F488802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1039 | 538 | 2078 | 451 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0052702|Ga0501034_0052702_1042_2565 |
| Length | 507 |
| Sequence | MRGADGRSRVGRLPSEAVAVRDEIGRTARRQTPPTTASPTRQPMRTGTPPVLLDHSDPVVTADDSVIAGLDHWRTLEAKQQPAWPDADAARVAAEELATLPPLVFAGEVDQLRARMAAAAQGRAFLLQGGDCAETFAGATADQIRNRVKTVLQMAVVLTYGASVPVIKMGRMAGQFAKPRSSDTETRGEVSLPAYRGDMVNGYDFTPESRRADPRRLVQGYHTAASTLNLIRAFTQGGFADLREVHSWNRGFAQNPANQRYERLAREIDRAIKFMQAAGADFDELKRVEFYSSHEGLLMDYERAMTRIDSRTGTPYNTSAHFIWIGERTRQIDGAHVDFLSRVRNPIGVKLGPTTSADDMFRLIDKLDPTREPGRLTFITRMGAGKIRDALPPLLEAIKGHGATPLWVSDPMHGNGLTTPNGYKTRRFDDVVDEVKGFFEAHRDAGTIPGGIHVELTGDEVTECLGGSEHIDEATLATRYESLCDPRLNHMQSLELAFLVAEELGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 217 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 218 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 227 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 228 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 229 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 230 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 231 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 232 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 235 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 238 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 357 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 364 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 369 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 375 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 376 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 377 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 378 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 379 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 380 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 381 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 382 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 383 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 384 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 385 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 386 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 387 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 388 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 389 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 390 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 391 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 392 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 393 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 394 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 395 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 396 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 397 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 398 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 399 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 400 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 401 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 402 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 403 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 404 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 405 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 406 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 407 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 408 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 409 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 410 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 411 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 412 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 413 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 414 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 415 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 416 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 417 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 418 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 419 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 420 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 421 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 422 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 423 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 424 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 425 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 426 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 427 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 428 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 429 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 430 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 431 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 432 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 433 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 434 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 435 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 436 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 437 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 438 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 439 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 440 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 441 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 442 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 443 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 444 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 445 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 446 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 447 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 448 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 449 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 450 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 451 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 452 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 453 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 454 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 455 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 456 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 457 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 458 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 459 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 460 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 461 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 462 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 463 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 464 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 465 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 466 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 467 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 468 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 469 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 470 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 471 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 472 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 473 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 474 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 475 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 476 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 477 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 478 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 479 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 480 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 481 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 482 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 483 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 484 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 485 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 486 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 487 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 488 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 489 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 490 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 491 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 492 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 493 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 494 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 495 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 496 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 497 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 498 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 499 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 500 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 501 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 502 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 503 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 504 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 505 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 506 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 507 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 508 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 509 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 510 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 511 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 512 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 513 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 514 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 515 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 516 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 517 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 518 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 519 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 520 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 521 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 522 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 523 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 524 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 525 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 526 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 527 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 528 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 529 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 530 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 531 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 532 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 533 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 534 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 535 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 536 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 537 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 538 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.77 |
| Metatranscriptomes | 1.35 |
| Isolates | 15.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 7.31 |
| Nodule | 0 |
| Rhizoplane | 6.93 |
| Rhizosphere | 70.16 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0052702 | 3300049571 | Bacteria | 4098 |
| 2 | JGI24735J21928_10006502 | 3300002067 | Bacteria | 3845 |
| 3 | JGI24735J21928_10013802 | 3300002067 | Bacteria | 2534 |
| 4 | JGI25154J39366_1002688 | 3300002738 | Bacteria | 4344 |
| 5 | JGI25164J39214_1000379 | 3300002772 | Bacteria | 26416 |
| 6 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 7 | Ga0006562J51391_1021896 | 3300003578 | Bacteria | 2328 |
| 8 | Ga0006562J51391_1082829 | 3300003578 | Bacteria | 5917 |
| 9 | Ga0006562J51391_1131020 | 3300003578 | Bacteria | 7120 |
| 10 | Ga0006562J51391_1131021 | 3300003578 | Bacteria | 6500 |
| 11 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 12 | Ga0055539_1002881 | 3300003752 | Bacteria | 2512 |
| 13 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 14 | Ga0055525_1000297 | 3300003759 | Bacteria | 42949 |
| 15 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 16 | Ga0055529_1000019 | 3300003763 | Bacteria | 332786 |
| 17 | Ga0055534_1002138 | 3300003784 | Bacteria | 7076 |
| 18 | Ga0055541_1001174 | 3300003841 | Bacteria | 5847 |
| 19 | Ga0065714_10010373 | 3300005288 | Bacteria | 3932 |
| 20 | Ga0070658_10000616 | 3300005327 | Bacteria | 30727 |
| 21 | Ga0070658_10009207 | 3300005327 | Bacteria | 7938 |
| 22 | Ga0070658_10015628 | 3300005327 | Bacteria | 6071 |
| 23 | Ga0070658_10015836 | 3300005327 | Bacteria | 6029 |
| 24 | Ga0070683_100019962 | 3300005329 | Bacteria | 5956 |
| 25 | Ga0068869_100001475 | 3300005334 | Bacteria | 13926 |
| 26 | Ga0068869_100071046 | 3300005334 | Bacteria | 2577 |
| 27 | Ga0070666_10020796 | 3300005335 | Bacteria | 4245 |
| 28 | Ga0070666_10022178 | 3300005335 | Bacteria | 4121 |
| 29 | Ga0070680_100005277 | 3300005336 | Bacteria | 9772 |
| 30 | Ga0070680_100031263 | 3300005336 | Bacteria | 4280 |
| 31 | Ga0070682_100010564 | 3300005337 | Bacteria | 5240 |
| 32 | Ga0070682_100031338 | 3300005337 | Bacteria | 3215 |
| 33 | Ga0068868_100005820 | 3300005338 | Bacteria | 8691 |
| 34 | Ga0068868_100133319 | 3300005338 | Bacteria | 2035 |
| 35 | Ga0070660_100088778 | 3300005339 | Bacteria | 2435 |
| 36 | Ga0070689_100070071 | 3300005340 | Bacteria | 2736 |
| 37 | Ga0070661_100050100 | 3300005344 | Bacteria | 3056 |
| 38 | Ga0070669_100022907 | 3300005353 | Bacteria | 4467 |
| 39 | Ga0070675_100014554 | 3300005354 | Bacteria | 6205 |
| 40 | Ga0070671_100001939 | 3300005355 | Bacteria | 15867 |
| 41 | Ga0070671_100074945 | 3300005355 | Bacteria | 2827 |
| 42 | Ga0070659_100089072 | 3300005366 | Bacteria | 2472 |
| 43 | Ga0070667_100007740 | 3300005367 | Bacteria | 8907 |
| 44 | Ga0070667_100023777 | 3300005367 | Bacteria | 5087 |
| 45 | Ga0070667_100077303 | 3300005367 | Bacteria | 2842 |
| 46 | Ga0070709_10000696 | 3300005434 | Bacteria | 19120 |
| 47 | Ga0070709_10011808 | 3300005434 | Bacteria | 4878 |
| 48 | Ga0070709_10014114 | 3300005434 | Bacteria | 4511 |
| 49 | Ga0070714_100000012 | 3300005435 | Bacteria | 226258 |
| 50 | Ga0070714_100088519 | 3300005435 | Bacteria | 2709 |
| 51 | Ga0070713_100031187 | 3300005436 | Bacteria | 4243 |
| 52 | Ga0070710_10010715 | 3300005437 | Bacteria | 4508 |
| 53 | Ga0070710_10041043 | 3300005437 | Bacteria | 2552 |
| 54 | Ga0070711_100004803 | 3300005439 | Bacteria | 8013 |
| 55 | Ga0070711_100038991 | 3300005439 | Bacteria | 3197 |
| 56 | Ga0070711_100118850 | 3300005439 | Bacteria | 1951 |
| 57 | Ga0070694_100051329 | 3300005444 | Bacteria | 2783 |
| 58 | Ga0070708_100169119 | 3300005445 | Bacteria | 2040 |
| 59 | Ga0070663_100003790 | 3300005455 | Bacteria | 8789 |
| 60 | Ga0070663_100061352 | 3300005455 | Bacteria | 2708 |
| 61 | Ga0070678_100016087 | 3300005456 | Bacteria | 4773 |
| 62 | Ga0070681_10003063 | 3300005458 | Bacteria | 15501 |
| 63 | Ga0070685_10035272 | 3300005466 | Bacteria | 2821 |
| 64 | Ga0070707_100074225 | 3300005468 | Bacteria | 3280 |
| 65 | Ga0070707_100139666 | 3300005468 | Bacteria | 2358 |
| 66 | Ga0070699_100205298 | 3300005518 | Bacteria | 1753 |
| 67 | Ga0070679_100002341 | 3300005530 | Bacteria | 17150 |
| 68 | Ga0070684_100002989 | 3300005535 | Bacteria | 12583 |
| 69 | Ga0068853_100032173 | 3300005539 | Bacteria | 4442 |
| 70 | Ga0070672_100017136 | 3300005543 | Bacteria | 5208 |
| 71 | Ga0070672_100216357 | 3300005543 | Bacteria | 1606 |
| 72 | Ga0070672_100225304 | 3300005543 | Bacteria | 1573 |
| 73 | Ga0070686_100039003 | 3300005544 | Bacteria | 2957 |
| 74 | Ga0070695_100105702 | 3300005545 | Bacteria | 1903 |
| 75 | Ga0070693_100003762 | 3300005547 | Bacteria | 7105 |
| 76 | Ga0070693_100012396 | 3300005547 | Bacteria | 4313 |
| 77 | Ga0070665_100000914 | 3300005548 | Bacteria | 37867 |
| 78 | Ga0070665_100161395 | 3300005548 | Bacteria | 2244 |
| 79 | Ga0070704_100111012 | 3300005549 | Bacteria | 2086 |
| 80 | Ga0068855_100006610 | 3300005563 | Bacteria | 14085 |
| 81 | Ga0068855_100007387 | 3300005563 | Bacteria | 13303 |
| 82 | Ga0068855_100009838 | 3300005563 | Bacteria | 11535 |
| 83 | Ga0068855_100064424 | 3300005563 | Bacteria | 4274 |
| 84 | Ga0068855_100065057 | 3300005563 | Bacteria | 4251 |
| 85 | Ga0068855_100161710 | 3300005563 | Bacteria | 2540 |
| 86 | Ga0068855_100289162 | 3300005563 | Bacteria | 1817 |
| 87 | Ga0070664_100010089 | 3300005564 | Bacteria | 7657 |
| 88 | Ga0070664_100189924 | 3300005564 | Bacteria | 1830 |
| 89 | Ga0068857_100001825 | 3300005577 | Bacteria | 17126 |
| 90 | Ga0068857_100238892 | 3300005577 | Bacteria | 1663 |
| 91 | Ga0068854_100012597 | 3300005578 | Bacteria | 5540 |
| 92 | Ga0068856_100017394 | 3300005614 | Bacteria | 6968 |
| 93 | Ga0068856_100029350 | 3300005614 | Bacteria | 5373 |
| 94 | Ga0068856_100067818 | 3300005614 | Bacteria | 3526 |
| 95 | Ga0068856_100069229 | 3300005614 | Bacteria | 3489 |
| 96 | Ga0068856_100098280 | 3300005614 | Bacteria | 2917 |
| 97 | Ga0068856_100126398 | 3300005614 | Bacteria | 2560 |
| 98 | Ga0070702_100000113 | 3300005615 | Bacteria | 24389 |
| 99 | Ga0068852_100004374 | 3300005616 | Bacteria | 9982 |
| 100 | Ga0068852_100009980 | 3300005616 | Bacteria | 7065 |
| 101 | Ga0068852_100070643 | 3300005616 | Bacteria | 3064 |
| 102 | Ga0068859_100048050 | 3300005617 | Bacteria | 4287 |
| 103 | Ga0068859_100094165 | 3300005617 | Bacteria | 3047 |
| 104 | Ga0068864_100023109 | 3300005618 | Bacteria | 5221 |
| 105 | Ga0068866_10010899 | 3300005718 | Bacteria | 3914 |
| 106 | Ga0068851_10000020 | 3300005834 | Bacteria | 133551 |
| 107 | Ga0068863_100001414 | 3300005841 | Bacteria | 23780 |
| 108 | Ga0068863_100065426 | 3300005841 | Bacteria | 3439 |
| 109 | Ga0068858_100001345 | 3300005842 | Bacteria | 25360 |
| 110 | Ga0068858_100023362 | 3300005842 | Bacteria | 5760 |
| 111 | Ga0068858_100112997 | 3300005842 | Bacteria | 2536 |
| 112 | Ga0068860_100000043 | 3300005843 | Bacteria | 225862 |
| 113 | Ga0068860_100186769 | 3300005843 | Bacteria | 2005 |
| 114 | Ga0081455_10025487 | 3300005937 | Bacteria | 5456 |
| 115 | Ga0081455_10043090 | 3300005937 | Bacteria | 3953 |
| 116 | Ga0081538_10000110 | 3300005981 | Bacteria | 81874 |
| 117 | Ga0081540_1002596 | 3300005983 | Bacteria | 14676 |
| 118 | Ga0081540_1003581 | 3300005983 | Bacteria | 12203 |
| 119 | Ga0070717_10021333 | 3300006028 | Bacteria | 5102 |
| 120 | Ga0070717_10039517 | 3300006028 | Bacteria | 3839 |
| 121 | Ga0075365_10005491 | 3300006038 | Bacteria | 6843 |
| 122 | Ga0075365_10024553 | 3300006038 | Bacteria | 3804 |
| 123 | Ga0075365_10148524 | 3300006038 | Bacteria | 1630 |
| 124 | Ga0075363_100079023 | 3300006048 | Bacteria | 1797 |
| 125 | Ga0075364_10011400 | 3300006051 | Bacteria | 5401 |
| 126 | Ga0075364_10011888 | 3300006051 | Bacteria | 5303 |
| 127 | Ga0075364_10129890 | 3300006051 | Bacteria | 1690 |
| 128 | Ga0075432_10004784 | 3300006058 | Bacteria | 4606 |
| 129 | Ga0070716_100026138 | 3300006173 | Bacteria | 3123 |
| 130 | Ga0070716_100038720 | 3300006173 | Bacteria | 2641 |
| 131 | Ga0070712_100009411 | 3300006175 | Bacteria | 6157 |
| 132 | Ga0070712_100013737 | 3300006175 | Bacteria | 5180 |
| 133 | Ga0075362_10000644 | 3300006177 | Bacteria | 10241 |
| 134 | Ga0075362_10014314 | 3300006177 | Bacteria | 3198 |
| 135 | Ga0075369_10002657 | 3300006186 | Bacteria | 6399 |
| 136 | Ga0075369_10008071 | 3300006186 | Bacteria | 4037 |
| 137 | Ga0075366_10010352 | 3300006195 | Bacteria | 5235 |
| 138 | Ga0075370_10019588 | 3300006353 | Bacteria | 3687 |
| 139 | Ga0068871_100087630 | 3300006358 | Bacteria | 2589 |
| 140 | Ga0075433_10213221 | 3300006852 | Bacteria | 1716 |
| 141 | Ga0075434_100042058 | 3300006871 | Bacteria | 4529 |
| 142 | Ga0097620_100048049 | 3300006931 | Bacteria | 4287 |
| 143 | Ga0097620_100094170 | 3300006931 | Bacteria | 3047 |
| 144 | Ga0105244_10002101 | 3300009036 | Bacteria | 15315 |
| 145 | Ga0105244_10017272 | 3300009036 | Bacteria | 4082 |
| 146 | Ga0105240_10002778 | 3300009093 | Bacteria | 27669 |
| 147 | Ga0105240_10016936 | 3300009093 | Bacteria | 9850 |
| 148 | Ga0105240_10019688 | 3300009093 | Bacteria | 9015 |
| 149 | Ga0105240_10139690 | 3300009093 | Bacteria | 2897 |
| 150 | Ga0105240_10425251 | 3300009093 | Bacteria | 1491 |
| 151 | Ga0111539_10001321 | 3300009094 | Bacteria | 33126 |
| 152 | Ga0111539_10214696 | 3300009094 | Bacteria | 2241 |
| 153 | Ga0105245_10006395 | 3300009098 | Bacteria | 10365 |
| 154 | Ga0105245_10009353 | 3300009098 | Bacteria | 8549 |
| 155 | Ga0105245_10017818 | 3300009098 | Bacteria | 6200 |
| 156 | Ga0105245_10030291 | 3300009098 | Bacteria | 4784 |
| 157 | Ga0105245_10052103 | 3300009098 | Bacteria | 3670 |
| 158 | Ga0105245_10058674 | 3300009098 | Bacteria | 3464 |
| 159 | Ga0105247_10012967 | 3300009101 | Bacteria | 4997 |
| 160 | Ga0114129_10377364 | 3300009147 | Bacteria | 1873 |
| 161 | Ga0105243_10007769 | 3300009148 | Bacteria | 8245 |
| 162 | Ga0105243_10039114 | 3300009148 | Bacteria | 3696 |
| 163 | Ga0105243_10093330 | 3300009148 | Bacteria | 2484 |
| 164 | Ga0105243_10135954 | 3300009148 | Bacteria | 2091 |
| 165 | Ga0105243_10174873 | 3300009148 | Bacteria | 1863 |
| 166 | Ga0105241_10000285 | 3300009174 | Bacteria | 37695 |
| 167 | Ga0105241_10021063 | 3300009174 | Bacteria | 4820 |
| 168 | Ga0105241_10183247 | 3300009174 | Bacteria | 1738 |
| 169 | Ga0105241_10239430 | 3300009174 | Bacteria | 1533 |
| 170 | Ga0105242_10017332 | 3300009176 | Bacteria | 5610 |
| 171 | Ga0105242_10018016 | 3300009176 | Bacteria | 5516 |
| 172 | Ga0105248_10007135 | 3300009177 | Bacteria | 12249 |
| 173 | Ga0105248_10262257 | 3300009177 | Bacteria | 1945 |
| 174 | Ga0105237_10001300 | 3300009545 | Bacteria | 33250 |
| 175 | Ga0105237_10076283 | 3300009545 | Bacteria | 3343 |
| 176 | Ga0105237_10086749 | 3300009545 | Bacteria | 3120 |
| 177 | Ga0105237_10155543 | 3300009545 | Bacteria | 2283 |
| 178 | Ga0105238_10011322 | 3300009551 | Bacteria | 8973 |
| 179 | Ga0105238_10186967 | 3300009551 | Bacteria | 2048 |
| 180 | Ga0105249_10035707 | 3300009553 | Bacteria | 4507 |
| 181 | Ga0105249_10104861 | 3300009553 | Bacteria | 2664 |
| 182 | Ga0105249_10129544 | 3300009553 | Bacteria | 2407 |
| 183 | Ga0105239_10006959 | 3300010375 | Bacteria | 13029 |
| 184 | Ga0105239_10071813 | 3300010375 | Bacteria | 3803 |
| 185 | Ga0105239_10170809 | 3300010375 | Bacteria | 2431 |
| 186 | Ga0105239_10171609 | 3300010375 | Bacteria | 2425 |
| 187 | Ga0105239_10336601 | 3300010375 | Bacteria | 1703 |
| 188 | Ga0105246_10000311 | 3300011119 | Bacteria | 25825 |
| 189 | Ga0105246_10000653 | 3300011119 | Bacteria | 19375 |
| 190 | Ga0105246_10047159 | 3300011119 | Bacteria | 2941 |
| 191 | Ga0157371_10002137 | 3300013102 | Bacteria | 19248 |
| 192 | Ga0157371_10101690 | 3300013102 | Bacteria | 2039 |
| 193 | Ga0157370_10001273 | 3300013104 | Bacteria | 31530 |
| 194 | Ga0157370_10036533 | 3300013104 | Bacteria | 4767 |
| 195 | Ga0157369_10003857 | 3300013105 | Bacteria | 17822 |
| 196 | Ga0157369_10064865 | 3300013105 | Bacteria | 3932 |
| 197 | Ga0157369_10094480 | 3300013105 | Bacteria | 3191 |
| 198 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 199 | Ga0157374_10148599 | 3300013296 | Bacteria | 2277 |
| 200 | Ga0157374_10243151 | 3300013296 | Bacteria | 1770 |
| 201 | Ga0163162_10015489 | 3300013306 | Bacteria | 7452 |
| 202 | Ga0163162_10054437 | 3300013306 | Bacteria | 4025 |
| 203 | Ga0157372_10000025 | 3300013307 | Bacteria | 195491 |
| 204 | Ga0157372_10109939 | 3300013307 | Bacteria | 3157 |
| 205 | Ga0157375_10010156 | 3300013308 | Bacteria | 8282 |
| 206 | Ga0157375_10083023 | 3300013308 | Bacteria | 3248 |
| 207 | Ga0157375_10241795 | 3300013308 | Bacteria | 1965 |
| 208 | Ga0157375_10348412 | 3300013308 | Bacteria | 1647 |
| 209 | Ga0163163_10055231 | 3300014325 | Bacteria | 3925 |
| 210 | Ga0163163_10100474 | 3300014325 | Bacteria | 2915 |
| 211 | Ga0157377_10010797 | 3300014745 | Bacteria | 4533 |
| 212 | Ga0157379_10020390 | 3300014968 | Bacteria | 5860 |
| 213 | Ga0157379_10035121 | 3300014968 | Bacteria | 4470 |
| 214 | Ga0157379_10046646 | 3300014968 | Bacteria | 3866 |
| 215 | Ga0157379_10281069 | 3300014968 | Bacteria | 1515 |
| 216 | Ga0183362_10010 | 3300015683 | Bacteria | 106392 |
| 217 | Ga0163161_10023675 | 3300017792 | Bacteria | 4334 |
| 218 | Ga0163161_10047901 | 3300017792 | Bacteria | 3086 |
| 219 | Ga0197907_10914208 | 3300020069 | Bacteria | 2855 |
| 220 | Ga0206354_11077811 | 3300020081 | Bacteria | 2521 |
| 221 | Ga0206353_10393585 | 3300020082 | Bacteria | 21237 |
| 222 | Ga0209566_100240 | 3300025225 | Bacteria | 52739 |
| 223 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 224 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 225 | Ga0209147_103547 | 3300025229 | Bacteria | 2976 |
| 226 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 227 | Ga0209563_100215 | 3300025230 | Bacteria | 29781 |
| 228 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 229 | Ga0209437_100216 | 3300025233 | Bacteria | 106353 |
| 230 | Ga0209646_1000248 | 3300025246 | Bacteria | 54666 |
| 231 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 232 | Ga0209677_100951 | 3300025253 | Bacteria | 14103 |
| 233 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 234 | Ga0209148_1000731 | 3300025254 | Bacteria | 25734 |
| 235 | Ga0209148_1006877 | 3300025254 | Bacteria | 2417 |
| 236 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 237 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 238 | Ga0209455_1001444 | 3300025272 | Bacteria | 10740 |
| 239 | Ga0209130_1004326 | 3300025284 | Bacteria | 5458 |
| 240 | Ga0209675_1010798 | 3300025291 | Bacteria | 3082 |
| 241 | Ga0209676_1016487 | 3300025292 | Bacteria | 2663 |
| 242 | Ga0207697_10001880 | 3300025315 | Bacteria | 11214 |
| 243 | Ga0207697_10018919 | 3300025315 | Bacteria | 2822 |
| 244 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 245 | Ga0207655_1001340 | 3300025728 | Bacteria | 23144 |
| 246 | Ga0207655_1013440 | 3300025728 | Bacteria | 4700 |
| 247 | Ga0207655_1014313 | 3300025728 | Bacteria | 4492 |
| 248 | Ga0207655_1023219 | 3300025728 | Bacteria | 3083 |
| 249 | Ga0207655_1024469 | 3300025728 | Bacteria | 2958 |
| 250 | Ga0207655_1035426 | 3300025728 | Bacteria | 2228 |
| 251 | Ga0207710_10004994 | 3300025900 | Bacteria | 5746 |
| 252 | Ga0207710_10049273 | 3300025900 | Bacteria | 1887 |
| 253 | Ga0207688_10018777 | 3300025901 | Bacteria | 3761 |
| 254 | Ga0207680_10015052 | 3300025903 | Bacteria | 4026 |
| 255 | Ga0207647_10046217 | 3300025904 | Bacteria | 2713 |
| 256 | Ga0207647_10046371 | 3300025904 | Bacteria | 2709 |
| 257 | Ga0207645_10011404 | 3300025907 | Bacteria | 6070 |
| 258 | Ga0207645_10108981 | 3300025907 | Bacteria | 1792 |
| 259 | Ga0207643_10065782 | 3300025908 | Bacteria | 2077 |
| 260 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 261 | Ga0207705_10029732 | 3300025909 | Bacteria | 3895 |
| 262 | Ga0207705_10097814 | 3300025909 | Bacteria | 2156 |
| 263 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 264 | Ga0207654_10020288 | 3300025911 | Bacteria | 3521 |
| 265 | Ga0207654_10053670 | 3300025911 | Bacteria | 2328 |
| 266 | Ga0207654_10090465 | 3300025911 | Bacteria | 1864 |
| 267 | Ga0207654_10098521 | 3300025911 | Bacteria | 1796 |
| 268 | Ga0207707_10002791 | 3300025912 | Bacteria | 15576 |
| 269 | Ga0207695_10001243 | 3300025913 | Bacteria | 43579 |
| 270 | Ga0207695_10006991 | 3300025913 | Bacteria | 14485 |
| 271 | Ga0207695_10060553 | 3300025913 | Bacteria | 3917 |
| 272 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 273 | Ga0207671_10017364 | 3300025914 | Bacteria | 5551 |
| 274 | Ga0207671_10038615 | 3300025914 | Bacteria | 3538 |
| 275 | Ga0207671_10039960 | 3300025914 | Bacteria | 3473 |
| 276 | Ga0207693_10002172 | 3300025915 | Bacteria | 17096 |
| 277 | Ga0207693_10029023 | 3300025915 | Bacteria | 4372 |
| 278 | Ga0207693_10185850 | 3300025915 | Bacteria | 1636 |
| 279 | Ga0207660_10004954 | 3300025917 | Bacteria | 8675 |
| 280 | Ga0207657_10010287 | 3300025919 | Bacteria | 9340 |
| 281 | Ga0207657_10012590 | 3300025919 | Bacteria | 8338 |
| 282 | Ga0207649_10006683 | 3300025920 | Bacteria | 6268 |
| 283 | Ga0207652_10205837 | 3300025921 | Bacteria | 1771 |
| 284 | Ga0207694_10000073 | 3300025924 | Bacteria | 118507 |
| 285 | Ga0207694_10040301 | 3300025924 | Bacteria | 3595 |
| 286 | Ga0207659_10004965 | 3300025926 | Bacteria | 8061 |
| 287 | Ga0207687_10000517 | 3300025927 | Bacteria | 25969 |
| 288 | Ga0207687_10005501 | 3300025927 | Bacteria | 8381 |
| 289 | Ga0207687_10030771 | 3300025927 | Bacteria | 3622 |
| 290 | Ga0207687_10046453 | 3300025927 | Bacteria | 3006 |
| 291 | Ga0207664_10000003 | 3300025929 | Bacteria | 510966 |
| 292 | Ga0207644_10033871 | 3300025931 | Bacteria | 3573 |
| 293 | Ga0207644_10169578 | 3300025931 | Bacteria | 1703 |
| 294 | Ga0207706_10031614 | 3300025933 | Bacteria | 4715 |
| 295 | Ga0207706_10059806 | 3300025933 | Bacteria | 3355 |
| 296 | Ga0207686_10021435 | 3300025934 | Bacteria | 3708 |
| 297 | Ga0207709_10031539 | 3300025935 | Bacteria | 3096 |
| 298 | Ga0207709_10038443 | 3300025935 | Bacteria | 2850 |
| 299 | Ga0207709_10206223 | 3300025935 | Bacteria | 1407 |
| 300 | Ga0207704_10062302 | 3300025938 | Bacteria | 2318 |
| 301 | Ga0207665_10002334 | 3300025939 | Bacteria | 12818 |
| 302 | Ga0207665_10037514 | 3300025939 | Bacteria | 3225 |
| 303 | Ga0207665_10061257 | 3300025939 | Bacteria | 2550 |
| 304 | Ga0207691_10010262 | 3300025940 | Bacteria | 8986 |
| 305 | Ga0207691_10028775 | 3300025940 | Bacteria | 5200 |
| 306 | Ga0207691_10194508 | 3300025940 | Bacteria | 1768 |
| 307 | Ga0207711_10000352 | 3300025941 | Bacteria | 48788 |
| 308 | Ga0207711_10015798 | 3300025941 | Bacteria | 6263 |
| 309 | Ga0207689_10004967 | 3300025942 | Bacteria | 11979 |
| 310 | Ga0207689_10012709 | 3300025942 | Bacteria | 7192 |
| 311 | Ga0207661_10133637 | 3300025944 | Bacteria | 2128 |
| 312 | Ga0207679_10053047 | 3300025945 | Bacteria | 2977 |
| 313 | Ga0207679_10112492 | 3300025945 | Bacteria | 2152 |
| 314 | Ga0207667_10004737 | 3300025949 | Bacteria | 16644 |
| 315 | Ga0207712_10055698 | 3300025961 | Bacteria | 2783 |
| 316 | Ga0207668_10027457 | 3300025972 | Bacteria | 3708 |
| 317 | Ga0207658_10037729 | 3300025986 | Bacteria | 3475 |
| 318 | Ga0207658_10145606 | 3300025986 | Bacteria | 1923 |
| 319 | Ga0207658_10209832 | 3300025986 | Bacteria | 1631 |
| 320 | Ga0207677_10011616 | 3300026023 | Bacteria | 5026 |
| 321 | Ga0207677_10066786 | 3300026023 | Bacteria | 2516 |
| 322 | Ga0207677_10172102 | 3300026023 | Bacteria | 1694 |
| 323 | Ga0207703_10001586 | 3300026035 | Bacteria | 20579 |
| 324 | Ga0207703_10018291 | 3300026035 | Bacteria | 5473 |
| 325 | Ga0207639_10003804 | 3300026041 | Bacteria | 10163 |
| 326 | Ga0207678_10005002 | 3300026067 | Bacteria | 11886 |
| 327 | Ga0207702_10037241 | 3300026078 | Bacteria | 4071 |
| 328 | Ga0207702_10041282 | 3300026078 | Bacteria | 3868 |
| 329 | Ga0207702_10050239 | 3300026078 | Bacteria | 3520 |
| 330 | Ga0207702_10122273 | 3300026078 | Bacteria | 2331 |
| 331 | Ga0207702_10183678 | 3300026078 | Bacteria | 1927 |
| 332 | Ga0207641_10006468 | 3300026088 | Bacteria | 9870 |
| 333 | Ga0207641_10077654 | 3300026088 | Bacteria | 2874 |
| 334 | Ga0207648_10119855 | 3300026089 | Bacteria | 2313 |
| 335 | Ga0207676_10083152 | 3300026095 | Bacteria | 2606 |
| 336 | Ga0207674_10001204 | 3300026116 | Bacteria | 33692 |
| 337 | Ga0207674_10029619 | 3300026116 | Bacteria | 5763 |
| 338 | Ga0207674_10091783 | 3300026116 | Bacteria | 3027 |
| 339 | Ga0207675_100021179 | 3300026118 | Bacteria | 6057 |
| 340 | Ga0207683_10003270 | 3300026121 | Bacteria | 14127 |
| 341 | Ga0207683_10011750 | 3300026121 | Bacteria | 7472 |
| 342 | Ga0207683_10019462 | 3300026121 | Bacteria | 5797 |
| 343 | Ga0207698_10000464 | 3300026142 | Bacteria | 23539 |
| 344 | Ga0207698_10002958 | 3300026142 | Bacteria | 10169 |
| 345 | Ga0207698_10014721 | 3300026142 | Bacteria | 5210 |
| 346 | Ga0268266_10001243 | 3300028379 | Bacteria | 31174 |
| 347 | Ga0268266_10043615 | 3300028379 | Bacteria | 3834 |
| 348 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 349 | Ga0307515_10109140 | 3300028794 | Bacteria | 3253 |
| 350 | Ga0265338_10000717 | 3300028800 | Bacteria | 56686 |
| 351 | Ga0265338_10057924 | 3300028800 | Bacteria | 3424 |
| 352 | Ga0265325_10004206 | 3300031241 | Bacteria | 9142 |
| 353 | Ga0265325_10032071 | 3300031241 | Bacteria | 2807 |
| 354 | Ga0265340_10001055 | 3300031247 | Bacteria | 15690 |
| 355 | Ga0265339_10007115 | 3300031249 | Bacteria | 7265 |
| 356 | Ga0265339_10042837 | 3300031249 | Bacteria | 2505 |
| 357 | Ga0265331_10031328 | 3300031250 | Bacteria | 2643 |
| 358 | Ga0307408_100007066 | 3300031548 | Bacteria | 7426 |
| 359 | Ga0307408_100009782 | 3300031548 | Bacteria | 6322 |
| 360 | Ga0307408_100016396 | 3300031548 | Bacteria | 4944 |
| 361 | Ga0307408_100028312 | 3300031548 | Bacteria | 3871 |
| 362 | Ga0307408_100086337 | 3300031548 | Bacteria | 2358 |
| 363 | Ga0307408_100152480 | 3300031548 | Bacteria | 1826 |
| 364 | Ga0265313_10052123 | 3300031595 | Bacteria | 1955 |
| 365 | Ga0265314_10029009 | 3300031711 | Bacteria | 4118 |
| 366 | Ga0265342_10056102 | 3300031712 | Bacteria | 2336 |
| 367 | Ga0316576_10000350 | 3300031727 | Bacteria | 20732 |
| 368 | Ga0316576_10057225 | 3300031727 | Bacteria | 2849 |
| 369 | Ga0307405_10011887 | 3300031731 | Bacteria | 4583 |
| 370 | Ga0307405_10023558 | 3300031731 | Bacteria | 3501 |
| 371 | Ga0307405_10029133 | 3300031731 | Bacteria | 3224 |
| 372 | Ga0307405_10049026 | 3300031731 | Bacteria | 2608 |
| 373 | Ga0307405_10061709 | 3300031731 | Bacteria | 2370 |
| 374 | Ga0307405_10154322 | 3300031731 | Bacteria | 1618 |
| 375 | Ga0307405_10176173 | 3300031731 | Bacteria | 1530 |
| 376 | Ga0307413_10010627 | 3300031824 | Bacteria | 4481 |
| 377 | Ga0307413_10012529 | 3300031824 | Bacteria | 4224 |
| 378 | Ga0307413_10016823 | 3300031824 | Bacteria | 3792 |
| 379 | Ga0307413_10033043 | 3300031824 | Bacteria | 2940 |
| 380 | Ga0307413_10185149 | 3300031824 | Bacteria | 1489 |
| 381 | Ga0307410_10001736 | 3300031852 | Bacteria | 10074 |
| 382 | Ga0307410_10016463 | 3300031852 | Bacteria | 4410 |
| 383 | Ga0307410_10017646 | 3300031852 | Bacteria | 4292 |
| 384 | Ga0307410_10022344 | 3300031852 | Bacteria | 3908 |
| 385 | Ga0307410_10043132 | 3300031852 | Bacteria | 2987 |
| 386 | Ga0307410_10050352 | 3300031852 | Bacteria | 2801 |
| 387 | Ga0307410_10080877 | 3300031852 | Bacteria | 2281 |
| 388 | Ga0307406_10000034 | 3300031901 | Bacteria | 83739 |
| 389 | Ga0307406_10000392 | 3300031901 | Bacteria | 25311 |
| 390 | Ga0307406_10012680 | 3300031901 | Bacteria | 4807 |
| 391 | Ga0307406_10029468 | 3300031901 | Bacteria | 3324 |
| 392 | Ga0307406_10052020 | 3300031901 | Bacteria | 2603 |
| 393 | Ga0307407_10008616 | 3300031903 | Bacteria | 4696 |
| 394 | Ga0307407_10017688 | 3300031903 | Bacteria | 3585 |
| 395 | Ga0307407_10069558 | 3300031903 | Bacteria | 2090 |
| 396 | Ga0307407_10100975 | 3300031903 | Bacteria | 1790 |
| 397 | Ga0307412_10000868 | 3300031911 | Bacteria | 17366 |
| 398 | Ga0307412_10016411 | 3300031911 | Bacteria | 4411 |
| 399 | Ga0307412_10019627 | 3300031911 | Bacteria | 4098 |
| 400 | Ga0307412_10030768 | 3300031911 | Bacteria | 3384 |
| 401 | Ga0307412_10073137 | 3300031911 | Bacteria | 2344 |
| 402 | Ga0307412_10126902 | 3300031911 | Bacteria | 1846 |
| 403 | Ga0307409_100001350 | 3300031995 | Bacteria | 11931 |
| 404 | Ga0307409_100009337 | 3300031995 | Bacteria | 6019 |
| 405 | Ga0307409_100044601 | 3300031995 | Bacteria | 3341 |
| 406 | Ga0307416_100019022 | 3300032002 | Bacteria | 4858 |
| 407 | Ga0307416_100064227 | 3300032002 | Bacteria | 3010 |
| 408 | Ga0307416_100066631 | 3300032002 | Bacteria | 2965 |
| 409 | Ga0307416_100095294 | 3300032002 | Bacteria | 2569 |
| 410 | Ga0307416_100124090 | 3300032002 | Bacteria | 2309 |
| 411 | Ga0307416_100175645 | 3300032002 | Bacteria | 2000 |
| 412 | Ga0307416_100206303 | 3300032002 | Bacteria | 1870 |
| 413 | Ga0307416_100292020 | 3300032002 | Bacteria | 1614 |
| 414 | Ga0307414_10049282 | 3300032004 | Bacteria | 2911 |
| 415 | Ga0307411_10022784 | 3300032005 | Bacteria | 3696 |
| 416 | Ga0307411_10060135 | 3300032005 | Bacteria | 2521 |
| 417 | Ga0307415_100009626 | 3300032126 | Bacteria | 5431 |
| 418 | Ga0373923_0036629 | 3300035111 | Bacteria | 2004 |
| 419 | Ga0373953_0017287 | 3300035117 | Bacteria | 2649 |
| 420 | Ga0373943_0024788 | 3300035170 | Bacteria | 2800 |
| 421 | Ga0373942_0013218 | 3300035207 | Bacteria | 1982 |
| 422 | Ga0316574_0024039 | 3300035398 | Bacteria | 3643 |
| 423 | Ga0316574_0058518 | 3300035398 | Bacteria | 2414 |
| 424 | Ga0373935_0082051 | 3300035692 | Bacteria | 2097 |
| 425 | Ga0316584_0010630 | 3300036712 | Bacteria | 6441 |
| 426 | Ga0395899_0031249 | 3300037312 | Bacteria | 4003 |
| 427 | Ga0395899_0049616 | 3300037312 | Bacteria | 3119 |
| 428 | Ga0395899_0052909 | 3300037312 | Bacteria | 3008 |
| 429 | Ga0395899_0070876 | 3300037312 | Bacteria | 2551 |
| 430 | Ga0395899_0097879 | 3300037312 | Bacteria | 2120 |
| 431 | Ga0395900_0023442 | 3300037418 | Bacteria | 6317 |
| 432 | Ga0395900_0027560 | 3300037418 | Bacteria | 5821 |
| 433 | Ga0395900_0031146 | 3300037418 | Bacteria | 5479 |
| 434 | Ga0395900_0048579 | 3300037418 | Bacteria | 4371 |
| 435 | Ga0395900_0049354 | 3300037418 | Bacteria | 4336 |
| 436 | Ga0395900_0194492 | 3300037418 | Bacteria | 2055 |
| 437 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 438 | Ga0395898_0008364 | 3300037466 | Bacteria | 10938 |
| 439 | Ga0395898_0010700 | 3300037466 | Bacteria | 9586 |
| 440 | Ga0395898_0021565 | 3300037466 | Bacteria | 6530 |
| 441 | Ga0395898_0049208 | 3300037466 | Bacteria | 4130 |
| 442 | Ga0395898_0102772 | 3300037466 | Bacteria | 2743 |
| 443 | Ga0395898_0229308 | 3300037466 | Bacteria | 1771 |
| 444 | Ga0395905_0071058 | 3300037471 | Bacteria | 3263 |
| 445 | Ga0395901_0005712 | 3300038443 | Bacteria | 12595 |
| 446 | Ga0395901_0014744 | 3300038443 | Bacteria | 7945 |
| 447 | Ga0395901_0026196 | 3300038443 | Bacteria | 5985 |
| 448 | Ga0395901_0033857 | 3300038443 | Bacteria | 5276 |
| 449 | Ga0395901_0104971 | 3300038443 | Bacteria | 2965 |
| 450 | Ga0395901_0121139 | 3300038443 | Bacteria | 2749 |
| 451 | Ga0395901_0136118 | 3300038443 | Bacteria | 2582 |
| 452 | Ga0395901_0193483 | 3300038443 | Bacteria | 2133 |
| 453 | Ga0395901_0211518 | 3300038443 | Bacteria | 2029 |
| 454 | Ga0395901_0265716 | 3300038443 | Bacteria | 1785 |
| 455 | Ga0439436_0000191 | 3300041404 | Bacteria | 14540 |
| 456 | Ga0439436_0009512 | 3300041404 | Bacteria | 2979 |
| 457 | Ga0439436_0018571 | 3300041404 | Bacteria | 2079 |
| 458 | Ga0439439_0004216 | 3300041406 | Bacteria | 3225 |
| 459 | Ga0439439_0005898 | 3300041406 | Bacteria | 2819 |
| 460 | Ga0439466_0009633 | 3300041411 | Bacteria | 3611 |
| 461 | Ga0439465_0026069 | 3300041413 | Bacteria | 1847 |
| 462 | Ga0451806_009371 | 3300041462 | Bacteria | 1876 |
| 463 | Ga0451853_3313517 | 3300041512 | Bacteria | 1453 |
| 464 | Ga0439442_000053 | 3300042002 | Bacteria | 26463 |
| 465 | Ga0439442_000228 | 3300042002 | Bacteria | 13801 |
| 466 | Ga0439442_004449 | 3300042002 | Bacteria | 2782 |
| 467 | Ga0439442_007220 | 3300042002 | Bacteria | 2234 |
| 468 | Ga0439445_0005744 | 3300042004 | Bacteria | 2835 |
| 469 | Ga0439432_005896 | 3300042006 | Bacteria | 4397 |
| 470 | Ga0439432_030422 | 3300042006 | Bacteria | 1751 |
| 471 | Ga0439449_0000387 | 3300042007 | Bacteria | 16320 |
| 472 | Ga0439449_0006234 | 3300042007 | Bacteria | 4556 |
| 473 | Ga0439449_0011604 | 3300042007 | Bacteria | 3313 |
| 474 | Ga0439452_003748 | 3300042010 | Bacteria | 5237 |
| 475 | Ga0439457_001930 | 3300042014 | Bacteria | 6106 |
| 476 | Ga0439457_005001 | 3300042014 | Bacteria | 3393 |
| 477 | Ga0439457_009687 | 3300042014 | Bacteria | 2237 |
| 478 | Ga0439462_0000865 | 3300042015 | Bacteria | 6353 |
| 479 | Ga0439462_0005085 | 3300042015 | Bacteria | 3226 |
| 480 | Ga0450911_001576 | 3300042115 | Bacteria | 5153 |
| 481 | Ga0450919_000400 | 3300042121 | Bacteria | 5289 |
| 482 | Ga0450920_001058 | 3300042122 | Bacteria | 4507 |
| 483 | Ga0450907_000157 | 3300042146 | Bacteria | 25405 |
| 484 | Ga0439446_0020098 | 3300042156 | Bacteria | 1879 |
| 485 | Ga0450908_002011 | 3300042184 | Bacteria | 3983 |
| 486 | Ga0450909_000232 | 3300042185 | Bacteria | 6627 |
| 487 | Ga0439434_0000258 | 3300042435 | Bacteria | 15001 |
| 488 | Ga0439434_0006980 | 3300042435 | Bacteria | 3298 |
| 489 | Ga0450918_003717 | 3300042531 | Bacteria | 2823 |
| 490 | Ga0450893_0008043 | 3300042532 | Bacteria | 1716 |
| 491 | Ga0466969_0055206 | 3300044656 | Bacteria | 1944 |
| 492 | Ga0466972_0002555 | 3300044658 | Bacteria | 9008 |
| 493 | Ga0466965_0000015 | 3300044683 | Bacteria | 81629 |
| 494 | Ga0466965_0038086 | 3300044683 | Bacteria | 2362 |
| 495 | Ga0466965_0039178 | 3300044683 | Bacteria | 2329 |
| 496 | Ga0466966_0000651 | 3300044684 | Bacteria | 22101 |
| 497 | Ga0466966_0016602 | 3300044684 | Bacteria | 4863 |
| 498 | Ga0466966_0043624 | 3300044684 | Bacteria | 2874 |
| 499 | Ga0466966_0078915 | 3300044684 | Bacteria | 2052 |
| 500 | Ga0466961_0002633 | 3300044693 | Bacteria | 11150 |
| 501 | Ga0466961_0021649 | 3300044693 | Bacteria | 4136 |
| 502 | Ga0466961_0029915 | 3300044693 | Bacteria | 3498 |
| 503 | Ga0466961_0042614 | 3300044693 | Bacteria | 2909 |
| 504 | Ga0466961_0062165 | 3300044693 | Bacteria | 2373 |
| 505 | Ga0466961_0081472 | 3300044693 | Bacteria | 2047 |
| 506 | Ga0466961_0086138 | 3300044693 | Bacteria | 1986 |
| 507 | Ga0466963_0005450 | 3300044694 | Bacteria | 7453 |
| 508 | Ga0466963_0008471 | 3300044694 | Bacteria | 6162 |
| 509 | Ga0466963_0018106 | 3300044694 | Bacteria | 4398 |
| 510 | Ga0466963_0049742 | 3300044694 | Bacteria | 2773 |
| 511 | Ga0466963_0074712 | 3300044694 | Bacteria | 2287 |
| 512 | Ga0466963_0094457 | 3300044694 | Bacteria | 2039 |
| 513 | Ga0466971_0026081 | 3300044719 | Bacteria | 2610 |
| 514 | Ga0466971_0101217 | 3300044719 | Bacteria | 1324 |
| 515 | Ga0466970_0000004 | 3300044765 | Bacteria | 108620 |
| 516 | Ga0466970_0041981 | 3300044765 | Bacteria | 2432 |
| 517 | Ga0466970_0098058 | 3300044765 | Bacteria | 1595 |
| 518 | Ga0466957_0026793 | 3300044842 | Bacteria | 3421 |
| 519 | Ga0466957_0059420 | 3300044842 | Bacteria | 2343 |
| 520 | Ga0466960_0005621 | 3300044901 | Bacteria | 4975 |
| 521 | Ga0466959_0013199 | 3300045049 | Bacteria | 5984 |
| 522 | Ga0466958_0010879 | 3300045836 | Bacteria | 5109 |
| 523 | Ga0466967_0000729 | 3300045976 | Bacteria | 16846 |
| 524 | Ga0466967_0015629 | 3300045976 | Bacteria | 5956 |
| 525 | Ga0466967_0016226 | 3300045976 | Bacteria | 5864 |
| 526 | Ga0466967_0048514 | 3300045976 | Bacteria | 3708 |
| 527 | Ga0466967_0076530 | 3300045976 | Bacteria | 3010 |
| 528 | Ga0466967_0122350 | 3300045976 | Bacteria | 2406 |
| 529 | Ga0466967_0134998 | 3300045976 | Bacteria | 2294 |
| 530 | Ga0466967_0181017 | 3300045976 | Bacteria | 1988 |
| 531 | Ga0466967_0194649 | 3300045976 | Bacteria | 1917 |
| 532 | Ga0466967_0353215 | 3300045976 | Bacteria | 1423 |
| 533 | Ga0495627_004139 | 3300046453 | Bacteria | 6156 |
| 534 | Ga0495590_0000279 | 3300046457 | Bacteria | 27525 |
| 535 | Ga0495629_0009176 | 3300046459 | Bacteria | 7242 |
| 536 | Ga0495651_0006649 | 3300046462 | Bacteria | 8838 |
| 537 | Ga0495653_0030356 | 3300046463 | Bacteria | 4306 |
| 538 | Ga0495653_0042128 | 3300046463 | Bacteria | 3558 |
| 539 | Ga0495650_0000763 | 3300046471 | Bacteria | 39830 |
| 540 | Ga0495582_0101864 | 3300046473 | Bacteria | 1608 |
| 541 | Ga0495639_0009546 | 3300046475 | Bacteria | 4164 |
| 542 | Ga0495662_0022647 | 3300046476 | Bacteria | 3033 |
| 543 | Ga0495664_0048062 | 3300046477 | Bacteria | 2533 |
| 544 | Ga0495594_0012572 | 3300046499 | Bacteria | 4412 |
| 545 | Ga0495628_0052851 | 3300046516 | Bacteria | 3208 |
| 546 | Ga0495630_0037997 | 3300046517 | Bacteria | 3600 |
| 547 | Ga0495643_0040276 | 3300046522 | Bacteria | 2552 |
| 548 | Ga0495665_0001619 | 3300046531 | Bacteria | 12045 |
| 549 | Ga0495640_0036300 | 3300046533 | Bacteria | 3482 |
| 550 | Ga0495586_0010858 | 3300046535 | Bacteria | 4837 |
| 551 | Ga0495587_0006448 | 3300046536 | Bacteria | 7648 |
| 552 | Ga0495621_0007740 | 3300046539 | Bacteria | 3192 |
| 553 | Ga0495645_0000761 | 3300046543 | Bacteria | 21999 |
| 554 | Ga0495645_0070863 | 3300046543 | Bacteria | 2515 |
| 555 | Ga0495645_0130917 | 3300046543 | Bacteria | 1758 |
| 556 | Ga0495667_0002112 | 3300046559 | Bacteria | 13215 |
| 557 | Ga0495656_0000193 | 3300046615 | Bacteria | 21880 |
| 558 | Ga0495659_0027434 | 3300046664 | Bacteria | 1965 |
| 559 | Ga0495588_0000869 | 3300046674 | Bacteria | 13347 |
| 560 | Ga0495588_0004339 | 3300046674 | Bacteria | 6262 |
| 561 | Ga0495657_0014449 | 3300046675 | Bacteria | 5797 |
| 562 | Ga0495623_0025154 | 3300046679 | Bacteria | 3835 |
| 563 | Ga0495646_0025391 | 3300046680 | Bacteria | 3726 |
| 564 | Ga0495647_0019961 | 3300046681 | Bacteria | 2402 |
| 565 | Ga0495658_0028888 | 3300046683 | Bacteria | 2997 |
| 566 | Ga0495613_0030212 | 3300046689 | Bacteria | 4025 |
| 567 | Ga0495613_0066177 | 3300046689 | Bacteria | 2639 |
| 568 | Ga0495670_0015905 | 3300046691 | Bacteria | 3697 |
| 569 | Ga0495670_0062585 | 3300046691 | Bacteria | 1872 |
| 570 | Ga0495670_0087896 | 3300046691 | Bacteria | 1588 |
| 571 | Ga0495581_0021314 | 3300047315 | Bacteria | 3757 |
| 572 | Ga0495581_0098279 | 3300047315 | Bacteria | 1700 |
| 573 | Ga0495672_0036431 | 3300047320 | Bacteria | 3021 |
| 574 | Ga0495680_0020771 | 3300047322 | Bacteria | 5513 |
| 575 | Ga0495680_0028340 | 3300047322 | Bacteria | 4593 |
| 576 | Ga0495675_0020962 | 3300047444 | Bacteria | 4160 |
| 577 | Ga0495593_0013931 | 3300047673 | Bacteria | 4581 |
| 578 | Ga0495593_0092425 | 3300047673 | Bacteria | 1557 |
| 579 | Ga0496100_0067631 | 3300048903 | Bacteria | 2373 |
| 580 | Ga0496101_0002802 | 3300048904 | Bacteria | 10698 |
| 581 | Ga0496101_0023516 | 3300048904 | Bacteria | 4258 |
| 582 | Ga0496101_0103536 | 3300048904 | Bacteria | 2133 |
| 583 | Ga0496102_0000110 | 3300048905 | Bacteria | 117178 |
| 584 | Ga0496102_0000602 | 3300048905 | Bacteria | 37524 |
| 585 | Ga0496102_0034601 | 3300048905 | Bacteria | 4544 |
| 586 | Ga0496102_0089803 | 3300048905 | Bacteria | 2843 |
| 587 | Ga0496102_0216999 | 3300048905 | Bacteria | 1803 |
| 588 | Ga0496103_0000135 | 3300048906 | Bacteria | 77221 |
| 589 | Ga0496103_0006592 | 3300048906 | Bacteria | 6924 |
| 590 | Ga0496103_0007234 | 3300048906 | Bacteria | 6616 |
| 591 | Ga0496103_0020706 | 3300048906 | Bacteria | 3954 |
| 592 | Ga0496103_0115191 | 3300048906 | Bacteria | 1709 |
| 593 | Ga0496103_0129614 | 3300048906 | Bacteria | 1610 |
| 594 | Ga0496103_0173792 | 3300048906 | Bacteria | 1384 |
| 595 | Ga0496104_0000407 | 3300048907 | Bacteria | 37689 |
| 596 | Ga0496104_0021197 | 3300048907 | Bacteria | 5964 |
| 597 | Ga0496104_0089625 | 3300048907 | Bacteria | 2938 |
| 598 | Ga0496104_0201576 | 3300048907 | Bacteria | 1902 |
| 599 | Ga0496105_0000185 | 3300048908 | Bacteria | 41781 |
| 600 | Ga0496105_0016507 | 3300048908 | Bacteria | 5896 |
| 601 | Ga0496105_0027352 | 3300048908 | Bacteria | 4658 |
| 602 | Ga0496105_0047628 | 3300048908 | Bacteria | 3537 |
| 603 | Ga0496105_0072736 | 3300048908 | Bacteria | 2841 |
| 604 | Ga0496105_0106265 | 3300048908 | Bacteria | 2317 |
| 605 | Ga0496106_0020317 | 3300048909 | Bacteria | 4929 |
| 606 | Ga0496106_0027839 | 3300048909 | Bacteria | 4208 |
| 607 | Ga0496106_0085263 | 3300048909 | Bacteria | 2432 |
| 608 | Ga0496107_0031322 | 3300048910 | Bacteria | 3794 |
| 609 | Ga0496107_0128502 | 3300048910 | Bacteria | 1870 |
| 610 | Ga0496108_0001727 | 3300048911 | Bacteria | 17341 |
| 611 | Ga0496108_0003760 | 3300048911 | Bacteria | 12156 |
| 612 | Ga0496108_0009615 | 3300048911 | Bacteria | 7837 |
| 613 | Ga0496108_0045121 | 3300048911 | Bacteria | 3680 |
| 614 | Ga0496108_0066626 | 3300048911 | Bacteria | 3037 |
| 615 | Ga0496108_0143878 | 3300048911 | Bacteria | 2055 |
| 616 | Ga0496109_0002285 | 3300048912 | Bacteria | 15933 |
| 617 | Ga0496109_0032839 | 3300048912 | Bacteria | 4668 |
| 618 | Ga0496109_0035481 | 3300048912 | Bacteria | 4499 |
| 619 | Ga0496109_0173239 | 3300048912 | Bacteria | 2025 |
| 620 | Ga0496109_0176417 | 3300048912 | Bacteria | 2006 |
| 621 | Ga0496110_0004627 | 3300048913 | Bacteria | 10690 |
| 622 | Ga0496110_0028626 | 3300048913 | Bacteria | 4788 |
| 623 | Ga0496110_0032811 | 3300048913 | Bacteria | 4488 |
| 624 | Ga0496110_0056922 | 3300048913 | Bacteria | 3440 |
| 625 | Ga0496110_0063531 | 3300048913 | Bacteria | 3262 |
| 626 | Ga0496110_0221381 | 3300048913 | Bacteria | 1721 |
| 627 | Ga0496111_0000336 | 3300048914 | Bacteria | 23420 |
| 628 | Ga0496111_0003011 | 3300048914 | Bacteria | 10320 |
| 629 | Ga0496111_0014853 | 3300048914 | Bacteria | 5329 |
| 630 | Ga0496111_0035211 | 3300048914 | Bacteria | 3577 |
| 631 | Ga0496111_0125307 | 3300048914 | Bacteria | 1898 |
| 632 | Ga0496111_0160602 | 3300048914 | Bacteria | 1668 |
| 633 | Ga0496112_0003509 | 3300048915 | Bacteria | 12998 |
| 634 | Ga0496112_0042923 | 3300048915 | Bacteria | 4426 |
| 635 | Ga0496112_0114729 | 3300048915 | Bacteria | 2664 |
| 636 | Ga0496112_0153118 | 3300048915 | Bacteria | 2273 |
| 637 | Ga0496112_0259724 | 3300048915 | Bacteria | 1686 |
| 638 | Ga0496113_0005179 | 3300048916 | Bacteria | 8108 |
| 639 | Ga0496113_0030869 | 3300048916 | Bacteria | 3884 |
| 640 | Ga0496113_0031659 | 3300048916 | Bacteria | 3840 |
| 641 | Ga0496113_0079464 | 3300048916 | Bacteria | 2511 |
| 642 | Ga0496113_0164574 | 3300048916 | Bacteria | 1754 |
| 643 | Ga0496114_0003212 | 3300048917 | Bacteria | 12535 |
| 644 | Ga0496114_0038389 | 3300048917 | Bacteria | 3962 |
| 645 | Ga0496114_0061362 | 3300048917 | Bacteria | 3144 |
| 646 | Ga0496114_0146526 | 3300048917 | Bacteria | 2047 |
| 647 | Ga0496115_0031536 | 3300048918 | Bacteria | 4177 |
| 648 | Ga0496115_0065590 | 3300048918 | Bacteria | 2933 |
| 649 | Ga0496115_0088953 | 3300048918 | Bacteria | 2521 |
| 650 | Ga0496116_0010627 | 3300048919 | Bacteria | 7697 |
| 651 | Ga0496117_0000232 | 3300048920 | Bacteria | 105479 |
| 652 | Ga0496117_0001383 | 3300048920 | Bacteria | 35268 |
| 653 | Ga0496117_0002730 | 3300048920 | Bacteria | 21670 |
| 654 | Ga0496117_0007872 | 3300048920 | Bacteria | 10249 |
| 655 | Ga0496117_0008761 | 3300048920 | Bacteria | 9547 |
| 656 | Ga0496117_0019357 | 3300048920 | Bacteria | 5595 |
| 657 | Ga0496117_0064537 | 3300048920 | Bacteria | 2496 |
| 658 | Ga0496118_0000134 | 3300048921 | Bacteria | 130991 |
| 659 | Ga0496118_0010662 | 3300048921 | Bacteria | 9065 |
| 660 | Ga0496118_0012064 | 3300048921 | Bacteria | 8343 |
| 661 | Ga0496118_0018385 | 3300048921 | Bacteria | 6310 |
| 662 | Ga0496119_0001043 | 3300048922 | Bacteria | 35409 |
| 663 | Ga0496119_0001189 | 3300048922 | Bacteria | 32563 |
| 664 | Ga0496119_0001941 | 3300048922 | Bacteria | 23565 |
| 665 | Ga0496119_0002335 | 3300048922 | Bacteria | 20883 |
| 666 | Ga0496119_0005825 | 3300048922 | Bacteria | 11646 |
| 667 | Ga0496119_0010849 | 3300048922 | Bacteria | 7619 |
| 668 | Ga0496119_0034272 | 3300048922 | Bacteria | 3349 |
| 669 | Ga0496120_0001174 | 3300048923 | Bacteria | 33434 |
| 670 | Ga0496120_0001282 | 3300048923 | Bacteria | 31373 |
| 671 | Ga0496120_0003000 | 3300048923 | Bacteria | 16025 |
| 672 | Ga0496120_0003591 | 3300048923 | Bacteria | 13944 |
| 673 | Ga0496120_0004696 | 3300048923 | Bacteria | 11275 |
| 674 | Ga0496120_0010259 | 3300048923 | Bacteria | 6556 |
| 675 | Ga0496120_0033941 | 3300048923 | Bacteria | 3061 |
| 676 | Ga0496120_0038940 | 3300048923 | Bacteria | 2809 |
| 677 | Ga0496120_0054212 | 3300048923 | Bacteria | 2274 |
| 678 | Ga0496120_0075384 | 3300048923 | Bacteria | 1841 |
| 679 | Ga0496121_0000040 | 3300048924 | Bacteria | 348494 |
| 680 | Ga0496121_0017339 | 3300048924 | Bacteria | 7365 |
| 681 | Ga0496121_0021940 | 3300048924 | Bacteria | 6228 |
| 682 | Ga0496121_0097641 | 3300048924 | Bacteria | 2276 |
| 683 | Ga0496122_0000030 | 3300048925 | Bacteria | 331586 |
| 684 | Ga0496122_0002594 | 3300048925 | Bacteria | 25336 |
| 685 | Ga0496122_0002595 | 3300048925 | Bacteria | 25327 |
| 686 | Ga0496122_0004089 | 3300048925 | Bacteria | 18484 |
| 687 | Ga0496122_0028059 | 3300048925 | Bacteria | 4792 |
| 688 | Ga0496122_0035512 | 3300048925 | Bacteria | 4053 |
| 689 | Ga0496122_0103048 | 3300048925 | Bacteria | 1900 |
| 690 | Ga0496123_0000024 | 3300048926 | Bacteria | 331587 |
| 691 | Ga0496123_0000051 | 3300048926 | Bacteria | 237095 |
| 692 | Ga0496123_0001071 | 3300048926 | Bacteria | 41360 |
| 693 | Ga0496123_0002826 | 3300048926 | Bacteria | 20537 |
| 694 | Ga0496123_0011351 | 3300048926 | Bacteria | 7734 |
| 695 | Ga0496123_0041459 | 3300048926 | Bacteria | 3191 |
| 696 | Ga0496124_0000134 | 3300048927 | Bacteria | 153436 |
| 697 | Ga0496124_0001836 | 3300048927 | Bacteria | 29326 |
| 698 | Ga0496124_0007705 | 3300048927 | Bacteria | 11387 |
| 699 | Ga0496124_0027988 | 3300048927 | Bacteria | 5047 |
| 700 | Ga0496124_0072879 | 3300048927 | Bacteria | 2843 |
| 701 | Ga0496125_0000097 | 3300048928 | Bacteria | 204607 |
| 702 | Ga0496125_0004040 | 3300048928 | Bacteria | 17201 |
| 703 | Ga0496125_0013210 | 3300048928 | Bacteria | 8134 |
| 704 | Ga0496125_0040465 | 3300048928 | Bacteria | 3998 |
| 705 | Ga0496125_0054205 | 3300048928 | Bacteria | 3279 |
| 706 | Ga0496125_0089027 | 3300048928 | Bacteria | 2323 |
| 707 | Ga0496125_0124967 | 3300048928 | Bacteria | 1825 |
| 708 | Ga0496126_0000022 | 3300048929 | Bacteria | 464393 |
| 709 | Ga0496126_0000072 | 3300048929 | Bacteria | 238130 |
| 710 | Ga0496126_0002454 | 3300048929 | Bacteria | 25035 |
| 711 | Ga0496126_0008783 | 3300048929 | Bacteria | 10845 |
| 712 | Ga0496126_0014995 | 3300048929 | Bacteria | 7812 |
| 713 | Ga0496126_0017351 | 3300048929 | Bacteria | 7174 |
| 714 | Ga0496126_0040234 | 3300048929 | Bacteria | 4334 |
| 715 | Ga0496126_0042259 | 3300048929 | Bacteria | 4210 |
| 716 | Ga0496126_0083190 | 3300048929 | Bacteria | 2825 |
| 717 | Ga0496126_0122079 | 3300048929 | Bacteria | 2258 |
| 718 | Ga0501317_002004 | 3300049533 | Bacteria | 1859 |
| 719 | Ga0501317_002136 | 3300049533 | Bacteria | 1824 |
| 720 | Ga0501318_001580 | 3300049534 | Bacteria | 1824 |
| 721 | Ga0501320_002124 | 3300049536 | Bacteria | 1556 |
| 722 | Ga0501321_001697 | 3300049537 | Bacteria | 1804 |
| 723 | Ga0501325_000901 | 3300049541 | Bacteria | 1652 |
| 724 | Ga0501031_0021945 | 3300049568 | Bacteria | 4160 |
| 725 | Ga0501031_0038829 | 3300049568 | Bacteria | 3106 |
| 726 | Ga0501031_0052797 | 3300049568 | Bacteria | 2648 |
| 727 | Ga0501031_0135650 | 3300049568 | Bacteria | 1608 |
| 728 | Ga0501032_0000415 | 3300049569 | Bacteria | 35219 |
| 729 | Ga0501032_0003113 | 3300049569 | Bacteria | 12794 |
| 730 | Ga0501032_0006209 | 3300049569 | Bacteria | 8789 |
| 731 | Ga0501033_0000989 | 3300049570 | Bacteria | 25877 |
| 732 | Ga0501033_0007497 | 3300049570 | Bacteria | 8491 |
| 733 | Ga0501033_0007920 | 3300049570 | Bacteria | 8230 |
| 734 | Ga0501033_0053638 | 3300049570 | Bacteria | 2985 |
| 735 | Ga0501033_0135847 | 3300049570 | Bacteria | 1779 |
| 736 | Ga0501034_0000080 | 3300049571 | Bacteria | 170742 |
| 737 | Ga0501034_0000227 | 3300049571 | Bacteria | 106244 |
| 738 | Ga0501034_0016744 | 3300049571 | Bacteria | 7516 |
| 739 | Ga0501034_0024191 | 3300049571 | Bacteria | 6177 |
| 740 | Ga0501034_0081913 | 3300049571 | Bacteria | 3229 |
| 741 | Ga0501034_0133511 | 3300049571 | Bacteria | 2464 |
| 742 | Ga0501034_0170385 | 3300049571 | Bacteria | 2145 |
| 743 | Ga0501034_0263120 | 3300049571 | Bacteria | 1667 |
| 744 | Ga0501034_0289088 | 3300049571 | Bacteria | 1578 |
| 745 | Ga0501036_0018043 | 3300049572 | Bacteria | 5907 |
| 746 | Ga0501036_0194717 | 3300049572 | Bacteria | 1705 |
| 747 | Ga0501037_0005467 | 3300049573 | Bacteria | 9255 |
| 748 | Ga0501037_0008612 | 3300049573 | Bacteria | 7480 |
| 749 | Ga0501037_0009463 | 3300049573 | Bacteria | 7153 |
| 750 | Ga0501037_0013666 | 3300049573 | Bacteria | 5981 |
| 751 | Ga0501037_0028173 | 3300049573 | Bacteria | 4150 |
| 752 | Ga0501037_0044709 | 3300049573 | Bacteria | 3252 |
| 753 | Ga0501037_0044714 | 3300049573 | Bacteria | 3252 |
| 754 | Ga0501037_0060855 | 3300049573 | Bacteria | 2754 |
| 755 | Ga0501037_0087970 | 3300049573 | Bacteria | 2248 |
| 756 | Ga0501038_0007892 | 3300049574 | Bacteria | 9810 |
| 757 | Ga0501038_0008532 | 3300049574 | Bacteria | 9415 |
| 758 | Ga0501038_0010191 | 3300049574 | Bacteria | 8599 |
| 759 | Ga0501038_0011798 | 3300049574 | Bacteria | 7974 |
| 760 | Ga0501038_0037561 | 3300049574 | Bacteria | 4246 |
| 761 | Ga0501038_0042844 | 3300049574 | Bacteria | 3940 |
| 762 | Ga0501038_0185895 | 3300049574 | Bacteria | 1674 |
| 763 | Ga0501039_0069270 | 3300049575 | Bacteria | 2739 |
| 764 | Ga0501039_0157216 | 3300049575 | Bacteria | 1786 |
| 765 | Ga0501039_0165801 | 3300049575 | Bacteria | 1737 |
| 766 | Ga0501042_0046735 | 3300049578 | Bacteria | 3086 |
| 767 | Ga0501043_0011547 | 3300049579 | Bacteria | 6914 |
| 768 | Ga0501043_0016668 | 3300049579 | Bacteria | 5758 |
| 769 | Ga0501043_0021039 | 3300049579 | Bacteria | 5115 |
| 770 | Ga0501043_0022980 | 3300049579 | Bacteria | 4890 |
| 771 | Ga0501043_0028906 | 3300049579 | Bacteria | 4351 |
| 772 | Ga0501043_0063050 | 3300049579 | Bacteria | 2911 |
| 773 | Ga0501043_0067160 | 3300049579 | Bacteria | 2816 |
| 774 | Ga0501043_0082894 | 3300049579 | Bacteria | 2521 |
| 775 | Ga0501043_0188474 | 3300049579 | Bacteria | 1605 |
| 776 | Ga0501046_0001194 | 3300049580 | Bacteria | 25255 |
| 777 | Ga0501046_0001908 | 3300049580 | Bacteria | 19798 |
| 778 | Ga0501046_0012399 | 3300049580 | Bacteria | 7257 |
| 779 | Ga0501046_0023076 | 3300049580 | Bacteria | 5123 |
| 780 | Ga0501047_0000309 | 3300049581 | Bacteria | 56264 |
| 781 | Ga0501047_0004842 | 3300049581 | Bacteria | 12644 |
| 782 | Ga0501047_0008056 | 3300049581 | Bacteria | 9943 |
| 783 | Ga0501047_0011123 | 3300049581 | Bacteria | 8517 |
| 784 | Ga0501047_0035420 | 3300049581 | Bacteria | 4822 |
| 785 | Ga0501047_0043307 | 3300049581 | Bacteria | 4348 |
| 786 | Ga0501047_0332526 | 3300049581 | Bacteria | 1358 |
| 787 | Ga0501048_0060787 | 3300049582 | Bacteria | 2677 |
| 788 | Ga0501048_0115066 | 3300049582 | Bacteria | 1900 |
| 789 | Ga0501067_0024323 | 3300049583 | Bacteria | 3360 |
| 790 | Ga0501067_0049109 | 3300049583 | Bacteria | 2339 |
| 791 | Ga0501069_0081399 | 3300049585 | Bacteria | 1824 |
| 792 | Ga0501070_0000786 | 3300049586 | Bacteria | 28832 |
| 793 | Ga0501070_0001897 | 3300049586 | Bacteria | 18498 |
| 794 | Ga0501070_0002246 | 3300049586 | Bacteria | 16969 |
| 795 | Ga0501070_0017879 | 3300049586 | Bacteria | 5953 |
| 796 | Ga0501070_0026745 | 3300049586 | Bacteria | 4839 |
| 797 | Ga0501070_0039757 | 3300049586 | Bacteria | 3922 |
| 798 | Ga0501070_0049973 | 3300049586 | Bacteria | 3472 |
| 799 | Ga0501070_0067754 | 3300049586 | Bacteria | 2956 |
| 800 | Ga0501070_0133691 | 3300049586 | Bacteria | 2048 |
| 801 | Ga0501071_0067192 | 3300049587 | Bacteria | 2607 |
| 802 | Ga0501071_0150567 | 3300049587 | Bacteria | 1735 |
| 803 | Ga0501072_0014137 | 3300049588 | Bacteria | 6116 |
| 804 | Ga0501073_0000940 | 3300049589 | Bacteria | 20936 |
| 805 | Ga0501073_0041524 | 3300049589 | Bacteria | 3250 |
| 806 | Ga0501073_0048987 | 3300049589 | Bacteria | 2963 |
| 807 | Ga0501075_0037513 | 3300049591 | Bacteria | 3621 |
| 808 | Ga0501077_0042366 | 3300049593 | Bacteria | 2895 |
| 809 | Ga0501077_0129384 | 3300049593 | Bacteria | 1601 |
| 810 | Ga0501080_0091627 | 3300049742 | Bacteria | 2823 |
| 811 | Ga0501081_0096409 | 3300049743 | Bacteria | 2086 |
| 812 | Ga0501083_0000027 | 3300049744 | Bacteria | 117605 |
| 813 | Ga0501083_0014487 | 3300049744 | Bacteria | 5514 |
| 814 | Ga0501035_0001774 | 3300049822 | Bacteria | 21783 |
| 815 | Ga0501035_0041081 | 3300049822 | Bacteria | 4177 |
| 816 | Ga0501035_0105764 | 3300049822 | Bacteria | 2467 |
| 817 | Ga0501035_0138189 | 3300049822 | Bacteria | 2120 |
| 818 | Ga0501035_0156852 | 3300049822 | Bacteria | 1972 |
| 819 | Ga0501044_0000673 | 3300049823 | Bacteria | 41320 |
| 820 | Ga0501044_0004313 | 3300049823 | Bacteria | 15948 |
| 821 | Ga0501044_0004715 | 3300049823 | Bacteria | 15235 |
| 822 | Ga0501044_0006429 | 3300049823 | Bacteria | 12982 |
| 823 | Ga0501044_0066604 | 3300049823 | Bacteria | 3671 |
| 824 | Ga0501044_0067096 | 3300049823 | Bacteria | 3656 |
| 825 | Ga0501044_0074344 | 3300049823 | Bacteria | 3453 |
| 826 | Ga0501044_0138223 | 3300049823 | Bacteria | 2426 |
| 827 | Ga0501045_0170402 | 3300049824 | Bacteria | 1621 |
| 828 | nmdc:mga03683_604_c1 | 3300050489 | Bacteria | 10322 |
| 829 | nmdc:mga03n38_7434_c2 | 3300050490 | Bacteria | 1830 |
| 830 | nmdc:mga00v17_21027_c1 | 3300050491 | Bacteria | 3747 |
| 831 | nmdc:mga00v17_23467_c1 | 3300050491 | Bacteria | 3568 |
| 832 | nmdc:mga0yw44_103570_c1 | 3300050492 | Bacteria | 1815 |
| 833 | nmdc:mga0yw44_23090_c1 | 3300050492 | Bacteria | 2915 |
| 834 | nmdc:mga0k408_18971_c1 | 3300050493 | Bacteria | 3840 |
| 835 | nmdc:mga07m45_35367_c1 | 3300050496 | Bacteria | 2778 |
| 836 | nmdc:mga0rr50_59796_c1 | 3300050513 | Bacteria | 2863 |
| 837 | nmdc:mga0a205_198854_c1 | 3300050515 | Bacteria | 1895 |
| 838 | nmdc:mga0sz30_58841_c1 | 3300050516 | Bacteria | 1639 |
| 839 | Ga0495601_0045057 | 3300053077 | Bacteria | 2773 |
| 840 | Ga0500635_0000028 | 3300053080 | Bacteria | 104398 |
| 841 | Ga0495655_0000392 | 3300053083 | Bacteria | 7423 |
| 842 | Ga0495619_0055392 | 3300053085 | Bacteria | 2626 |
| 843 | Ga0495619_0126318 | 3300053085 | Bacteria | 1755 |
| 844 | Ga0500643_000334 | 3300053087 | Bacteria | 37718 |
| 845 | Ga0500643_000401 | 3300053087 | Bacteria | 33175 |
| 846 | Ga0500651_0000407 | 3300053093 | Bacteria | 23283 |
| 847 | Ga0500641_0000776 | 3300053096 | Bacteria | 11565 |
| 848 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 849 | Ga0500556_0000204 | 3300053104 | Bacteria | 48558 |
| 850 | Ga0500562_000228 | 3300053108 | Bacteria | 14753 |
| 851 | Ga0500593_000685 | 3300053117 | Bacteria | 12903 |
| 852 | Ga0500655_001594 | 3300053133 | Bacteria | 4279 |
| 853 | Ga0500559_0000218 | 3300053136 | Bacteria | 46051 |
| 854 | Ga0500559_0000606 | 3300053136 | Bacteria | 24406 |
| 855 | Ga0500559_0004381 | 3300053136 | Bacteria | 6723 |
| 856 | Ga0500568_0000016 | 3300053139 | Bacteria | 217194 |
| 857 | Ga0500568_0001477 | 3300053139 | Bacteria | 15057 |
| 858 | Ga0500568_0005422 | 3300053139 | Bacteria | 6593 |
| 859 | Ga0500568_0018308 | 3300053139 | Bacteria | 3068 |
| 860 | Ga0500568_0022522 | 3300053139 | Bacteria | 2693 |
| 861 | Ga0500568_0051655 | 3300053139 | Bacteria | 1616 |
| 862 | Ga0500573_0000059 | 3300053140 | Bacteria | 71066 |
| 863 | Ga0500573_0001660 | 3300053140 | Bacteria | 10796 |
| 864 | Ga0500573_0002098 | 3300053140 | Bacteria | 9815 |
| 865 | Ga0500616_0000540 | 3300053153 | Bacteria | 47313 |
| 866 | Ga0500616_0001498 | 3300053153 | Bacteria | 22063 |
| 867 | Ga0500616_0011514 | 3300053153 | Bacteria | 5216 |
| 868 | Ga0501084_0092110 | 3300054114 | Bacteria | 2545 |
| 869 | Ga0587072_008701 | 3300059643 | Bacteria | 1612 |
| 870 | Ga0501082_0017799 | 3300060353 | Bacteria | 6121 |
| 871 | Ga0466962_0008462 | 3300061719 | Bacteria | 4929 |
| 872 | Ga0466962_0010274 | 3300061719 | Bacteria | 4495 |
| 873 | Ga0466962_0022320 | 3300061719 | Bacteria | 3041 |
| 874 | Ga0466962_0026584 | 3300061719 | Bacteria | 2778 |
| 875 | 2537898746 | 2537561592 | Bacteria | 4348607 |
| 876 | 2587862507 | 2585428094 | Bacteria | 3604039 |
| 877 | 2588108174 | 2585428157 | Bacteria | 3018951 |
| 878 | 2643733328 | 2643221542 | Bacteria | 3563959 |
| 879 | 2643753550 | 2643221546 | Bacteria | 2910897 |
| 880 | 2643767400 | 2643221549 | Bacteria | 4042819 |
| 881 | 2643786183 | 2643221553 | Bacteria | 3544260 |
| 882 | 2643848042 | 2643221566 | Bacteria | 3460379 |
| 883 | 2643874981 | 2643221572 | Bacteria | 3614809 |
| 884 | 2643885069 | 2643221575 | Bacteria | 4022601 |
| 885 | 2643995575 | 2643221597 | Bacteria | 3347721 |
| 886 | 2644083167 | 2643221613 | Bacteria | 4622396 |
| 887 | 2644097067 | 2643221616 | Bacteria | 4066575 |
| 888 | 2644110621 | 2643221619 | Bacteria | 4158469 |
| 889 | 2644169902 | 2643221630 | Bacteria | 3601215 |
| 890 | 2644183677 | 2643221632 | Bacteria | 3406696 |
| 891 | 2644199437 | 2643221635 | Bacteria | 2632343 |
| 892 | 2644279244 | 2643221649 | Bacteria | 3867359 |
| 893 | 2644382037 | 2643221669 | Bacteria | 3611286 |
| 894 | 2644665724 | 2643221721 | Bacteria | 4486924 |
| 895 | 2644680576 | 2643221724 | Bacteria | 3593515 |
| 896 | 2691513552 | 2690315906 | Bacteria | 4517044 |
| 897 | 2723642410 | 2721755702 | Bacteria | 4373124 |
| 898 | 2729906079 | 2728369276 | Bacteria | 5610032 |
| 899 | 2730230036 | 2728369380 | Bacteria | 3620317 |
| 900 | 2739250440 | 2738543013 | Bacteria | 5618633 |
| 901 | 2739326768 | 2738543027 | Bacteria | 6409078 |
| 902 | 2747954742 | 2747842429 | Bacteria | 3914386 |
| 903 | 2758227216 | 2757320536 | Bacteria | 3629334 |
| 904 | 2768644313 | 2767802112 | Bacteria | 6465194 |
| 905 | 2774381619 | 2773857758 | Bacteria | 3592392 |
| 906 | 2774384748 | 2773857759 | Bacteria | 2963774 |
| 907 | 2774399860 | 2773857763 | Bacteria | 4180068 |
| 908 | 2775656127 | 2775506735 | Bacteria | 4556596 |
| 909 | 2784471962 | 2784132109 | Bacteria | 3141763 |
| 910 | 2808631474 | 2808606306 | Bacteria | 3608896 |
| 911 | 2808830807 | 2808606357 | Bacteria | 4466944 |
| 912 | 2808851995 | 2808606360 | Bacteria | 4404006 |
| 913 | 2808879693 | 2808606366 | Bacteria | 4415912 |
| 914 | 2808885368 | 2808606368 | Bacteria | 3174172 |
| 915 | 2808890738 | 2808606370 | Bacteria | 4942454 |
| 916 | 2808896018 | 2808606371 | Bacteria | 4251511 |
| 917 | 2808902396 | 2808606372 | Bacteria | 4649509 |
| 918 | 2809227120 | 2808606447 | Bacteria | 3572005 |
| 919 | 2810365508 | 2808606700 | Bacteria | 3482157 |
| 920 | 2812321640 | 2811994871 | Bacteria | 4497550 |
| 921 | 2812322801 | 2811994872 | Bacteria | 4121241 |
| 922 | 2812364942 | 2811994880 | Bacteria | 4147780 |
| 923 | 2817509409 | 2816332305 | Bacteria | 2697803 |
| 924 | 2821269677 | 2821268502 | Bacteria | 3750023 |
| 925 | 2833710624 | 2833709550 | Bacteria | 4008291 |
| 926 | 2835188613 | 2835188231 | Bacteria | 3476928 |
| 927 | 2839989006 | 2839986021 | Bacteria | 3685650 |
| 928 | 2844842767 | 2844841374 | Bacteria | 3917147 |
| 929 | 2844852379 | 2844849076 | Bacteria | 4091819 |
| 930 | 2844855277 | 2844852863 | Bacteria | 3849151 |
| 931 | 2848552312 | 2848551377 | Bacteria | 3720646 |
| 932 | 2852633499 | 2852632344 | Bacteria | 3463163 |
| 933 | 2852645313 | 2852643534 | Bacteria | 3013378 |
| 934 | 2852648737 | 2852646457 | Bacteria | 3408613 |
| 935 | 2852666890 | 2852663356 | Bacteria | 4090475 |
| 936 | 2852679525 | 2852677369 | Bacteria | 3768884 |
| 937 | 2857480455 | 2857479173 | Bacteria | 2469263 |
| 938 | 2857634099 | 2857632687 | Bacteria | 2448521 |
| 939 | 2857712844 | 2857710386 | Bacteria | 3186771 |
| 940 | 2857720527 | 2857720070 | Bacteria | 3189373 |
| 941 | 2857724241 | 2857723135 | Bacteria | 4217853 |
| 942 | 2857732489 | 2857729791 | Bacteria | 4040535 |
| 943 | 2857735479 | 2857733635 | Bacteria | 3532004 |
| 944 | 2857740089 | 2857737099 | Bacteria | 3104305 |
| 945 | 2857744406 | 2857740372 | Bacteria | 4782044 |
| 946 | 2858872689 | 2858868258 | Bacteria | 7683772 |
| 947 | 2862996476 | 2862993130 | Bacteria | 3860849 |
| 948 | 2867351286 | 2867346516 | Bacteria | 7608576 |
| 949 | 2870623306 | 2870622029 | Bacteria | 3643329 |
| 950 | 2870630043 | 2870628048 | Bacteria | 3696012 |
| 951 | 2870802262 | 2870801768 | Bacteria | 2710986 |
| 952 | 2870804344 | 2870804320 | Bacteria | 2552467 |
| 953 | 2884765741 | 2884763398 | Bacteria | 4091164 |
| 954 | 2884995706 | 2884994152 | Bacteria | 4492978 |
| 955 | 2887446400 | 2887443736 | Bacteria | 4426037 |
| 956 | 2893684754 | 2893684298 | Bacteria | 2897960 |
| 957 | 2895661106 | 2895660088 | Bacteria | 3782833 |
| 958 | 2897563556 | 2897561785 | Bacteria | 3256946 |
| 959 | 2904433199 | 2904430863 | Bacteria | 3486923 |
| 960 | 2904501069 | 2904497146 | Bacteria | 4731781 |
| 961 | 2904502679 | 2904501621 | Bacteria | 3401437 |
| 962 | 2904512725 | 2904509784 | Bacteria | 3520416 |
| 963 | 2904778055 | 2904776348 | Bacteria | 4658726 |
| 964 | 2905927024 | 2905926851 | Bacteria | 4423176 |
| 965 | 2906800178 | 2906799679 | Bacteria | 4031749 |
| 966 | 2908677638 | 2908674828 | Bacteria | 3382763 |
| 967 | 2908681277 | 2908678064 | Bacteria | 3482747 |
| 968 | 2909075211 | 2909074476 | Bacteria | 3436050 |
| 969 | 2910813041 | 2910809715 | Bacteria | 4982797 |
| 970 | 2919038858 | 2919034639 | Bacteria | 4763403 |
| 971 | 2919040624 | 2919039151 | Bacteria | 3391018 |
| 972 | 2919043589 | 2919042368 | Bacteria | 3905917 |
| 973 | 2919051654 | 2919051321 | Bacteria | 4210889 |
| 974 | 2919058468 | 2919055335 | Bacteria | 3875751 |
| 975 | 2919062830 | 2919059106 | Bacteria | 4991624 |
| 976 | 2919071441 | 2919069694 | Bacteria | 3622919 |
| 977 | 2919393370 | 2919391150 | Bacteria | 4884741 |
| 978 | 2919398276 | 2919395869 | Bacteria | 3704152 |
| 979 | 2919445897 | 2919443155 | Bacteria | 4072969 |
| 980 | 2919524851 | 2919523602 | Bacteria | 3788128 |
| 981 | 2919542591 | 2919538618 | Bacteria | 4677069 |
| 982 | 2920882396 | 2920879853 | Bacteria | 4216831 |
| 983 | 2928078310 | 2928070936 | Bacteria | 8062541 |
| 984 | 2928092389 | 2928090899 | Bacteria | 3158267 |
| 985 | 2928108487 | 2928104781 | Bacteria | 3877447 |
| 986 | 2928122830 | 2928121344 | Bacteria | 3972376 |
| 987 | 2928156238 | 2928153084 | Bacteria | 4020257 |
| 988 | 2928501551 | 2928500415 | Bacteria | 3384541 |
| 989 | 2932430519 | 2932426870 | Bacteria | 4547726 |
| 990 | 2932434859 | 2932431166 | Bacteria | 4215299 |
| 991 | 2933421690 | 2933418574 | Bacteria | 4476724 |
| 992 | 2935412791 | 2935409751 | Bacteria | 4179611 |
| 993 | 2935894675 | 2935890801 | Bacteria | 4593001 |
| 994 | 2939600117 | 2939598168 | Bacteria | 4687164 |
| 995 | 2939651096 | 2939647034 | Bacteria | 4681660 |
| 996 | 2939657740 | 2939657138 | Bacteria | 3740283 |
| 997 | 2939660921 | 2939660829 | Bacteria | 3784848 |
| 998 | 2939678862 | 2939674588 | Bacteria | 4844420 |
| 999 | 2945919506 | 2945916053 | Bacteria | 4555517 |
| 1000 | 2945920380 | 2945920336 | Bacteria | 4501603 |
| 1001 | 2945943681 | 2945941187 | Bacteria | 4682474 |
| 1002 | 2945958135 | 2945956166 | Bacteria | 5110334 |
| 1003 | 2946004122 | 2946003308 | Bacteria | 3857229 |
| 1004 | 2946025446 | 2946024296 | Bacteria | 3508095 |
| 1005 | 2946033423 | 2946033335 | Bacteria | 3835514 |
| 1006 | 2946039654 | 2946037020 | Bacteria | 4900426 |
| 1007 | 2946044662 | 2946041624 | Bacteria | 4191385 |
| 1008 | 2946063230 | 2946059875 | Bacteria | 4386623 |
| 1009 | 2946080568 | 2946080515 | Bacteria | 4310960 |
| 1010 | 2954000879 | 2953998280 | Bacteria | 4812144 |
| 1011 | 2964326857 | 2964326757 | Bacteria | 3290868 |
| 1012 | 2966923351 | 2966921586 | Bacteria | 3092803 |
| 1013 | 2966924696 | 2966924647 | Bacteria | 3268643 |
| 1014 | 2974297745 | 2974294766 | Bacteria | 3767688 |
| 1015 | 2974303148 | 2974302888 | Bacteria | 4369871 |
| 1016 | 2974326021 | 2974324384 | Bacteria | 3750535 |
| 1017 | 2977230984 | 2977228692 | Bacteria | 3450105 |
| 1018 | 2977239779 | 2977236895 | Bacteria | 3569373 |
| 1019 | 2977253669 | 2977251589 | Bacteria | 2952848 |
| 1020 | 2984545948 | 2984542743 | Bacteria | 3569378 |
| 1021 | 2984553808 | 2984551494 | Bacteria | 3877562 |
| 1022 | 2984580845 | 2984580707 | Bacteria | 3351387 |
| 1023 | 2990049420 | 2990044586 | Bacteria | 6603797 |
| 1024 | 2995728259 | 2995726249 | Bacteria | 3470435 |
| 1025 | 8002812870 | 8002811521 | Bacteria | 2942897 |
| 1026 | 8004024144 | 8004021418 | Bacteria | 4313954 |
| 1027 | 8004184814 | 8004182704 | Bacteria | 3391155 |
| 1028 | 8004214414 | 8004212874 | Bacteria | 2861420 |
| 1029 | 8008489510 | 8008485437 | Bacteria | 7198341 |
| 1030 | 8016257921 | 8016254467 | Bacteria | 3797036 |
| 1031 | 8025528914 | 8025524527 | Bacteria | 7197316 |
| 1032 | 8033684929 | 8033684223 | Bacteria | 6906479 |
| 1033 | 8045830851 | 8045830549 | Bacteria | 4444727 |
| 1034 | 8046356165 | 8046352972 | Bacteria | 3613806 |
| 1035 | 8055035722 | 8055034563 | Bacteria | 3562128 |
| 1036 | 8055038721 | 8055037949 | Bacteria | 3337834 |
| 1037 | 8056037791 | 8056037122 | Bacteria | 3854319 |
| 1038 | 8056583741 | 8056579771 | Bacteria | 5840325 |
| 1039 | 8057349076 | 8057345674 | Bacteria | 4160394 |
| 1040 | Ga0501034_0052702 | |||
| 1041 | JGI24735J21928_10006502 | |||
| 1042 | JGI24735J21928_10013802 | |||
| 1043 | JGI25154J39366_1002688 | |||
| 1044 | JGI25164J39214_1000379 | |||
| 1045 | JGI25165J46597_1000004 | |||
| 1046 | Ga0006562J51391_1021896 | |||
| 1047 | Ga0006562J51391_1082829 | |||
| 1048 | Ga0006562J51391_1131020 | |||
| 1049 | Ga0006562J51391_1131021 | |||
| 1050 | Ga0055539_1000005 | |||
| 1051 | Ga0055539_1002881 | |||
| 1052 | Ga0055533_1000001 | |||
| 1053 | Ga0055525_1000297 | |||
| 1054 | Ga0055527_1000001 | |||
| 1055 | Ga0055529_1000019 | |||
| 1056 | Ga0055534_1002138 | |||
| 1057 | Ga0055541_1001174 | |||
| 1058 | Ga0065714_10010373 | |||
| 1059 | Ga0070658_10000616 | |||
| 1060 | Ga0070658_10009207 | |||
| 1061 | Ga0070658_10015628 | |||
| 1062 | Ga0070658_10015836 | |||
| 1063 | Ga0070683_100019962 | |||
| 1064 | Ga0068869_100001475 | |||
| 1065 | Ga0068869_100071046 | |||
| 1066 | Ga0070666_10020796 | |||
| 1067 | Ga0070666_10022178 | |||
| 1068 | Ga0070680_100005277 | |||
| 1069 | Ga0070680_100031263 | |||
| 1070 | Ga0070682_100010564 | |||
| 1071 | Ga0070682_100031338 | |||
| 1072 | Ga0068868_100005820 | |||
| 1073 | Ga0068868_100133319 | |||
| 1074 | Ga0070660_100088778 | |||
| 1075 | Ga0070689_100070071 | |||
| 1076 | Ga0070661_100050100 | |||
| 1077 | Ga0070669_100022907 | |||
| 1078 | Ga0070675_100014554 | |||
| 1079 | Ga0070671_100001939 | |||
| 1080 | Ga0070671_100074945 | |||
| 1081 | Ga0070659_100089072 | |||
| 1082 | Ga0070667_100007740 | |||
| 1083 | Ga0070667_100023777 | |||
| 1084 | Ga0070667_100077303 | |||
| 1085 | Ga0070709_10000696 | |||
| 1086 | Ga0070709_10011808 | |||
| 1087 | Ga0070709_10014114 | |||
| 1088 | Ga0070714_100000012 | |||
| 1089 | Ga0070714_100088519 | |||
| 1090 | Ga0070713_100031187 | |||
| 1091 | Ga0070710_10010715 | |||
| 1092 | Ga0070710_10041043 | |||
| 1093 | Ga0070711_100004803 | |||
| 1094 | Ga0070711_100038991 | |||
| 1095 | Ga0070711_100118850 | |||
| 1096 | Ga0070694_100051329 | |||
| 1097 | Ga0070708_100169119 | |||
| 1098 | Ga0070663_100003790 | |||
| 1099 | Ga0070663_100061352 | |||
| 1100 | Ga0070678_100016087 | |||
| 1101 | Ga0070681_10003063 | |||
| 1102 | Ga0070685_10035272 | |||
| 1103 | Ga0070707_100074225 | |||
| 1104 | Ga0070707_100139666 | |||
| 1105 | Ga0070699_100205298 | |||
| 1106 | Ga0070679_100002341 | |||
| 1107 | Ga0070684_100002989 | |||
| 1108 | Ga0068853_100032173 | |||
| 1109 | Ga0070672_100017136 | |||
| 1110 | Ga0070672_100216357 | |||
| 1111 | Ga0070672_100225304 | |||
| 1112 | Ga0070686_100039003 | |||
| 1113 | Ga0070695_100105702 | |||
| 1114 | Ga0070693_100003762 | |||
| 1115 | Ga0070693_100012396 | |||
| 1116 | Ga0070665_100000914 | |||
| 1117 | Ga0070665_100161395 | |||
| 1118 | Ga0070704_100111012 | |||
| 1119 | Ga0068855_100006610 | |||
| 1120 | Ga0068855_100007387 | |||
| 1121 | Ga0068855_100009838 | |||
| 1122 | Ga0068855_100064424 | |||
| 1123 | Ga0068855_100065057 | |||
| 1124 | Ga0068855_100161710 | |||
| 1125 | Ga0068855_100289162 | |||
| 1126 | Ga0070664_100010089 | |||
| 1127 | Ga0070664_100189924 | |||
| 1128 | Ga0068857_100001825 | |||
| 1129 | Ga0068857_100238892 | |||
| 1130 | Ga0068854_100012597 | |||
| 1131 | Ga0068856_100017394 | |||
| 1132 | Ga0068856_100029350 | |||
| 1133 | Ga0068856_100067818 | |||
| 1134 | Ga0068856_100069229 | |||
| 1135 | Ga0068856_100098280 | |||
| 1136 | Ga0068856_100126398 | |||
| 1137 | Ga0070702_100000113 | |||
| 1138 | Ga0068852_100004374 | |||
| 1139 | Ga0068852_100009980 | |||
| 1140 | Ga0068852_100070643 | |||
| 1141 | Ga0068859_100048050 | |||
| 1142 | Ga0068859_100094165 | |||
| 1143 | Ga0068864_100023109 | |||
| 1144 | Ga0068866_10010899 | |||
| 1145 | Ga0068851_10000020 | |||
| 1146 | Ga0068863_100001414 | |||
| 1147 | Ga0068863_100065426 | |||
| 1148 | Ga0068858_100001345 | |||
| 1149 | Ga0068858_100023362 | |||
| 1150 | Ga0068858_100112997 | |||
| 1151 | Ga0068860_100000043 | |||
| 1152 | Ga0068860_100186769 | |||
| 1153 | Ga0081455_10025487 | |||
| 1154 | Ga0081455_10043090 | |||
| 1155 | Ga0081538_10000110 | |||
| 1156 | Ga0081540_1002596 | |||
| 1157 | Ga0081540_1003581 | |||
| 1158 | Ga0070717_10021333 | |||
| 1159 | Ga0070717_10039517 | |||
| 1160 | Ga0075365_10005491 | |||
| 1161 | Ga0075365_10024553 | |||
| 1162 | Ga0075365_10148524 | |||
| 1163 | Ga0075363_100079023 | |||
| 1164 | Ga0075364_10011400 | |||
| 1165 | Ga0075364_10011888 | |||
| 1166 | Ga0075364_10129890 | |||
| 1167 | Ga0075432_10004784 | |||
| 1168 | Ga0070716_100026138 | |||
| 1169 | Ga0070716_100038720 | |||
| 1170 | Ga0070712_100009411 | |||
| 1171 | Ga0070712_100013737 | |||
| 1172 | Ga0075362_10000644 | |||
| 1173 | Ga0075362_10014314 | |||
| 1174 | Ga0075369_10002657 | |||
| 1175 | Ga0075369_10008071 | |||
| 1176 | Ga0075366_10010352 | |||
| 1177 | Ga0075370_10019588 | |||
| 1178 | Ga0068871_100087630 | |||
| 1179 | Ga0075433_10213221 | |||
| 1180 | Ga0075434_100042058 | |||
| 1181 | Ga0097620_100048049 | |||
| 1182 | Ga0097620_100094170 | |||
| 1183 | Ga0105244_10002101 | |||
| 1184 | Ga0105244_10017272 | |||
| 1185 | Ga0105240_10002778 | |||
| 1186 | Ga0105240_10016936 | |||
| 1187 | Ga0105240_10019688 | |||
| 1188 | Ga0105240_10139690 | |||
| 1189 | Ga0105240_10425251 | |||
| 1190 | Ga0111539_10001321 | |||
| 1191 | Ga0111539_10214696 | |||
| 1192 | Ga0105245_10006395 | |||
| 1193 | Ga0105245_10009353 | |||
| 1194 | Ga0105245_10017818 | |||
| 1195 | Ga0105245_10030291 | |||
| 1196 | Ga0105245_10052103 | |||
| 1197 | Ga0105245_10058674 | |||
| 1198 | Ga0105247_10012967 | |||
| 1199 | Ga0114129_10377364 | |||
| 1200 | Ga0105243_10007769 | |||
| 1201 | Ga0105243_10039114 | |||
| 1202 | Ga0105243_10093330 | |||
| 1203 | Ga0105243_10135954 | |||
| 1204 | Ga0105243_10174873 | |||
| 1205 | Ga0105241_10000285 | |||
| 1206 | Ga0105241_10021063 | |||
| 1207 | Ga0105241_10183247 | |||
| 1208 | Ga0105241_10239430 | |||
| 1209 | Ga0105242_10017332 | |||
| 1210 | Ga0105242_10018016 | |||
| 1211 | Ga0105248_10007135 | |||
| 1212 | Ga0105248_10262257 | |||
| 1213 | Ga0105237_10001300 | |||
| 1214 | Ga0105237_10076283 | |||
| 1215 | Ga0105237_10086749 | |||
| 1216 | Ga0105237_10155543 | |||
| 1217 | Ga0105238_10011322 | |||
| 1218 | Ga0105238_10186967 | |||
| 1219 | Ga0105249_10035707 | |||
| 1220 | Ga0105249_10104861 | |||
| 1221 | Ga0105249_10129544 | |||
| 1222 | Ga0105239_10006959 | |||
| 1223 | Ga0105239_10071813 | |||
| 1224 | Ga0105239_10170809 | |||
| 1225 | Ga0105239_10171609 | |||
| 1226 | Ga0105239_10336601 | |||
| 1227 | Ga0105246_10000311 | |||
| 1228 | Ga0105246_10000653 | |||
| 1229 | Ga0105246_10047159 | |||
| 1230 | Ga0157371_10002137 | |||
| 1231 | Ga0157371_10101690 | |||
| 1232 | Ga0157370_10001273 | |||
| 1233 | Ga0157370_10036533 | |||
| 1234 | Ga0157369_10003857 | |||
| 1235 | Ga0157369_10064865 | |||
| 1236 | Ga0157369_10094480 | |||
| 1237 | Ga0171462_1003 | |||
| 1238 | Ga0157374_10148599 | |||
| 1239 | Ga0157374_10243151 | |||
| 1240 | Ga0163162_10015489 | |||
| 1241 | Ga0163162_10054437 | |||
| 1242 | Ga0157372_10000025 | |||
| 1243 | Ga0157372_10109939 | |||
| 1244 | Ga0157375_10010156 | |||
| 1245 | Ga0157375_10083023 | |||
| 1246 | Ga0157375_10241795 | |||
| 1247 | Ga0157375_10348412 | |||
| 1248 | Ga0163163_10055231 | |||
| 1249 | Ga0163163_10100474 | |||
| 1250 | Ga0157377_10010797 | |||
| 1251 | Ga0157379_10020390 | |||
| 1252 | Ga0157379_10035121 | |||
| 1253 | Ga0157379_10046646 | |||
| 1254 | Ga0157379_10281069 | |||
| 1255 | Ga0183362_10010 | |||
| 1256 | Ga0163161_10023675 | |||
| 1257 | Ga0163161_10047901 | |||
| 1258 | Ga0197907_10914208 | |||
| 1259 | Ga0206354_11077811 | |||
| 1260 | Ga0206353_10393585 | |||
| 1261 | Ga0209566_100240 | |||
| 1262 | Ga0209674_100001 | |||
| 1263 | Ga0209672_100006 | |||
| 1264 | Ga0209147_103547 | |||
| 1265 | Ga0209563_100001 | |||
| 1266 | Ga0209563_100215 | |||
| 1267 | Ga0207427_100010 | |||
| 1268 | Ga0209437_100216 | |||
| 1269 | Ga0209646_1000248 | |||
| 1270 | Ga0209677_100001 | |||
| 1271 | Ga0209677_100951 | |||
| 1272 | Ga0209148_1000015 | |||
| 1273 | Ga0209148_1000731 | |||
| 1274 | Ga0209148_1006877 | |||
| 1275 | Ga0209233_1000001 | |||
| 1276 | Ga0209455_1000013 | |||
| 1277 | Ga0209455_1001444 | |||
| 1278 | Ga0209130_1004326 | |||
| 1279 | Ga0209675_1010798 | |||
| 1280 | Ga0209676_1016487 | |||
| 1281 | Ga0207697_10001880 | |||
| 1282 | Ga0207697_10018919 | |||
| 1283 | Ga0207656_10000003 | |||
| 1284 | Ga0207655_1001340 | |||
| 1285 | Ga0207655_1013440 | |||
| 1286 | Ga0207655_1014313 | |||
| 1287 | Ga0207655_1023219 | |||
| 1288 | Ga0207655_1024469 | |||
| 1289 | Ga0207655_1035426 | |||
| 1290 | Ga0207710_10004994 | |||
| 1291 | Ga0207710_10049273 | |||
| 1292 | Ga0207688_10018777 | |||
| 1293 | Ga0207680_10015052 | |||
| 1294 | Ga0207647_10046217 | |||
| 1295 | Ga0207647_10046371 | |||
| 1296 | Ga0207645_10011404 | |||
| 1297 | Ga0207645_10108981 | |||
| 1298 | Ga0207643_10065782 | |||
| 1299 | Ga0207705_10000006 | |||
| 1300 | Ga0207705_10029732 | |||
| 1301 | Ga0207705_10097814 | |||
| 1302 | Ga0207654_10000003 | |||
| 1303 | Ga0207654_10020288 | |||
| 1304 | Ga0207654_10053670 | |||
| 1305 | Ga0207654_10090465 | |||
| 1306 | Ga0207654_10098521 | |||
| 1307 | Ga0207707_10002791 | |||
| 1308 | Ga0207695_10001243 | |||
| 1309 | Ga0207695_10006991 | |||
| 1310 | Ga0207695_10060553 | |||
| 1311 | Ga0207671_10000002 | |||
| 1312 | Ga0207671_10017364 | |||
| 1313 | Ga0207671_10038615 | |||
| 1314 | Ga0207671_10039960 | |||
| 1315 | Ga0207693_10002172 | |||
| 1316 | Ga0207693_10029023 | |||
| 1317 | Ga0207693_10185850 | |||
| 1318 | Ga0207660_10004954 | |||
| 1319 | Ga0207657_10010287 | |||
| 1320 | Ga0207657_10012590 | |||
| 1321 | Ga0207649_10006683 | |||
| 1322 | Ga0207652_10205837 | |||
| 1323 | Ga0207694_10000073 | |||
| 1324 | Ga0207694_10040301 | |||
| 1325 | Ga0207659_10004965 | |||
| 1326 | Ga0207687_10000517 | |||
| 1327 | Ga0207687_10005501 | |||
| 1328 | Ga0207687_10030771 | |||
| 1329 | Ga0207687_10046453 | |||
| 1330 | Ga0207664_10000003 | |||
| 1331 | Ga0207644_10033871 | |||
| 1332 | Ga0207644_10169578 | |||
| 1333 | Ga0207706_10031614 | |||
| 1334 | Ga0207706_10059806 | |||
| 1335 | Ga0207686_10021435 | |||
| 1336 | Ga0207709_10031539 | |||
| 1337 | Ga0207709_10038443 | |||
| 1338 | Ga0207709_10206223 | |||
| 1339 | Ga0207704_10062302 | |||
| 1340 | Ga0207665_10002334 | |||
| 1341 | Ga0207665_10037514 | |||
| 1342 | Ga0207665_10061257 | |||
| 1343 | Ga0207691_10010262 | |||
| 1344 | Ga0207691_10028775 | |||
| 1345 | Ga0207691_10194508 | |||
| 1346 | Ga0207711_10000352 | |||
| 1347 | Ga0207711_10015798 | |||
| 1348 | Ga0207689_10004967 | |||
| 1349 | Ga0207689_10012709 | |||
| 1350 | Ga0207661_10133637 | |||
| 1351 | Ga0207679_10053047 | |||
| 1352 | Ga0207679_10112492 | |||
| 1353 | Ga0207667_10004737 | |||
| 1354 | Ga0207712_10055698 | |||
| 1355 | Ga0207668_10027457 | |||
| 1356 | Ga0207658_10037729 | |||
| 1357 | Ga0207658_10145606 | |||
| 1358 | Ga0207658_10209832 | |||
| 1359 | Ga0207677_10011616 | |||
| 1360 | Ga0207677_10066786 | |||
| 1361 | Ga0207677_10172102 | |||
| 1362 | Ga0207703_10001586 | |||
| 1363 | Ga0207703_10018291 | |||
| 1364 | Ga0207639_10003804 | |||
| 1365 | Ga0207678_10005002 | |||
| 1366 | Ga0207702_10037241 | |||
| 1367 | Ga0207702_10041282 | |||
| 1368 | Ga0207702_10050239 | |||
| 1369 | Ga0207702_10122273 | |||
| 1370 | Ga0207702_10183678 | |||
| 1371 | Ga0207641_10006468 | |||
| 1372 | Ga0207641_10077654 | |||
| 1373 | Ga0207648_10119855 | |||
| 1374 | Ga0207676_10083152 | |||
| 1375 | Ga0207674_10001204 | |||
| 1376 | Ga0207674_10029619 | |||
| 1377 | Ga0207674_10091783 | |||
| 1378 | Ga0207675_100021179 | |||
| 1379 | Ga0207683_10003270 | |||
| 1380 | Ga0207683_10011750 | |||
| 1381 | Ga0207683_10019462 | |||
| 1382 | Ga0207698_10000464 | |||
| 1383 | Ga0207698_10002958 | |||
| 1384 | Ga0207698_10014721 | |||
| 1385 | Ga0268266_10001243 | |||
| 1386 | Ga0268266_10043615 | |||
| 1387 | Ga0268264_10000027 | |||
| 1388 | Ga0307515_10109140 | |||
| 1389 | Ga0265338_10000717 | |||
| 1390 | Ga0265338_10057924 | |||
| 1391 | Ga0265325_10004206 | |||
| 1392 | Ga0265325_10032071 | |||
| 1393 | Ga0265340_10001055 | |||
| 1394 | Ga0265339_10007115 | |||
| 1395 | Ga0265339_10042837 | |||
| 1396 | Ga0265331_10031328 | |||
| 1397 | Ga0307408_100007066 | |||
| 1398 | Ga0307408_100009782 | |||
| 1399 | Ga0307408_100016396 | |||
| 1400 | Ga0307408_100028312 | |||
| 1401 | Ga0307408_100086337 | |||
| 1402 | Ga0307408_100152480 | |||
| 1403 | Ga0265313_10052123 | |||
| 1404 | Ga0265314_10029009 | |||
| 1405 | Ga0265342_10056102 | |||
| 1406 | Ga0316576_10000350 | |||
| 1407 | Ga0316576_10057225 | |||
| 1408 | Ga0307405_10011887 | |||
| 1409 | Ga0307405_10023558 | |||
| 1410 | Ga0307405_10029133 | |||
| 1411 | Ga0307405_10049026 | |||
| 1412 | Ga0307405_10061709 | |||
| 1413 | Ga0307405_10154322 | |||
| 1414 | Ga0307405_10176173 | |||
| 1415 | Ga0307413_10010627 | |||
| 1416 | Ga0307413_10012529 | |||
| 1417 | Ga0307413_10016823 | |||
| 1418 | Ga0307413_10033043 | |||
| 1419 | Ga0307413_10185149 | |||
| 1420 | Ga0307410_10001736 | |||
| 1421 | Ga0307410_10016463 | |||
| 1422 | Ga0307410_10017646 | |||
| 1423 | Ga0307410_10022344 | |||
| 1424 | Ga0307410_10043132 | |||
| 1425 | Ga0307410_10050352 | |||
| 1426 | Ga0307410_10080877 | |||
| 1427 | Ga0307406_10000034 | |||
| 1428 | Ga0307406_10000392 | |||
| 1429 | Ga0307406_10012680 | |||
| 1430 | Ga0307406_10029468 | |||
| 1431 | Ga0307406_10052020 | |||
| 1432 | Ga0307407_10008616 | |||
| 1433 | Ga0307407_10017688 | |||
| 1434 | Ga0307407_10069558 | |||
| 1435 | Ga0307407_10100975 | |||
| 1436 | Ga0307412_10000868 | |||
| 1437 | Ga0307412_10016411 | |||
| 1438 | Ga0307412_10019627 | |||
| 1439 | Ga0307412_10030768 | |||
| 1440 | Ga0307412_10073137 | |||
| 1441 | Ga0307412_10126902 | |||
| 1442 | Ga0307409_100001350 | |||
| 1443 | Ga0307409_100009337 | |||
| 1444 | Ga0307409_100044601 | |||
| 1445 | Ga0307416_100019022 | |||
| 1446 | Ga0307416_100064227 | |||
| 1447 | Ga0307416_100066631 | |||
| 1448 | Ga0307416_100095294 | |||
| 1449 | Ga0307416_100124090 | |||
| 1450 | Ga0307416_100175645 | |||
| 1451 | Ga0307416_100206303 | |||
| 1452 | Ga0307416_100292020 | |||
| 1453 | Ga0307414_10049282 | |||
| 1454 | Ga0307411_10022784 | |||
| 1455 | Ga0307411_10060135 | |||
| 1456 | Ga0307415_100009626 | |||
| 1457 | Ga0373923_0036629 | |||
| 1458 | Ga0373953_0017287 | |||
| 1459 | Ga0373943_0024788 | |||
| 1460 | Ga0373942_0013218 | |||
| 1461 | Ga0316574_0024039 | |||
| 1462 | Ga0316574_0058518 | |||
| 1463 | Ga0373935_0082051 | |||
| 1464 | Ga0316584_0010630 | |||
| 1465 | Ga0395899_0031249 | |||
| 1466 | Ga0395899_0049616 | |||
| 1467 | Ga0395899_0052909 | |||
| 1468 | Ga0395899_0070876 | |||
| 1469 | Ga0395899_0097879 | |||
| 1470 | Ga0395900_0023442 | |||
| 1471 | Ga0395900_0027560 | |||
| 1472 | Ga0395900_0031146 | |||
| 1473 | Ga0395900_0048579 | |||
| 1474 | Ga0395900_0049354 | |||
| 1475 | Ga0395900_0194492 | |||
| 1476 | Ga0395898_0000015 | |||
| 1477 | Ga0395898_0008364 | |||
| 1478 | Ga0395898_0010700 | |||
| 1479 | Ga0395898_0021565 | |||
| 1480 | Ga0395898_0049208 | |||
| 1481 | Ga0395898_0102772 | |||
| 1482 | Ga0395898_0229308 | |||
| 1483 | Ga0395905_0071058 | |||
| 1484 | Ga0395901_0005712 | |||
| 1485 | Ga0395901_0014744 | |||
| 1486 | Ga0395901_0026196 | |||
| 1487 | Ga0395901_0033857 | |||
| 1488 | Ga0395901_0104971 | |||
| 1489 | Ga0395901_0121139 | |||
| 1490 | Ga0395901_0136118 | |||
| 1491 | Ga0395901_0193483 | |||
| 1492 | Ga0395901_0211518 | |||
| 1493 | Ga0395901_0265716 | |||
| 1494 | Ga0439436_0000191 | |||
| 1495 | Ga0439436_0009512 | |||
| 1496 | Ga0439436_0018571 | |||
| 1497 | Ga0439439_0004216 | |||
| 1498 | Ga0439439_0005898 | |||
| 1499 | Ga0439466_0009633 | |||
| 1500 | Ga0439465_0026069 | |||
| 1501 | Ga0451806_009371 | |||
| 1502 | Ga0451853_3313517 | |||
| 1503 | Ga0439442_000053 | |||
| 1504 | Ga0439442_000228 | |||
| 1505 | Ga0439442_004449 | |||
| 1506 | Ga0439442_007220 | |||
| 1507 | Ga0439445_0005744 | |||
| 1508 | Ga0439432_005896 | |||
| 1509 | Ga0439432_030422 | |||
| 1510 | Ga0439449_0000387 | |||
| 1511 | Ga0439449_0006234 | |||
| 1512 | Ga0439449_0011604 | |||
| 1513 | Ga0439452_003748 | |||
| 1514 | Ga0439457_001930 | |||
| 1515 | Ga0439457_005001 | |||
| 1516 | Ga0439457_009687 | |||
| 1517 | Ga0439462_0000865 | |||
| 1518 | Ga0439462_0005085 | |||
| 1519 | Ga0450911_001576 | |||
| 1520 | Ga0450919_000400 | |||
| 1521 | Ga0450920_001058 | |||
| 1522 | Ga0450907_000157 | |||
| 1523 | Ga0439446_0020098 | |||
| 1524 | Ga0450908_002011 | |||
| 1525 | Ga0450909_000232 | |||
| 1526 | Ga0439434_0000258 | |||
| 1527 | Ga0439434_0006980 | |||
| 1528 | Ga0450918_003717 | |||
| 1529 | Ga0450893_0008043 | |||
| 1530 | Ga0466969_0055206 | |||
| 1531 | Ga0466972_0002555 | |||
| 1532 | Ga0466965_0000015 | |||
| 1533 | Ga0466965_0038086 | |||
| 1534 | Ga0466965_0039178 | |||
| 1535 | Ga0466966_0000651 | |||
| 1536 | Ga0466966_0016602 | |||
| 1537 | Ga0466966_0043624 | |||
| 1538 | Ga0466966_0078915 | |||
| 1539 | Ga0466961_0002633 | |||
| 1540 | Ga0466961_0021649 | |||
| 1541 | Ga0466961_0029915 | |||
| 1542 | Ga0466961_0042614 | |||
| 1543 | Ga0466961_0062165 | |||
| 1544 | Ga0466961_0081472 | |||
| 1545 | Ga0466961_0086138 | |||
| 1546 | Ga0466963_0005450 | |||
| 1547 | Ga0466963_0008471 | |||
| 1548 | Ga0466963_0018106 | |||
| 1549 | Ga0466963_0049742 | |||
| 1550 | Ga0466963_0074712 | |||
| 1551 | Ga0466963_0094457 | |||
| 1552 | Ga0466971_0026081 | |||
| 1553 | Ga0466971_0101217 | |||
| 1554 | Ga0466970_0000004 | |||
| 1555 | Ga0466970_0041981 | |||
| 1556 | Ga0466970_0098058 | |||
| 1557 | Ga0466957_0026793 | |||
| 1558 | Ga0466957_0059420 | |||
| 1559 | Ga0466960_0005621 | |||
| 1560 | Ga0466959_0013199 | |||
| 1561 | Ga0466958_0010879 | |||
| 1562 | Ga0466967_0000729 | |||
| 1563 | Ga0466967_0015629 | |||
| 1564 | Ga0466967_0016226 | |||
| 1565 | Ga0466967_0048514 | |||
| 1566 | Ga0466967_0076530 | |||
| 1567 | Ga0466967_0122350 | |||
| 1568 | Ga0466967_0134998 | |||
| 1569 | Ga0466967_0181017 | |||
| 1570 | Ga0466967_0194649 | |||
| 1571 | Ga0466967_0353215 | |||
| 1572 | Ga0495627_004139 | |||
| 1573 | Ga0495590_0000279 | |||
| 1574 | Ga0495629_0009176 | |||
| 1575 | Ga0495651_0006649 | |||
| 1576 | Ga0495653_0030356 | |||
| 1577 | Ga0495653_0042128 | |||
| 1578 | Ga0495650_0000763 | |||
| 1579 | Ga0495582_0101864 | |||
| 1580 | Ga0495639_0009546 | |||
| 1581 | Ga0495662_0022647 | |||
| 1582 | Ga0495664_0048062 | |||
| 1583 | Ga0495594_0012572 | |||
| 1584 | Ga0495628_0052851 | |||
| 1585 | Ga0495630_0037997 | |||
| 1586 | Ga0495643_0040276 | |||
| 1587 | Ga0495665_0001619 | |||
| 1588 | Ga0495640_0036300 | |||
| 1589 | Ga0495586_0010858 | |||
| 1590 | Ga0495587_0006448 | |||
| 1591 | Ga0495621_0007740 | |||
| 1592 | Ga0495645_0000761 | |||
| 1593 | Ga0495645_0070863 | |||
| 1594 | Ga0495645_0130917 | |||
| 1595 | Ga0495667_0002112 | |||
| 1596 | Ga0495656_0000193 | |||
| 1597 | Ga0495659_0027434 | |||
| 1598 | Ga0495588_0000869 | |||
| 1599 | Ga0495588_0004339 | |||
| 1600 | Ga0495657_0014449 | |||
| 1601 | Ga0495623_0025154 | |||
| 1602 | Ga0495646_0025391 | |||
| 1603 | Ga0495647_0019961 | |||
| 1604 | Ga0495658_0028888 | |||
| 1605 | Ga0495613_0030212 | |||
| 1606 | Ga0495613_0066177 | |||
| 1607 | Ga0495670_0015905 | |||
| 1608 | Ga0495670_0062585 | |||
| 1609 | Ga0495670_0087896 | |||
| 1610 | Ga0495581_0021314 | |||
| 1611 | Ga0495581_0098279 | |||
| 1612 | Ga0495672_0036431 | |||
| 1613 | Ga0495680_0020771 | |||
| 1614 | Ga0495680_0028340 | |||
| 1615 | Ga0495675_0020962 | |||
| 1616 | Ga0495593_0013931 | |||
| 1617 | Ga0495593_0092425 | |||
| 1618 | Ga0496100_0067631 | |||
| 1619 | Ga0496101_0002802 | |||
| 1620 | Ga0496101_0023516 | |||
| 1621 | Ga0496101_0103536 | |||
| 1622 | Ga0496102_0000110 | |||
| 1623 | Ga0496102_0000602 | |||
| 1624 | Ga0496102_0034601 | |||
| 1625 | Ga0496102_0089803 | |||
| 1626 | Ga0496102_0216999 | |||
| 1627 | Ga0496103_0000135 | |||
| 1628 | Ga0496103_0006592 | |||
| 1629 | Ga0496103_0007234 | |||
| 1630 | Ga0496103_0020706 | |||
| 1631 | Ga0496103_0115191 | |||
| 1632 | Ga0496103_0129614 | |||
| 1633 | Ga0496103_0173792 | |||
| 1634 | Ga0496104_0000407 | |||
| 1635 | Ga0496104_0021197 | |||
| 1636 | Ga0496104_0089625 | |||
| 1637 | Ga0496104_0201576 | |||
| 1638 | Ga0496105_0000185 | |||
| 1639 | Ga0496105_0016507 | |||
| 1640 | Ga0496105_0027352 | |||
| 1641 | Ga0496105_0047628 | |||
| 1642 | Ga0496105_0072736 | |||
| 1643 | Ga0496105_0106265 | |||
| 1644 | Ga0496106_0020317 | |||
| 1645 | Ga0496106_0027839 | |||
| 1646 | Ga0496106_0085263 | |||
| 1647 | Ga0496107_0031322 | |||
| 1648 | Ga0496107_0128502 | |||
| 1649 | Ga0496108_0001727 | |||
| 1650 | Ga0496108_0003760 | |||
| 1651 | Ga0496108_0009615 | |||
| 1652 | Ga0496108_0045121 | |||
| 1653 | Ga0496108_0066626 | |||
| 1654 | Ga0496108_0143878 | |||
| 1655 | Ga0496109_0002285 | |||
| 1656 | Ga0496109_0032839 | |||
| 1657 | Ga0496109_0035481 | |||
| 1658 | Ga0496109_0173239 | |||
| 1659 | Ga0496109_0176417 | |||
| 1660 | Ga0496110_0004627 | |||
| 1661 | Ga0496110_0028626 | |||
| 1662 | Ga0496110_0032811 | |||
| 1663 | Ga0496110_0056922 | |||
| 1664 | Ga0496110_0063531 | |||
| 1665 | Ga0496110_0221381 | |||
| 1666 | Ga0496111_0000336 | |||
| 1667 | Ga0496111_0003011 | |||
| 1668 | Ga0496111_0014853 | |||
| 1669 | Ga0496111_0035211 | |||
| 1670 | Ga0496111_0125307 | |||
| 1671 | Ga0496111_0160602 | |||
| 1672 | Ga0496112_0003509 | |||
| 1673 | Ga0496112_0042923 | |||
| 1674 | Ga0496112_0114729 | |||
| 1675 | Ga0496112_0153118 | |||
| 1676 | Ga0496112_0259724 | |||
| 1677 | Ga0496113_0005179 | |||
| 1678 | Ga0496113_0030869 | |||
| 1679 | Ga0496113_0031659 | |||
| 1680 | Ga0496113_0079464 | |||
| 1681 | Ga0496113_0164574 | |||
| 1682 | Ga0496114_0003212 | |||
| 1683 | Ga0496114_0038389 | |||
| 1684 | Ga0496114_0061362 | |||
| 1685 | Ga0496114_0146526 | |||
| 1686 | Ga0496115_0031536 | |||
| 1687 | Ga0496115_0065590 | |||
| 1688 | Ga0496115_0088953 | |||
| 1689 | Ga0496116_0010627 | |||
| 1690 | Ga0496117_0000232 | |||
| 1691 | Ga0496117_0001383 | |||
| 1692 | Ga0496117_0002730 | |||
| 1693 | Ga0496117_0007872 | |||
| 1694 | Ga0496117_0008761 | |||
| 1695 | Ga0496117_0019357 | |||
| 1696 | Ga0496117_0064537 | |||
| 1697 | Ga0496118_0000134 | |||
| 1698 | Ga0496118_0010662 | |||
| 1699 | Ga0496118_0012064 | |||
| 1700 | Ga0496118_0018385 | |||
| 1701 | Ga0496119_0001043 | |||
| 1702 | Ga0496119_0001189 | |||
| 1703 | Ga0496119_0001941 | |||
| 1704 | Ga0496119_0002335 | |||
| 1705 | Ga0496119_0005825 | |||
| 1706 | Ga0496119_0010849 | |||
| 1707 | Ga0496119_0034272 | |||
| 1708 | Ga0496120_0001174 | |||
| 1709 | Ga0496120_0001282 | |||
| 1710 | Ga0496120_0003000 | |||
| 1711 | Ga0496120_0003591 | |||
| 1712 | Ga0496120_0004696 | |||
| 1713 | Ga0496120_0010259 | |||
| 1714 | Ga0496120_0033941 | |||
| 1715 | Ga0496120_0038940 | |||
| 1716 | Ga0496120_0054212 | |||
| 1717 | Ga0496120_0075384 | |||
| 1718 | Ga0496121_0000040 | |||
| 1719 | Ga0496121_0017339 | |||
| 1720 | Ga0496121_0021940 | |||
| 1721 | Ga0496121_0097641 | |||
| 1722 | Ga0496122_0000030 | |||
| 1723 | Ga0496122_0002594 | |||
| 1724 | Ga0496122_0002595 | |||
| 1725 | Ga0496122_0004089 | |||
| 1726 | Ga0496122_0028059 | |||
| 1727 | Ga0496122_0035512 | |||
| 1728 | Ga0496122_0103048 | |||
| 1729 | Ga0496123_0000024 | |||
| 1730 | Ga0496123_0000051 | |||
| 1731 | Ga0496123_0001071 | |||
| 1732 | Ga0496123_0002826 | |||
| 1733 | Ga0496123_0011351 | |||
| 1734 | Ga0496123_0041459 | |||
| 1735 | Ga0496124_0000134 | |||
| 1736 | Ga0496124_0001836 | |||
| 1737 | Ga0496124_0007705 | |||
| 1738 | Ga0496124_0027988 | |||
| 1739 | Ga0496124_0072879 | |||
| 1740 | Ga0496125_0000097 | |||
| 1741 | Ga0496125_0004040 | |||
| 1742 | Ga0496125_0013210 | |||
| 1743 | Ga0496125_0040465 | |||
| 1744 | Ga0496125_0054205 | |||
| 1745 | Ga0496125_0089027 | |||
| 1746 | Ga0496125_0124967 | |||
| 1747 | Ga0496126_0000022 | |||
| 1748 | Ga0496126_0000072 | |||
| 1749 | Ga0496126_0002454 | |||
| 1750 | Ga0496126_0008783 | |||
| 1751 | Ga0496126_0014995 | |||
| 1752 | Ga0496126_0017351 | |||
| 1753 | Ga0496126_0040234 | |||
| 1754 | Ga0496126_0042259 | |||
| 1755 | Ga0496126_0083190 | |||
| 1756 | Ga0496126_0122079 | |||
| 1757 | Ga0501317_002004 | |||
| 1758 | Ga0501317_002136 | |||
| 1759 | Ga0501318_001580 | |||
| 1760 | Ga0501320_002124 | |||
| 1761 | Ga0501321_001697 | |||
| 1762 | Ga0501325_000901 | |||
| 1763 | Ga0501031_0021945 | |||
| 1764 | Ga0501031_0038829 | |||
| 1765 | Ga0501031_0052797 | |||
| 1766 | Ga0501031_0135650 | |||
| 1767 | Ga0501032_0000415 | |||
| 1768 | Ga0501032_0003113 | |||
| 1769 | Ga0501032_0006209 | |||
| 1770 | Ga0501033_0000989 | |||
| 1771 | Ga0501033_0007497 | |||
| 1772 | Ga0501033_0007920 | |||
| 1773 | Ga0501033_0053638 | |||
| 1774 | Ga0501033_0135847 | |||
| 1775 | Ga0501034_0000080 | |||
| 1776 | Ga0501034_0000227 | |||
| 1777 | Ga0501034_0016744 | |||
| 1778 | Ga0501034_0024191 | |||
| 1779 | Ga0501034_0081913 | |||
| 1780 | Ga0501034_0133511 | |||
| 1781 | Ga0501034_0170385 | |||
| 1782 | Ga0501034_0263120 | |||
| 1783 | Ga0501034_0289088 | |||
| 1784 | Ga0501036_0018043 | |||
| 1785 | Ga0501036_0194717 | |||
| 1786 | Ga0501037_0005467 | |||
| 1787 | Ga0501037_0008612 | |||
| 1788 | Ga0501037_0009463 | |||
| 1789 | Ga0501037_0013666 | |||
| 1790 | Ga0501037_0028173 | |||
| 1791 | Ga0501037_0044709 | |||
| 1792 | Ga0501037_0044714 | |||
| 1793 | Ga0501037_0060855 | |||
| 1794 | Ga0501037_0087970 | |||
| 1795 | Ga0501038_0007892 | |||
| 1796 | Ga0501038_0008532 | |||
| 1797 | Ga0501038_0010191 | |||
| 1798 | Ga0501038_0011798 | |||
| 1799 | Ga0501038_0037561 | |||
| 1800 | Ga0501038_0042844 | |||
| 1801 | Ga0501038_0185895 | |||
| 1802 | Ga0501039_0069270 | |||
| 1803 | Ga0501039_0157216 | |||
| 1804 | Ga0501039_0165801 | |||
| 1805 | Ga0501042_0046735 | |||
| 1806 | Ga0501043_0011547 | |||
| 1807 | Ga0501043_0016668 | |||
| 1808 | Ga0501043_0021039 | |||
| 1809 | Ga0501043_0022980 | |||
| 1810 | Ga0501043_0028906 | |||
| 1811 | Ga0501043_0063050 | |||
| 1812 | Ga0501043_0067160 | |||
| 1813 | Ga0501043_0082894 | |||
| 1814 | Ga0501043_0188474 | |||
| 1815 | Ga0501046_0001194 | |||
| 1816 | Ga0501046_0001908 | |||
| 1817 | Ga0501046_0012399 | |||
| 1818 | Ga0501046_0023076 | |||
| 1819 | Ga0501047_0000309 | |||
| 1820 | Ga0501047_0004842 | |||
| 1821 | Ga0501047_0008056 | |||
| 1822 | Ga0501047_0011123 | |||
| 1823 | Ga0501047_0035420 | |||
| 1824 | Ga0501047_0043307 | |||
| 1825 | Ga0501047_0332526 | |||
| 1826 | Ga0501048_0060787 | |||
| 1827 | Ga0501048_0115066 | |||
| 1828 | Ga0501067_0024323 | |||
| 1829 | Ga0501067_0049109 | |||
| 1830 | Ga0501069_0081399 | |||
| 1831 | Ga0501070_0000786 | |||
| 1832 | Ga0501070_0001897 | |||
| 1833 | Ga0501070_0002246 | |||
| 1834 | Ga0501070_0017879 | |||
| 1835 | Ga0501070_0026745 | |||
| 1836 | Ga0501070_0039757 | |||
| 1837 | Ga0501070_0049973 | |||
| 1838 | Ga0501070_0067754 | |||
| 1839 | Ga0501070_0133691 | |||
| 1840 | Ga0501071_0067192 | |||
| 1841 | Ga0501071_0150567 | |||
| 1842 | Ga0501072_0014137 | |||
| 1843 | Ga0501073_0000940 | |||
| 1844 | Ga0501073_0041524 | |||
| 1845 | Ga0501073_0048987 | |||
| 1846 | Ga0501075_0037513 | |||
| 1847 | Ga0501077_0042366 | |||
| 1848 | Ga0501077_0129384 | |||
| 1849 | Ga0501080_0091627 | |||
| 1850 | Ga0501081_0096409 | |||
| 1851 | Ga0501083_0000027 | |||
| 1852 | Ga0501083_0014487 | |||
| 1853 | Ga0501035_0001774 | |||
| 1854 | Ga0501035_0041081 | |||
| 1855 | Ga0501035_0105764 | |||
| 1856 | Ga0501035_0138189 | |||
| 1857 | Ga0501035_0156852 | |||
| 1858 | Ga0501044_0000673 | |||
| 1859 | Ga0501044_0004313 | |||
| 1860 | Ga0501044_0004715 | |||
| 1861 | Ga0501044_0006429 | |||
| 1862 | Ga0501044_0066604 | |||
| 1863 | Ga0501044_0067096 | |||
| 1864 | Ga0501044_0074344 | |||
| 1865 | Ga0501044_0138223 | |||
| 1866 | Ga0501045_0170402 | |||
| 1867 | nmdc:mga03683_604_c1 | |||
| 1868 | nmdc:mga03n38_7434_c2 | |||
| 1869 | nmdc:mga00v17_21027_c1 | |||
| 1870 | nmdc:mga00v17_23467_c1 | |||
| 1871 | nmdc:mga0yw44_103570_c1 | |||
| 1872 | nmdc:mga0yw44_23090_c1 | |||
| 1873 | nmdc:mga0k408_18971_c1 | |||
| 1874 | nmdc:mga07m45_35367_c1 | |||
| 1875 | nmdc:mga0rr50_59796_c1 | |||
| 1876 | nmdc:mga0a205_198854_c1 | |||
| 1877 | nmdc:mga0sz30_58841_c1 | |||
| 1878 | Ga0495601_0045057 | |||
| 1879 | Ga0500635_0000028 | |||
| 1880 | Ga0495655_0000392 | |||
| 1881 | Ga0495619_0055392 | |||
| 1882 | Ga0495619_0126318 | |||
| 1883 | Ga0500643_000334 | |||
| 1884 | Ga0500643_000401 | |||
| 1885 | Ga0500651_0000407 | |||
| 1886 | Ga0500641_0000776 | |||
| 1887 | Ga0500556_0000001 | |||
| 1888 | Ga0500556_0000204 | |||
| 1889 | Ga0500562_000228 | |||
| 1890 | Ga0500593_000685 | |||
| 1891 | Ga0500655_001594 | |||
| 1892 | Ga0500559_0000218 | |||
| 1893 | Ga0500559_0000606 | |||
| 1894 | Ga0500559_0004381 | |||
| 1895 | Ga0500568_0000016 | |||
| 1896 | Ga0500568_0001477 | |||
| 1897 | Ga0500568_0005422 | |||
| 1898 | Ga0500568_0018308 | |||
| 1899 | Ga0500568_0022522 | |||
| 1900 | Ga0500568_0051655 | |||
| 1901 | Ga0500573_0000059 | |||
| 1902 | Ga0500573_0001660 | |||
| 1903 | Ga0500573_0002098 | |||
| 1904 | Ga0500616_0000540 | |||
| 1905 | Ga0500616_0001498 | |||
| 1906 | Ga0500616_0011514 | |||
| 1907 | Ga0501084_0092110 | |||
| 1908 | Ga0587072_008701 | |||
| 1909 | Ga0501082_0017799 | |||
| 1910 | Ga0466962_0008462 | |||
| 1911 | Ga0466962_0010274 | |||
| 1912 | Ga0466962_0022320 | |||
| 1913 | Ga0466962_0026584 | |||
| 1914 | 2537898746 | |||
| 1915 | 2587862507 | |||
| 1916 | 2588108174 | |||
| 1917 | 2643733328 | |||
| 1918 | 2643753550 | |||
| 1919 | 2643767400 | |||
| 1920 | 2643786183 | |||
| 1921 | 2643848042 | |||
| 1922 | 2643874981 | |||
| 1923 | 2643885069 | |||
| 1924 | 2643995575 | |||
| 1925 | 2644083167 | |||
| 1926 | 2644097067 | |||
| 1927 | 2644110621 | |||
| 1928 | 2644169902 | |||
| 1929 | 2644183677 | |||
| 1930 | 2644199437 | |||
| 1931 | 2644279244 | |||
| 1932 | 2644382037 | |||
| 1933 | 2644665724 | |||
| 1934 | 2644680576 | |||
| 1935 | 2691513552 | |||
| 1936 | 2723642410 | |||
| 1937 | 2729906079 | |||
| 1938 | 2730230036 | |||
| 1939 | 2739250440 | |||
| 1940 | 2739326768 | |||
| 1941 | 2747954742 | |||
| 1942 | 2758227216 | |||
| 1943 | 2768644313 | |||
| 1944 | 2774381619 | |||
| 1945 | 2774384748 | |||
| 1946 | 2774399860 | |||
| 1947 | 2775656127 | |||
| 1948 | 2784471962 | |||
| 1949 | 2808631474 | |||
| 1950 | 2808830807 | |||
| 1951 | 2808851995 | |||
| 1952 | 2808879693 | |||
| 1953 | 2808885368 | |||
| 1954 | 2808890738 | |||
| 1955 | 2808896018 | |||
| 1956 | 2808902396 | |||
| 1957 | 2809227120 | |||
| 1958 | 2810365508 | |||
| 1959 | 2812321640 | |||
| 1960 | 2812322801 | |||
| 1961 | 2812364942 | |||
| 1962 | 2817509409 | |||
| 1963 | 2821269677 | |||
| 1964 | 2833710624 | |||
| 1965 | 2835188613 | |||
| 1966 | 2839989006 | |||
| 1967 | 2844842767 | |||
| 1968 | 2844852379 | |||
| 1969 | 2844855277 | |||
| 1970 | 2848552312 | |||
| 1971 | 2852633499 | |||
| 1972 | 2852645313 | |||
| 1973 | 2852648737 | |||
| 1974 | 2852666890 | |||
| 1975 | 2852679525 | |||
| 1976 | 2857480455 | |||
| 1977 | 2857634099 | |||
| 1978 | 2857712844 | |||
| 1979 | 2857720527 | |||
| 1980 | 2857724241 | |||
| 1981 | 2857732489 | |||
| 1982 | 2857735479 | |||
| 1983 | 2857740089 | |||
| 1984 | 2857744406 | |||
| 1985 | 2858872689 | |||
| 1986 | 2862996476 | |||
| 1987 | 2867351286 | |||
| 1988 | 2870623306 | |||
| 1989 | 2870630043 | |||
| 1990 | 2870802262 | |||
| 1991 | 2870804344 | |||
| 1992 | 2884765741 | |||
| 1993 | 2884995706 | |||
| 1994 | 2887446400 | |||
| 1995 | 2893684754 | |||
| 1996 | 2895661106 | |||
| 1997 | 2897563556 | |||
| 1998 | 2904433199 | |||
| 1999 | 2904501069 | |||
| 2000 | 2904502679 | |||
| 2001 | 2904512725 | |||
| 2002 | 2904778055 | |||
| 2003 | 2905927024 | |||
| 2004 | 2906800178 | |||
| 2005 | 2908677638 | |||
| 2006 | 2908681277 | |||
| 2007 | 2909075211 | |||
| 2008 | 2910813041 | |||
| 2009 | 2919038858 | |||
| 2010 | 2919040624 | |||
| 2011 | 2919043589 | |||
| 2012 | 2919051654 | |||
| 2013 | 2919058468 | |||
| 2014 | 2919062830 | |||
| 2015 | 2919071441 | |||
| 2016 | 2919393370 | |||
| 2017 | 2919398276 | |||
| 2018 | 2919445897 | |||
| 2019 | 2919524851 | |||
| 2020 | 2919542591 | |||
| 2021 | 2920882396 | |||
| 2022 | 2928078310 | |||
| 2023 | 2928092389 | |||
| 2024 | 2928108487 | |||
| 2025 | 2928122830 | |||
| 2026 | 2928156238 | |||
| 2027 | 2928501551 | |||
| 2028 | 2932430519 | |||
| 2029 | 2932434859 | |||
| 2030 | 2933421690 | |||
| 2031 | 2935412791 | |||
| 2032 | 2935894675 | |||
| 2033 | 2939600117 | |||
| 2034 | 2939651096 | |||
| 2035 | 2939657740 | |||
| 2036 | 2939660921 | |||
| 2037 | 2939678862 | |||
| 2038 | 2945919506 | |||
| 2039 | 2945920380 | |||
| 2040 | 2945943681 | |||
| 2041 | 2945958135 | |||
| 2042 | 2946004122 | |||
| 2043 | 2946025446 | |||
| 2044 | 2946033423 | |||
| 2045 | 2946039654 | |||
| 2046 | 2946044662 | |||
| 2047 | 2946063230 | |||
| 2048 | 2946080568 | |||
| 2049 | 2954000879 | |||
| 2050 | 2964326857 | |||
| 2051 | 2966923351 | |||
| 2052 | 2966924696 | |||
| 2053 | 2974297745 | |||
| 2054 | 2974303148 | |||
| 2055 | 2974326021 | |||
| 2056 | 2977230984 | |||
| 2057 | 2977239779 | |||
| 2058 | 2977253669 | |||
| 2059 | 2984545948 | |||
| 2060 | 2984553808 | |||
| 2061 | 2984580845 | |||
| 2062 | 2990049420 | |||
| 2063 | 2995728259 | |||
| 2064 | 8002812870 | |||
| 2065 | 8004024144 | |||
| 2066 | 8004184814 | |||
| 2067 | 8004214414 | |||
| 2068 | 8008489510 | |||
| 2069 | 8016257921 | |||
| 2070 | 8025528914 | |||
| 2071 | 8033684929 | |||
| 2072 | 8045830851 | |||
| 2073 | 8046356165 | |||
| 2074 | 8055035722 | |||
| 2075 | 8055038721 | |||
| 2076 | 8056037791 | |||
| 2077 | 8056583741 | |||
| 2078 | 8057349076 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5e4n-assembly1.cif.gz_A-2 | 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis with d-tyrosine bound in the tyrosine and phenylalanine binding sites | 0.9711 | 7 | 454 |
| 3kgf-assembly1.cif.gz_A-2 | the structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis complexed with phenylalanine and tryptophan | 0.9704 | 7 | 454 |
| 5huc-assembly1.cif.gz_A | dahp synthase from corynebacterium glutamicum | 0.9704 | 9 | 454 |
| 5e4n-assembly1.cif.gz_B-2 | 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis with d-tyrosine bound in the tyrosine and phenylalanine binding sites | 0.9698 | 6 | 454 |
| 5ckv-assembly1.cif.gz_A-2 | dahp synthase from mycobacterium tuberculosis, fully inhibited by tyrosine, phenylalanine, and tryptophan | 0.9695 | 7 | 453 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53512_218_462_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9827 | 214 | 453 | 3.20.20.70 |
| 2w1aB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9765 | 50 | 453 | 3.20.20.70 |
| af_Q75LR2_294_535_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9692 | 217 | 453 | 3.20.20.70 |
| 2w1aB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9683 | 50 | 453 | 3.20.20.70 |
| af_B4FZ59_134_526_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9653 | 67 | 454 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349CYY1-F1-model_v4 | Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) | 0.9996 | 361 | 455 |
GO:0003849
GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A528V3C7-F1-model_v4 | Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) | 0.997 | 239 | 332 |
GO:0003849
GO:0009073 |
| AF-A0A7K0LH42-F1-model_v4 | Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) | 0.9968 | 245 | 453 |
GO:0003849
GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A367LY30-F1-model_v4 | Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) | 0.9966 | 254 | 402 |
GO:0003849
GO:0009073 |
| AF-A0A6B3EYB7-F1-model_v4 | Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) | 0.996 | 272 | 410 |
GO:0003849
GO:0008652 GO:0009073 GO:0009423 |