F488803

General Info

Members Datasets Scaffolds Average Seq Length
1039 660 2077 267

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581866|2585393628
Length 315
Sequence SSLVPMHLVFLVSKRFCQAHVLNCWIYDICDRQALSYYRGWKFSLMEIVMTENSNGTALITGASSGIGAIYADRLARRGYDLILVARNKERLNALAKRLTDETGRAVEVIAADLGNKDDLGRIEKVLRSDASITTLVNNAGVGATAPLLSSDIDKMEEMITLNVNALTRLTYAAVPGFVKRGTGAIINIASIVGIAPEVLNGVYGGSKAFVLAFTLSLQKELSDKNIRVQAVLPGATATDFWGIAGTPLEHVPSEIVMSAEDMVDAALAGFDKGERITIPSLPDARDWEAYEAARQKLMPSLSLSTPAARYRTGG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
69 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
94 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
97 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
98 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
153 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
190 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
191 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
329 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
330 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
331 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
332 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
333 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
334 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
337 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
338 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
343 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
347 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
351 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
352 2509276019 Ensifer aridi TW10 Isolate Nodule
353 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
354 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
355 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
356 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
357 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
358 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
359 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
360 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
361 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
362 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
363 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
364 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
365 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
366 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
367 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
368 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
369 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
370 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
371 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
372 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
373 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
374 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
375 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
376 2516143018 Ensifer sp. BR816 Isolate Nodule
377 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
378 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
379 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
380 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
381 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
382 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
383 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
384 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
385 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
386 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
387 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
388 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
389 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
390 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
391 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
392 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
393 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
394 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
395 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
396 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
397 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
398 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
399 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
400 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
401 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
402 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
403 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
404 2643221557 Ensifer sp. Root558 Isolate Unclassified
405 2643221610 Ensifer sp. Root74 Isolate Unclassified
406 2643221618 Ensifer sp. Root231 Isolate Unclassified
407 2643221626 Ensifer sp. Root31 Isolate Unclassified
408 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
409 2643221655 Ensifer sp. Root1252 Isolate Unclassified
410 2643221659 Ensifer sp. Root127 Isolate Unclassified
411 2643221668 Ensifer sp. Root423 Isolate Unclassified
412 2643221675 Ensifer sp. Root1298 Isolate Unclassified
413 2643221680 Ensifer sp. Root1312 Isolate Unclassified
414 2643221698 Ensifer sp. Root142 Isolate Unclassified
415 2643221712 Ensifer sp. Root258 Isolate Unclassified
416 2643221723 Ensifer sp. Root278 Isolate Unclassified
417 2643221726 Ensifer sp. Root954 Isolate Unclassified
418 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
419 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
420 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
421 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
422 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
423 2738541277 Variovorax sp. GV051 Isolate Unclassified
424 2738543019 Variovorax sp. GV040 Isolate Unclassified
425 2739367700 Dyella sp. YR388 Isolate Unclassified
426 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
427 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
428 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
429 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
430 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
431 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
432 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
433 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
434 2791355260 Rhizobium sp. L9 Isolate Nodule
435 2791355261 Rhizobium sp. J15 Isolate Nodule
436 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
437 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
438 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
439 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
440 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
441 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
442 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
443 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
444 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
445 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
446 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
447 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
448 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
449 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
450 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
451 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
452 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
453 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
454 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
455 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
456 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
457 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
458 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
459 2844163670 Ensifer sp. 1H6 Isolate Unclassified
460 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
461 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
462 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
463 2851182111 Bosea sp. Tri-44 Isolate Nodule
464 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
465 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
466 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
467 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
468 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
469 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
470 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
471 2884411467 Dyella sp. AD56 Isolate Rhizosphere
472 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
473 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
474 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
475 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
476 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
477 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
478 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
479 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
480 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
481 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
482 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
483 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
484 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
485 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
486 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
487 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
488 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
489 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
490 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
491 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
492 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
493 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
494 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
495 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
496 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
497 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
498 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
499 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
500 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
501 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
502 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
503 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
504 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
505 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
506 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
507 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
508 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
509 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
510 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
511 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
512 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
513 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
514 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
515 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
516 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
517 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
518 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
519 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
520 2928037797 Variovorax sp. 1126 Isolate Unclassified
521 2928044640 Variovorax sp. 1128 Isolate Unclassified
522 2928963466 Dyella japonica 1073 Isolate Unclassified
523 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
524 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
525 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
526 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
527 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
528 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
529 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
530 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
531 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
532 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
533 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
534 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
535 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
536 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
537 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
538 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
539 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
540 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
541 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
542 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
543 2941479691
544 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
545 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
546 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
547 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
548 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
549 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
550 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
551 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
552 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
553 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
554 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
555 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
556 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
557 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
558 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
559 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
560 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
561 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
562 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
563 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
564 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
565 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
566 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
567 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
568 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
569 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
570 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
571 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
572 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
573 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
574 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
575 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
576 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
577 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
578 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
579 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
580 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
581 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
582 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
583 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
584 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
585 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
586 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
587 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
588 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
589 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
590 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
591 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
592 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
593 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
594 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
595 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
596 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
597 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
598 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
599 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
600 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
601 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
602 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
603 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
604 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
605 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
606 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
607 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
608 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
609 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
610 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
611 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
612 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
613 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
614 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
615 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
616 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
617 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
618 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
619 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
620 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
621 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
622 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
623 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
624 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
625 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
626 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
627 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
628 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
629 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
630 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
631 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
632 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
633 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
634 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
635 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
636 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
637 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
638 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
639 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
640 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
641 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
642 8005382845 Rhizobium sp. R634 Isolate Nodule
643 8005395548 Rhizobium sp. R339 Isolate Nodule
644 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
645 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
646 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
647 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
648 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
649 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
650 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
651 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
652 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
653 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
654 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
655 8024501048 Rhizobium sp. H4 Isolate Nodule
656 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
657 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
658 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
659 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
660 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.68
Metatranscriptomes 0
Isolates 30.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 18.09
Nodule 22.81
Rhizoplane 3.27
Rhizosphere 41
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_834 2124908027 Bacteria 18448
2 JGI24739J22299_10083135 3300001989 Bacteria 981
3 JGI24735J21928_10000540 3300002067 Bacteria 13365
4 JGI24749J21850_1000458 3300002076 Bacteria 6074
5 JGI25156J39149_1000312 3300002705 Bacteria 32295
6 JGI25162J39368_1002134 3300002737 Bacteria 8334
7 JGI25158J39367_1000180 3300002739 Bacteria 14916
8 JGI25152J39213_1004975 3300002773 Bacteria 4019
9 JGI25152J39213_1010334 3300002773 Bacteria 2144
10 JGI25150J39212_1001252 3300002774 Bacteria 7343
11 JGI25159J45721_1000009 3300002987 Bacteria 168868
12 JGI25159J45721_1001406 3300002987 Bacteria 9996
13 JGI25159J45721_1011633 3300002987 Bacteria 2144
14 JGI25151J46595_10000697 3300003187 Bacteria 28184
15 JGI25151J46595_10006772 3300003187 Bacteria 5705
16 JGI25151J46595_10020617 3300003187 Bacteria 2776
17 JGI25151J46595_10030011 3300003187 Bacteria 2144
18 JGI25153J46596_10003024 3300003215 Bacteria 9511
19 JGI25153J46596_10011067 3300003215 Bacteria 4019
20 JGI25153J46596_10024971 3300003215 Bacteria 2144
21 rootH1_10002822 3300003316 Bacteria 15935
22 rootH1_10007216 3300003316 Bacteria 10392
23 rootH2_10035196 3300003320 Bacteria 15170
24 rootH2_10155874 3300003320 Bacteria 1940
25 rootH2_10207593 3300003320 Bacteria 1599
26 rootL2_10001400 3300003322 Bacteria 6669
27 rootL2_10049284 3300003322 Bacteria 14756
28 rootH1_10007028 3300003323 Bacteria 5859
29 rootH1_10019204 3300003323 Bacteria 2703
30 rootH1_10031909 3300003316 Bacteria 4650
31 rootH1_10031909 3300003323 Bacteria 5971
32 JGI25160J50197_1000028 3300003354 Bacteria 179309
33 JGI25160J50197_1000035 3300003354 Bacteria 167972
34 JGI25160J50197_1004999 3300003354 Bacteria 5618
35 JGI25160J50197_1018760 3300003354 Bacteria 2144
36 JGI25161J50226_1000114 3300003374 Bacteria 62957
37 JGI25161J50226_1000332 3300003374 Bacteria 25529
38 JGI25161J50226_1006368 3300003374 Bacteria 2148
39 JGI25161J50226_1010287 3300003374 Bacteria 1260
40 Ga0055533_1000061 3300003756 Bacteria 181542
41 Ga0055533_1002300 3300003756 Bacteria 4418
42 Ga0055525_1001399 3300003759 Bacteria 4534
43 Ga0055542_1000082 3300003762 Bacteria 128120
44 Ga0055542_1000170 3300003762 Bacteria 81222
45 Ga0055526_1001815 3300003771 Bacteria 14781
46 Ga0055526_1002600 3300003771 Bacteria 12067
47 Ga0055526_1010599 3300003771 Bacteria 4267
48 Ga0055526_1022460 3300003771 Bacteria 2144
49 Ga0055526_1032264 3300003771 Bacteria 1482
50 Ga0055537_1009474 3300003773 Bacteria 2144
51 Ga0055524_1021361 3300003775 Bacteria 2148
52 Ga0055524_1021410 3300003775 Bacteria 2144
53 Ga0055536_1001115 3300003781 Bacteria 16861
54 Ga0055536_1001126 3300003781 Bacteria 16756
55 Ga0055536_1002109 3300003781 Bacteria 11320
56 Ga0055534_1009321 3300003784 Bacteria 2144
57 Ga0055528_1001469 3300003790 Bacteria 14317
58 Ga0055528_1013698 3300003790 Bacteria 3054
59 Ga0055528_1014169 3300003790 Bacteria 2966
60 Ga0055528_1020496 3300003790 Bacteria 2144
61 Ga0055530_10000459 3300003791 Bacteria 36096
62 Ga0055540_1003357 3300003792 Bacteria 7770
63 Ga0055540_1005909 3300003792 Bacteria 4999
64 Ga0055531_10005662 3300003794 Bacteria 7258
65 Ga0055531_10017404 3300003794 Bacteria 3037
66 Ga0055531_10017505 3300003794 Bacteria 3020
67 Ga0055543_1000077 3300004625 Bacteria 86457
68 Ga0055543_1000230 3300004625 Bacteria 44357
69 Ga0055543_1008887 3300004625 Bacteria 2193
70 Ga0055543_1011093 3300004625 Bacteria 1860
71 Ga0065165_1000061 3300005262 Bacteria 179347
72 Ga0065165_1000191 3300005262 Bacteria 106980
73 Ga0065165_1022210 3300005262 Bacteria 2182
74 Ga0070670_100249503 3300005331 Bacteria 1546
75 Ga0070689_100020078 3300005340 Bacteria 4953
76 Ga0070689_100069285 3300005340 Bacteria 2752
77 Ga0070661_100071802 3300005344 Bacteria 2547
78 Ga0070661_100464659 3300005344 Bacteria 1008
79 Ga0070668_100030013 3300005347 Bacteria 4131
80 Ga0070668_100529018 3300005347 Bacteria 1024
81 Ga0070688_100031656 3300005365 Bacteria 3184
82 Ga0070709_10080186 3300005434 Bacteria 2128
83 Ga0070709_10087768 3300005434 Bacteria 2044
84 Ga0070714_100034515 3300005435 Bacteria 4236
85 Ga0070713_100088845 3300005436 Bacteria 2653
86 Ga0070710_10035799 3300005437 Bacteria 2709
87 Ga0070711_100015393 3300005439 Bacteria 4841
88 Ga0070663_100062586 3300005455 Bacteria 2683
89 Ga0070663_100093519 3300005455 Bacteria 2231
90 Ga0070663_100378642 3300005455 Bacteria 1152
91 Ga0070681_10277547 3300005458 Bacteria 1587
92 Ga0070685_10003905 3300005466 Bacteria 7532
93 Ga0070685_10018292 3300005466 Bacteria 3766
94 Ga0070699_100295389 3300005518 Bacteria 1453
95 Ga0068853_100157160 3300005539 Bacteria 2049
96 Ga0070696_100084831 3300005546 Bacteria 2248
97 Ga0070665_100012436 3300005548 Bacteria 8580
98 Ga0068852_100018843 3300005616 Bacteria 5447
99 Ga0068859_100163501 3300005617 Bacteria 2305
100 Ga0068860_100267334 3300005843 Bacteria 1668
101 Ga0068862_100001888 3300005844 Bacteria 18996
102 Ga0068862_100025892 3300005844 Bacteria 4928
103 Ga0068862_100071716 3300005844 Bacteria 2991
104 Ga0068862_100113299 3300005844 Bacteria 2382
105 Ga0081540_1016574 3300005983 Bacteria 4603
106 Ga0081540_1016849 3300005983 Bacteria 4551
107 Ga0075363_100038752 3300006048 Bacteria 2506
108 Ga0075363_100091961 3300006048 Bacteria 1670
109 Ga0075432_10090219 3300006058 Bacteria 1121
110 Ga0070715_10014117 3300006163 Bacteria 2950
111 Ga0075362_10056315 3300006177 Bacteria 1769
112 Ga0075366_10018534 3300006195 Bacteria 4020
113 Ga0097621_100237883 3300006237 Bacteria 1591
114 Ga0075370_10005624 3300006353 Bacteria 6253
115 Ga0075370_10017694 3300006353 Bacteria 3854
116 Ga0068871_100076407 3300006358 Bacteria 2766
117 Ga0075428_100052887 3300006844 Bacteria 4450
118 Ga0075428_100056530 3300006844 Bacteria 4298
119 Ga0075428_100972875 3300006844 Bacteria 899
120 Ga0075430_100000150 3300006846 Bacteria 44915
121 Ga0075431_100000478 3300006847 Bacteria 33199
122 Ga0075436_100015945 3300006914 Bacteria 5143
123 Ga0097620_100005208 3300006931 Bacteria 13214
124 Ga0097620_100163499 3300006931 Bacteria 2305
125 Ga0099825_1032000 3300006941 Bacteria 2175
126 Ga0099823_1000409 3300006944 Bacteria 27729
127 Ga0105251_10049820 3300009011 Bacteria 2003
128 Ga0105240_10000797 3300009093 Bacteria 57090
129 Ga0105240_10001505 3300009093 Bacteria 39693
130 Ga0105240_10012223 3300009093 Bacteria 11867
131 Ga0105240_10091615 3300009093 Bacteria 3713
132 Ga0105240_10150652 3300009093 Bacteria 2771
133 Ga0111539_10079663 3300009094 Bacteria 3853
134 Ga0111539_10087735 3300009094 Unclassified 3655
135 Ga0105245_10019101 3300009098 Bacteria 5999
136 Ga0105245_11002064 3300009098 Bacteria 880
137 Ga0114129_10222700 3300009147 Bacteria 2544
138 Ga0114129_11249335 3300009147 Bacteria 923
139 Ga0105243_10063923 3300009148 Bacteria 2951
140 Ga0105241_10037079 3300009174 Bacteria 3672
141 Ga0105248_10006601 3300009177 Bacteria 12712
142 Ga0105248_10056586 3300009177 Bacteria 4400
143 Ga0105248_10284447 3300009177 Bacteria 1862
144 Ga0105237_10000628 3300009545 Bacteria 49290
145 Ga0105238_10000348 3300009551 Bacteria 49784
146 Ga0105238_10014753 3300009551 Bacteria 7902
147 Ga0105238_10045728 3300009551 Bacteria 4422
148 Ga0105249_10028967 3300009553 Bacteria 4999
149 Ga0105249_10096486 3300009553 Bacteria 2774
150 Ga0105033_104376 3300009986 Bacteria 1201
151 Ga0105239_10000288 3300010375 Bacteria 74273
152 Ga0105239_10001567 3300010375 Bacteria 30193
153 Ga0105239_10128502 3300010375 Bacteria 2817
154 Ga0157347_1000866 3300012502 Bacteria 2177
155 Ga0157370_10007496 3300013104 Bacteria 11853
156 Ga0157369_10012755 3300013105 Bacteria 9530
157 Ga0157369_10495442 3300013105 Bacteria 1264
158 Ga0171463_1012 3300013249 Bacteria 176554
159 Ga0157378_10033234 3300013297 Bacteria 4558
160 Ga0163162_10004865 3300013306 Bacteria 12963
161 Ga0163162_10057467 3300013306 Bacteria 3919
162 Ga0163162_10411931 3300013306 Bacteria 1484
163 Ga0157372_10000966 3300013307 Bacteria 31334
164 Ga0157372_10069585 3300013307 Bacteria 3958
165 Ga0157380_10000441 3300014326 Bacteria 25347
166 Ga0182008_10005615 3300014497 Bacteria 7111
167 Ga0157376_10533288 3300014969 Bacteria 1159
168 Ga0157376_10583077 3300014969 Bacteria 1111
169 Ga0183362_10002 3300015683 Bacteria 1432711
170 Ga0183368_1002 3300015687 Bacteria 1865598
171 Ga0163161_10000127 3300017792 Bacteria 71051
172 Ga0214544_1000906 3300021320 Bacteria 58379
173 Ga0214542_1000400 3300021321 Bacteria 76349
174 Ga0214542_1021144 3300021321 Bacteria 4569
175 Ga0214543_1000018 3300021327 Bacteria 272335
176 Ga0214543_1000019 3300021327 Bacteria 267908
177 Ga0213872_10066137 3300021361 Bacteria 1632
178 Ga0213872_10140035 3300021361 Bacteria 1062
179 Ga0213874_10048472 3300021377 Bacteria 1296
180 Ga0209436_100050 3300025208 Bacteria 65942
181 Ga0209436_100100 3300025208 Bacteria 42446
182 Ga0209674_100003 3300025226 Bacteria 2196646
183 Ga0209674_100043 3300025226 Bacteria 369728
184 Ga0209563_100086 3300025230 Bacteria 182199
185 Ga0207427_102087 3300025231 Bacteria 5869
186 Ga0207427_102860 3300025231 Bacteria 4151
187 Ga0209437_100194 3300025233 Bacteria 121991
188 Ga0209437_100651 3300025233 Bacteria 19894
189 Ga0209437_102442 3300025233 Bacteria 3604
190 Ga0209258_103160 3300025242 Bacteria 3721
191 Ga0207425_1000602 3300025245 Bacteria 20840
192 Ga0207425_1001660 3300025245 Bacteria 8937
193 Ga0207425_1002953 3300025245 Bacteria 5690
194 Ga0209026_1002643 3300025250 Bacteria 6529
195 Ga0209026_1003717 3300025250 Bacteria 4865
196 Ga0209677_100107 3300025253 Bacteria 89035
197 Ga0209148_1000002 3300025254 Bacteria 2399500
198 Ga0209759_1010985 3300025256 Bacteria 2609
199 Ga0209129_1000114 3300025258 Bacteria 141791
200 Ga0209129_1000788 3300025258 Bacteria 19977
201 Ga0209129_1001687 3300025258 Bacteria 11953
202 Ga0209129_1003368 3300025258 Bacteria 7025
203 Ga0209129_1006009 3300025258 Bacteria 4074
204 Ga0209233_1010598 3300025261 Bacteria 2752
205 Ga0209233_1026875 3300025261 Bacteria 1401
206 Ga0209565_1000198 3300025263 Bacteria 71641
207 Ga0209565_1006759 3300025263 Bacteria 3179
208 Ga0209673_1000060 3300025273 Bacteria 263602
209 Ga0209673_1000216 3300025273 Bacteria 114232
210 Ga0209673_1000481 3300025273 Bacteria 66688
211 Ga0209130_1000030 3300025284 Bacteria 323323
212 Ga0209130_1000068 3300025284 Bacteria 179361
213 Ga0209130_1000256 3300025284 Bacteria 66866
214 Ga0209130_1000364 3300025284 Bacteria 51592
215 Ga0209130_1019919 3300025284 Bacteria 1545
216 Ga0209675_1000333 3300025291 Bacteria 41235
217 Ga0209675_1001034 3300025291 Bacteria 17375
218 Ga0209676_1000004 3300025292 Bacteria 1138360
219 Ga0209676_1000714 3300025292 Bacteria 45991
220 Ga0209676_1002049 3300025292 Bacteria 15759
221 Ga0209025_1000183 3300025294 Bacteria 155799
222 Ga0209025_1000203 3300025294 Bacteria 145210
223 Ga0209025_1000682 3300025294 Bacteria 58271
224 Ga0209025_1001354 3300025294 Bacteria 32918
225 Ga0209025_1005996 3300025294 Bacteria 9651
226 Ga0209025_1011535 3300025294 Bacteria 5805
227 Ga0209025_1031431 3300025294 Bacteria 2511
228 Ga0209564_1000070 3300025295 Bacteria 303126
229 Ga0209564_1000081 3300025295 Bacteria 261592
230 Ga0209564_1000116 3300025295 Bacteria 207889
231 Ga0209564_1000295 3300025295 Bacteria 100738
232 Ga0209564_1000364 3300025295 Bacteria 84138
233 Ga0209564_1010613 3300025295 Bacteria 4217
234 Ga0209564_1036282 3300025295 Bacteria 1409
235 Ga0209758_1000180 3300025297 Bacteria 141791
236 Ga0209758_1000688 3300025297 Bacteria 50116
237 Ga0209758_1001342 3300025297 Bacteria 29705
238 Ga0209758_1010245 3300025297 Bacteria 5648
239 Ga0209758_1012315 3300025297 Bacteria 4801
240 Ga0209758_1013415 3300025297 Bacteria 4468
241 Ga0209050_1000002 3300025298 Bacteria 1792849
242 Ga0209050_1000270 3300025298 Bacteria 110916
243 Ga0209050_1002528 3300025298 Bacteria 15339
244 Ga0209050_1005653 3300025298 Bacteria 7741
245 Ga0209256_1000047 3300025299 Bacteria 314709
246 Ga0209256_1000157 3300025299 Bacteria 141791
247 Ga0209256_1000408 3300025299 Bacteria 67949
248 Ga0209256_1001292 3300025299 Bacteria 27015
249 Ga0209256_1002018 3300025299 Bacteria 18110
250 Ga0209256_1002320 3300025299 Bacteria 15934
251 Ga0209256_1033649 3300025299 Bacteria 1375
252 Ga0207426_1000021 3300025302 Bacteria 556343
253 Ga0207426_1000047 3300025302 Bacteria 417011
254 Ga0207426_1000155 3300025302 Bacteria 179361
255 Ga0207426_1000184 3300025302 Bacteria 154290
256 Ga0207426_1000204 3300025302 Bacteria 141791
257 Ga0207426_1038207 3300025302 Bacteria 1513
258 Ga0209051_1000002 3300025303 Bacteria 1631846
259 Ga0209051_1001764 3300025303 Bacteria 17175
260 Ga0209051_1013018 3300025303 Bacteria 3983
261 Ga0209051_1013964 3300025303 Bacteria 3780
262 Ga0209051_1018471 3300025303 Bacteria 3084
263 Ga0209051_1026604 3300025303 Bacteria 2327
264 Ga0209257_1000002 3300025304 Bacteria 1767052
265 Ga0209257_1003360 3300025304 Bacteria 13827
266 Ga0209257_1003606 3300025304 Bacteria 13048
267 Ga0209257_1005745 3300025304 Bacteria 8484
268 Ga0209257_1005920 3300025304 Bacteria 8230
269 Ga0209257_1011411 3300025304 Bacteria 4280
270 Ga0207692_10064647 3300025898 Bacteria 1906
271 Ga0207685_10124330 3300025905 Bacteria 1137
272 Ga0207699_10042009 3300025906 Bacteria 2645
273 Ga0207654_10003967 3300025911 Bacteria 7452
274 Ga0207695_10000740 3300025913 Bacteria 63254
275 Ga0207695_10001440 3300025913 Bacteria 39881
276 Ga0207695_10065146 3300025913 Plasmid 3747
277 Ga0207695_10111406 3300025913 Bacteria 2716
278 Ga0207671_10007548 3300025914 Bacteria 9416
279 Ga0207693_10019891 3300025915 Bacteria 5339
280 Ga0207663_10023949 3300025916 Bacteria 3511
281 Ga0207649_10074787 3300025920 Bacteria 2175
282 Ga0207694_10000223 3300025924 Bacteria 55562
283 Ga0207694_10010824 3300025924 Bacteria 6886
284 Ga0207694_10034757 3300025924 Bacteria 3866
285 Ga0207650_10206772 3300025925 Bacteria 1575
286 Ga0207700_10085538 3300025928 Bacteria 2475
287 Ga0207664_10054557 3300025929 Bacteria 3167
288 Ga0207644_10248702 3300025931 Bacteria 1418
289 Ga0207670_10007399 3300025936 Bacteria 6126
290 Ga0207670_10219686 3300025936 Bacteria 1454
291 Ga0207711_10004660 3300025941 Bacteria 11643
292 Ga0207711_10116697 3300025941 Bacteria 2380
293 Ga0207712_10017500 3300025961 Bacteria 4655
294 Ga0207712_10139195 3300025961 Bacteria 1860
295 Ga0207668_10323254 3300025972 Bacteria 1281
296 Ga0207658_10183848 3300025986 Bacteria 1732
297 Ga0207658_10310557 3300025986 Bacteria 1362
298 Ga0207639_10121648 3300026041 Bacteria 2146
299 Ga0207678_10031357 3300026067 Bacteria 4637
300 Ga0207678_10112241 3300026067 Bacteria 2325
301 Ga0207702_10263167 3300026078 Bacteria 1625
302 Ga0207641_10045191 3300026088 Bacteria 3708
303 Ga0207676_10242745 3300026095 Bacteria 1617
304 Ga0207698_10012938 3300026142 Bacteria 5485
305 Ga0209281_1000185 3300027111 Bacteria 144489
306 Ga0209389_1000111 3300027296 Bacteria 72517
307 Ga0209489_100220 3300027361 Bacteria 95167
308 Ga0209700_100041 3300027363 Bacteria 168380
309 Ga0207428_10081816 3300027907 Unclassified 2521
310 Ga0268265_10001544 3300028380 Bacteria 19126
311 Ga0268265_10037579 3300028380 Bacteria 3555
312 Ga0268265_10124646 3300028380 Bacteria 2129
313 Ga0268264_10643980 3300028381 Bacteria 1048
314 Ga0307517_10000476 3300028786 Bacteria 68696
315 Ga0307515_10003433 3300028794 Bacteria 33339
316 Ga0307515_10013332 3300028794 Bacteria 15375
317 Ga0307515_10052798 3300028794 Bacteria 6016
318 Ga0307515_10125487 3300028794 Bacteria 2871
319 Ga0307515_10207377 3300028794 Bacteria 1815
320 Ga0268256_1029578 3300030500 Bacteria 1339
321 Ga0265325_10029855 3300031241 Bacteria 2927
322 Ga0265316_10104963 3300031344 Bacteria 2144
323 Ga0307513_10053739 3300031456 Bacteria 4326
324 Ga0307513_10137433 3300031456 Bacteria 2377
325 Ga0307513_10405327 3300031456 Bacteria 1097
326 Ga0307509_10000679 3300031507 Bacteria 58021
327 Ga0307509_10001891 3300031507 Bacteria 34576
328 Ga0307509_10138137 3300031507 Bacteria 2378
329 Ga0307509_10177896 3300031507 Bacteria 1997
330 Ga0265313_10019692 3300031595 Bacteria 3746
331 Ga0307508_10000041 3300031616 Bacteria 147868
332 Ga0307508_10001204 3300031616 Bacteria 29689
333 Ga0307508_10205964 3300031616 Bacteria 1568
334 Ga0307514_10002728 3300031649 Bacteria 17817
335 Ga0265314_10000737 3300031711 Bacteria 39300
336 Ga0307413_10135470 3300031824 Bacteria 1693
337 Ga0307410_10393261 3300031852 Bacteria 1118
338 Ga0307416_100279163 3300032002 Bacteria 1646
339 Ga0307414_10015680 3300032004 Bacteria 4581
340 Ga0307411_10104151 3300032005 Bacteria 2014
341 Ga0307507_10016383 3300033179 Bacteria 8625
342 Ga0307507_10082189 3300033179 Bacteria 2826
343 Ga0307507_10090633 3300033179 Bacteria 2623
344 Ga0307510_10000049 3300033180 Bacteria 91546
345 Ga0307510_10000560 3300033180 Bacteria 37413
346 Ga0307510_10165965 3300033180 Bacteria 1796
347 Ga0395899_0091168 3300037312 Bacteria 2209
348 Ga0395900_0099882 3300037418 Bacteria 2981
349 Ga0395900_0118701 3300037418 Bacteria 2714
350 Ga0395900_0709283 3300037418 Bacteria 939
351 Ga0395905_0086013 3300037471 Bacteria 2946
352 Ga0395905_0149246 3300037471 Bacteria 2199
353 Ga0395905_0210760 3300037471 Bacteria 1820
354 Ga0395905_0393992 3300037471 Bacteria 1279
355 Ga0395901_0152005 3300038443 Bacteria 2432
356 Ga0395901_0506308 3300038443 Bacteria 1229
357 Ga0436365_1664905 3300039437 Bacteria 3705
358 Ga0436360_0942008 3300039438 Bacteria 3040
359 Ga0436361_0182016 3300039447 Bacteria 5201
360 Ga0436361_0256750 3300039447 Bacteria 3388
361 Ga0436361_0311633 3300039447 Bacteria 6215
362 Ga0436361_0520279 3300039447 Bacteria 1777
363 Ga0436361_0652761 3300039447 Bacteria 3610
364 Ga0436361_0731048 3300039447 Bacteria 1684
365 Ga0436361_1204738 3300039447 Bacteria 3997
366 Ga0436363_1168066 3300039450 Bacteria 1300
367 Ga0439436_0038475 3300041404 Bacteria 1376
368 Ga0439465_0014148 3300041413 Bacteria 2486
369 Ga0439465_0023856 3300041413 Bacteria 1926
370 Ga0451839_0723437 3300041496 Bacteria 1332
371 Ga0451841_0401007 3300041498 Bacteria 1269
372 Ga0451845_0222913 3300041501 Bacteria 1537
373 Ga0451849_1504856 3300041505 Bacteria 1543
374 Ga0451855_0207479 3300041511 Bacteria 1677
375 Ga0451853_1605859 3300041512 Bacteria 1571
376 Ga0451853_3818750 3300041512 Bacteria 3084
377 Ga0439432_010858 3300042006 Bacteria 3145
378 Ga0439449_0020674 3300042007 Bacteria 2466
379 Ga0439452_020470 3300042010 Bacteria 1735
380 Ga0439455_0041259 3300042012 Bacteria 1183
381 Ga0450893_0025629 3300042532 Bacteria 1034
382 Ga0466958_0329285 3300045836 Bacteria 982
383 Ga0495592_0002656 3300046454 Bacteria 12640
384 Ga0495592_0070932 3300046454 Bacteria 2537
385 Ga0495603_0009896 3300046455 Bacteria 5771
386 Ga0495591_005100 3300046458 Bacteria 6165
387 Ga0495629_0008162 3300046459 Bacteria 7701
388 Ga0495629_0008457 3300046459 Bacteria 7577
389 Ga0495638_0000135 3300046460 Bacteria 118223
390 Ga0495638_0000164 3300046460 Bacteria 103139
391 Ga0495638_0000248 3300046460 Bacteria 73332
392 Ga0495638_0000377 3300046460 Bacteria 55414
393 Ga0495638_0170734 3300046460 Bacteria 1248
394 Ga0495651_0013349 3300046462 Bacteria 6355
395 Ga0495651_0246269 3300046462 Bacteria 1223
396 Ga0495653_0008680 3300046463 Bacteria 8328
397 Ga0495653_0082677 3300046463 Bacteria 2369
398 Ga0495653_0110373 3300046463 Bacteria 1977
399 Ga0495650_0000078 3300046471 Bacteria 245487
400 Ga0495650_0000378 3300046471 Bacteria 77220
401 Ga0495650_0000430 3300046471 Bacteria 67718
402 Ga0495650_0020803 3300046471 Bacteria 3189
403 Ga0495650_0035439 3300046471 Bacteria 2197
404 Ga0495580_0000001 3300046472 Bacteria 180598
405 Ga0495580_0005614 3300046472 Bacteria 10332
406 Ga0495580_0035956 3300046472 Bacteria 3559
407 Ga0495580_0098316 3300046472 Bacteria 2035
408 Ga0495582_0001589 3300046473 Bacteria 12808
409 Ga0495582_0007371 3300046473 Bacteria 6093
410 Ga0495582_0017475 3300046473 Bacteria 3924
411 Ga0495582_0169531 3300046473 Bacteria 1243
412 Ga0495605_0001133 3300046474 Bacteria 17679
413 Ga0495605_0012979 3300046474 Bacteria 4607
414 Ga0495605_0013552 3300046474 Bacteria 4487
415 Ga0495605_0056390 3300046474 Bacteria 1895
416 Ga0495662_0000473 3300046476 Bacteria 18250
417 Ga0495662_0026921 3300046476 Bacteria 2777
418 Ga0495664_0000156 3300046477 Bacteria 33686
419 Ga0495664_0006200 3300046477 Bacteria 6601
420 Ga0495664_0019698 3300046477 Bacteria 3883
421 Ga0495585_0004599 3300046492 Bacteria 8919
422 Ga0495585_0010597 3300046492 Bacteria 5480
423 Ga0495585_0029304 3300046492 Bacteria 3134
424 Ga0495594_0002528 3300046499 Bacteria 9524
425 Ga0495594_0167453 3300046499 Bacteria 1250
426 Ga0495596_0003386 3300046500 Bacteria 8099
427 Ga0495607_0022789 3300046501 Bacteria 3929
428 Ga0495607_0221788 3300046501 Bacteria 924
429 Ga0495583_0013752 3300046506 Bacteria 4495
430 Ga0495583_0085502 3300046506 Bacteria 1365
431 Ga0495606_0001316 3300046507 Bacteria 34004
432 Ga0495606_0002214 3300046507 Bacteria 23254
433 Ga0495606_0014454 3300046507 Bacteria 6159
434 Ga0495606_0054320 3300046507 Bacteria 2594
435 Ga0495608_0045646 3300046511 Bacteria 2919
436 Ga0495610_0029128 3300046512 Bacteria 2912
437 Ga0495610_0036143 3300046512 Bacteria 2527
438 Ga0495610_0096685 3300046512 Bacteria 1329
439 Ga0495616_0017890 3300046513 Bacteria 3905
440 Ga0495616_0132691 3300046513 Bacteria 1140
441 Ga0495618_0007714 3300046514 Bacteria 6508
442 Ga0495620_0025727 3300046515 Bacteria 2779
443 Ga0495620_0030226 3300046515 Bacteria 2497
444 Ga0495620_0053586 3300046515 Bacteria 1707
445 Ga0495628_0002011 3300046516 Bacteria 18436
446 Ga0495628_0010303 3300046516 Bacteria 7946
447 Ga0495628_0041134 3300046516 Bacteria 3690
448 Ga0495630_0016474 3300046517 Bacteria 5402
449 Ga0495630_0029949 3300046517 Bacteria 4047
450 Ga0495631_0000815 3300046518 Bacteria 19942
451 Ga0495631_0031340 3300046518 Bacteria 2406
452 Ga0495632_0044494 3300046519 Bacteria 2215
453 Ga0495632_0049815 3300046519 Bacteria 2069
454 Ga0495643_0009269 3300046522 Bacteria 6132
455 Ga0495643_0015548 3300046522 Bacteria 4495
456 Ga0495643_0018327 3300046522 Bacteria 4071
457 Ga0495643_0043621 3300046522 Bacteria 2440
458 Ga0495643_0094676 3300046522 Bacteria 1537
459 Ga0495648_0009862 3300046524 Bacteria 7338
460 Ga0495648_0010894 3300046524 Bacteria 6896
461 Ga0495648_0025674 3300046524 Bacteria 3984
462 Ga0495648_0035603 3300046524 Bacteria 3225
463 Ga0495648_0050389 3300046524 Bacteria 2544
464 Ga0495648_0056208 3300046524 Bacteria 2368
465 Ga0495663_0045627 3300046525 Bacteria 1344
466 Ga0495666_0004780 3300046526 Bacteria 6846
467 Ga0495666_0115133 3300046526 Bacteria 1261
468 Ga0495652_0009446 3300046529 Bacteria 8860
469 Ga0495652_0088225 3300046529 Bacteria 2542
470 Ga0495654_0082027 3300046530 Bacteria 1510
471 Ga0495654_0138648 3300046530 Bacteria 1086
472 Ga0495665_0003687 3300046531 Bacteria 8305
473 Ga0495665_0004228 3300046531 Bacteria 7750
474 Ga0495665_0008185 3300046531 Bacteria 5672
475 Ga0495640_0002199 3300046533 Bacteria 15604
476 Ga0495640_0008237 3300046533 Bacteria 8180
477 Ga0495586_0015187 3300046535 Bacteria 4097
478 Ga0495586_0210387 3300046535 Bacteria 1103
479 Ga0495587_0000900 3300046536 Bacteria 19689
480 Ga0495587_0001007 3300046536 Bacteria 18533
481 Ga0495587_0030035 3300046536 Bacteria 3297
482 Ga0495609_0086908 3300046538 Bacteria 1363
483 Ga0495597_0011930 3300046542 Bacteria 4203
484 Ga0495597_0025643 3300046542 Bacteria 2713
485 Ga0495645_0001999 3300046543 Bacteria 13873
486 Ga0495645_0101067 3300046543 Bacteria 2050
487 Ga0495622_0001061 3300046557 Bacteria 14578
488 Ga0495622_0007924 3300046557 Bacteria 4925
489 Ga0495622_0032010 3300046557 Bacteria 2456
490 Ga0495633_0018023 3300046558 Bacteria 3592
491 Ga0495633_0044644 3300046558 Bacteria 2100
492 Ga0495667_0000823 3300046559 Bacteria 20015
493 Ga0495656_0142319 3300046615 Bacteria 1151
494 Ga0495656_0239118 3300046615 Bacteria 914
495 Ga0495668_0000186 3300046616 Bacteria 92604
496 Ga0495668_0005275 3300046616 Bacteria 8840
497 Ga0495668_0020765 3300046616 Bacteria 3774
498 Ga0495668_0021744 3300046616 Bacteria 3673
499 Ga0495668_0122942 3300046616 Bacteria 1420
500 Ga0495634_0017302 3300046642 Bacteria 5147
501 Ga0495634_0195115 3300046642 Bacteria 1260
502 Ga0495611_0013881 3300046648 Bacteria 3436
503 Ga0495625_0005983 3300046660 Bacteria 10932
504 Ga0495625_0017296 3300046660 Bacteria 5647
505 Ga0495625_0033898 3300046660 Bacteria 3771
506 Ga0495625_0034650 3300046660 Bacteria 3725
507 Ga0495625_0080837 3300046660 Bacteria 2263
508 Ga0495625_0108381 3300046660 Bacteria 1900
509 Ga0495625_0181962 3300046660 Bacteria 1397
510 Ga0495625_0221701 3300046660 Bacteria 1239
511 Ga0495635_0335328 3300046663 Bacteria 1010
512 Ga0495661_0039959 3300046665 Bacteria 2912
513 Ga0495661_0075056 3300046665 Bacteria 1966
514 Ga0495588_0085333 3300046674 Bacteria 1651
515 Ga0495588_0199122 3300046674 Bacteria 1058
516 Ga0495657_0162102 3300046675 Bacteria 1383
517 Ga0495599_0003382 3300046678 Bacteria 9328
518 Ga0495599_0010036 3300046678 Bacteria 5796
519 Ga0495599_0025519 3300046678 Bacteria 3700
520 Ga0495599_0029919 3300046678 Bacteria 3416
521 Ga0495623_0006658 3300046679 Bacteria 7517
522 Ga0495623_0019580 3300046679 Bacteria 4374
523 Ga0495646_0001465 3300046680 Bacteria 14020
524 Ga0495646_0005211 3300046680 Bacteria 8197
525 Ga0495658_0114338 3300046683 Bacteria 1626
526 Ga0495669_0134131 3300046684 Bacteria 1167
527 Ga0495613_0000806 3300046689 Bacteria 24291
528 Ga0495613_0012198 3300046689 Bacteria 6386
529 Ga0495624_0002496 3300046690 Bacteria 13948
530 Ga0495624_0249887 3300046690 Bacteria 1072
531 Ga0495670_0065818 3300046691 Bacteria 1827
532 Ga0495670_0113327 3300046691 Bacteria 1405
533 Ga0495670_0230433 3300046691 Bacteria 985
534 Ga0495671_0009539 3300046692 Bacteria 5420
535 Ga0495671_0114402 3300046692 Bacteria 1317
536 Ga0495671_0143406 3300046692 Bacteria 1164
537 Ga0495649_0001469 3300046694 Bacteria 17717
538 Ga0495649_0153629 3300046694 Bacteria 1208
539 Ga0495589_0019075 3300046794 Bacteria 3518
540 Ga0495600_0002884 3300046809 Bacteria 10019
541 Ga0495660_0033063 3300046810 Bacteria 2902
542 Ga0495660_0062238 3300046810 Bacteria 2001
543 Ga0495660_0116281 3300046810 Bacteria 1359
544 Ga0495581_0001655 3300047315 Bacteria 12423
545 Ga0495581_0001895 3300047315 Bacteria 11712
546 Ga0495581_0034639 3300047315 Bacteria 2921
547 Ga0495604_0001350 3300047317 Bacteria 20066
548 Ga0495604_0007361 3300047317 Bacteria 8720
549 Ga0495604_0015181 3300047317 Bacteria 6148
550 Ga0495604_0025750 3300047317 Bacteria 4685
551 Ga0495636_0059516 3300047318 Bacteria 1612
552 Ga0495674_0009897 3300047319 Bacteria 9046
553 Ga0495674_0013133 3300047319 Bacteria 7788
554 Ga0495674_0129108 3300047319 Bacteria 2130
555 Ga0495674_0334512 3300047319 Bacteria 1231
556 Ga0495672_0001402 3300047320 Bacteria 23718
557 Ga0495672_0004852 3300047320 Bacteria 10834
558 Ga0495672_0022545 3300047320 Bacteria 4091
559 Ga0495672_0132564 3300047320 Bacteria 1309
560 Ga0495676_0000429 3300047321 Bacteria 34133
561 Ga0495676_0007624 3300047321 Bacteria 9926
562 Ga0495676_0033769 3300047321 Bacteria 4301
563 Ga0495680_0001304 3300047322 Bacteria 27169
564 Ga0495680_0032131 3300047322 Bacteria 4265
565 Ga0495680_0034478 3300047322 Bacteria 4086
566 Ga0495683_0002754 3300047323 Bacteria 10467
567 Ga0495683_0148359 3300047323 Bacteria 1094
568 Ga0495683_0165269 3300047323 Bacteria 1021
569 Ga0495687_010314 3300047443 Bacteria 5130
570 Ga0495675_0003911 3300047444 Bacteria 9019
571 Ga0495675_0013440 3300047444 Bacteria 5168
572 Ga0495675_0024369 3300047444 Bacteria 3857
573 Ga0495679_000456 3300047446 Bacteria 30142
574 Ga0495685_019047 3300047447 Bacteria 2357
575 Ga0495673_0019422 3300047469 Bacteria 3405
576 Ga0495684_0093121 3300047471 Bacteria 2282
577 Ga0495684_0141889 3300047471 Bacteria 1801
578 Ga0495684_0396946 3300047471 Bacteria 969
579 Ga0495686_0000877 3300047472 Bacteria 38321
580 Ga0495686_0005161 3300047472 Bacteria 10403
581 Ga0495686_0059750 3300047472 Bacteria 2371
582 Ga0495602_0004273 3300048088 Bacteria 14870
583 Ga0495602_0007942 3300048088 Bacteria 11087
584 Ga0495614_0007960 3300048089 Bacteria 4710
585 Ga0495614_0018480 3300048089 Bacteria 3018
586 Ga0495615_0004875 3300048090 Bacteria 2374
587 Ga0495626_0020342 3300048091 Bacteria 3309
588 Ga0496100_0000131 3300048903 Bacteria 42180
589 Ga0496100_0491129 3300048903 Bacteria 945
590 Ga0496101_0000444 3300048904 Bacteria 26360
591 Ga0496101_0032528 3300048904 Bacteria 3672
592 Ga0496102_0000128 3300048905 Bacteria 104717
593 Ga0496102_0001693 3300048905 Bacteria 19332
594 Ga0496102_0227002 3300048905 Bacteria 1761
595 Ga0496103_0002616 3300048906 Bacteria 11274
596 Ga0496103_0017231 3300048906 Bacteria 4321
597 Ga0496103_0336339 3300048906 Bacteria 971
598 Ga0496104_0048897 3300048907 Bacteria 3988
599 Ga0496104_0128110 3300048907 Bacteria 2437
600 Ga0496104_0249726 3300048907 Bacteria 1687
601 Ga0496105_0004378 3300048908 Bacteria 10632
602 Ga0496105_0038156 3300048908 Bacteria 3957
603 Ga0496105_0112414 3300048908 Bacteria 2248
604 Ga0496106_0000106 3300048909 Bacteria 64785
605 Ga0496106_0000334 3300048909 Bacteria 33088
606 Ga0496106_0201489 3300048909 Bacteria 1584
607 Ga0496107_0024888 3300048910 Bacteria 4237
608 Ga0496112_0003785 3300048915 Bacteria 12637
609 Ga0496112_0093881 3300048915 Bacteria 2970
610 Ga0496113_0030941 3300048916 Bacteria 3879
611 Ga0496113_0092206 3300048916 Bacteria 2336
612 Ga0496113_0125540 3300048916 Bacteria 2009
613 Ga0496114_0188789 3300048917 Bacteria 1802
614 Ga0496114_0273799 3300048917 Bacteria 1488
615 Ga0496115_0000032 3300048918 Bacteria 136928
616 Ga0496115_0000332 3300048918 Bacteria 40242
617 Ga0496115_0006397 3300048918 Bacteria 8631
618 Ga0496115_0020633 3300048918 Bacteria 5084
619 Ga0496115_0175970 3300048918 Bacteria 1769
620 Ga0496116_0017805 3300048919 Bacteria 5501
621 Ga0496116_0049283 3300048919 Bacteria 2818
622 Ga0496116_0109845 3300048919 Bacteria 1624
623 Ga0496116_0118320 3300048919 Bacteria 1539
624 Ga0496116_0121872 3300048919 Bacteria 1507
625 Ga0496116_0160613 3300048919 Bacteria 1233
626 Ga0496117_0000203 3300048920 Bacteria 117413
627 Ga0496117_0003083 3300048920 Bacteria 19947
628 Ga0496117_0023894 3300048920 Bacteria 4853
629 Ga0496117_0027957 3300048920 Bacteria 4375
630 Ga0496117_0054184 3300048920 Bacteria 2811
631 Ga0496117_0076007 3300048920 Bacteria 2229
632 Ga0496118_0000079 3300048921 Bacteria 190113
633 Ga0496118_0002439 3300048921 Bacteria 25029
634 Ga0496118_0002629 3300048921 Bacteria 23811
635 Ga0496118_0016317 3300048921 Bacteria 6819
636 Ga0496118_0020512 3300048921 Bacteria 5855
637 Ga0496118_0066605 3300048921 Bacteria 2628
638 Ga0496119_0000537 3300048922 Bacteria 51588
639 Ga0496119_0025527 3300048922 Bacteria 4123
640 Ga0496120_0000055 3300048923 Bacteria 180856
641 Ga0496120_0018436 3300048923 Bacteria 4499
642 Ga0496120_0059146 3300048923 Bacteria 2149
643 Ga0496121_0000249 3300048924 Bacteria 114260
644 Ga0496121_0000438 3300048924 Bacteria 82370
645 Ga0496121_0001644 3300048924 Bacteria 36928
646 Ga0496121_0003905 3300048924 Bacteria 20690
647 Ga0496121_0018741 3300048924 Bacteria 6959
648 Ga0496121_0031171 3300048924 Bacteria 4877
649 Ga0496121_0092519 3300048924 Bacteria 2357
650 Ga0496121_0093372 3300048924 Bacteria 2343
651 Ga0496121_0239562 3300048924 Bacteria 1265
652 Ga0496121_0274708 3300048924 Bacteria 1156
653 Ga0496122_0002390 3300048925 Bacteria 26829
654 Ga0496122_0013403 3300048925 Bacteria 8028
655 Ga0496122_0043529 3300048925 Bacteria 3516
656 Ga0496122_0121670 3300048925 Bacteria 1681
657 Ga0496123_0002146 3300048926 Bacteria 25206
658 Ga0496123_0011515 3300048926 Bacteria 7662
659 Ga0496123_0033851 3300048926 Bacteria 3670
660 Ga0496124_0010137 3300048927 Bacteria 9592
661 Ga0496124_0110283 3300048927 Bacteria 2216
662 Ga0496124_0303054 3300048927 Bacteria 1153
663 Ga0496125_0003865 3300048928 Bacteria 17724
664 Ga0496125_0013718 3300048928 Bacteria 7948
665 Ga0496126_0000389 3300048929 Bacteria 90452
666 Ga0496126_0005898 3300048929 Bacteria 13817
667 Ga0496126_0238973 3300048929 Bacteria 1518
668 Ga0495678_006144 3300049459 Bacteria 6446
669 Ga0495678_022210 3300049459 Bacteria 2778
670 Ga0495682_0020404 3300049460 Bacteria 2488
671 Ga0495682_0033343 3300049460 Bacteria 1901
672 Ga0495682_0055902 3300049460 Bacteria 1431
673 Ga0495682_0099920 3300049460 Bacteria 1040
674 Ga0501032_0049212 3300049569 Bacteria 2844
675 Ga0501033_0000071 3300049570 Bacteria 97350
676 Ga0501043_0071412 3300049579 Bacteria 2727
677 Ga0501047_0646739 3300049581 Bacteria 877
678 Ga0501069_0193550 3300049585 Bacteria 1177
679 Ga0501083_0072179 3300049744 Bacteria 2295
680 Ga0501266_005671 3300049763 Bacteria 1552
681 Ga0501044_0068024 3300049823 Unclassified 3629
682 nmdc:mga03683_10525_c1 3300050489 Bacteria 3319
683 nmdc:mga03n38_153756_c1 3300050490 Bacteria 1160
684 nmdc:mga0yw44_196_c1 3300050492 Bacteria 21440
685 nmdc:mga0yw44_45096_c1 3300050492 Bacteria 2641
686 nmdc:mga0k408_18468_c1 3300050493 Bacteria 3894
687 nmdc:mga07m45_3295_c1 3300050496 Bacteria 7771
688 nmdc:mga05p37_221279_c1 3300050507 Bacteria 2284
689 nmdc:mga0qj67_97_c1 3300050509 Bacteria 58508
690 nmdc:mga06r32_569_c1 3300050510 Bacteria 32069
691 nmdc:mga08x19_21720_c1 3300050514 Bacteria 3966
692 nmdc:mga0sz30_24077_c1 3300050516 Bacteria 1971
693 Ga0495601_0127080 3300053077 Bacteria 1659
694 Ga0500610_0002770 3300053079 Bacteria 6559
695 Ga0500610_0005738 3300053079 Bacteria 5126
696 Ga0500610_0037052 3300053079 Bacteria 2509
697 Ga0500578_0153648 3300053086 Bacteria 1432
698 Ga0500651_0000867 3300053093 Bacteria 14814
699 Ga0500556_0000065 3300053104 Bacteria 106261
700 Ga0500557_000361 3300053105 Bacteria 5925
701 Ga0500569_001114 3300053109 Bacteria 4934
702 Ga0500593_000137 3300053117 Bacteria 29162
703 Ga0500594_0009520 3300053118 Bacteria 2239
704 Ga0500607_000320 3300053121 Bacteria 45511
705 Ga0500618_000430 3300053125 Bacteria 27901
706 Ga0500618_001324 3300053125 Bacteria 11301
707 Ga0500618_012795 3300053125 Bacteria 2188
708 Ga0500642_0001721 3300053130 Bacteria 6314
709 Ga0500658_0000067 3300053134 Bacteria 48662
710 Ga0500658_0002046 3300053134 Bacteria 7863
711 Ga0500559_0228774 3300053136 Bacteria 877
712 Ga0500568_0000185 3300053139 Bacteria 54765
713 Ga0500568_0002618 3300053139 Bacteria 10468
714 Ga0500577_0150634 3300053142 Bacteria 986
715 Ga0500588_0004544 3300053146 Bacteria 3017
716 Ga0500588_0021789 3300053146 Bacteria 1736
717 Ga0500616_0000102 3300053153 Bacteria 168834
718 Ga0500616_0000526 3300053153 Bacteria 48257
719 Ga0500622_0000237 3300053156 Bacteria 57253
720 Ga0500622_0025606 3300053156 Bacteria 3116
721 Ga0500633_0007242 3300053160 Bacteria 2781
722 Ga0500636_0010399 3300053177 Bacteria 5428
723 Ga0500645_012767 3300053730 Bacteria 2712
724 Ga0501082_0052112 3300060353 Bacteria 3527
725 2585393628 2582581866 Bacteria 6859583
726 2509111678 2508501122 Bacteria 6292184
727 2509378442 2509276019 Bacteria 6802256
728 2510134774 2510065019 Bacteria 6903379
729 2510303158 2510065057 Bacteria 6649661
730 2510896126 2510461076 Bacteria 8618824
731 2511172824 2510917026 Bacteria 7046020
732 2511198474 2510917030 Bacteria 7460662
733 2511390941 2511231027 Bacteria 5013807
734 2511497156 2511231052 Bacteria 6974333
735 2513572540 2513237084 Bacteria 7231967
736 2513581254 2513237085 Bacteria 7695351
737 2513631387 2513237093 Bacteria 7545552
738 2513710678 2513237103 Bacteria 7647401
739 2513869736 2513237138 Bacteria 7368160
740 2513882243 2513237140 Bacteria 7076289
741 2513901820 2513237143 Bacteria 6664116
742 2513924694 2513237146 Bacteria 7166346
743 2514022403 2513237162 Bacteria 7468464
744 2514050005 2513237166 Bacteria 10373764
745 2514592618 2513237351 Bacteria 6968952
746 2515634732 2515154113 Bacteria 7807172
747 2515645966 2515154114 Bacteria 7848616
748 2515656847 2515154116 Bacteria 7552979
749 2515681961 2515154122 Bacteria 8609520
750 2515743586 2515154134 Bacteria 7220242
751 2516205959 2516143018 Bacteria 6951533
752 2516895614 2516653046 Bacteria 6989037
753 2517037476 2516653077 Bacteria 7555578
754 2517096573 2517093000 Bacteria 7412387
755 2551693112 2551306086 Bacteria 6843938
756 2551699551 2551306087 Bacteria 7351905
757 2551712076 2551306089 Bacteria 7162724
758 2551716317 2551306090 Bacteria 7953713
759 2551730680 2551306091 Bacteria 7086830
760 2551735646 2551306092 Bacteria 6992595
761 2551741042 2551306093 Bacteria 7064773
762 2555246740 2554235231 Bacteria 5215788
763 2558861831 2558860100 Bacteria 8458965
764 2563060243 2562617112 Bacteria 10918404
765 2572255040 2571042365 Bacteria 3289345
766 2585224854 2582581298 Bacteria 7315509
767 2585227725 2582581299 Bacteria 6518058
768 2585269946 2582581306 Bacteria 6450535
769 2585332708 2582581316 Bacteria 7774528
770 2585390653 2582581865 Bacteria 6644329
771 2585403315 2582581867 Bacteria 7184437
772 2585530203 2585427526 Bacteria 7258840
773 2585547410 2585427529 Bacteria 7395659
774 2585823612 2585427590 Bacteria 6824633
775 2599416247 2599185170 Bacteria 7295545
776 2600197646 2599185352 Bacteria 7228948
777 2616295490 2615840624 Bacteria 6557588
778 2617385470 2617270742 Bacteria 6808054
779 2643809237 2643221557 Bacteria 7184309
780 2644064361 2643221610 Bacteria 7480339
781 2644105379 2643221618 Bacteria 7717186
782 2644147349 2643221626 Bacteria 8069654
783 2644191467 2643221634 Bacteria 6705461
784 2644311204 2643221655 Bacteria 7722067
785 2644335192 2643221659 Bacteria 7890716
786 2644378831 2643221668 Bacteria 7306521
787 2644416193 2643221675 Bacteria 7473456
788 2644449233 2643221680 Bacteria 7473610
789 2644543528 2643221698 Bacteria 7756764
790 2644614439 2643221712 Bacteria 7729434
791 2644672172 2643221723 Bacteria 7095460
792 2644688457 2643221726 Bacteria 7455827
793 2692318474 2690316117 Bacteria 6800650
794 2713475417 2711768613 Bacteria 11048459
795 2723847180 2721755755 Bacteria 8322773
796 2723878154 2721755763 Bacteria 4464185
797 2725947761 2724679232 Bacteria 7646494
798 2738723368 2738541277 Bacteria 7458140
799 2739284099 2738543019 Bacteria 7459457
800 2739731178 2739367700 Bacteria 4747630
801 2739732472 2739367700 Bacteria 4747630
802 2753461139 2751185821 Bacteria 6189929
803 2766065390 2765235942 Bacteria 7445910
804 2770198050 2767802442 Bacteria 5747986
805 2778176965 2775507266 Bacteria 7392367
806 2792584912 2791355082 Bacteria 5973319
807 2792619329 2791355091 Bacteria 6135441
808 2792627101 2791355092 Bacteria 6248105
809 2792637594 2791355094 Bacteria 7011481
810 2793319787 2791355260 Bacteria 6598818
811 2793328207 2791355261 Bacteria 6661293
812 2805930562 2802429605 Bacteria 6875453
813 2805934259 2802429606 Bacteria 6346811
814 2819607783 2818991448 Bacteria 6772224
815 2831267358 2831265667 Bacteria 7184833
816 2838036371 2838035591 Bacteria 7166484
817 2838060335 2838054893 Bacteria 7451788
818 2838080045 2838074704 Bacteria 6785777
819 2838671209 2838668709 Bacteria 6671819
820 2838703611 2838701080 Bacteria 6669771
821 2841741038 2841734538 Bacteria 6784580
822 2841866270 2841864319 Bacteria 6742987
823 2842113506 2842110456 Bacteria 7656360
824 2842149387 2842146304 Bacteria 5957337
825 2842169759 2842163707 Bacteria 6916235
826 2842197846 2842192696 Bacteria 6147454
827 2842220148 2842217011 Bacteria 7497767
828 2842253975 2842250916 Bacteria 6579627
829 2842321461 2842317721 Bacteria 6793725
830 2842342155 2842341865 Bacteria 7003929
831 2842365869 2842363717 Bacteria 6844742
832 2842493205 2842489311 Bacteria 6620893
833 2842499227 2842495871 Bacteria 6820686
834 2842874335 2842871566 Bacteria 4827117
835 2844166592 2844163670 Bacteria 7266046
836 2847423023 2847417321 Bacteria 6913799
837 2848997575 2848992105 Bacteria 6810864
838 2850084127 2850079185 Bacteria 6848280
839 2851186848 2851182111 Bacteria 6047226
840 2852391422 2852387548 Bacteria 8025568
841 2855829572 2855825444 Bacteria 6785811
842 2855875345 2855872281 Bacteria 6964271
843 2857518973 2857516855 Bacteria 7787325
844 2858805868 2858800743 Bacteria 6603254
845 2871475491 2871474448 Bacteria 6806570
846 2882461762 2882456835 Bacteria 6863978
847 2884412538 2884411467 Bacteria 5246714
848 2885416143 2885409591 Bacteria 9235467
849 2896387170 2896384573 Bacteria 7700774
850 2900636753 2900634093 Bacteria 10263517
851 2902688803 2902682994 Bacteria 8951596
852 2904543801 2904541872 Bacteria 8915136
853 2904580298 2904578770 Bacteria 5302906
854 2904615607 2904615490 Bacteria 10047340
855 2908757029 2908756301 Bacteria 8864324
856 2909399116 2909399089 Bacteria 3922598
857 2913301550 2913295892 Bacteria 6333755
858 2915991518 2915986958 Bacteria 6739310
859 2916000547 2915993759 Bacteria 7016183
860 2916005140 2916000859 Bacteria 6865702
861 2916016038 2916014648 Bacteria 6946486
862 2916021882 2916021584 Bacteria 6854472
863 2916030921 2916028427 Bacteria 6748433
864 2916037312 2916035215 Bacteria 6755766
865 2916042232 2916041962 Bacteria 6820487
866 2916053448 2916048683 Bacteria 6543552
867 2916057194 2916055098 Bacteria 6758838
868 2916068683 2916068649 Bacteria 6943657
869 2916080657 2916076590 Bacteria 6596108
870 2919104493 2919100787 Bacteria 7710546
871 2919120026 2919119836 Bacteria 5208557
872 2919174639 2919171160 Bacteria 6499771
873 2920826499 2920822456 Bacteria 6897201
874 2921203347 2921201388 Bacteria 6926299
875 2921212402 2921208531 Bacteria 6745326
876 2921242097 2921237296 Bacteria 6876710
877 2921246273 2921244191 Bacteria 6568419
878 2921259240 2921257292 Bacteria 6808382
879 2921269829 2921263974 Bacteria 6864552
880 2921286739 2921282425 Bacteria 6826397
881 2921644621 2921643360 Bacteria 11448031
882 2923558857 2923556063 Bacteria 6793593
883 2924147929 2924144063 Bacteria 6883928
884 2924152814 2924150972 Bacteria 7169444
885 2924165757 2924165586 Bacteria 7260590
886 2924175648 2924172951 Bacteria 6749356
887 2924184222 2924179722 Bacteria 6843264
888 2924186715 2924186466 Bacteria 6876637
889 2924194400 2924193448 Bacteria 6955718
890 2924200750 2924200457 Bacteria 6757188
891 2924207373 2924207177 Bacteria 6917007
892 2924214103 2924214083 Bacteria 7080103
893 2924222522 2924221636 Bacteria 7113495
894 2924229090 2924228884 Bacteria 6633132
895 2924755440 2924754689 Bacteria 6774424
896 2928043056 2928037797 Bacteria 7273642
897 2928050285 2928044640 Bacteria 7271509
898 2928964453 2928963466 Bacteria 5165703
899 2928965159 2928963466 Bacteria 5165703
900 2929162641 2929160207 Bacteria 9075316
901 2933589204 2933586486 Bacteria 7667493
902 2935906968 2935901341 Bacteria 7341747
903 2936374941 2936367885 Bacteria 7324495
904 2936380632 2936375103 Bacteria 6652732
905 2937003215 2937002841 Bacteria 6934057
906 2937010064 2937009748 Bacteria 6746052
907 2937020500 2937016420 Bacteria 6782579
908 2937025382 2937023124 Bacteria 6815156
909 2937045240 2937042894 Bacteria 6741576
910 2937060322 2937056579 Bacteria 7107896
911 2937064140 2937063883 Bacteria 7199456
912 2937076872 2937071275 Bacteria 6984483
913 2937096329 2937091812 Bacteria 6979387
914 2937109819 2937106411 Bacteria 6947143
915 2937115644 2937113482 Bacteria 6505872
916 2937119877 2937119839 Bacteria 6597547
917 2937132524 2937126314 Bacteria 6771275
918 2937825264 2937822353 Bacteria 7290551
919 2937841425 2937836603 Bacteria 6811263
920 2941481312
921 2941505717 2941499720 Bacteria 7599444
922 2945910435 2945909444 Bacteria 7065066
923 2945987510 2945984333 Bacteria 7358892
924 2957382489 2957382221 Bacteria 6737050
925 2957400161 2957395598 Bacteria 6822399
926 2957404065 2957402308 Bacteria 6741770
927 2957411451 2957408893 Bacteria 6558585
928 2957416433 2957415311 Bacteria 6991633
929 2957425667 2957422303 Bacteria 7172205
930 2957432739 2957430029 Bacteria 7022557
931 2957445793 2957443900 Bacteria 6869977
932 2957450892 2957450854 Bacteria 6765715
933 2957460285 2957457609 Bacteria 6967680
934 2957465427 2957464669 Bacteria 6568877
935 2957474441 2957471148 Bacteria 6797643
936 2957478862 2957478035 Bacteria 6756658
937 2957485290 2957484790 Bacteria 6703082
938 2957493403 2957491536 Bacteria 6695180
939 2957498506 2957498199 Bacteria 7126688
940 2958075036 2958071322 Bacteria 6815895
941 2960588066 2960584000 Bacteria 6864594
942 2960600067 2960597568 Bacteria 6550735
943 2960607352 2960603979 Bacteria 6898737
944 2960611162 2960610863 Bacteria 6691244
945 2960622520 2960617483 Bacteria 6727748
946 2960627547 2960624210 Bacteria 6875384
947 2960644247 2960637947 Bacteria 7296468
948 2960647352 2960645483 Bacteria 7211087
949 2960657134 2960652885 Bacteria 7083688
950 2960663907 2960660292 Bacteria 7041660
951 2960667721 2960667422 Bacteria 6763020
952 2960679171 2960674078 Bacteria 6609048
953 2960691828 2960687367 Bacteria 6535474
954 2964611831 2964607997 Bacteria 7101408
955 2964618623 2964615318 Bacteria 6809089
956 2964626674 2964621998 Bacteria 6834995
957 2964634786 2964628898 Bacteria 7083044
958 2964636286 2964636051 Bacteria 7091832
959 2964643215 2964643177 Bacteria 6820887
960 2964662139 2964656573 Bacteria 7100150
961 2964663841 2964663802 Bacteria 7019362
962 2964674472 2964670856 Bacteria 6851364
963 2964683564 2964678106 Bacteria 6792020
964 2964685166 2964685014 Bacteria 6839111
965 2964694231 2964691889 Bacteria 6802758
966 2964699074 2964698721 Bacteria 6765331
967 2964710883 2964705432 Bacteria 7114648
968 2964716596 2964712639 Bacteria 6695970
969 2964722704 2964719344 Bacteria 7286602
970 2967669890 2967664464 Bacteria 6948836
971 2967671609 2967671571 Bacteria 7021409
972 2967703697 2967699805 Bacteria 6854538
973 2967708092 2967706974 Bacteria 7186053
974 2967721571 2967721400 Bacteria 7073753
975 2967737245 2967735183 Bacteria 6827012
976 2967742863 2967742019 Bacteria 6794534
977 2967749010 2967748971 Bacteria 6733771
978 2967755760 2967755722 Bacteria 6814706
979 2967769614 2967769361 Bacteria 6587838
980 2967781771 2967775926 Bacteria 6738189
981 2970023979 2970019648 Bacteria 7072033
982 2970033689 2970033650 Bacteria 7118744
983 2970050086 2970047711 Bacteria 7088379
984 2970065733 2970061556 Bacteria 7099761
985 2970068865 2970068827 Bacteria 7123112
986 2970078178 2970076120 Bacteria 6697332
987 2970084297 2970082768 Bacteria 6183754
988 2970092067 2970088815 Bacteria 6933825
989 2970095804 2970095765 Bacteria 6936963
990 2970102715 2970102677 Bacteria 6812532
991 2970111177 2970109326 Bacteria 6863976
992 2970136221 2970136068 Bacteria 7207982
993 2970160860 2970156795 Bacteria 7168044
994 2970169016 2970164137 Bacteria 6861252
995 2970171001 2970170962 Bacteria 6876229
996 2970183327 2970177841 Bacteria 6768001
997 2970189497 2970184632 Bacteria 7054431
998 2970192021 2970191845 Bacteria 7032787
999 2977518357 2977516862 Bacteria 6940108
1000 2977526369 2977523885 Bacteria 6960446
1001 2977543096 2977537788 Bacteria 6929320
1002 2977560515 2977558990 Bacteria 6863948
1003 2977566247 2977565890 Bacteria 6901543
1004 2984559302 2984559226 Bacteria 5683096
1005 2984595829 2984595703 Bacteria 5682994
1006 2996340362 2996336353 Bacteria 5511628
1007 3003935171 3003930520 Bacteria 5667563
1008 639649932 639633055 Bacteria 7751309
1009 642595960 642555112 Bacteria 8676562
1010 642623557 642555113 Bacteria 8214658
1011 643822111 643692032 Bacteria 6891900
1012 648735680 648276728 Bacteria 6968865
1013 8003015796 8003014200 Bacteria 4059994
1014 8004638808 8004633249 Bacteria 6723080
1015 8005294371 8005289223 Bacteria 6634003
1016 8005306451 8005301065 Bacteria 6614431
1017 8005306744 8005301065 Bacteria 6614431
1018 8005311237 8005307578 Bacteria 7395396
1019 8005378264 8005376324 Bacteria 6590079
1020 8005383910 8005382845 Bacteria 6732062
1021 8005401236 8005395548 Bacteria 6806915
1022 8005547211 8005542996 Bacteria 7077758
1023 8005558453 8005556819 Bacteria 6908598
1024 8005566703 8005563573 Bacteria 7153261
1025 8005650645 8005645114 Bacteria 6950293
1026 8005683660 8005682033 Bacteria 6726518
1027 8005693561 8005688590 Bacteria 6610080
1028 8005693849 8005688590 Bacteria 6610080
1029 8011352063 8011350971 Bacteria 6158957
1030 8018133682 8018127388 Bacteria 7351159
1031 8018170147 8018163183 Bacteria 7277977
1032 8023687621 8023680758 Bacteria 7729763
1033 8024489105 8024486573 Bacteria 6540512
1034 8024506012 8024501048 Bacteria 6427847
1035 8046769257 8046767195 Bacteria 7547379
1036 8049297753 8049293176 Bacteria 6128433
1037 8056686232 8056681323 Bacteria 8472857
1038 8057578566 8057575449 Bacteria 7367519
1039 8057876755 8057874678 Bacteria 7494653
1040 MRS2a_Contig_834
1041 JGI24739J22299_10083135
1042 JGI24735J21928_10000540
1043 JGI24749J21850_1000458
1044 JGI25156J39149_1000312
1045 JGI25162J39368_1002134
1046 JGI25158J39367_1000180
1047 JGI25152J39213_1004975
1048 JGI25152J39213_1010334
1049 JGI25150J39212_1001252
1050 JGI25159J45721_1000009
1051 JGI25159J45721_1001406
1052 JGI25159J45721_1011633
1053 JGI25151J46595_10000697
1054 JGI25151J46595_10006772
1055 JGI25151J46595_10020617
1056 JGI25151J46595_10030011
1057 JGI25153J46596_10003024
1058 JGI25153J46596_10011067
1059 JGI25153J46596_10024971
1060 rootH1_10002822
1061 rootH1_10007216
1062 rootH2_10035196
1063 rootH2_10155874
1064 rootH2_10207593
1065 rootL2_10001400
1066 rootL2_10049284
1067 rootH1_10007028
1068 rootH1_10019204
1069 rootH1_10031909
1070 JGI25160J50197_1000028
1071 JGI25160J50197_1000035
1072 JGI25160J50197_1004999
1073 JGI25160J50197_1018760
1074 JGI25161J50226_1000114
1075 JGI25161J50226_1000332
1076 JGI25161J50226_1006368
1077 JGI25161J50226_1010287
1078 Ga0055533_1000061
1079 Ga0055533_1002300
1080 Ga0055525_1001399
1081 Ga0055542_1000082
1082 Ga0055542_1000170
1083 Ga0055526_1001815
1084 Ga0055526_1002600
1085 Ga0055526_1010599
1086 Ga0055526_1022460
1087 Ga0055526_1032264
1088 Ga0055537_1009474
1089 Ga0055524_1021361
1090 Ga0055524_1021410
1091 Ga0055536_1001115
1092 Ga0055536_1001126
1093 Ga0055536_1002109
1094 Ga0055534_1009321
1095 Ga0055528_1001469
1096 Ga0055528_1013698
1097 Ga0055528_1014169
1098 Ga0055528_1020496
1099 Ga0055530_10000459
1100 Ga0055540_1003357
1101 Ga0055540_1005909
1102 Ga0055531_10005662
1103 Ga0055531_10017404
1104 Ga0055531_10017505
1105 Ga0055543_1000077
1106 Ga0055543_1000230
1107 Ga0055543_1008887
1108 Ga0055543_1011093
1109 Ga0065165_1000061
1110 Ga0065165_1000191
1111 Ga0065165_1022210
1112 Ga0070670_100249503
1113 Ga0070689_100020078
1114 Ga0070689_100069285
1115 Ga0070661_100071802
1116 Ga0070661_100464659
1117 Ga0070668_100030013
1118 Ga0070668_100529018
1119 Ga0070688_100031656
1120 Ga0070709_10080186
1121 Ga0070709_10087768
1122 Ga0070714_100034515
1123 Ga0070713_100088845
1124 Ga0070710_10035799
1125 Ga0070711_100015393
1126 Ga0070663_100062586
1127 Ga0070663_100093519
1128 Ga0070663_100378642
1129 Ga0070681_10277547
1130 Ga0070685_10003905
1131 Ga0070685_10018292
1132 Ga0070699_100295389
1133 Ga0068853_100157160
1134 Ga0070696_100084831
1135 Ga0070665_100012436
1136 Ga0068852_100018843
1137 Ga0068859_100163501
1138 Ga0068860_100267334
1139 Ga0068862_100001888
1140 Ga0068862_100025892
1141 Ga0068862_100071716
1142 Ga0068862_100113299
1143 Ga0081540_1016574
1144 Ga0081540_1016849
1145 Ga0075363_100038752
1146 Ga0075363_100091961
1147 Ga0075432_10090219
1148 Ga0070715_10014117
1149 Ga0075362_10056315
1150 Ga0075366_10018534
1151 Ga0097621_100237883
1152 Ga0075370_10005624
1153 Ga0075370_10017694
1154 Ga0068871_100076407
1155 Ga0075428_100052887
1156 Ga0075428_100056530
1157 Ga0075428_100972875
1158 Ga0075430_100000150
1159 Ga0075431_100000478
1160 Ga0075436_100015945
1161 Ga0097620_100005208
1162 Ga0097620_100163499
1163 Ga0099825_1032000
1164 Ga0099823_1000409
1165 Ga0105251_10049820
1166 Ga0105240_10000797
1167 Ga0105240_10001505
1168 Ga0105240_10012223
1169 Ga0105240_10091615
1170 Ga0105240_10150652
1171 Ga0111539_10079663
1172 Ga0111539_10087735
1173 Ga0105245_10019101
1174 Ga0105245_11002064
1175 Ga0114129_10222700
1176 Ga0114129_11249335
1177 Ga0105243_10063923
1178 Ga0105241_10037079
1179 Ga0105248_10006601
1180 Ga0105248_10056586
1181 Ga0105248_10284447
1182 Ga0105237_10000628
1183 Ga0105238_10000348
1184 Ga0105238_10014753
1185 Ga0105238_10045728
1186 Ga0105249_10028967
1187 Ga0105249_10096486
1188 Ga0105033_104376
1189 Ga0105239_10000288
1190 Ga0105239_10001567
1191 Ga0105239_10128502
1192 Ga0157347_1000866
1193 Ga0157370_10007496
1194 Ga0157369_10012755
1195 Ga0157369_10495442
1196 Ga0171463_1012
1197 Ga0157378_10033234
1198 Ga0163162_10004865
1199 Ga0163162_10057467
1200 Ga0163162_10411931
1201 Ga0157372_10000966
1202 Ga0157372_10069585
1203 Ga0157380_10000441
1204 Ga0182008_10005615
1205 Ga0157376_10533288
1206 Ga0157376_10583077
1207 Ga0183362_10002
1208 Ga0183368_1002
1209 Ga0163161_10000127
1210 Ga0214544_1000906
1211 Ga0214542_1000400
1212 Ga0214542_1021144
1213 Ga0214543_1000018
1214 Ga0214543_1000019
1215 Ga0213872_10066137
1216 Ga0213872_10140035
1217 Ga0213874_10048472
1218 Ga0209436_100050
1219 Ga0209436_100100
1220 Ga0209674_100003
1221 Ga0209674_100043
1222 Ga0209563_100086
1223 Ga0207427_102087
1224 Ga0207427_102860
1225 Ga0209437_100194
1226 Ga0209437_100651
1227 Ga0209437_102442
1228 Ga0209258_103160
1229 Ga0207425_1000602
1230 Ga0207425_1001660
1231 Ga0207425_1002953
1232 Ga0209026_1002643
1233 Ga0209026_1003717
1234 Ga0209677_100107
1235 Ga0209148_1000002
1236 Ga0209759_1010985
1237 Ga0209129_1000114
1238 Ga0209129_1000788
1239 Ga0209129_1001687
1240 Ga0209129_1003368
1241 Ga0209129_1006009
1242 Ga0209233_1010598
1243 Ga0209233_1026875
1244 Ga0209565_1000198
1245 Ga0209565_1006759
1246 Ga0209673_1000060
1247 Ga0209673_1000216
1248 Ga0209673_1000481
1249 Ga0209130_1000030
1250 Ga0209130_1000068
1251 Ga0209130_1000256
1252 Ga0209130_1000364
1253 Ga0209130_1019919
1254 Ga0209675_1000333
1255 Ga0209675_1001034
1256 Ga0209676_1000004
1257 Ga0209676_1000714
1258 Ga0209676_1002049
1259 Ga0209025_1000183
1260 Ga0209025_1000203
1261 Ga0209025_1000682
1262 Ga0209025_1001354
1263 Ga0209025_1005996
1264 Ga0209025_1011535
1265 Ga0209025_1031431
1266 Ga0209564_1000070
1267 Ga0209564_1000081
1268 Ga0209564_1000116
1269 Ga0209564_1000295
1270 Ga0209564_1000364
1271 Ga0209564_1010613
1272 Ga0209564_1036282
1273 Ga0209758_1000180
1274 Ga0209758_1000688
1275 Ga0209758_1001342
1276 Ga0209758_1010245
1277 Ga0209758_1012315
1278 Ga0209758_1013415
1279 Ga0209050_1000002
1280 Ga0209050_1000270
1281 Ga0209050_1002528
1282 Ga0209050_1005653
1283 Ga0209256_1000047
1284 Ga0209256_1000157
1285 Ga0209256_1000408
1286 Ga0209256_1001292
1287 Ga0209256_1002018
1288 Ga0209256_1002320
1289 Ga0209256_1033649
1290 Ga0207426_1000021
1291 Ga0207426_1000047
1292 Ga0207426_1000155
1293 Ga0207426_1000184
1294 Ga0207426_1000204
1295 Ga0207426_1038207
1296 Ga0209051_1000002
1297 Ga0209051_1001764
1298 Ga0209051_1013018
1299 Ga0209051_1013964
1300 Ga0209051_1018471
1301 Ga0209051_1026604
1302 Ga0209257_1000002
1303 Ga0209257_1003360
1304 Ga0209257_1003606
1305 Ga0209257_1005745
1306 Ga0209257_1005920
1307 Ga0209257_1011411
1308 Ga0207692_10064647
1309 Ga0207685_10124330
1310 Ga0207699_10042009
1311 Ga0207654_10003967
1312 Ga0207695_10000740
1313 Ga0207695_10001440
1314 Ga0207695_10065146
1315 Ga0207695_10111406
1316 Ga0207671_10007548
1317 Ga0207693_10019891
1318 Ga0207663_10023949
1319 Ga0207649_10074787
1320 Ga0207694_10000223
1321 Ga0207694_10010824
1322 Ga0207694_10034757
1323 Ga0207650_10206772
1324 Ga0207700_10085538
1325 Ga0207664_10054557
1326 Ga0207644_10248702
1327 Ga0207670_10007399
1328 Ga0207670_10219686
1329 Ga0207711_10004660
1330 Ga0207711_10116697
1331 Ga0207712_10017500
1332 Ga0207712_10139195
1333 Ga0207668_10323254
1334 Ga0207658_10183848
1335 Ga0207658_10310557
1336 Ga0207639_10121648
1337 Ga0207678_10031357
1338 Ga0207678_10112241
1339 Ga0207702_10263167
1340 Ga0207641_10045191
1341 Ga0207676_10242745
1342 Ga0207698_10012938
1343 Ga0209281_1000185
1344 Ga0209389_1000111
1345 Ga0209489_100220
1346 Ga0209700_100041
1347 Ga0207428_10081816
1348 Ga0268265_10001544
1349 Ga0268265_10037579
1350 Ga0268265_10124646
1351 Ga0268264_10643980
1352 Ga0307517_10000476
1353 Ga0307515_10003433
1354 Ga0307515_10013332
1355 Ga0307515_10052798
1356 Ga0307515_10125487
1357 Ga0307515_10207377
1358 Ga0268256_1029578
1359 Ga0265325_10029855
1360 Ga0265316_10104963
1361 Ga0307513_10053739
1362 Ga0307513_10137433
1363 Ga0307513_10405327
1364 Ga0307509_10000679
1365 Ga0307509_10001891
1366 Ga0307509_10138137
1367 Ga0307509_10177896
1368 Ga0265313_10019692
1369 Ga0307508_10000041
1370 Ga0307508_10001204
1371 Ga0307508_10205964
1372 Ga0307514_10002728
1373 Ga0265314_10000737
1374 Ga0307413_10135470
1375 Ga0307410_10393261
1376 Ga0307416_100279163
1377 Ga0307414_10015680
1378 Ga0307411_10104151
1379 Ga0307507_10016383
1380 Ga0307507_10082189
1381 Ga0307507_10090633
1382 Ga0307510_10000049
1383 Ga0307510_10000560
1384 Ga0307510_10165965
1385 Ga0395899_0091168
1386 Ga0395900_0099882
1387 Ga0395900_0118701
1388 Ga0395900_0709283
1389 Ga0395905_0086013
1390 Ga0395905_0149246
1391 Ga0395905_0210760
1392 Ga0395905_0393992
1393 Ga0395901_0152005
1394 Ga0395901_0506308
1395 Ga0436365_1664905
1396 Ga0436360_0942008
1397 Ga0436361_0182016
1398 Ga0436361_0256750
1399 Ga0436361_0311633
1400 Ga0436361_0520279
1401 Ga0436361_0652761
1402 Ga0436361_0731048
1403 Ga0436361_1204738
1404 Ga0436363_1168066
1405 Ga0439436_0038475
1406 Ga0439465_0014148
1407 Ga0439465_0023856
1408 Ga0451839_0723437
1409 Ga0451841_0401007
1410 Ga0451845_0222913
1411 Ga0451849_1504856
1412 Ga0451855_0207479
1413 Ga0451853_1605859
1414 Ga0451853_3818750
1415 Ga0439432_010858
1416 Ga0439449_0020674
1417 Ga0439452_020470
1418 Ga0439455_0041259
1419 Ga0450893_0025629
1420 Ga0466958_0329285
1421 Ga0495592_0002656
1422 Ga0495592_0070932
1423 Ga0495603_0009896
1424 Ga0495591_005100
1425 Ga0495629_0008162
1426 Ga0495629_0008457
1427 Ga0495638_0000135
1428 Ga0495638_0000164
1429 Ga0495638_0000248
1430 Ga0495638_0000377
1431 Ga0495638_0170734
1432 Ga0495651_0013349
1433 Ga0495651_0246269
1434 Ga0495653_0008680
1435 Ga0495653_0082677
1436 Ga0495653_0110373
1437 Ga0495650_0000078
1438 Ga0495650_0000378
1439 Ga0495650_0000430
1440 Ga0495650_0020803
1441 Ga0495650_0035439
1442 Ga0495580_0000001
1443 Ga0495580_0005614
1444 Ga0495580_0035956
1445 Ga0495580_0098316
1446 Ga0495582_0001589
1447 Ga0495582_0007371
1448 Ga0495582_0017475
1449 Ga0495582_0169531
1450 Ga0495605_0001133
1451 Ga0495605_0012979
1452 Ga0495605_0013552
1453 Ga0495605_0056390
1454 Ga0495662_0000473
1455 Ga0495662_0026921
1456 Ga0495664_0000156
1457 Ga0495664_0006200
1458 Ga0495664_0019698
1459 Ga0495585_0004599
1460 Ga0495585_0010597
1461 Ga0495585_0029304
1462 Ga0495594_0002528
1463 Ga0495594_0167453
1464 Ga0495596_0003386
1465 Ga0495607_0022789
1466 Ga0495607_0221788
1467 Ga0495583_0013752
1468 Ga0495583_0085502
1469 Ga0495606_0001316
1470 Ga0495606_0002214
1471 Ga0495606_0014454
1472 Ga0495606_0054320
1473 Ga0495608_0045646
1474 Ga0495610_0029128
1475 Ga0495610_0036143
1476 Ga0495610_0096685
1477 Ga0495616_0017890
1478 Ga0495616_0132691
1479 Ga0495618_0007714
1480 Ga0495620_0025727
1481 Ga0495620_0030226
1482 Ga0495620_0053586
1483 Ga0495628_0002011
1484 Ga0495628_0010303
1485 Ga0495628_0041134
1486 Ga0495630_0016474
1487 Ga0495630_0029949
1488 Ga0495631_0000815
1489 Ga0495631_0031340
1490 Ga0495632_0044494
1491 Ga0495632_0049815
1492 Ga0495643_0009269
1493 Ga0495643_0015548
1494 Ga0495643_0018327
1495 Ga0495643_0043621
1496 Ga0495643_0094676
1497 Ga0495648_0009862
1498 Ga0495648_0010894
1499 Ga0495648_0025674
1500 Ga0495648_0035603
1501 Ga0495648_0050389
1502 Ga0495648_0056208
1503 Ga0495663_0045627
1504 Ga0495666_0004780
1505 Ga0495666_0115133
1506 Ga0495652_0009446
1507 Ga0495652_0088225
1508 Ga0495654_0082027
1509 Ga0495654_0138648
1510 Ga0495665_0003687
1511 Ga0495665_0004228
1512 Ga0495665_0008185
1513 Ga0495640_0002199
1514 Ga0495640_0008237
1515 Ga0495586_0015187
1516 Ga0495586_0210387
1517 Ga0495587_0000900
1518 Ga0495587_0001007
1519 Ga0495587_0030035
1520 Ga0495609_0086908
1521 Ga0495597_0011930
1522 Ga0495597_0025643
1523 Ga0495645_0001999
1524 Ga0495645_0101067
1525 Ga0495622_0001061
1526 Ga0495622_0007924
1527 Ga0495622_0032010
1528 Ga0495633_0018023
1529 Ga0495633_0044644
1530 Ga0495667_0000823
1531 Ga0495656_0142319
1532 Ga0495656_0239118
1533 Ga0495668_0000186
1534 Ga0495668_0005275
1535 Ga0495668_0020765
1536 Ga0495668_0021744
1537 Ga0495668_0122942
1538 Ga0495634_0017302
1539 Ga0495634_0195115
1540 Ga0495611_0013881
1541 Ga0495625_0005983
1542 Ga0495625_0017296
1543 Ga0495625_0033898
1544 Ga0495625_0034650
1545 Ga0495625_0080837
1546 Ga0495625_0108381
1547 Ga0495625_0181962
1548 Ga0495625_0221701
1549 Ga0495635_0335328
1550 Ga0495661_0039959
1551 Ga0495661_0075056
1552 Ga0495588_0085333
1553 Ga0495588_0199122
1554 Ga0495657_0162102
1555 Ga0495599_0003382
1556 Ga0495599_0010036
1557 Ga0495599_0025519
1558 Ga0495599_0029919
1559 Ga0495623_0006658
1560 Ga0495623_0019580
1561 Ga0495646_0001465
1562 Ga0495646_0005211
1563 Ga0495658_0114338
1564 Ga0495669_0134131
1565 Ga0495613_0000806
1566 Ga0495613_0012198
1567 Ga0495624_0002496
1568 Ga0495624_0249887
1569 Ga0495670_0065818
1570 Ga0495670_0113327
1571 Ga0495670_0230433
1572 Ga0495671_0009539
1573 Ga0495671_0114402
1574 Ga0495671_0143406
1575 Ga0495649_0001469
1576 Ga0495649_0153629
1577 Ga0495589_0019075
1578 Ga0495600_0002884
1579 Ga0495660_0033063
1580 Ga0495660_0062238
1581 Ga0495660_0116281
1582 Ga0495581_0001655
1583 Ga0495581_0001895
1584 Ga0495581_0034639
1585 Ga0495604_0001350
1586 Ga0495604_0007361
1587 Ga0495604_0015181
1588 Ga0495604_0025750
1589 Ga0495636_0059516
1590 Ga0495674_0009897
1591 Ga0495674_0013133
1592 Ga0495674_0129108
1593 Ga0495674_0334512
1594 Ga0495672_0001402
1595 Ga0495672_0004852
1596 Ga0495672_0022545
1597 Ga0495672_0132564
1598 Ga0495676_0000429
1599 Ga0495676_0007624
1600 Ga0495676_0033769
1601 Ga0495680_0001304
1602 Ga0495680_0032131
1603 Ga0495680_0034478
1604 Ga0495683_0002754
1605 Ga0495683_0148359
1606 Ga0495683_0165269
1607 Ga0495687_010314
1608 Ga0495675_0003911
1609 Ga0495675_0013440
1610 Ga0495675_0024369
1611 Ga0495679_000456
1612 Ga0495685_019047
1613 Ga0495673_0019422
1614 Ga0495684_0093121
1615 Ga0495684_0141889
1616 Ga0495684_0396946
1617 Ga0495686_0000877
1618 Ga0495686_0005161
1619 Ga0495686_0059750
1620 Ga0495602_0004273
1621 Ga0495602_0007942
1622 Ga0495614_0007960
1623 Ga0495614_0018480
1624 Ga0495615_0004875
1625 Ga0495626_0020342
1626 Ga0496100_0000131
1627 Ga0496100_0491129
1628 Ga0496101_0000444
1629 Ga0496101_0032528
1630 Ga0496102_0000128
1631 Ga0496102_0001693
1632 Ga0496102_0227002
1633 Ga0496103_0002616
1634 Ga0496103_0017231
1635 Ga0496103_0336339
1636 Ga0496104_0048897
1637 Ga0496104_0128110
1638 Ga0496104_0249726
1639 Ga0496105_0004378
1640 Ga0496105_0038156
1641 Ga0496105_0112414
1642 Ga0496106_0000106
1643 Ga0496106_0000334
1644 Ga0496106_0201489
1645 Ga0496107_0024888
1646 Ga0496112_0003785
1647 Ga0496112_0093881
1648 Ga0496113_0030941
1649 Ga0496113_0092206
1650 Ga0496113_0125540
1651 Ga0496114_0188789
1652 Ga0496114_0273799
1653 Ga0496115_0000032
1654 Ga0496115_0000332
1655 Ga0496115_0006397
1656 Ga0496115_0020633
1657 Ga0496115_0175970
1658 Ga0496116_0017805
1659 Ga0496116_0049283
1660 Ga0496116_0109845
1661 Ga0496116_0118320
1662 Ga0496116_0121872
1663 Ga0496116_0160613
1664 Ga0496117_0000203
1665 Ga0496117_0003083
1666 Ga0496117_0023894
1667 Ga0496117_0027957
1668 Ga0496117_0054184
1669 Ga0496117_0076007
1670 Ga0496118_0000079
1671 Ga0496118_0002439
1672 Ga0496118_0002629
1673 Ga0496118_0016317
1674 Ga0496118_0020512
1675 Ga0496118_0066605
1676 Ga0496119_0000537
1677 Ga0496119_0025527
1678 Ga0496120_0000055
1679 Ga0496120_0018436
1680 Ga0496120_0059146
1681 Ga0496121_0000249
1682 Ga0496121_0000438
1683 Ga0496121_0001644
1684 Ga0496121_0003905
1685 Ga0496121_0018741
1686 Ga0496121_0031171
1687 Ga0496121_0092519
1688 Ga0496121_0093372
1689 Ga0496121_0239562
1690 Ga0496121_0274708
1691 Ga0496122_0002390
1692 Ga0496122_0013403
1693 Ga0496122_0043529
1694 Ga0496122_0121670
1695 Ga0496123_0002146
1696 Ga0496123_0011515
1697 Ga0496123_0033851
1698 Ga0496124_0010137
1699 Ga0496124_0110283
1700 Ga0496124_0303054
1701 Ga0496125_0003865
1702 Ga0496125_0013718
1703 Ga0496126_0000389
1704 Ga0496126_0005898
1705 Ga0496126_0238973
1706 Ga0495678_006144
1707 Ga0495678_022210
1708 Ga0495682_0020404
1709 Ga0495682_0033343
1710 Ga0495682_0055902
1711 Ga0495682_0099920
1712 Ga0501032_0049212
1713 Ga0501033_0000071
1714 Ga0501043_0071412
1715 Ga0501047_0646739
1716 Ga0501069_0193550
1717 Ga0501083_0072179
1718 Ga0501266_005671
1719 Ga0501044_0068024
1720 nmdc:mga03683_10525_c1
1721 nmdc:mga03n38_153756_c1
1722 nmdc:mga0yw44_196_c1
1723 nmdc:mga0yw44_45096_c1
1724 nmdc:mga0k408_18468_c1
1725 nmdc:mga07m45_3295_c1
1726 nmdc:mga05p37_221279_c1
1727 nmdc:mga0qj67_97_c1
1728 nmdc:mga06r32_569_c1
1729 nmdc:mga08x19_21720_c1
1730 nmdc:mga0sz30_24077_c1
1731 Ga0495601_0127080
1732 Ga0500610_0002770
1733 Ga0500610_0005738
1734 Ga0500610_0037052
1735 Ga0500578_0153648
1736 Ga0500651_0000867
1737 Ga0500556_0000065
1738 Ga0500557_000361
1739 Ga0500569_001114
1740 Ga0500593_000137
1741 Ga0500594_0009520
1742 Ga0500607_000320
1743 Ga0500618_000430
1744 Ga0500618_001324
1745 Ga0500618_012795
1746 Ga0500642_0001721
1747 Ga0500658_0000067
1748 Ga0500658_0002046
1749 Ga0500559_0228774
1750 Ga0500568_0000185
1751 Ga0500568_0002618
1752 Ga0500577_0150634
1753 Ga0500588_0004544
1754 Ga0500588_0021789
1755 Ga0500616_0000102
1756 Ga0500616_0000526
1757 Ga0500622_0000237
1758 Ga0500622_0025606
1759 Ga0500633_0007242
1760 Ga0500636_0010399
1761 Ga0500645_012767
1762 Ga0501082_0052112
1763 2585393628
1764 2509111678
1765 2509378442
1766 2510134774
1767 2510303158
1768 2510896126
1769 2511172824
1770 2511198474
1771 2511390941
1772 2511497156
1773 2513572540
1774 2513581254
1775 2513631387
1776 2513710678
1777 2513869736
1778 2513882243
1779 2513901820
1780 2513924694
1781 2514022403
1782 2514050005
1783 2514592618
1784 2515634732
1785 2515645966
1786 2515656847
1787 2515681961
1788 2515743586
1789 2516205959
1790 2516895614
1791 2517037476
1792 2517096573
1793 2551693112
1794 2551699551
1795 2551712076
1796 2551716317
1797 2551730680
1798 2551735646
1799 2551741042
1800 2555246740
1801 2558861831
1802 2563060243
1803 2572255040
1804 2585224854
1805 2585227725
1806 2585269946
1807 2585332708
1808 2585390653
1809 2585403315
1810 2585530203
1811 2585547410
1812 2585823612
1813 2599416247
1814 2600197646
1815 2616295490
1816 2617385470
1817 2643809237
1818 2644064361
1819 2644105379
1820 2644147349
1821 2644191467
1822 2644311204
1823 2644335192
1824 2644378831
1825 2644416193
1826 2644449233
1827 2644543528
1828 2644614439
1829 2644672172
1830 2644688457
1831 2692318474
1832 2713475417
1833 2723847180
1834 2723878154
1835 2725947761
1836 2738723368
1837 2739284099
1838 2739731178
1839 2739732472
1840 2753461139
1841 2766065390
1842 2770198050
1843 2778176965
1844 2792584912
1845 2792619329
1846 2792627101
1847 2792637594
1848 2793319787
1849 2793328207
1850 2805930562
1851 2805934259
1852 2819607783
1853 2831267358
1854 2838036371
1855 2838060335
1856 2838080045
1857 2838671209
1858 2838703611
1859 2841741038
1860 2841866270
1861 2842113506
1862 2842149387
1863 2842169759
1864 2842197846
1865 2842220148
1866 2842253975
1867 2842321461
1868 2842342155
1869 2842365869
1870 2842493205
1871 2842499227
1872 2842874335
1873 2844166592
1874 2847423023
1875 2848997575
1876 2850084127
1877 2851186848
1878 2852391422
1879 2855829572
1880 2855875345
1881 2857518973
1882 2858805868
1883 2871475491
1884 2882461762
1885 2884412538
1886 2885416143
1887 2896387170
1888 2900636753
1889 2902688803
1890 2904543801
1891 2904580298
1892 2904615607
1893 2908757029
1894 2909399116
1895 2913301550
1896 2915991518
1897 2916000547
1898 2916005140
1899 2916016038
1900 2916021882
1901 2916030921
1902 2916037312
1903 2916042232
1904 2916053448
1905 2916057194
1906 2916068683
1907 2916080657
1908 2919104493
1909 2919120026
1910 2919174639
1911 2920826499
1912 2921203347
1913 2921212402
1914 2921242097
1915 2921246273
1916 2921259240
1917 2921269829
1918 2921286739
1919 2921644621
1920 2923558857
1921 2924147929
1922 2924152814
1923 2924165757
1924 2924175648
1925 2924184222
1926 2924186715
1927 2924194400
1928 2924200750
1929 2924207373
1930 2924214103
1931 2924222522
1932 2924229090
1933 2924755440
1934 2928043056
1935 2928050285
1936 2928964453
1937 2928965159
1938 2929162641
1939 2933589204
1940 2935906968
1941 2936374941
1942 2936380632
1943 2937003215
1944 2937010064
1945 2937020500
1946 2937025382
1947 2937045240
1948 2937060322
1949 2937064140
1950 2937076872
1951 2937096329
1952 2937109819
1953 2937115644
1954 2937119877
1955 2937132524
1956 2937825264
1957 2937841425
1958 2941481312
1959 2941505717
1960 2945910435
1961 2945987510
1962 2957382489
1963 2957400161
1964 2957404065
1965 2957411451
1966 2957416433
1967 2957425667
1968 2957432739
1969 2957445793
1970 2957450892
1971 2957460285
1972 2957465427
1973 2957474441
1974 2957478862
1975 2957485290
1976 2957493403
1977 2957498506
1978 2958075036
1979 2960588066
1980 2960600067
1981 2960607352
1982 2960611162
1983 2960622520
1984 2960627547
1985 2960644247
1986 2960647352
1987 2960657134
1988 2960663907
1989 2960667721
1990 2960679171
1991 2960691828
1992 2964611831
1993 2964618623
1994 2964626674
1995 2964634786
1996 2964636286
1997 2964643215
1998 2964662139
1999 2964663841
2000 2964674472
2001 2964683564
2002 2964685166
2003 2964694231
2004 2964699074
2005 2964710883
2006 2964716596
2007 2964722704
2008 2967669890
2009 2967671609
2010 2967703697
2011 2967708092
2012 2967721571
2013 2967737245
2014 2967742863
2015 2967749010
2016 2967755760
2017 2967769614
2018 2967781771
2019 2970023979
2020 2970033689
2021 2970050086
2022 2970065733
2023 2970068865
2024 2970078178
2025 2970084297
2026 2970092067
2027 2970095804
2028 2970102715
2029 2970111177
2030 2970136221
2031 2970160860
2032 2970169016
2033 2970171001
2034 2970183327
2035 2970189497
2036 2970192021
2037 2977518357
2038 2977526369
2039 2977543096
2040 2977560515
2041 2977566247
2042 2984559302
2043 2984595829
2044 2996340362
2045 3003935171
2046 639649932
2047 642595960
2048 642623557
2049 643822111
2050 648735680
2051 8003015796
2052 8004638808
2053 8005294371
2054 8005306451
2055 8005306744
2056 8005311237
2057 8005378264
2058 8005383910
2059 8005401236
2060 8005547211
2061 8005558453
2062 8005566703
2063 8005650645
2064 8005683660
2065 8005693561
2066 8005693849
2067 8011352063
2068 8018133682
2069 8018170147
2070 8023687621
2071 8024489105
2072 8024506012
2073 8046769257
2074 8049297753
2075 8056686232
2076 8057578566
2077 8057876755

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

247

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

260

0.93

PF08659

KR

KR domain

56

230

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

58

222

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9693 12 264
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9667 12 263
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9555 12 263
6zdz-assembly1.cif.gz_B tetragonal crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.9549 12 264
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9509 12 264
ID Description Score Start End Superfamily
4bmvE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9705 12 264 3.40.50.720
4bmvE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 12 264 3.40.50.720
af_Q4CR34_41_280_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9183 12 235 3.40.50.720
af_Q4DKY8_26_208_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9135 10 171 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9087 13 78 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q4CV41-F1-model_v4 SDR family oxidoreductase 0.981 12 264 GO:0016020
GO:0016491
AF-A0A3R8NDT4-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9782 6 263 GO:0016491
AF-A0A2T9J0G4-F1-model_v4 SDR family oxidoreductase 0.9726 9 263 GO:0016491
AF-A0A1G5YGT2-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9716 9 264 GO:0016491
AF-A0A5A9EPS6-F1-model_v4 Catalase (EC 1.11.1.6) 0.9704 8 264 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
GO:0046872

Map