 Ga0501070_0017879
1835 Ga0501070_0026745
1836 Ga0501070_0039757
1837 Ga0501070_0049973
1838 Ga0501070_0067754
1839 Ga0501070_0133691
1840 Ga0501071_0067192
1841 Ga0501071_0150567
1842 Ga0501072_0014137
1843 Ga0501073_0000940
1844 Ga0501073_0041524
1845 Ga0501073_0048987
1846 Ga0501075_0037513
1847 Ga0501077_0042366
1848 Ga0501077_0129384
1849 Ga0501080_0091627
1850 Ga0501081_0096409
1851 Ga0501083_0000027
1852 Ga0501083_0014487
1853 Ga0501035_0001774
1854 Ga0501035_0041081
1855 Ga0501035_0105764
1856 Ga0501035_0138189
1857 Ga0501035_0156852
1858 Ga0501044_0000673
1859 Ga0501044_0004313
1860 Ga0501044_0004715
1861 Ga0501044_0006429
1862 Ga0501044_0066604
1863 Ga0501044_0067096
1864 Ga0501044_0074344
1865 Ga0501044_0138223
1866 Ga0501045_0170402
1867 nmdc:mga03683_604_c1
1868 nmdc:mga03n38_7434_c2
1869 nmdc:mga00v17_21027_c1
1870 nmdc:mga00v17_23467_c1
1871 nmdc:mga0yw44_103570_c1
1872 nmdc:mga0yw44_23090_c1
1873 nmdc:mga0k408_18971_c1
1874 nmdc:mga07m45_35367_c1
1875 nmdc:mga0rr50_59796_c1
1876 nmdc:mga0a205_198854_c1
1877 nmdc:mga0sz30_58841_c1
1878 Ga0495601_0045057
1879 Ga0500635_0000028
1880 Ga0495655_0000392
1881 Ga0495619_0055392
1882 Ga0495619_0126318
1883 Ga0500643_000334
1884 Ga0500643_000401
1885 Ga0500651_0000407
1886 Ga0500641_0000776
1887 Ga0500556_0000001
1888 Ga0500556_0000204
1889 Ga0500562_000228
1890 Ga0500593_000685
1891 Ga0500655_001594
1892 Ga0500559_0000218
1893 Ga0500559_0000606
1894 Ga0500559_0004381
1895 Ga0500568_0000016
1896 Ga0500568_0001477
1897 Ga0500568_0005422
1898 Ga0500568_0018308
1899 Ga0500568_0022522
1900 Ga0500568_0051655
1901 Ga0500573_0000059
1902 Ga0500573_0001660
1903 Ga0500573_0002098
1904 Ga0500616_0000540
1905 Ga0500616_0001498
1906 Ga0500616_0011514
1907 Ga0501084_0092110
1908 Ga0587072_008701
1909 Ga0501082_0017799
1910 Ga0466962_0008462
1911 Ga0466962_0010274
1912 Ga0466962_0022320
1913 Ga0466962_0026584
1914 2537898746
1915 2587862507
1916 2588108174
1917 2643733328
1918 2643753550
1919 2643767400
1920 2643786183
1921 2643848042
1922 2643874981
1923 2643885069
1924 2643995575
1925 2644083167
1926 2644097067
1927 2644110621
1928 2644169902
1929 2644183677
1930 2644199437
1931 2644279244
1932 2644382037
1933 2644665724
1934 2644680576
1935 2691513552
1936 2723642410
1937 2729906079
1938 2730230036
1939 2739250440
1940 2739326768
1941 2747954742
1942 2758227216
1943 2768644313
1944 2774381619
1945 2774384748
1946 2774399860
1947 2775656127
1948 2784471962
1949 2808631474
1950 2808830807
1951 2808851995
1952 2808879693
1953 2808885368
1954 2808890738
1955 2808896018
1956 2808902396
1957 2809227120
1958 2810365508
1959 2812321640
1960 2812322801
1961 2812364942
1962 2817509409
1963 2821269677
1964 2833710624
1965 2835188613
1966 2839989006
1967 2844842767
1968 2844852379
1969 2844855277
1970 2848552312
1971 2852633499
1972 2852645313
1973 2852648737
1974 2852666890
1975 2852679525
1976 2857480455
1977 2857634099
1978 2857712844
1979 2857720527
1980 2857724241
1981 2857732489
1982 2857735479
1983 2857740089
1984 2857744406
1985 2858872689
1986 2862996476
1987 2867351286
1988 2870623306
1989 2870630043
1990 2870802262
1991 2870804344
1992 2884765741
1993 2884995706
1994 2887446400
1995 2893684754
1996 2895661106
1997 2897563556
1998 2904433199
1999 2904501069
2000 2904502679
2001 2904512725
2002 2904778055
2003 2905927024
2004 2906800178
2005 2908677638
2006 2908681277
2007 2909075211
2008 2910813041
2009 2919038858
2010 2919040624
2011 2919043589
2012 2919051654
2013 2919058468
2014 2919062830
2015 2919071441
2016 2919393370
2017 2919398276
2018 2919445897
2019 2919524851
2020 2919542591
2021 2920882396
2022 2928078310
2023 2928092389
2024 2928108487
2025 2928122830
2026 2928156238
2027 2928501551
2028 2932430519
2029 2932434859
2030 2933421690
2031 2935412791
2032 2935894675
2033 2939600117
2034 2939651096
2035 2939657740
2036 2939660921
2037 2939678862
2038 2945919506
2039 2945920380
2040 2945943681
2041 2945958135
2042 2946004122
2043 2946025446
2044 2946033423
2045 2946039654
2046 2946044662
2047 2946063230
2048 2946080568
2049 2954000879
2050 2964326857
2051 2966923351
2052 2966924696
2053 2974297745
2054 2974303148
2055 2974326021
2056 2977230984
2057 2977239779
2058 2977253669
2059 2984545948
2060 2984553808
2061 2984580845
2062 2990049420
2063 2995728259
2064 8002812870
2065 8004024144
2066 8004184814
2067 8004214414
2068 8008489510
2069 8016257921
2070 8025528914
2071 8033684929
2072 8045830851
2073 8046356165
2074 8055035722
2075 8055038721
2076 8056037791
2077 8056583741
2078 8057349076

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01474

DAHP_synth_2

Class-II DAHP synthetase family

68

501

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e4n-assembly1.cif.gz_A-2 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis with d-tyrosine bound in the tyrosine and phenylalanine binding sites 0.9711 7 454
3kgf-assembly1.cif.gz_A-2 the structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis complexed with phenylalanine and tryptophan 0.9704 7 454
5huc-assembly1.cif.gz_A dahp synthase from corynebacterium glutamicum 0.9704 9 454
5e4n-assembly1.cif.gz_B-2 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis with d-tyrosine bound in the tyrosine and phenylalanine binding sites 0.9698 6 454
5ckv-assembly1.cif.gz_A-2 dahp synthase from mycobacterium tuberculosis, fully inhibited by tyrosine, phenylalanine, and tryptophan 0.9695 7 453
ID Description Score Start End Superfamily
af_O53512_218_462_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9827 214 453 3.20.20.70
2w1aB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9765 50 453 3.20.20.70
af_Q75LR2_294_535_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9692 217 453 3.20.20.70
2w1aB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9683 50 453 3.20.20.70
af_B4FZ59_134_526_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9653 67 454 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A349CYY1-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) 0.9996 361 455 GO:0003849
GO:0008652
GO:0009073
GO:0009423
AF-A0A528V3C7-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) 0.997 239 332 GO:0003849
GO:0009073
AF-A0A7K0LH42-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) 0.9968 245 453 GO:0003849
GO:0008652
GO:0009073
GO:0009423
AF-A0A367LY30-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) 0.9966 254 402 GO:0003849
GO:0009073
AF-A0A6B3EYB7-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) 0.996 272 410 GO:0003849
GO:0008652
GO:0009073
GO:0009423

Map