F488803
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1039 | 660 | 2077 | 267 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2582581866|2585393628 |
| Length | 315 |
| Sequence | SSLVPMHLVFLVSKRFCQAHVLNCWIYDICDRQALSYYRGWKFSLMEIVMTENSNGTALITGASSGIGAIYADRLARRGYDLILVARNKERLNALAKRLTDETGRAVEVIAADLGNKDDLGRIEKVLRSDASITTLVNNAGVGATAPLLSSDIDKMEEMITLNVNALTRLTYAAVPGFVKRGTGAIINIASIVGIAPEVLNGVYGGSKAFVLAFTLSLQKELSDKNIRVQAVLPGATATDFWGIAGTPLEHVPSEIVMSAEDMVDAALAGFDKGERITIPSLPDARDWEAYEAARQKLMPSLSLSTPAARYRTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 69 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 94 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 97 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 98 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 99 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 176 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 186 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 187 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 188 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 189 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 190 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 191 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 192 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 193 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 194 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 195 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 196 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 197 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 297 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 298 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 299 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 300 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 303 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 330 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 331 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 333 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 335 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 337 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 343 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 344 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 346 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 347 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 351 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 352 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 353 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 354 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 355 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 356 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 357 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 358 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 359 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 360 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 361 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 362 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 363 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 364 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 365 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 366 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 367 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 368 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 369 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 370 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 371 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 372 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 373 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 374 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 375 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 376 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 377 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 378 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 379 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 380 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 381 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 382 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 383 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 384 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 385 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 386 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 387 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 388 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 389 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 390 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 391 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 392 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 393 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 394 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 395 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 396 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 397 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 398 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 399 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 400 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 401 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 402 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 403 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 404 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 405 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 406 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 407 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 408 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 409 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 410 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 411 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 412 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 413 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 414 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 415 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 416 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 417 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 418 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 419 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 420 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 421 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 422 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 423 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 424 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 425 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 426 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 427 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 428 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 429 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 430 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 431 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 432 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 433 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 434 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 435 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 436 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 437 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 438 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 439 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 440 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 441 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 442 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 443 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 444 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 445 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 446 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 447 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 448 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 449 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 450 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 451 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 452 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 453 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 454 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 455 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 456 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 457 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 458 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 459 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 460 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 461 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 462 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 463 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 464 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 465 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 466 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 467 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 468 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 469 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 470 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 471 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 472 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 473 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 474 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 475 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 476 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 477 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 478 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 479 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 480 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 481 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 482 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 483 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 484 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 485 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 486 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 487 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 488 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 489 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 490 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 491 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 492 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 493 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 494 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 495 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 496 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 497 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 498 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 499 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 500 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 501 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 502 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 503 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 504 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 505 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 506 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 507 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 508 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 509 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 510 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 511 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 512 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 513 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 514 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 515 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 516 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 517 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 518 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 519 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 520 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 521 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 522 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 523 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 524 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 525 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 526 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 527 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 528 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 529 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 530 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 531 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 532 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 533 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 534 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 535 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 536 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 537 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 538 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 539 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 540 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 541 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 542 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 543 | 2941479691 | |||
| 544 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 545 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 546 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 547 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 548 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 549 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 550 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 551 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 552 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 553 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 554 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 555 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 556 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 557 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 558 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 559 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 560 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 561 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 562 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 563 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 564 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 565 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 566 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 567 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 568 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 569 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 570 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 571 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 572 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 573 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 574 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 575 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 576 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 577 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 578 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 579 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 580 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 581 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 582 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 583 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 584 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 585 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 586 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 587 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 588 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 589 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 590 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 591 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 592 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 593 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 594 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 595 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 596 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 597 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 598 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 599 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 600 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 601 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 602 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 603 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 604 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 605 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 606 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 607 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 608 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 609 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 610 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 611 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 612 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 613 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 614 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 615 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 616 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 617 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 618 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 619 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 620 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 621 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 622 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 623 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 624 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 625 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 626 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 627 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 628 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 629 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 630 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 631 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 632 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 633 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 634 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 635 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 636 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 637 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 638 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 639 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 640 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 641 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 642 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 643 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 644 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 645 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 646 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 647 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 648 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 649 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 650 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 651 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 652 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 653 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 654 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 655 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 656 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 657 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 658 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 659 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 660 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.68 |
| Metatranscriptomes | 0 |
| Isolates | 30.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 18.09 |
| Nodule | 22.81 |
| Rhizoplane | 3.27 |
| Rhizosphere | 41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_834 | 2124908027 | Bacteria | 18448 |
| 2 | JGI24739J22299_10083135 | 3300001989 | Bacteria | 981 |
| 3 | JGI24735J21928_10000540 | 3300002067 | Bacteria | 13365 |
| 4 | JGI24749J21850_1000458 | 3300002076 | Bacteria | 6074 |
| 5 | JGI25156J39149_1000312 | 3300002705 | Bacteria | 32295 |
| 6 | JGI25162J39368_1002134 | 3300002737 | Bacteria | 8334 |
| 7 | JGI25158J39367_1000180 | 3300002739 | Bacteria | 14916 |
| 8 | JGI25152J39213_1004975 | 3300002773 | Bacteria | 4019 |
| 9 | JGI25152J39213_1010334 | 3300002773 | Bacteria | 2144 |
| 10 | JGI25150J39212_1001252 | 3300002774 | Bacteria | 7343 |
| 11 | JGI25159J45721_1000009 | 3300002987 | Bacteria | 168868 |
| 12 | JGI25159J45721_1001406 | 3300002987 | Bacteria | 9996 |
| 13 | JGI25159J45721_1011633 | 3300002987 | Bacteria | 2144 |
| 14 | JGI25151J46595_10000697 | 3300003187 | Bacteria | 28184 |
| 15 | JGI25151J46595_10006772 | 3300003187 | Bacteria | 5705 |
| 16 | JGI25151J46595_10020617 | 3300003187 | Bacteria | 2776 |
| 17 | JGI25151J46595_10030011 | 3300003187 | Bacteria | 2144 |
| 18 | JGI25153J46596_10003024 | 3300003215 | Bacteria | 9511 |
| 19 | JGI25153J46596_10011067 | 3300003215 | Bacteria | 4019 |
| 20 | JGI25153J46596_10024971 | 3300003215 | Bacteria | 2144 |
| 21 | rootH1_10002822 | 3300003316 | Bacteria | 15935 |
| 22 | rootH1_10007216 | 3300003316 | Bacteria | 10392 |
| 23 | rootH2_10035196 | 3300003320 | Bacteria | 15170 |
| 24 | rootH2_10155874 | 3300003320 | Bacteria | 1940 |
| 25 | rootH2_10207593 | 3300003320 | Bacteria | 1599 |
| 26 | rootL2_10001400 | 3300003322 | Bacteria | 6669 |
| 27 | rootL2_10049284 | 3300003322 | Bacteria | 14756 |
| 28 | rootH1_10007028 | 3300003323 | Bacteria | 5859 |
| 29 | rootH1_10019204 | 3300003323 | Bacteria | 2703 |
| 30 | rootH1_10031909 | 3300003316 | Bacteria | 4650 |
| 31 | rootH1_10031909 | 3300003323 | Bacteria | 5971 |
| 32 | JGI25160J50197_1000028 | 3300003354 | Bacteria | 179309 |
| 33 | JGI25160J50197_1000035 | 3300003354 | Bacteria | 167972 |
| 34 | JGI25160J50197_1004999 | 3300003354 | Bacteria | 5618 |
| 35 | JGI25160J50197_1018760 | 3300003354 | Bacteria | 2144 |
| 36 | JGI25161J50226_1000114 | 3300003374 | Bacteria | 62957 |
| 37 | JGI25161J50226_1000332 | 3300003374 | Bacteria | 25529 |
| 38 | JGI25161J50226_1006368 | 3300003374 | Bacteria | 2148 |
| 39 | JGI25161J50226_1010287 | 3300003374 | Bacteria | 1260 |
| 40 | Ga0055533_1000061 | 3300003756 | Bacteria | 181542 |
| 41 | Ga0055533_1002300 | 3300003756 | Bacteria | 4418 |
| 42 | Ga0055525_1001399 | 3300003759 | Bacteria | 4534 |
| 43 | Ga0055542_1000082 | 3300003762 | Bacteria | 128120 |
| 44 | Ga0055542_1000170 | 3300003762 | Bacteria | 81222 |
| 45 | Ga0055526_1001815 | 3300003771 | Bacteria | 14781 |
| 46 | Ga0055526_1002600 | 3300003771 | Bacteria | 12067 |
| 47 | Ga0055526_1010599 | 3300003771 | Bacteria | 4267 |
| 48 | Ga0055526_1022460 | 3300003771 | Bacteria | 2144 |
| 49 | Ga0055526_1032264 | 3300003771 | Bacteria | 1482 |
| 50 | Ga0055537_1009474 | 3300003773 | Bacteria | 2144 |
| 51 | Ga0055524_1021361 | 3300003775 | Bacteria | 2148 |
| 52 | Ga0055524_1021410 | 3300003775 | Bacteria | 2144 |
| 53 | Ga0055536_1001115 | 3300003781 | Bacteria | 16861 |
| 54 | Ga0055536_1001126 | 3300003781 | Bacteria | 16756 |
| 55 | Ga0055536_1002109 | 3300003781 | Bacteria | 11320 |
| 56 | Ga0055534_1009321 | 3300003784 | Bacteria | 2144 |
| 57 | Ga0055528_1001469 | 3300003790 | Bacteria | 14317 |
| 58 | Ga0055528_1013698 | 3300003790 | Bacteria | 3054 |
| 59 | Ga0055528_1014169 | 3300003790 | Bacteria | 2966 |
| 60 | Ga0055528_1020496 | 3300003790 | Bacteria | 2144 |
| 61 | Ga0055530_10000459 | 3300003791 | Bacteria | 36096 |
| 62 | Ga0055540_1003357 | 3300003792 | Bacteria | 7770 |
| 63 | Ga0055540_1005909 | 3300003792 | Bacteria | 4999 |
| 64 | Ga0055531_10005662 | 3300003794 | Bacteria | 7258 |
| 65 | Ga0055531_10017404 | 3300003794 | Bacteria | 3037 |
| 66 | Ga0055531_10017505 | 3300003794 | Bacteria | 3020 |
| 67 | Ga0055543_1000077 | 3300004625 | Bacteria | 86457 |
| 68 | Ga0055543_1000230 | 3300004625 | Bacteria | 44357 |
| 69 | Ga0055543_1008887 | 3300004625 | Bacteria | 2193 |
| 70 | Ga0055543_1011093 | 3300004625 | Bacteria | 1860 |
| 71 | Ga0065165_1000061 | 3300005262 | Bacteria | 179347 |
| 72 | Ga0065165_1000191 | 3300005262 | Bacteria | 106980 |
| 73 | Ga0065165_1022210 | 3300005262 | Bacteria | 2182 |
| 74 | Ga0070670_100249503 | 3300005331 | Bacteria | 1546 |
| 75 | Ga0070689_100020078 | 3300005340 | Bacteria | 4953 |
| 76 | Ga0070689_100069285 | 3300005340 | Bacteria | 2752 |
| 77 | Ga0070661_100071802 | 3300005344 | Bacteria | 2547 |
| 78 | Ga0070661_100464659 | 3300005344 | Bacteria | 1008 |
| 79 | Ga0070668_100030013 | 3300005347 | Bacteria | 4131 |
| 80 | Ga0070668_100529018 | 3300005347 | Bacteria | 1024 |
| 81 | Ga0070688_100031656 | 3300005365 | Bacteria | 3184 |
| 82 | Ga0070709_10080186 | 3300005434 | Bacteria | 2128 |
| 83 | Ga0070709_10087768 | 3300005434 | Bacteria | 2044 |
| 84 | Ga0070714_100034515 | 3300005435 | Bacteria | 4236 |
| 85 | Ga0070713_100088845 | 3300005436 | Bacteria | 2653 |
| 86 | Ga0070710_10035799 | 3300005437 | Bacteria | 2709 |
| 87 | Ga0070711_100015393 | 3300005439 | Bacteria | 4841 |
| 88 | Ga0070663_100062586 | 3300005455 | Bacteria | 2683 |
| 89 | Ga0070663_100093519 | 3300005455 | Bacteria | 2231 |
| 90 | Ga0070663_100378642 | 3300005455 | Bacteria | 1152 |
| 91 | Ga0070681_10277547 | 3300005458 | Bacteria | 1587 |
| 92 | Ga0070685_10003905 | 3300005466 | Bacteria | 7532 |
| 93 | Ga0070685_10018292 | 3300005466 | Bacteria | 3766 |
| 94 | Ga0070699_100295389 | 3300005518 | Bacteria | 1453 |
| 95 | Ga0068853_100157160 | 3300005539 | Bacteria | 2049 |
| 96 | Ga0070696_100084831 | 3300005546 | Bacteria | 2248 |
| 97 | Ga0070665_100012436 | 3300005548 | Bacteria | 8580 |
| 98 | Ga0068852_100018843 | 3300005616 | Bacteria | 5447 |
| 99 | Ga0068859_100163501 | 3300005617 | Bacteria | 2305 |
| 100 | Ga0068860_100267334 | 3300005843 | Bacteria | 1668 |
| 101 | Ga0068862_100001888 | 3300005844 | Bacteria | 18996 |
| 102 | Ga0068862_100025892 | 3300005844 | Bacteria | 4928 |
| 103 | Ga0068862_100071716 | 3300005844 | Bacteria | 2991 |
| 104 | Ga0068862_100113299 | 3300005844 | Bacteria | 2382 |
| 105 | Ga0081540_1016574 | 3300005983 | Bacteria | 4603 |
| 106 | Ga0081540_1016849 | 3300005983 | Bacteria | 4551 |
| 107 | Ga0075363_100038752 | 3300006048 | Bacteria | 2506 |
| 108 | Ga0075363_100091961 | 3300006048 | Bacteria | 1670 |
| 109 | Ga0075432_10090219 | 3300006058 | Bacteria | 1121 |
| 110 | Ga0070715_10014117 | 3300006163 | Bacteria | 2950 |
| 111 | Ga0075362_10056315 | 3300006177 | Bacteria | 1769 |
| 112 | Ga0075366_10018534 | 3300006195 | Bacteria | 4020 |
| 113 | Ga0097621_100237883 | 3300006237 | Bacteria | 1591 |
| 114 | Ga0075370_10005624 | 3300006353 | Bacteria | 6253 |
| 115 | Ga0075370_10017694 | 3300006353 | Bacteria | 3854 |
| 116 | Ga0068871_100076407 | 3300006358 | Bacteria | 2766 |
| 117 | Ga0075428_100052887 | 3300006844 | Bacteria | 4450 |
| 118 | Ga0075428_100056530 | 3300006844 | Bacteria | 4298 |
| 119 | Ga0075428_100972875 | 3300006844 | Bacteria | 899 |
| 120 | Ga0075430_100000150 | 3300006846 | Bacteria | 44915 |
| 121 | Ga0075431_100000478 | 3300006847 | Bacteria | 33199 |
| 122 | Ga0075436_100015945 | 3300006914 | Bacteria | 5143 |
| 123 | Ga0097620_100005208 | 3300006931 | Bacteria | 13214 |
| 124 | Ga0097620_100163499 | 3300006931 | Bacteria | 2305 |
| 125 | Ga0099825_1032000 | 3300006941 | Bacteria | 2175 |
| 126 | Ga0099823_1000409 | 3300006944 | Bacteria | 27729 |
| 127 | Ga0105251_10049820 | 3300009011 | Bacteria | 2003 |
| 128 | Ga0105240_10000797 | 3300009093 | Bacteria | 57090 |
| 129 | Ga0105240_10001505 | 3300009093 | Bacteria | 39693 |
| 130 | Ga0105240_10012223 | 3300009093 | Bacteria | 11867 |
| 131 | Ga0105240_10091615 | 3300009093 | Bacteria | 3713 |
| 132 | Ga0105240_10150652 | 3300009093 | Bacteria | 2771 |
| 133 | Ga0111539_10079663 | 3300009094 | Bacteria | 3853 |
| 134 | Ga0111539_10087735 | 3300009094 | Unclassified | 3655 |
| 135 | Ga0105245_10019101 | 3300009098 | Bacteria | 5999 |
| 136 | Ga0105245_11002064 | 3300009098 | Bacteria | 880 |
| 137 | Ga0114129_10222700 | 3300009147 | Bacteria | 2544 |
| 138 | Ga0114129_11249335 | 3300009147 | Bacteria | 923 |
| 139 | Ga0105243_10063923 | 3300009148 | Bacteria | 2951 |
| 140 | Ga0105241_10037079 | 3300009174 | Bacteria | 3672 |
| 141 | Ga0105248_10006601 | 3300009177 | Bacteria | 12712 |
| 142 | Ga0105248_10056586 | 3300009177 | Bacteria | 4400 |
| 143 | Ga0105248_10284447 | 3300009177 | Bacteria | 1862 |
| 144 | Ga0105237_10000628 | 3300009545 | Bacteria | 49290 |
| 145 | Ga0105238_10000348 | 3300009551 | Bacteria | 49784 |
| 146 | Ga0105238_10014753 | 3300009551 | Bacteria | 7902 |
| 147 | Ga0105238_10045728 | 3300009551 | Bacteria | 4422 |
| 148 | Ga0105249_10028967 | 3300009553 | Bacteria | 4999 |
| 149 | Ga0105249_10096486 | 3300009553 | Bacteria | 2774 |
| 150 | Ga0105033_104376 | 3300009986 | Bacteria | 1201 |
| 151 | Ga0105239_10000288 | 3300010375 | Bacteria | 74273 |
| 152 | Ga0105239_10001567 | 3300010375 | Bacteria | 30193 |
| 153 | Ga0105239_10128502 | 3300010375 | Bacteria | 2817 |
| 154 | Ga0157347_1000866 | 3300012502 | Bacteria | 2177 |
| 155 | Ga0157370_10007496 | 3300013104 | Bacteria | 11853 |
| 156 | Ga0157369_10012755 | 3300013105 | Bacteria | 9530 |
| 157 | Ga0157369_10495442 | 3300013105 | Bacteria | 1264 |
| 158 | Ga0171463_1012 | 3300013249 | Bacteria | 176554 |
| 159 | Ga0157378_10033234 | 3300013297 | Bacteria | 4558 |
| 160 | Ga0163162_10004865 | 3300013306 | Bacteria | 12963 |
| 161 | Ga0163162_10057467 | 3300013306 | Bacteria | 3919 |
| 162 | Ga0163162_10411931 | 3300013306 | Bacteria | 1484 |
| 163 | Ga0157372_10000966 | 3300013307 | Bacteria | 31334 |
| 164 | Ga0157372_10069585 | 3300013307 | Bacteria | 3958 |
| 165 | Ga0157380_10000441 | 3300014326 | Bacteria | 25347 |
| 166 | Ga0182008_10005615 | 3300014497 | Bacteria | 7111 |
| 167 | Ga0157376_10533288 | 3300014969 | Bacteria | 1159 |
| 168 | Ga0157376_10583077 | 3300014969 | Bacteria | 1111 |
| 169 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 170 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 171 | Ga0163161_10000127 | 3300017792 | Bacteria | 71051 |
| 172 | Ga0214544_1000906 | 3300021320 | Bacteria | 58379 |
| 173 | Ga0214542_1000400 | 3300021321 | Bacteria | 76349 |
| 174 | Ga0214542_1021144 | 3300021321 | Bacteria | 4569 |
| 175 | Ga0214543_1000018 | 3300021327 | Bacteria | 272335 |
| 176 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 177 | Ga0213872_10066137 | 3300021361 | Bacteria | 1632 |
| 178 | Ga0213872_10140035 | 3300021361 | Bacteria | 1062 |
| 179 | Ga0213874_10048472 | 3300021377 | Bacteria | 1296 |
| 180 | Ga0209436_100050 | 3300025208 | Bacteria | 65942 |
| 181 | Ga0209436_100100 | 3300025208 | Bacteria | 42446 |
| 182 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 183 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 184 | Ga0209563_100086 | 3300025230 | Bacteria | 182199 |
| 185 | Ga0207427_102087 | 3300025231 | Bacteria | 5869 |
| 186 | Ga0207427_102860 | 3300025231 | Bacteria | 4151 |
| 187 | Ga0209437_100194 | 3300025233 | Bacteria | 121991 |
| 188 | Ga0209437_100651 | 3300025233 | Bacteria | 19894 |
| 189 | Ga0209437_102442 | 3300025233 | Bacteria | 3604 |
| 190 | Ga0209258_103160 | 3300025242 | Bacteria | 3721 |
| 191 | Ga0207425_1000602 | 3300025245 | Bacteria | 20840 |
| 192 | Ga0207425_1001660 | 3300025245 | Bacteria | 8937 |
| 193 | Ga0207425_1002953 | 3300025245 | Bacteria | 5690 |
| 194 | Ga0209026_1002643 | 3300025250 | Bacteria | 6529 |
| 195 | Ga0209026_1003717 | 3300025250 | Bacteria | 4865 |
| 196 | Ga0209677_100107 | 3300025253 | Bacteria | 89035 |
| 197 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 198 | Ga0209759_1010985 | 3300025256 | Bacteria | 2609 |
| 199 | Ga0209129_1000114 | 3300025258 | Bacteria | 141791 |
| 200 | Ga0209129_1000788 | 3300025258 | Bacteria | 19977 |
| 201 | Ga0209129_1001687 | 3300025258 | Bacteria | 11953 |
| 202 | Ga0209129_1003368 | 3300025258 | Bacteria | 7025 |
| 203 | Ga0209129_1006009 | 3300025258 | Bacteria | 4074 |
| 204 | Ga0209233_1010598 | 3300025261 | Bacteria | 2752 |
| 205 | Ga0209233_1026875 | 3300025261 | Bacteria | 1401 |
| 206 | Ga0209565_1000198 | 3300025263 | Bacteria | 71641 |
| 207 | Ga0209565_1006759 | 3300025263 | Bacteria | 3179 |
| 208 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 209 | Ga0209673_1000216 | 3300025273 | Bacteria | 114232 |
| 210 | Ga0209673_1000481 | 3300025273 | Bacteria | 66688 |
| 211 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 212 | Ga0209130_1000068 | 3300025284 | Bacteria | 179361 |
| 213 | Ga0209130_1000256 | 3300025284 | Bacteria | 66866 |
| 214 | Ga0209130_1000364 | 3300025284 | Bacteria | 51592 |
| 215 | Ga0209130_1019919 | 3300025284 | Bacteria | 1545 |
| 216 | Ga0209675_1000333 | 3300025291 | Bacteria | 41235 |
| 217 | Ga0209675_1001034 | 3300025291 | Bacteria | 17375 |
| 218 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 219 | Ga0209676_1000714 | 3300025292 | Bacteria | 45991 |
| 220 | Ga0209676_1002049 | 3300025292 | Bacteria | 15759 |
| 221 | Ga0209025_1000183 | 3300025294 | Bacteria | 155799 |
| 222 | Ga0209025_1000203 | 3300025294 | Bacteria | 145210 |
| 223 | Ga0209025_1000682 | 3300025294 | Bacteria | 58271 |
| 224 | Ga0209025_1001354 | 3300025294 | Bacteria | 32918 |
| 225 | Ga0209025_1005996 | 3300025294 | Bacteria | 9651 |
| 226 | Ga0209025_1011535 | 3300025294 | Bacteria | 5805 |
| 227 | Ga0209025_1031431 | 3300025294 | Bacteria | 2511 |
| 228 | Ga0209564_1000070 | 3300025295 | Bacteria | 303126 |
| 229 | Ga0209564_1000081 | 3300025295 | Bacteria | 261592 |
| 230 | Ga0209564_1000116 | 3300025295 | Bacteria | 207889 |
| 231 | Ga0209564_1000295 | 3300025295 | Bacteria | 100738 |
| 232 | Ga0209564_1000364 | 3300025295 | Bacteria | 84138 |
| 233 | Ga0209564_1010613 | 3300025295 | Bacteria | 4217 |
| 234 | Ga0209564_1036282 | 3300025295 | Bacteria | 1409 |
| 235 | Ga0209758_1000180 | 3300025297 | Bacteria | 141791 |
| 236 | Ga0209758_1000688 | 3300025297 | Bacteria | 50116 |
| 237 | Ga0209758_1001342 | 3300025297 | Bacteria | 29705 |
| 238 | Ga0209758_1010245 | 3300025297 | Bacteria | 5648 |
| 239 | Ga0209758_1012315 | 3300025297 | Bacteria | 4801 |
| 240 | Ga0209758_1013415 | 3300025297 | Bacteria | 4468 |
| 241 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 242 | Ga0209050_1000270 | 3300025298 | Bacteria | 110916 |
| 243 | Ga0209050_1002528 | 3300025298 | Bacteria | 15339 |
| 244 | Ga0209050_1005653 | 3300025298 | Bacteria | 7741 |
| 245 | Ga0209256_1000047 | 3300025299 | Bacteria | 314709 |
| 246 | Ga0209256_1000157 | 3300025299 | Bacteria | 141791 |
| 247 | Ga0209256_1000408 | 3300025299 | Bacteria | 67949 |
| 248 | Ga0209256_1001292 | 3300025299 | Bacteria | 27015 |
| 249 | Ga0209256_1002018 | 3300025299 | Bacteria | 18110 |
| 250 | Ga0209256_1002320 | 3300025299 | Bacteria | 15934 |
| 251 | Ga0209256_1033649 | 3300025299 | Bacteria | 1375 |
| 252 | Ga0207426_1000021 | 3300025302 | Bacteria | 556343 |
| 253 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 254 | Ga0207426_1000155 | 3300025302 | Bacteria | 179361 |
| 255 | Ga0207426_1000184 | 3300025302 | Bacteria | 154290 |
| 256 | Ga0207426_1000204 | 3300025302 | Bacteria | 141791 |
| 257 | Ga0207426_1038207 | 3300025302 | Bacteria | 1513 |
| 258 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 259 | Ga0209051_1001764 | 3300025303 | Bacteria | 17175 |
| 260 | Ga0209051_1013018 | 3300025303 | Bacteria | 3983 |
| 261 | Ga0209051_1013964 | 3300025303 | Bacteria | 3780 |
| 262 | Ga0209051_1018471 | 3300025303 | Bacteria | 3084 |
| 263 | Ga0209051_1026604 | 3300025303 | Bacteria | 2327 |
| 264 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 265 | Ga0209257_1003360 | 3300025304 | Bacteria | 13827 |
| 266 | Ga0209257_1003606 | 3300025304 | Bacteria | 13048 |
| 267 | Ga0209257_1005745 | 3300025304 | Bacteria | 8484 |
| 268 | Ga0209257_1005920 | 3300025304 | Bacteria | 8230 |
| 269 | Ga0209257_1011411 | 3300025304 | Bacteria | 4280 |
| 270 | Ga0207692_10064647 | 3300025898 | Bacteria | 1906 |
| 271 | Ga0207685_10124330 | 3300025905 | Bacteria | 1137 |
| 272 | Ga0207699_10042009 | 3300025906 | Bacteria | 2645 |
| 273 | Ga0207654_10003967 | 3300025911 | Bacteria | 7452 |
| 274 | Ga0207695_10000740 | 3300025913 | Bacteria | 63254 |
| 275 | Ga0207695_10001440 | 3300025913 | Bacteria | 39881 |
| 276 | Ga0207695_10065146 | 3300025913 | Plasmid | 3747 |
| 277 | Ga0207695_10111406 | 3300025913 | Bacteria | 2716 |
| 278 | Ga0207671_10007548 | 3300025914 | Bacteria | 9416 |
| 279 | Ga0207693_10019891 | 3300025915 | Bacteria | 5339 |
| 280 | Ga0207663_10023949 | 3300025916 | Bacteria | 3511 |
| 281 | Ga0207649_10074787 | 3300025920 | Bacteria | 2175 |
| 282 | Ga0207694_10000223 | 3300025924 | Bacteria | 55562 |
| 283 | Ga0207694_10010824 | 3300025924 | Bacteria | 6886 |
| 284 | Ga0207694_10034757 | 3300025924 | Bacteria | 3866 |
| 285 | Ga0207650_10206772 | 3300025925 | Bacteria | 1575 |
| 286 | Ga0207700_10085538 | 3300025928 | Bacteria | 2475 |
| 287 | Ga0207664_10054557 | 3300025929 | Bacteria | 3167 |
| 288 | Ga0207644_10248702 | 3300025931 | Bacteria | 1418 |
| 289 | Ga0207670_10007399 | 3300025936 | Bacteria | 6126 |
| 290 | Ga0207670_10219686 | 3300025936 | Bacteria | 1454 |
| 291 | Ga0207711_10004660 | 3300025941 | Bacteria | 11643 |
| 292 | Ga0207711_10116697 | 3300025941 | Bacteria | 2380 |
| 293 | Ga0207712_10017500 | 3300025961 | Bacteria | 4655 |
| 294 | Ga0207712_10139195 | 3300025961 | Bacteria | 1860 |
| 295 | Ga0207668_10323254 | 3300025972 | Bacteria | 1281 |
| 296 | Ga0207658_10183848 | 3300025986 | Bacteria | 1732 |
| 297 | Ga0207658_10310557 | 3300025986 | Bacteria | 1362 |
| 298 | Ga0207639_10121648 | 3300026041 | Bacteria | 2146 |
| 299 | Ga0207678_10031357 | 3300026067 | Bacteria | 4637 |
| 300 | Ga0207678_10112241 | 3300026067 | Bacteria | 2325 |
| 301 | Ga0207702_10263167 | 3300026078 | Bacteria | 1625 |
| 302 | Ga0207641_10045191 | 3300026088 | Bacteria | 3708 |
| 303 | Ga0207676_10242745 | 3300026095 | Bacteria | 1617 |
| 304 | Ga0207698_10012938 | 3300026142 | Bacteria | 5485 |
| 305 | Ga0209281_1000185 | 3300027111 | Bacteria | 144489 |
| 306 | Ga0209389_1000111 | 3300027296 | Bacteria | 72517 |
| 307 | Ga0209489_100220 | 3300027361 | Bacteria | 95167 |
| 308 | Ga0209700_100041 | 3300027363 | Bacteria | 168380 |
| 309 | Ga0207428_10081816 | 3300027907 | Unclassified | 2521 |
| 310 | Ga0268265_10001544 | 3300028380 | Bacteria | 19126 |
| 311 | Ga0268265_10037579 | 3300028380 | Bacteria | 3555 |
| 312 | Ga0268265_10124646 | 3300028380 | Bacteria | 2129 |
| 313 | Ga0268264_10643980 | 3300028381 | Bacteria | 1048 |
| 314 | Ga0307517_10000476 | 3300028786 | Bacteria | 68696 |
| 315 | Ga0307515_10003433 | 3300028794 | Bacteria | 33339 |
| 316 | Ga0307515_10013332 | 3300028794 | Bacteria | 15375 |
| 317 | Ga0307515_10052798 | 3300028794 | Bacteria | 6016 |
| 318 | Ga0307515_10125487 | 3300028794 | Bacteria | 2871 |
| 319 | Ga0307515_10207377 | 3300028794 | Bacteria | 1815 |
| 320 | Ga0268256_1029578 | 3300030500 | Bacteria | 1339 |
| 321 | Ga0265325_10029855 | 3300031241 | Bacteria | 2927 |
| 322 | Ga0265316_10104963 | 3300031344 | Bacteria | 2144 |
| 323 | Ga0307513_10053739 | 3300031456 | Bacteria | 4326 |
| 324 | Ga0307513_10137433 | 3300031456 | Bacteria | 2377 |
| 325 | Ga0307513_10405327 | 3300031456 | Bacteria | 1097 |
| 326 | Ga0307509_10000679 | 3300031507 | Bacteria | 58021 |
| 327 | Ga0307509_10001891 | 3300031507 | Bacteria | 34576 |
| 328 | Ga0307509_10138137 | 3300031507 | Bacteria | 2378 |
| 329 | Ga0307509_10177896 | 3300031507 | Bacteria | 1997 |
| 330 | Ga0265313_10019692 | 3300031595 | Bacteria | 3746 |
| 331 | Ga0307508_10000041 | 3300031616 | Bacteria | 147868 |
| 332 | Ga0307508_10001204 | 3300031616 | Bacteria | 29689 |
| 333 | Ga0307508_10205964 | 3300031616 | Bacteria | 1568 |
| 334 | Ga0307514_10002728 | 3300031649 | Bacteria | 17817 |
| 335 | Ga0265314_10000737 | 3300031711 | Bacteria | 39300 |
| 336 | Ga0307413_10135470 | 3300031824 | Bacteria | 1693 |
| 337 | Ga0307410_10393261 | 3300031852 | Bacteria | 1118 |
| 338 | Ga0307416_100279163 | 3300032002 | Bacteria | 1646 |
| 339 | Ga0307414_10015680 | 3300032004 | Bacteria | 4581 |
| 340 | Ga0307411_10104151 | 3300032005 | Bacteria | 2014 |
| 341 | Ga0307507_10016383 | 3300033179 | Bacteria | 8625 |
| 342 | Ga0307507_10082189 | 3300033179 | Bacteria | 2826 |
| 343 | Ga0307507_10090633 | 3300033179 | Bacteria | 2623 |
| 344 | Ga0307510_10000049 | 3300033180 | Bacteria | 91546 |
| 345 | Ga0307510_10000560 | 3300033180 | Bacteria | 37413 |
| 346 | Ga0307510_10165965 | 3300033180 | Bacteria | 1796 |
| 347 | Ga0395899_0091168 | 3300037312 | Bacteria | 2209 |
| 348 | Ga0395900_0099882 | 3300037418 | Bacteria | 2981 |
| 349 | Ga0395900_0118701 | 3300037418 | Bacteria | 2714 |
| 350 | Ga0395900_0709283 | 3300037418 | Bacteria | 939 |
| 351 | Ga0395905_0086013 | 3300037471 | Bacteria | 2946 |
| 352 | Ga0395905_0149246 | 3300037471 | Bacteria | 2199 |
| 353 | Ga0395905_0210760 | 3300037471 | Bacteria | 1820 |
| 354 | Ga0395905_0393992 | 3300037471 | Bacteria | 1279 |
| 355 | Ga0395901_0152005 | 3300038443 | Bacteria | 2432 |
| 356 | Ga0395901_0506308 | 3300038443 | Bacteria | 1229 |
| 357 | Ga0436365_1664905 | 3300039437 | Bacteria | 3705 |
| 358 | Ga0436360_0942008 | 3300039438 | Bacteria | 3040 |
| 359 | Ga0436361_0182016 | 3300039447 | Bacteria | 5201 |
| 360 | Ga0436361_0256750 | 3300039447 | Bacteria | 3388 |
| 361 | Ga0436361_0311633 | 3300039447 | Bacteria | 6215 |
| 362 | Ga0436361_0520279 | 3300039447 | Bacteria | 1777 |
| 363 | Ga0436361_0652761 | 3300039447 | Bacteria | 3610 |
| 364 | Ga0436361_0731048 | 3300039447 | Bacteria | 1684 |
| 365 | Ga0436361_1204738 | 3300039447 | Bacteria | 3997 |
| 366 | Ga0436363_1168066 | 3300039450 | Bacteria | 1300 |
| 367 | Ga0439436_0038475 | 3300041404 | Bacteria | 1376 |
| 368 | Ga0439465_0014148 | 3300041413 | Bacteria | 2486 |
| 369 | Ga0439465_0023856 | 3300041413 | Bacteria | 1926 |
| 370 | Ga0451839_0723437 | 3300041496 | Bacteria | 1332 |
| 371 | Ga0451841_0401007 | 3300041498 | Bacteria | 1269 |
| 372 | Ga0451845_0222913 | 3300041501 | Bacteria | 1537 |
| 373 | Ga0451849_1504856 | 3300041505 | Bacteria | 1543 |
| 374 | Ga0451855_0207479 | 3300041511 | Bacteria | 1677 |
| 375 | Ga0451853_1605859 | 3300041512 | Bacteria | 1571 |
| 376 | Ga0451853_3818750 | 3300041512 | Bacteria | 3084 |
| 377 | Ga0439432_010858 | 3300042006 | Bacteria | 3145 |
| 378 | Ga0439449_0020674 | 3300042007 | Bacteria | 2466 |
| 379 | Ga0439452_020470 | 3300042010 | Bacteria | 1735 |
| 380 | Ga0439455_0041259 | 3300042012 | Bacteria | 1183 |
| 381 | Ga0450893_0025629 | 3300042532 | Bacteria | 1034 |
| 382 | Ga0466958_0329285 | 3300045836 | Bacteria | 982 |
| 383 | Ga0495592_0002656 | 3300046454 | Bacteria | 12640 |
| 384 | Ga0495592_0070932 | 3300046454 | Bacteria | 2537 |
| 385 | Ga0495603_0009896 | 3300046455 | Bacteria | 5771 |
| 386 | Ga0495591_005100 | 3300046458 | Bacteria | 6165 |
| 387 | Ga0495629_0008162 | 3300046459 | Bacteria | 7701 |
| 388 | Ga0495629_0008457 | 3300046459 | Bacteria | 7577 |
| 389 | Ga0495638_0000135 | 3300046460 | Bacteria | 118223 |
| 390 | Ga0495638_0000164 | 3300046460 | Bacteria | 103139 |
| 391 | Ga0495638_0000248 | 3300046460 | Bacteria | 73332 |
| 392 | Ga0495638_0000377 | 3300046460 | Bacteria | 55414 |
| 393 | Ga0495638_0170734 | 3300046460 | Bacteria | 1248 |
| 394 | Ga0495651_0013349 | 3300046462 | Bacteria | 6355 |
| 395 | Ga0495651_0246269 | 3300046462 | Bacteria | 1223 |
| 396 | Ga0495653_0008680 | 3300046463 | Bacteria | 8328 |
| 397 | Ga0495653_0082677 | 3300046463 | Bacteria | 2369 |
| 398 | Ga0495653_0110373 | 3300046463 | Bacteria | 1977 |
| 399 | Ga0495650_0000078 | 3300046471 | Bacteria | 245487 |
| 400 | Ga0495650_0000378 | 3300046471 | Bacteria | 77220 |
| 401 | Ga0495650_0000430 | 3300046471 | Bacteria | 67718 |
| 402 | Ga0495650_0020803 | 3300046471 | Bacteria | 3189 |
| 403 | Ga0495650_0035439 | 3300046471 | Bacteria | 2197 |
| 404 | Ga0495580_0000001 | 3300046472 | Bacteria | 180598 |
| 405 | Ga0495580_0005614 | 3300046472 | Bacteria | 10332 |
| 406 | Ga0495580_0035956 | 3300046472 | Bacteria | 3559 |
| 407 | Ga0495580_0098316 | 3300046472 | Bacteria | 2035 |
| 408 | Ga0495582_0001589 | 3300046473 | Bacteria | 12808 |
| 409 | Ga0495582_0007371 | 3300046473 | Bacteria | 6093 |
| 410 | Ga0495582_0017475 | 3300046473 | Bacteria | 3924 |
| 411 | Ga0495582_0169531 | 3300046473 | Bacteria | 1243 |
| 412 | Ga0495605_0001133 | 3300046474 | Bacteria | 17679 |
| 413 | Ga0495605_0012979 | 3300046474 | Bacteria | 4607 |
| 414 | Ga0495605_0013552 | 3300046474 | Bacteria | 4487 |
| 415 | Ga0495605_0056390 | 3300046474 | Bacteria | 1895 |
| 416 | Ga0495662_0000473 | 3300046476 | Bacteria | 18250 |
| 417 | Ga0495662_0026921 | 3300046476 | Bacteria | 2777 |
| 418 | Ga0495664_0000156 | 3300046477 | Bacteria | 33686 |
| 419 | Ga0495664_0006200 | 3300046477 | Bacteria | 6601 |
| 420 | Ga0495664_0019698 | 3300046477 | Bacteria | 3883 |
| 421 | Ga0495585_0004599 | 3300046492 | Bacteria | 8919 |
| 422 | Ga0495585_0010597 | 3300046492 | Bacteria | 5480 |
| 423 | Ga0495585_0029304 | 3300046492 | Bacteria | 3134 |
| 424 | Ga0495594_0002528 | 3300046499 | Bacteria | 9524 |
| 425 | Ga0495594_0167453 | 3300046499 | Bacteria | 1250 |
| 426 | Ga0495596_0003386 | 3300046500 | Bacteria | 8099 |
| 427 | Ga0495607_0022789 | 3300046501 | Bacteria | 3929 |
| 428 | Ga0495607_0221788 | 3300046501 | Bacteria | 924 |
| 429 | Ga0495583_0013752 | 3300046506 | Bacteria | 4495 |
| 430 | Ga0495583_0085502 | 3300046506 | Bacteria | 1365 |
| 431 | Ga0495606_0001316 | 3300046507 | Bacteria | 34004 |
| 432 | Ga0495606_0002214 | 3300046507 | Bacteria | 23254 |
| 433 | Ga0495606_0014454 | 3300046507 | Bacteria | 6159 |
| 434 | Ga0495606_0054320 | 3300046507 | Bacteria | 2594 |
| 435 | Ga0495608_0045646 | 3300046511 | Bacteria | 2919 |
| 436 | Ga0495610_0029128 | 3300046512 | Bacteria | 2912 |
| 437 | Ga0495610_0036143 | 3300046512 | Bacteria | 2527 |
| 438 | Ga0495610_0096685 | 3300046512 | Bacteria | 1329 |
| 439 | Ga0495616_0017890 | 3300046513 | Bacteria | 3905 |
| 440 | Ga0495616_0132691 | 3300046513 | Bacteria | 1140 |
| 441 | Ga0495618_0007714 | 3300046514 | Bacteria | 6508 |
| 442 | Ga0495620_0025727 | 3300046515 | Bacteria | 2779 |
| 443 | Ga0495620_0030226 | 3300046515 | Bacteria | 2497 |
| 444 | Ga0495620_0053586 | 3300046515 | Bacteria | 1707 |
| 445 | Ga0495628_0002011 | 3300046516 | Bacteria | 18436 |
| 446 | Ga0495628_0010303 | 3300046516 | Bacteria | 7946 |
| 447 | Ga0495628_0041134 | 3300046516 | Bacteria | 3690 |
| 448 | Ga0495630_0016474 | 3300046517 | Bacteria | 5402 |
| 449 | Ga0495630_0029949 | 3300046517 | Bacteria | 4047 |
| 450 | Ga0495631_0000815 | 3300046518 | Bacteria | 19942 |
| 451 | Ga0495631_0031340 | 3300046518 | Bacteria | 2406 |
| 452 | Ga0495632_0044494 | 3300046519 | Bacteria | 2215 |
| 453 | Ga0495632_0049815 | 3300046519 | Bacteria | 2069 |
| 454 | Ga0495643_0009269 | 3300046522 | Bacteria | 6132 |
| 455 | Ga0495643_0015548 | 3300046522 | Bacteria | 4495 |
| 456 | Ga0495643_0018327 | 3300046522 | Bacteria | 4071 |
| 457 | Ga0495643_0043621 | 3300046522 | Bacteria | 2440 |
| 458 | Ga0495643_0094676 | 3300046522 | Bacteria | 1537 |
| 459 | Ga0495648_0009862 | 3300046524 | Bacteria | 7338 |
| 460 | Ga0495648_0010894 | 3300046524 | Bacteria | 6896 |
| 461 | Ga0495648_0025674 | 3300046524 | Bacteria | 3984 |
| 462 | Ga0495648_0035603 | 3300046524 | Bacteria | 3225 |
| 463 | Ga0495648_0050389 | 3300046524 | Bacteria | 2544 |
| 464 | Ga0495648_0056208 | 3300046524 | Bacteria | 2368 |
| 465 | Ga0495663_0045627 | 3300046525 | Bacteria | 1344 |
| 466 | Ga0495666_0004780 | 3300046526 | Bacteria | 6846 |
| 467 | Ga0495666_0115133 | 3300046526 | Bacteria | 1261 |
| 468 | Ga0495652_0009446 | 3300046529 | Bacteria | 8860 |
| 469 | Ga0495652_0088225 | 3300046529 | Bacteria | 2542 |
| 470 | Ga0495654_0082027 | 3300046530 | Bacteria | 1510 |
| 471 | Ga0495654_0138648 | 3300046530 | Bacteria | 1086 |
| 472 | Ga0495665_0003687 | 3300046531 | Bacteria | 8305 |
| 473 | Ga0495665_0004228 | 3300046531 | Bacteria | 7750 |
| 474 | Ga0495665_0008185 | 3300046531 | Bacteria | 5672 |
| 475 | Ga0495640_0002199 | 3300046533 | Bacteria | 15604 |
| 476 | Ga0495640_0008237 | 3300046533 | Bacteria | 8180 |
| 477 | Ga0495586_0015187 | 3300046535 | Bacteria | 4097 |
| 478 | Ga0495586_0210387 | 3300046535 | Bacteria | 1103 |
| 479 | Ga0495587_0000900 | 3300046536 | Bacteria | 19689 |
| 480 | Ga0495587_0001007 | 3300046536 | Bacteria | 18533 |
| 481 | Ga0495587_0030035 | 3300046536 | Bacteria | 3297 |
| 482 | Ga0495609_0086908 | 3300046538 | Bacteria | 1363 |
| 483 | Ga0495597_0011930 | 3300046542 | Bacteria | 4203 |
| 484 | Ga0495597_0025643 | 3300046542 | Bacteria | 2713 |
| 485 | Ga0495645_0001999 | 3300046543 | Bacteria | 13873 |
| 486 | Ga0495645_0101067 | 3300046543 | Bacteria | 2050 |
| 487 | Ga0495622_0001061 | 3300046557 | Bacteria | 14578 |
| 488 | Ga0495622_0007924 | 3300046557 | Bacteria | 4925 |
| 489 | Ga0495622_0032010 | 3300046557 | Bacteria | 2456 |
| 490 | Ga0495633_0018023 | 3300046558 | Bacteria | 3592 |
| 491 | Ga0495633_0044644 | 3300046558 | Bacteria | 2100 |
| 492 | Ga0495667_0000823 | 3300046559 | Bacteria | 20015 |
| 493 | Ga0495656_0142319 | 3300046615 | Bacteria | 1151 |
| 494 | Ga0495656_0239118 | 3300046615 | Bacteria | 914 |
| 495 | Ga0495668_0000186 | 3300046616 | Bacteria | 92604 |
| 496 | Ga0495668_0005275 | 3300046616 | Bacteria | 8840 |
| 497 | Ga0495668_0020765 | 3300046616 | Bacteria | 3774 |
| 498 | Ga0495668_0021744 | 3300046616 | Bacteria | 3673 |
| 499 | Ga0495668_0122942 | 3300046616 | Bacteria | 1420 |
| 500 | Ga0495634_0017302 | 3300046642 | Bacteria | 5147 |
| 501 | Ga0495634_0195115 | 3300046642 | Bacteria | 1260 |
| 502 | Ga0495611_0013881 | 3300046648 | Bacteria | 3436 |
| 503 | Ga0495625_0005983 | 3300046660 | Bacteria | 10932 |
| 504 | Ga0495625_0017296 | 3300046660 | Bacteria | 5647 |
| 505 | Ga0495625_0033898 | 3300046660 | Bacteria | 3771 |
| 506 | Ga0495625_0034650 | 3300046660 | Bacteria | 3725 |
| 507 | Ga0495625_0080837 | 3300046660 | Bacteria | 2263 |
| 508 | Ga0495625_0108381 | 3300046660 | Bacteria | 1900 |
| 509 | Ga0495625_0181962 | 3300046660 | Bacteria | 1397 |
| 510 | Ga0495625_0221701 | 3300046660 | Bacteria | 1239 |
| 511 | Ga0495635_0335328 | 3300046663 | Bacteria | 1010 |
| 512 | Ga0495661_0039959 | 3300046665 | Bacteria | 2912 |
| 513 | Ga0495661_0075056 | 3300046665 | Bacteria | 1966 |
| 514 | Ga0495588_0085333 | 3300046674 | Bacteria | 1651 |
| 515 | Ga0495588_0199122 | 3300046674 | Bacteria | 1058 |
| 516 | Ga0495657_0162102 | 3300046675 | Bacteria | 1383 |
| 517 | Ga0495599_0003382 | 3300046678 | Bacteria | 9328 |
| 518 | Ga0495599_0010036 | 3300046678 | Bacteria | 5796 |
| 519 | Ga0495599_0025519 | 3300046678 | Bacteria | 3700 |
| 520 | Ga0495599_0029919 | 3300046678 | Bacteria | 3416 |
| 521 | Ga0495623_0006658 | 3300046679 | Bacteria | 7517 |
| 522 | Ga0495623_0019580 | 3300046679 | Bacteria | 4374 |
| 523 | Ga0495646_0001465 | 3300046680 | Bacteria | 14020 |
| 524 | Ga0495646_0005211 | 3300046680 | Bacteria | 8197 |
| 525 | Ga0495658_0114338 | 3300046683 | Bacteria | 1626 |
| 526 | Ga0495669_0134131 | 3300046684 | Bacteria | 1167 |
| 527 | Ga0495613_0000806 | 3300046689 | Bacteria | 24291 |
| 528 | Ga0495613_0012198 | 3300046689 | Bacteria | 6386 |
| 529 | Ga0495624_0002496 | 3300046690 | Bacteria | 13948 |
| 530 | Ga0495624_0249887 | 3300046690 | Bacteria | 1072 |
| 531 | Ga0495670_0065818 | 3300046691 | Bacteria | 1827 |
| 532 | Ga0495670_0113327 | 3300046691 | Bacteria | 1405 |
| 533 | Ga0495670_0230433 | 3300046691 | Bacteria | 985 |
| 534 | Ga0495671_0009539 | 3300046692 | Bacteria | 5420 |
| 535 | Ga0495671_0114402 | 3300046692 | Bacteria | 1317 |
| 536 | Ga0495671_0143406 | 3300046692 | Bacteria | 1164 |
| 537 | Ga0495649_0001469 | 3300046694 | Bacteria | 17717 |
| 538 | Ga0495649_0153629 | 3300046694 | Bacteria | 1208 |
| 539 | Ga0495589_0019075 | 3300046794 | Bacteria | 3518 |
| 540 | Ga0495600_0002884 | 3300046809 | Bacteria | 10019 |
| 541 | Ga0495660_0033063 | 3300046810 | Bacteria | 2902 |
| 542 | Ga0495660_0062238 | 3300046810 | Bacteria | 2001 |
| 543 | Ga0495660_0116281 | 3300046810 | Bacteria | 1359 |
| 544 | Ga0495581_0001655 | 3300047315 | Bacteria | 12423 |
| 545 | Ga0495581_0001895 | 3300047315 | Bacteria | 11712 |
| 546 | Ga0495581_0034639 | 3300047315 | Bacteria | 2921 |
| 547 | Ga0495604_0001350 | 3300047317 | Bacteria | 20066 |
| 548 | Ga0495604_0007361 | 3300047317 | Bacteria | 8720 |
| 549 | Ga0495604_0015181 | 3300047317 | Bacteria | 6148 |
| 550 | Ga0495604_0025750 | 3300047317 | Bacteria | 4685 |
| 551 | Ga0495636_0059516 | 3300047318 | Bacteria | 1612 |
| 552 | Ga0495674_0009897 | 3300047319 | Bacteria | 9046 |
| 553 | Ga0495674_0013133 | 3300047319 | Bacteria | 7788 |
| 554 | Ga0495674_0129108 | 3300047319 | Bacteria | 2130 |
| 555 | Ga0495674_0334512 | 3300047319 | Bacteria | 1231 |
| 556 | Ga0495672_0001402 | 3300047320 | Bacteria | 23718 |
| 557 | Ga0495672_0004852 | 3300047320 | Bacteria | 10834 |
| 558 | Ga0495672_0022545 | 3300047320 | Bacteria | 4091 |
| 559 | Ga0495672_0132564 | 3300047320 | Bacteria | 1309 |
| 560 | Ga0495676_0000429 | 3300047321 | Bacteria | 34133 |
| 561 | Ga0495676_0007624 | 3300047321 | Bacteria | 9926 |
| 562 | Ga0495676_0033769 | 3300047321 | Bacteria | 4301 |
| 563 | Ga0495680_0001304 | 3300047322 | Bacteria | 27169 |
| 564 | Ga0495680_0032131 | 3300047322 | Bacteria | 4265 |
| 565 | Ga0495680_0034478 | 3300047322 | Bacteria | 4086 |
| 566 | Ga0495683_0002754 | 3300047323 | Bacteria | 10467 |
| 567 | Ga0495683_0148359 | 3300047323 | Bacteria | 1094 |
| 568 | Ga0495683_0165269 | 3300047323 | Bacteria | 1021 |
| 569 | Ga0495687_010314 | 3300047443 | Bacteria | 5130 |
| 570 | Ga0495675_0003911 | 3300047444 | Bacteria | 9019 |
| 571 | Ga0495675_0013440 | 3300047444 | Bacteria | 5168 |
| 572 | Ga0495675_0024369 | 3300047444 | Bacteria | 3857 |
| 573 | Ga0495679_000456 | 3300047446 | Bacteria | 30142 |
| 574 | Ga0495685_019047 | 3300047447 | Bacteria | 2357 |
| 575 | Ga0495673_0019422 | 3300047469 | Bacteria | 3405 |
| 576 | Ga0495684_0093121 | 3300047471 | Bacteria | 2282 |
| 577 | Ga0495684_0141889 | 3300047471 | Bacteria | 1801 |
| 578 | Ga0495684_0396946 | 3300047471 | Bacteria | 969 |
| 579 | Ga0495686_0000877 | 3300047472 | Bacteria | 38321 |
| 580 | Ga0495686_0005161 | 3300047472 | Bacteria | 10403 |
| 581 | Ga0495686_0059750 | 3300047472 | Bacteria | 2371 |
| 582 | Ga0495602_0004273 | 3300048088 | Bacteria | 14870 |
| 583 | Ga0495602_0007942 | 3300048088 | Bacteria | 11087 |
| 584 | Ga0495614_0007960 | 3300048089 | Bacteria | 4710 |
| 585 | Ga0495614_0018480 | 3300048089 | Bacteria | 3018 |
| 586 | Ga0495615_0004875 | 3300048090 | Bacteria | 2374 |
| 587 | Ga0495626_0020342 | 3300048091 | Bacteria | 3309 |
| 588 | Ga0496100_0000131 | 3300048903 | Bacteria | 42180 |
| 589 | Ga0496100_0491129 | 3300048903 | Bacteria | 945 |
| 590 | Ga0496101_0000444 | 3300048904 | Bacteria | 26360 |
| 591 | Ga0496101_0032528 | 3300048904 | Bacteria | 3672 |
| 592 | Ga0496102_0000128 | 3300048905 | Bacteria | 104717 |
| 593 | Ga0496102_0001693 | 3300048905 | Bacteria | 19332 |
| 594 | Ga0496102_0227002 | 3300048905 | Bacteria | 1761 |
| 595 | Ga0496103_0002616 | 3300048906 | Bacteria | 11274 |
| 596 | Ga0496103_0017231 | 3300048906 | Bacteria | 4321 |
| 597 | Ga0496103_0336339 | 3300048906 | Bacteria | 971 |
| 598 | Ga0496104_0048897 | 3300048907 | Bacteria | 3988 |
| 599 | Ga0496104_0128110 | 3300048907 | Bacteria | 2437 |
| 600 | Ga0496104_0249726 | 3300048907 | Bacteria | 1687 |
| 601 | Ga0496105_0004378 | 3300048908 | Bacteria | 10632 |
| 602 | Ga0496105_0038156 | 3300048908 | Bacteria | 3957 |
| 603 | Ga0496105_0112414 | 3300048908 | Bacteria | 2248 |
| 604 | Ga0496106_0000106 | 3300048909 | Bacteria | 64785 |
| 605 | Ga0496106_0000334 | 3300048909 | Bacteria | 33088 |
| 606 | Ga0496106_0201489 | 3300048909 | Bacteria | 1584 |
| 607 | Ga0496107_0024888 | 3300048910 | Bacteria | 4237 |
| 608 | Ga0496112_0003785 | 3300048915 | Bacteria | 12637 |
| 609 | Ga0496112_0093881 | 3300048915 | Bacteria | 2970 |
| 610 | Ga0496113_0030941 | 3300048916 | Bacteria | 3879 |
| 611 | Ga0496113_0092206 | 3300048916 | Bacteria | 2336 |
| 612 | Ga0496113_0125540 | 3300048916 | Bacteria | 2009 |
| 613 | Ga0496114_0188789 | 3300048917 | Bacteria | 1802 |
| 614 | Ga0496114_0273799 | 3300048917 | Bacteria | 1488 |
| 615 | Ga0496115_0000032 | 3300048918 | Bacteria | 136928 |
| 616 | Ga0496115_0000332 | 3300048918 | Bacteria | 40242 |
| 617 | Ga0496115_0006397 | 3300048918 | Bacteria | 8631 |
| 618 | Ga0496115_0020633 | 3300048918 | Bacteria | 5084 |
| 619 | Ga0496115_0175970 | 3300048918 | Bacteria | 1769 |
| 620 | Ga0496116_0017805 | 3300048919 | Bacteria | 5501 |
| 621 | Ga0496116_0049283 | 3300048919 | Bacteria | 2818 |
| 622 | Ga0496116_0109845 | 3300048919 | Bacteria | 1624 |
| 623 | Ga0496116_0118320 | 3300048919 | Bacteria | 1539 |
| 624 | Ga0496116_0121872 | 3300048919 | Bacteria | 1507 |
| 625 | Ga0496116_0160613 | 3300048919 | Bacteria | 1233 |
| 626 | Ga0496117_0000203 | 3300048920 | Bacteria | 117413 |
| 627 | Ga0496117_0003083 | 3300048920 | Bacteria | 19947 |
| 628 | Ga0496117_0023894 | 3300048920 | Bacteria | 4853 |
| 629 | Ga0496117_0027957 | 3300048920 | Bacteria | 4375 |
| 630 | Ga0496117_0054184 | 3300048920 | Bacteria | 2811 |
| 631 | Ga0496117_0076007 | 3300048920 | Bacteria | 2229 |
| 632 | Ga0496118_0000079 | 3300048921 | Bacteria | 190113 |
| 633 | Ga0496118_0002439 | 3300048921 | Bacteria | 25029 |
| 634 | Ga0496118_0002629 | 3300048921 | Bacteria | 23811 |
| 635 | Ga0496118_0016317 | 3300048921 | Bacteria | 6819 |
| 636 | Ga0496118_0020512 | 3300048921 | Bacteria | 5855 |
| 637 | Ga0496118_0066605 | 3300048921 | Bacteria | 2628 |
| 638 | Ga0496119_0000537 | 3300048922 | Bacteria | 51588 |
| 639 | Ga0496119_0025527 | 3300048922 | Bacteria | 4123 |
| 640 | Ga0496120_0000055 | 3300048923 | Bacteria | 180856 |
| 641 | Ga0496120_0018436 | 3300048923 | Bacteria | 4499 |
| 642 | Ga0496120_0059146 | 3300048923 | Bacteria | 2149 |
| 643 | Ga0496121_0000249 | 3300048924 | Bacteria | 114260 |
| 644 | Ga0496121_0000438 | 3300048924 | Bacteria | 82370 |
| 645 | Ga0496121_0001644 | 3300048924 | Bacteria | 36928 |
| 646 | Ga0496121_0003905 | 3300048924 | Bacteria | 20690 |
| 647 | Ga0496121_0018741 | 3300048924 | Bacteria | 6959 |
| 648 | Ga0496121_0031171 | 3300048924 | Bacteria | 4877 |
| 649 | Ga0496121_0092519 | 3300048924 | Bacteria | 2357 |
| 650 | Ga0496121_0093372 | 3300048924 | Bacteria | 2343 |
| 651 | Ga0496121_0239562 | 3300048924 | Bacteria | 1265 |
| 652 | Ga0496121_0274708 | 3300048924 | Bacteria | 1156 |
| 653 | Ga0496122_0002390 | 3300048925 | Bacteria | 26829 |
| 654 | Ga0496122_0013403 | 3300048925 | Bacteria | 8028 |
| 655 | Ga0496122_0043529 | 3300048925 | Bacteria | 3516 |
| 656 | Ga0496122_0121670 | 3300048925 | Bacteria | 1681 |
| 657 | Ga0496123_0002146 | 3300048926 | Bacteria | 25206 |
| 658 | Ga0496123_0011515 | 3300048926 | Bacteria | 7662 |
| 659 | Ga0496123_0033851 | 3300048926 | Bacteria | 3670 |
| 660 | Ga0496124_0010137 | 3300048927 | Bacteria | 9592 |
| 661 | Ga0496124_0110283 | 3300048927 | Bacteria | 2216 |
| 662 | Ga0496124_0303054 | 3300048927 | Bacteria | 1153 |
| 663 | Ga0496125_0003865 | 3300048928 | Bacteria | 17724 |
| 664 | Ga0496125_0013718 | 3300048928 | Bacteria | 7948 |
| 665 | Ga0496126_0000389 | 3300048929 | Bacteria | 90452 |
| 666 | Ga0496126_0005898 | 3300048929 | Bacteria | 13817 |
| 667 | Ga0496126_0238973 | 3300048929 | Bacteria | 1518 |
| 668 | Ga0495678_006144 | 3300049459 | Bacteria | 6446 |
| 669 | Ga0495678_022210 | 3300049459 | Bacteria | 2778 |
| 670 | Ga0495682_0020404 | 3300049460 | Bacteria | 2488 |
| 671 | Ga0495682_0033343 | 3300049460 | Bacteria | 1901 |
| 672 | Ga0495682_0055902 | 3300049460 | Bacteria | 1431 |
| 673 | Ga0495682_0099920 | 3300049460 | Bacteria | 1040 |
| 674 | Ga0501032_0049212 | 3300049569 | Bacteria | 2844 |
| 675 | Ga0501033_0000071 | 3300049570 | Bacteria | 97350 |
| 676 | Ga0501043_0071412 | 3300049579 | Bacteria | 2727 |
| 677 | Ga0501047_0646739 | 3300049581 | Bacteria | 877 |
| 678 | Ga0501069_0193550 | 3300049585 | Bacteria | 1177 |
| 679 | Ga0501083_0072179 | 3300049744 | Bacteria | 2295 |
| 680 | Ga0501266_005671 | 3300049763 | Bacteria | 1552 |
| 681 | Ga0501044_0068024 | 3300049823 | Unclassified | 3629 |
| 682 | nmdc:mga03683_10525_c1 | 3300050489 | Bacteria | 3319 |
| 683 | nmdc:mga03n38_153756_c1 | 3300050490 | Bacteria | 1160 |
| 684 | nmdc:mga0yw44_196_c1 | 3300050492 | Bacteria | 21440 |
| 685 | nmdc:mga0yw44_45096_c1 | 3300050492 | Bacteria | 2641 |
| 686 | nmdc:mga0k408_18468_c1 | 3300050493 | Bacteria | 3894 |
| 687 | nmdc:mga07m45_3295_c1 | 3300050496 | Bacteria | 7771 |
| 688 | nmdc:mga05p37_221279_c1 | 3300050507 | Bacteria | 2284 |
| 689 | nmdc:mga0qj67_97_c1 | 3300050509 | Bacteria | 58508 |
| 690 | nmdc:mga06r32_569_c1 | 3300050510 | Bacteria | 32069 |
| 691 | nmdc:mga08x19_21720_c1 | 3300050514 | Bacteria | 3966 |
| 692 | nmdc:mga0sz30_24077_c1 | 3300050516 | Bacteria | 1971 |
| 693 | Ga0495601_0127080 | 3300053077 | Bacteria | 1659 |
| 694 | Ga0500610_0002770 | 3300053079 | Bacteria | 6559 |
| 695 | Ga0500610_0005738 | 3300053079 | Bacteria | 5126 |
| 696 | Ga0500610_0037052 | 3300053079 | Bacteria | 2509 |
| 697 | Ga0500578_0153648 | 3300053086 | Bacteria | 1432 |
| 698 | Ga0500651_0000867 | 3300053093 | Bacteria | 14814 |
| 699 | Ga0500556_0000065 | 3300053104 | Bacteria | 106261 |
| 700 | Ga0500557_000361 | 3300053105 | Bacteria | 5925 |
| 701 | Ga0500569_001114 | 3300053109 | Bacteria | 4934 |
| 702 | Ga0500593_000137 | 3300053117 | Bacteria | 29162 |
| 703 | Ga0500594_0009520 | 3300053118 | Bacteria | 2239 |
| 704 | Ga0500607_000320 | 3300053121 | Bacteria | 45511 |
| 705 | Ga0500618_000430 | 3300053125 | Bacteria | 27901 |
| 706 | Ga0500618_001324 | 3300053125 | Bacteria | 11301 |
| 707 | Ga0500618_012795 | 3300053125 | Bacteria | 2188 |
| 708 | Ga0500642_0001721 | 3300053130 | Bacteria | 6314 |
| 709 | Ga0500658_0000067 | 3300053134 | Bacteria | 48662 |
| 710 | Ga0500658_0002046 | 3300053134 | Bacteria | 7863 |
| 711 | Ga0500559_0228774 | 3300053136 | Bacteria | 877 |
| 712 | Ga0500568_0000185 | 3300053139 | Bacteria | 54765 |
| 713 | Ga0500568_0002618 | 3300053139 | Bacteria | 10468 |
| 714 | Ga0500577_0150634 | 3300053142 | Bacteria | 986 |
| 715 | Ga0500588_0004544 | 3300053146 | Bacteria | 3017 |
| 716 | Ga0500588_0021789 | 3300053146 | Bacteria | 1736 |
| 717 | Ga0500616_0000102 | 3300053153 | Bacteria | 168834 |
| 718 | Ga0500616_0000526 | 3300053153 | Bacteria | 48257 |
| 719 | Ga0500622_0000237 | 3300053156 | Bacteria | 57253 |
| 720 | Ga0500622_0025606 | 3300053156 | Bacteria | 3116 |
| 721 | Ga0500633_0007242 | 3300053160 | Bacteria | 2781 |
| 722 | Ga0500636_0010399 | 3300053177 | Bacteria | 5428 |
| 723 | Ga0500645_012767 | 3300053730 | Bacteria | 2712 |
| 724 | Ga0501082_0052112 | 3300060353 | Bacteria | 3527 |
| 725 | 2585393628 | 2582581866 | Bacteria | 6859583 |
| 726 | 2509111678 | 2508501122 | Bacteria | 6292184 |
| 727 | 2509378442 | 2509276019 | Bacteria | 6802256 |
| 728 | 2510134774 | 2510065019 | Bacteria | 6903379 |
| 729 | 2510303158 | 2510065057 | Bacteria | 6649661 |
| 730 | 2510896126 | 2510461076 | Bacteria | 8618824 |
| 731 | 2511172824 | 2510917026 | Bacteria | 7046020 |
| 732 | 2511198474 | 2510917030 | Bacteria | 7460662 |
| 733 | 2511390941 | 2511231027 | Bacteria | 5013807 |
| 734 | 2511497156 | 2511231052 | Bacteria | 6974333 |
| 735 | 2513572540 | 2513237084 | Bacteria | 7231967 |
| 736 | 2513581254 | 2513237085 | Bacteria | 7695351 |
| 737 | 2513631387 | 2513237093 | Bacteria | 7545552 |
| 738 | 2513710678 | 2513237103 | Bacteria | 7647401 |
| 739 | 2513869736 | 2513237138 | Bacteria | 7368160 |
| 740 | 2513882243 | 2513237140 | Bacteria | 7076289 |
| 741 | 2513901820 | 2513237143 | Bacteria | 6664116 |
| 742 | 2513924694 | 2513237146 | Bacteria | 7166346 |
| 743 | 2514022403 | 2513237162 | Bacteria | 7468464 |
| 744 | 2514050005 | 2513237166 | Bacteria | 10373764 |
| 745 | 2514592618 | 2513237351 | Bacteria | 6968952 |
| 746 | 2515634732 | 2515154113 | Bacteria | 7807172 |
| 747 | 2515645966 | 2515154114 | Bacteria | 7848616 |
| 748 | 2515656847 | 2515154116 | Bacteria | 7552979 |
| 749 | 2515681961 | 2515154122 | Bacteria | 8609520 |
| 750 | 2515743586 | 2515154134 | Bacteria | 7220242 |
| 751 | 2516205959 | 2516143018 | Bacteria | 6951533 |
| 752 | 2516895614 | 2516653046 | Bacteria | 6989037 |
| 753 | 2517037476 | 2516653077 | Bacteria | 7555578 |
| 754 | 2517096573 | 2517093000 | Bacteria | 7412387 |
| 755 | 2551693112 | 2551306086 | Bacteria | 6843938 |
| 756 | 2551699551 | 2551306087 | Bacteria | 7351905 |
| 757 | 2551712076 | 2551306089 | Bacteria | 7162724 |
| 758 | 2551716317 | 2551306090 | Bacteria | 7953713 |
| 759 | 2551730680 | 2551306091 | Bacteria | 7086830 |
| 760 | 2551735646 | 2551306092 | Bacteria | 6992595 |
| 761 | 2551741042 | 2551306093 | Bacteria | 7064773 |
| 762 | 2555246740 | 2554235231 | Bacteria | 5215788 |
| 763 | 2558861831 | 2558860100 | Bacteria | 8458965 |
| 764 | 2563060243 | 2562617112 | Bacteria | 10918404 |
| 765 | 2572255040 | 2571042365 | Bacteria | 3289345 |
| 766 | 2585224854 | 2582581298 | Bacteria | 7315509 |
| 767 | 2585227725 | 2582581299 | Bacteria | 6518058 |
| 768 | 2585269946 | 2582581306 | Bacteria | 6450535 |
| 769 | 2585332708 | 2582581316 | Bacteria | 7774528 |
| 770 | 2585390653 | 2582581865 | Bacteria | 6644329 |
| 771 | 2585403315 | 2582581867 | Bacteria | 7184437 |
| 772 | 2585530203 | 2585427526 | Bacteria | 7258840 |
| 773 | 2585547410 | 2585427529 | Bacteria | 7395659 |
| 774 | 2585823612 | 2585427590 | Bacteria | 6824633 |
| 775 | 2599416247 | 2599185170 | Bacteria | 7295545 |
| 776 | 2600197646 | 2599185352 | Bacteria | 7228948 |
| 777 | 2616295490 | 2615840624 | Bacteria | 6557588 |
| 778 | 2617385470 | 2617270742 | Bacteria | 6808054 |
| 779 | 2643809237 | 2643221557 | Bacteria | 7184309 |
| 780 | 2644064361 | 2643221610 | Bacteria | 7480339 |
| 781 | 2644105379 | 2643221618 | Bacteria | 7717186 |
| 782 | 2644147349 | 2643221626 | Bacteria | 8069654 |
| 783 | 2644191467 | 2643221634 | Bacteria | 6705461 |
| 784 | 2644311204 | 2643221655 | Bacteria | 7722067 |
| 785 | 2644335192 | 2643221659 | Bacteria | 7890716 |
| 786 | 2644378831 | 2643221668 | Bacteria | 7306521 |
| 787 | 2644416193 | 2643221675 | Bacteria | 7473456 |
| 788 | 2644449233 | 2643221680 | Bacteria | 7473610 |
| 789 | 2644543528 | 2643221698 | Bacteria | 7756764 |
| 790 | 2644614439 | 2643221712 | Bacteria | 7729434 |
| 791 | 2644672172 | 2643221723 | Bacteria | 7095460 |
| 792 | 2644688457 | 2643221726 | Bacteria | 7455827 |
| 793 | 2692318474 | 2690316117 | Bacteria | 6800650 |
| 794 | 2713475417 | 2711768613 | Bacteria | 11048459 |
| 795 | 2723847180 | 2721755755 | Bacteria | 8322773 |
| 796 | 2723878154 | 2721755763 | Bacteria | 4464185 |
| 797 | 2725947761 | 2724679232 | Bacteria | 7646494 |
| 798 | 2738723368 | 2738541277 | Bacteria | 7458140 |
| 799 | 2739284099 | 2738543019 | Bacteria | 7459457 |
| 800 | 2739731178 | 2739367700 | Bacteria | 4747630 |
| 801 | 2739732472 | 2739367700 | Bacteria | 4747630 |
| 802 | 2753461139 | 2751185821 | Bacteria | 6189929 |
| 803 | 2766065390 | 2765235942 | Bacteria | 7445910 |
| 804 | 2770198050 | 2767802442 | Bacteria | 5747986 |
| 805 | 2778176965 | 2775507266 | Bacteria | 7392367 |
| 806 | 2792584912 | 2791355082 | Bacteria | 5973319 |
| 807 | 2792619329 | 2791355091 | Bacteria | 6135441 |
| 808 | 2792627101 | 2791355092 | Bacteria | 6248105 |
| 809 | 2792637594 | 2791355094 | Bacteria | 7011481 |
| 810 | 2793319787 | 2791355260 | Bacteria | 6598818 |
| 811 | 2793328207 | 2791355261 | Bacteria | 6661293 |
| 812 | 2805930562 | 2802429605 | Bacteria | 6875453 |
| 813 | 2805934259 | 2802429606 | Bacteria | 6346811 |
| 814 | 2819607783 | 2818991448 | Bacteria | 6772224 |
| 815 | 2831267358 | 2831265667 | Bacteria | 7184833 |
| 816 | 2838036371 | 2838035591 | Bacteria | 7166484 |
| 817 | 2838060335 | 2838054893 | Bacteria | 7451788 |
| 818 | 2838080045 | 2838074704 | Bacteria | 6785777 |
| 819 | 2838671209 | 2838668709 | Bacteria | 6671819 |
| 820 | 2838703611 | 2838701080 | Bacteria | 6669771 |
| 821 | 2841741038 | 2841734538 | Bacteria | 6784580 |
| 822 | 2841866270 | 2841864319 | Bacteria | 6742987 |
| 823 | 2842113506 | 2842110456 | Bacteria | 7656360 |
| 824 | 2842149387 | 2842146304 | Bacteria | 5957337 |
| 825 | 2842169759 | 2842163707 | Bacteria | 6916235 |
| 826 | 2842197846 | 2842192696 | Bacteria | 6147454 |
| 827 | 2842220148 | 2842217011 | Bacteria | 7497767 |
| 828 | 2842253975 | 2842250916 | Bacteria | 6579627 |
| 829 | 2842321461 | 2842317721 | Bacteria | 6793725 |
| 830 | 2842342155 | 2842341865 | Bacteria | 7003929 |
| 831 | 2842365869 | 2842363717 | Bacteria | 6844742 |
| 832 | 2842493205 | 2842489311 | Bacteria | 6620893 |
| 833 | 2842499227 | 2842495871 | Bacteria | 6820686 |
| 834 | 2842874335 | 2842871566 | Bacteria | 4827117 |
| 835 | 2844166592 | 2844163670 | Bacteria | 7266046 |
| 836 | 2847423023 | 2847417321 | Bacteria | 6913799 |
| 837 | 2848997575 | 2848992105 | Bacteria | 6810864 |
| 838 | 2850084127 | 2850079185 | Bacteria | 6848280 |
| 839 | 2851186848 | 2851182111 | Bacteria | 6047226 |
| 840 | 2852391422 | 2852387548 | Bacteria | 8025568 |
| 841 | 2855829572 | 2855825444 | Bacteria | 6785811 |
| 842 | 2855875345 | 2855872281 | Bacteria | 6964271 |
| 843 | 2857518973 | 2857516855 | Bacteria | 7787325 |
| 844 | 2858805868 | 2858800743 | Bacteria | 6603254 |
| 845 | 2871475491 | 2871474448 | Bacteria | 6806570 |
| 846 | 2882461762 | 2882456835 | Bacteria | 6863978 |
| 847 | 2884412538 | 2884411467 | Bacteria | 5246714 |
| 848 | 2885416143 | 2885409591 | Bacteria | 9235467 |
| 849 | 2896387170 | 2896384573 | Bacteria | 7700774 |
| 850 | 2900636753 | 2900634093 | Bacteria | 10263517 |
| 851 | 2902688803 | 2902682994 | Bacteria | 8951596 |
| 852 | 2904543801 | 2904541872 | Bacteria | 8915136 |
| 853 | 2904580298 | 2904578770 | Bacteria | 5302906 |
| 854 | 2904615607 | 2904615490 | Bacteria | 10047340 |
| 855 | 2908757029 | 2908756301 | Bacteria | 8864324 |
| 856 | 2909399116 | 2909399089 | Bacteria | 3922598 |
| 857 | 2913301550 | 2913295892 | Bacteria | 6333755 |
| 858 | 2915991518 | 2915986958 | Bacteria | 6739310 |
| 859 | 2916000547 | 2915993759 | Bacteria | 7016183 |
| 860 | 2916005140 | 2916000859 | Bacteria | 6865702 |
| 861 | 2916016038 | 2916014648 | Bacteria | 6946486 |
| 862 | 2916021882 | 2916021584 | Bacteria | 6854472 |
| 863 | 2916030921 | 2916028427 | Bacteria | 6748433 |
| 864 | 2916037312 | 2916035215 | Bacteria | 6755766 |
| 865 | 2916042232 | 2916041962 | Bacteria | 6820487 |
| 866 | 2916053448 | 2916048683 | Bacteria | 6543552 |
| 867 | 2916057194 | 2916055098 | Bacteria | 6758838 |
| 868 | 2916068683 | 2916068649 | Bacteria | 6943657 |
| 869 | 2916080657 | 2916076590 | Bacteria | 6596108 |
| 870 | 2919104493 | 2919100787 | Bacteria | 7710546 |
| 871 | 2919120026 | 2919119836 | Bacteria | 5208557 |
| 872 | 2919174639 | 2919171160 | Bacteria | 6499771 |
| 873 | 2920826499 | 2920822456 | Bacteria | 6897201 |
| 874 | 2921203347 | 2921201388 | Bacteria | 6926299 |
| 875 | 2921212402 | 2921208531 | Bacteria | 6745326 |
| 876 | 2921242097 | 2921237296 | Bacteria | 6876710 |
| 877 | 2921246273 | 2921244191 | Bacteria | 6568419 |
| 878 | 2921259240 | 2921257292 | Bacteria | 6808382 |
| 879 | 2921269829 | 2921263974 | Bacteria | 6864552 |
| 880 | 2921286739 | 2921282425 | Bacteria | 6826397 |
| 881 | 2921644621 | 2921643360 | Bacteria | 11448031 |
| 882 | 2923558857 | 2923556063 | Bacteria | 6793593 |
| 883 | 2924147929 | 2924144063 | Bacteria | 6883928 |
| 884 | 2924152814 | 2924150972 | Bacteria | 7169444 |
| 885 | 2924165757 | 2924165586 | Bacteria | 7260590 |
| 886 | 2924175648 | 2924172951 | Bacteria | 6749356 |
| 887 | 2924184222 | 2924179722 | Bacteria | 6843264 |
| 888 | 2924186715 | 2924186466 | Bacteria | 6876637 |
| 889 | 2924194400 | 2924193448 | Bacteria | 6955718 |
| 890 | 2924200750 | 2924200457 | Bacteria | 6757188 |
| 891 | 2924207373 | 2924207177 | Bacteria | 6917007 |
| 892 | 2924214103 | 2924214083 | Bacteria | 7080103 |
| 893 | 2924222522 | 2924221636 | Bacteria | 7113495 |
| 894 | 2924229090 | 2924228884 | Bacteria | 6633132 |
| 895 | 2924755440 | 2924754689 | Bacteria | 6774424 |
| 896 | 2928043056 | 2928037797 | Bacteria | 7273642 |
| 897 | 2928050285 | 2928044640 | Bacteria | 7271509 |
| 898 | 2928964453 | 2928963466 | Bacteria | 5165703 |
| 899 | 2928965159 | 2928963466 | Bacteria | 5165703 |
| 900 | 2929162641 | 2929160207 | Bacteria | 9075316 |
| 901 | 2933589204 | 2933586486 | Bacteria | 7667493 |
| 902 | 2935906968 | 2935901341 | Bacteria | 7341747 |
| 903 | 2936374941 | 2936367885 | Bacteria | 7324495 |
| 904 | 2936380632 | 2936375103 | Bacteria | 6652732 |
| 905 | 2937003215 | 2937002841 | Bacteria | 6934057 |
| 906 | 2937010064 | 2937009748 | Bacteria | 6746052 |
| 907 | 2937020500 | 2937016420 | Bacteria | 6782579 |
| 908 | 2937025382 | 2937023124 | Bacteria | 6815156 |
| 909 | 2937045240 | 2937042894 | Bacteria | 6741576 |
| 910 | 2937060322 | 2937056579 | Bacteria | 7107896 |
| 911 | 2937064140 | 2937063883 | Bacteria | 7199456 |
| 912 | 2937076872 | 2937071275 | Bacteria | 6984483 |
| 913 | 2937096329 | 2937091812 | Bacteria | 6979387 |
| 914 | 2937109819 | 2937106411 | Bacteria | 6947143 |
| 915 | 2937115644 | 2937113482 | Bacteria | 6505872 |
| 916 | 2937119877 | 2937119839 | Bacteria | 6597547 |
| 917 | 2937132524 | 2937126314 | Bacteria | 6771275 |
| 918 | 2937825264 | 2937822353 | Bacteria | 7290551 |
| 919 | 2937841425 | 2937836603 | Bacteria | 6811263 |
| 920 | 2941481312 | |||
| 921 | 2941505717 | 2941499720 | Bacteria | 7599444 |
| 922 | 2945910435 | 2945909444 | Bacteria | 7065066 |
| 923 | 2945987510 | 2945984333 | Bacteria | 7358892 |
| 924 | 2957382489 | 2957382221 | Bacteria | 6737050 |
| 925 | 2957400161 | 2957395598 | Bacteria | 6822399 |
| 926 | 2957404065 | 2957402308 | Bacteria | 6741770 |
| 927 | 2957411451 | 2957408893 | Bacteria | 6558585 |
| 928 | 2957416433 | 2957415311 | Bacteria | 6991633 |
| 929 | 2957425667 | 2957422303 | Bacteria | 7172205 |
| 930 | 2957432739 | 2957430029 | Bacteria | 7022557 |
| 931 | 2957445793 | 2957443900 | Bacteria | 6869977 |
| 932 | 2957450892 | 2957450854 | Bacteria | 6765715 |
| 933 | 2957460285 | 2957457609 | Bacteria | 6967680 |
| 934 | 2957465427 | 2957464669 | Bacteria | 6568877 |
| 935 | 2957474441 | 2957471148 | Bacteria | 6797643 |
| 936 | 2957478862 | 2957478035 | Bacteria | 6756658 |
| 937 | 2957485290 | 2957484790 | Bacteria | 6703082 |
| 938 | 2957493403 | 2957491536 | Bacteria | 6695180 |
| 939 | 2957498506 | 2957498199 | Bacteria | 7126688 |
| 940 | 2958075036 | 2958071322 | Bacteria | 6815895 |
| 941 | 2960588066 | 2960584000 | Bacteria | 6864594 |
| 942 | 2960600067 | 2960597568 | Bacteria | 6550735 |
| 943 | 2960607352 | 2960603979 | Bacteria | 6898737 |
| 944 | 2960611162 | 2960610863 | Bacteria | 6691244 |
| 945 | 2960622520 | 2960617483 | Bacteria | 6727748 |
| 946 | 2960627547 | 2960624210 | Bacteria | 6875384 |
| 947 | 2960644247 | 2960637947 | Bacteria | 7296468 |
| 948 | 2960647352 | 2960645483 | Bacteria | 7211087 |
| 949 | 2960657134 | 2960652885 | Bacteria | 7083688 |
| 950 | 2960663907 | 2960660292 | Bacteria | 7041660 |
| 951 | 2960667721 | 2960667422 | Bacteria | 6763020 |
| 952 | 2960679171 | 2960674078 | Bacteria | 6609048 |
| 953 | 2960691828 | 2960687367 | Bacteria | 6535474 |
| 954 | 2964611831 | 2964607997 | Bacteria | 7101408 |
| 955 | 2964618623 | 2964615318 | Bacteria | 6809089 |
| 956 | 2964626674 | 2964621998 | Bacteria | 6834995 |
| 957 | 2964634786 | 2964628898 | Bacteria | 7083044 |
| 958 | 2964636286 | 2964636051 | Bacteria | 7091832 |
| 959 | 2964643215 | 2964643177 | Bacteria | 6820887 |
| 960 | 2964662139 | 2964656573 | Bacteria | 7100150 |
| 961 | 2964663841 | 2964663802 | Bacteria | 7019362 |
| 962 | 2964674472 | 2964670856 | Bacteria | 6851364 |
| 963 | 2964683564 | 2964678106 | Bacteria | 6792020 |
| 964 | 2964685166 | 2964685014 | Bacteria | 6839111 |
| 965 | 2964694231 | 2964691889 | Bacteria | 6802758 |
| 966 | 2964699074 | 2964698721 | Bacteria | 6765331 |
| 967 | 2964710883 | 2964705432 | Bacteria | 7114648 |
| 968 | 2964716596 | 2964712639 | Bacteria | 6695970 |
| 969 | 2964722704 | 2964719344 | Bacteria | 7286602 |
| 970 | 2967669890 | 2967664464 | Bacteria | 6948836 |
| 971 | 2967671609 | 2967671571 | Bacteria | 7021409 |
| 972 | 2967703697 | 2967699805 | Bacteria | 6854538 |
| 973 | 2967708092 | 2967706974 | Bacteria | 7186053 |
| 974 | 2967721571 | 2967721400 | Bacteria | 7073753 |
| 975 | 2967737245 | 2967735183 | Bacteria | 6827012 |
| 976 | 2967742863 | 2967742019 | Bacteria | 6794534 |
| 977 | 2967749010 | 2967748971 | Bacteria | 6733771 |
| 978 | 2967755760 | 2967755722 | Bacteria | 6814706 |
| 979 | 2967769614 | 2967769361 | Bacteria | 6587838 |
| 980 | 2967781771 | 2967775926 | Bacteria | 6738189 |
| 981 | 2970023979 | 2970019648 | Bacteria | 7072033 |
| 982 | 2970033689 | 2970033650 | Bacteria | 7118744 |
| 983 | 2970050086 | 2970047711 | Bacteria | 7088379 |
| 984 | 2970065733 | 2970061556 | Bacteria | 7099761 |
| 985 | 2970068865 | 2970068827 | Bacteria | 7123112 |
| 986 | 2970078178 | 2970076120 | Bacteria | 6697332 |
| 987 | 2970084297 | 2970082768 | Bacteria | 6183754 |
| 988 | 2970092067 | 2970088815 | Bacteria | 6933825 |
| 989 | 2970095804 | 2970095765 | Bacteria | 6936963 |
| 990 | 2970102715 | 2970102677 | Bacteria | 6812532 |
| 991 | 2970111177 | 2970109326 | Bacteria | 6863976 |
| 992 | 2970136221 | 2970136068 | Bacteria | 7207982 |
| 993 | 2970160860 | 2970156795 | Bacteria | 7168044 |
| 994 | 2970169016 | 2970164137 | Bacteria | 6861252 |
| 995 | 2970171001 | 2970170962 | Bacteria | 6876229 |
| 996 | 2970183327 | 2970177841 | Bacteria | 6768001 |
| 997 | 2970189497 | 2970184632 | Bacteria | 7054431 |
| 998 | 2970192021 | 2970191845 | Bacteria | 7032787 |
| 999 | 2977518357 | 2977516862 | Bacteria | 6940108 |
| 1000 | 2977526369 | 2977523885 | Bacteria | 6960446 |
| 1001 | 2977543096 | 2977537788 | Bacteria | 6929320 |
| 1002 | 2977560515 | 2977558990 | Bacteria | 6863948 |
| 1003 | 2977566247 | 2977565890 | Bacteria | 6901543 |
| 1004 | 2984559302 | 2984559226 | Bacteria | 5683096 |
| 1005 | 2984595829 | 2984595703 | Bacteria | 5682994 |
| 1006 | 2996340362 | 2996336353 | Bacteria | 5511628 |
| 1007 | 3003935171 | 3003930520 | Bacteria | 5667563 |
| 1008 | 639649932 | 639633055 | Bacteria | 7751309 |
| 1009 | 642595960 | 642555112 | Bacteria | 8676562 |
| 1010 | 642623557 | 642555113 | Bacteria | 8214658 |
| 1011 | 643822111 | 643692032 | Bacteria | 6891900 |
| 1012 | 648735680 | 648276728 | Bacteria | 6968865 |
| 1013 | 8003015796 | 8003014200 | Bacteria | 4059994 |
| 1014 | 8004638808 | 8004633249 | Bacteria | 6723080 |
| 1015 | 8005294371 | 8005289223 | Bacteria | 6634003 |
| 1016 | 8005306451 | 8005301065 | Bacteria | 6614431 |
| 1017 | 8005306744 | 8005301065 | Bacteria | 6614431 |
| 1018 | 8005311237 | 8005307578 | Bacteria | 7395396 |
| 1019 | 8005378264 | 8005376324 | Bacteria | 6590079 |
| 1020 | 8005383910 | 8005382845 | Bacteria | 6732062 |
| 1021 | 8005401236 | 8005395548 | Bacteria | 6806915 |
| 1022 | 8005547211 | 8005542996 | Bacteria | 7077758 |
| 1023 | 8005558453 | 8005556819 | Bacteria | 6908598 |
| 1024 | 8005566703 | 8005563573 | Bacteria | 7153261 |
| 1025 | 8005650645 | 8005645114 | Bacteria | 6950293 |
| 1026 | 8005683660 | 8005682033 | Bacteria | 6726518 |
| 1027 | 8005693561 | 8005688590 | Bacteria | 6610080 |
| 1028 | 8005693849 | 8005688590 | Bacteria | 6610080 |
| 1029 | 8011352063 | 8011350971 | Bacteria | 6158957 |
| 1030 | 8018133682 | 8018127388 | Bacteria | 7351159 |
| 1031 | 8018170147 | 8018163183 | Bacteria | 7277977 |
| 1032 | 8023687621 | 8023680758 | Bacteria | 7729763 |
| 1033 | 8024489105 | 8024486573 | Bacteria | 6540512 |
| 1034 | 8024506012 | 8024501048 | Bacteria | 6427847 |
| 1035 | 8046769257 | 8046767195 | Bacteria | 7547379 |
| 1036 | 8049297753 | 8049293176 | Bacteria | 6128433 |
| 1037 | 8056686232 | 8056681323 | Bacteria | 8472857 |
| 1038 | 8057578566 | 8057575449 | Bacteria | 7367519 |
| 1039 | 8057876755 | 8057874678 | Bacteria | 7494653 |
| 1040 | MRS2a_Contig_834 | |||
| 1041 | JGI24739J22299_10083135 | |||
| 1042 | JGI24735J21928_10000540 | |||
| 1043 | JGI24749J21850_1000458 | |||
| 1044 | JGI25156J39149_1000312 | |||
| 1045 | JGI25162J39368_1002134 | |||
| 1046 | JGI25158J39367_1000180 | |||
| 1047 | JGI25152J39213_1004975 | |||
| 1048 | JGI25152J39213_1010334 | |||
| 1049 | JGI25150J39212_1001252 | |||
| 1050 | JGI25159J45721_1000009 | |||
| 1051 | JGI25159J45721_1001406 | |||
| 1052 | JGI25159J45721_1011633 | |||
| 1053 | JGI25151J46595_10000697 | |||
| 1054 | JGI25151J46595_10006772 | |||
| 1055 | JGI25151J46595_10020617 | |||
| 1056 | JGI25151J46595_10030011 | |||
| 1057 | JGI25153J46596_10003024 | |||
| 1058 | JGI25153J46596_10011067 | |||
| 1059 | JGI25153J46596_10024971 | |||
| 1060 | rootH1_10002822 | |||
| 1061 | rootH1_10007216 | |||
| 1062 | rootH2_10035196 | |||
| 1063 | rootH2_10155874 | |||
| 1064 | rootH2_10207593 | |||
| 1065 | rootL2_10001400 | |||
| 1066 | rootL2_10049284 | |||
| 1067 | rootH1_10007028 | |||
| 1068 | rootH1_10019204 | |||
| 1069 | rootH1_10031909 | |||
| 1070 | JGI25160J50197_1000028 | |||
| 1071 | JGI25160J50197_1000035 | |||
| 1072 | JGI25160J50197_1004999 | |||
| 1073 | JGI25160J50197_1018760 | |||
| 1074 | JGI25161J50226_1000114 | |||
| 1075 | JGI25161J50226_1000332 | |||
| 1076 | JGI25161J50226_1006368 | |||
| 1077 | JGI25161J50226_1010287 | |||
| 1078 | Ga0055533_1000061 | |||
| 1079 | Ga0055533_1002300 | |||
| 1080 | Ga0055525_1001399 | |||
| 1081 | Ga0055542_1000082 | |||
| 1082 | Ga0055542_1000170 | |||
| 1083 | Ga0055526_1001815 | |||
| 1084 | Ga0055526_1002600 | |||
| 1085 | Ga0055526_1010599 | |||
| 1086 | Ga0055526_1022460 | |||
| 1087 | Ga0055526_1032264 | |||
| 1088 | Ga0055537_1009474 | |||
| 1089 | Ga0055524_1021361 | |||
| 1090 | Ga0055524_1021410 | |||
| 1091 | Ga0055536_1001115 | |||
| 1092 | Ga0055536_1001126 | |||
| 1093 | Ga0055536_1002109 | |||
| 1094 | Ga0055534_1009321 | |||
| 1095 | Ga0055528_1001469 | |||
| 1096 | Ga0055528_1013698 | |||
| 1097 | Ga0055528_1014169 | |||
| 1098 | Ga0055528_1020496 | |||
| 1099 | Ga0055530_10000459 | |||
| 1100 | Ga0055540_1003357 | |||
| 1101 | Ga0055540_1005909 | |||
| 1102 | Ga0055531_10005662 | |||
| 1103 | Ga0055531_10017404 | |||
| 1104 | Ga0055531_10017505 | |||
| 1105 | Ga0055543_1000077 | |||
| 1106 | Ga0055543_1000230 | |||
| 1107 | Ga0055543_1008887 | |||
| 1108 | Ga0055543_1011093 | |||
| 1109 | Ga0065165_1000061 | |||
| 1110 | Ga0065165_1000191 | |||
| 1111 | Ga0065165_1022210 | |||
| 1112 | Ga0070670_100249503 | |||
| 1113 | Ga0070689_100020078 | |||
| 1114 | Ga0070689_100069285 | |||
| 1115 | Ga0070661_100071802 | |||
| 1116 | Ga0070661_100464659 | |||
| 1117 | Ga0070668_100030013 | |||
| 1118 | Ga0070668_100529018 | |||
| 1119 | Ga0070688_100031656 | |||
| 1120 | Ga0070709_10080186 | |||
| 1121 | Ga0070709_10087768 | |||
| 1122 | Ga0070714_100034515 | |||
| 1123 | Ga0070713_100088845 | |||
| 1124 | Ga0070710_10035799 | |||
| 1125 | Ga0070711_100015393 | |||
| 1126 | Ga0070663_100062586 | |||
| 1127 | Ga0070663_100093519 | |||
| 1128 | Ga0070663_100378642 | |||
| 1129 | Ga0070681_10277547 | |||
| 1130 | Ga0070685_10003905 | |||
| 1131 | Ga0070685_10018292 | |||
| 1132 | Ga0070699_100295389 | |||
| 1133 | Ga0068853_100157160 | |||
| 1134 | Ga0070696_100084831 | |||
| 1135 | Ga0070665_100012436 | |||
| 1136 | Ga0068852_100018843 | |||
| 1137 | Ga0068859_100163501 | |||
| 1138 | Ga0068860_100267334 | |||
| 1139 | Ga0068862_100001888 | |||
| 1140 | Ga0068862_100025892 | |||
| 1141 | Ga0068862_100071716 | |||
| 1142 | Ga0068862_100113299 | |||
| 1143 | Ga0081540_1016574 | |||
| 1144 | Ga0081540_1016849 | |||
| 1145 | Ga0075363_100038752 | |||
| 1146 | Ga0075363_100091961 | |||
| 1147 | Ga0075432_10090219 | |||
| 1148 | Ga0070715_10014117 | |||
| 1149 | Ga0075362_10056315 | |||
| 1150 | Ga0075366_10018534 | |||
| 1151 | Ga0097621_100237883 | |||
| 1152 | Ga0075370_10005624 | |||
| 1153 | Ga0075370_10017694 | |||
| 1154 | Ga0068871_100076407 | |||
| 1155 | Ga0075428_100052887 | |||
| 1156 | Ga0075428_100056530 | |||
| 1157 | Ga0075428_100972875 | |||
| 1158 | Ga0075430_100000150 | |||
| 1159 | Ga0075431_100000478 | |||
| 1160 | Ga0075436_100015945 | |||
| 1161 | Ga0097620_100005208 | |||
| 1162 | Ga0097620_100163499 | |||
| 1163 | Ga0099825_1032000 | |||
| 1164 | Ga0099823_1000409 | |||
| 1165 | Ga0105251_10049820 | |||
| 1166 | Ga0105240_10000797 | |||
| 1167 | Ga0105240_10001505 | |||
| 1168 | Ga0105240_10012223 | |||
| 1169 | Ga0105240_10091615 | |||
| 1170 | Ga0105240_10150652 | |||
| 1171 | Ga0111539_10079663 | |||
| 1172 | Ga0111539_10087735 | |||
| 1173 | Ga0105245_10019101 | |||
| 1174 | Ga0105245_11002064 | |||
| 1175 | Ga0114129_10222700 | |||
| 1176 | Ga0114129_11249335 | |||
| 1177 | Ga0105243_10063923 | |||
| 1178 | Ga0105241_10037079 | |||
| 1179 | Ga0105248_10006601 | |||
| 1180 | Ga0105248_10056586 | |||
| 1181 | Ga0105248_10284447 | |||
| 1182 | Ga0105237_10000628 | |||
| 1183 | Ga0105238_10000348 | |||
| 1184 | Ga0105238_10014753 | |||
| 1185 | Ga0105238_10045728 | |||
| 1186 | Ga0105249_10028967 | |||
| 1187 | Ga0105249_10096486 | |||
| 1188 | Ga0105033_104376 | |||
| 1189 | Ga0105239_10000288 | |||
| 1190 | Ga0105239_10001567 | |||
| 1191 | Ga0105239_10128502 | |||
| 1192 | Ga0157347_1000866 | |||
| 1193 | Ga0157370_10007496 | |||
| 1194 | Ga0157369_10012755 | |||
| 1195 | Ga0157369_10495442 | |||
| 1196 | Ga0171463_1012 | |||
| 1197 | Ga0157378_10033234 | |||
| 1198 | Ga0163162_10004865 | |||
| 1199 | Ga0163162_10057467 | |||
| 1200 | Ga0163162_10411931 | |||
| 1201 | Ga0157372_10000966 | |||
| 1202 | Ga0157372_10069585 | |||
| 1203 | Ga0157380_10000441 | |||
| 1204 | Ga0182008_10005615 | |||
| 1205 | Ga0157376_10533288 | |||
| 1206 | Ga0157376_10583077 | |||
| 1207 | Ga0183362_10002 | |||
| 1208 | Ga0183368_1002 | |||
| 1209 | Ga0163161_10000127 | |||
| 1210 | Ga0214544_1000906 | |||
| 1211 | Ga0214542_1000400 | |||
| 1212 | Ga0214542_1021144 | |||
| 1213 | Ga0214543_1000018 | |||
| 1214 | Ga0214543_1000019 | |||
| 1215 | Ga0213872_10066137 | |||
| 1216 | Ga0213872_10140035 | |||
| 1217 | Ga0213874_10048472 | |||
| 1218 | Ga0209436_100050 | |||
| 1219 | Ga0209436_100100 | |||
| 1220 | Ga0209674_100003 | |||
| 1221 | Ga0209674_100043 | |||
| 1222 | Ga0209563_100086 | |||
| 1223 | Ga0207427_102087 | |||
| 1224 | Ga0207427_102860 | |||
| 1225 | Ga0209437_100194 | |||
| 1226 | Ga0209437_100651 | |||
| 1227 | Ga0209437_102442 | |||
| 1228 | Ga0209258_103160 | |||
| 1229 | Ga0207425_1000602 | |||
| 1230 | Ga0207425_1001660 | |||
| 1231 | Ga0207425_1002953 | |||
| 1232 | Ga0209026_1002643 | |||
| 1233 | Ga0209026_1003717 | |||
| 1234 | Ga0209677_100107 | |||
| 1235 | Ga0209148_1000002 | |||
| 1236 | Ga0209759_1010985 | |||
| 1237 | Ga0209129_1000114 | |||
| 1238 | Ga0209129_1000788 | |||
| 1239 | Ga0209129_1001687 | |||
| 1240 | Ga0209129_1003368 | |||
| 1241 | Ga0209129_1006009 | |||
| 1242 | Ga0209233_1010598 | |||
| 1243 | Ga0209233_1026875 | |||
| 1244 | Ga0209565_1000198 | |||
| 1245 | Ga0209565_1006759 | |||
| 1246 | Ga0209673_1000060 | |||
| 1247 | Ga0209673_1000216 | |||
| 1248 | Ga0209673_1000481 | |||
| 1249 | Ga0209130_1000030 | |||
| 1250 | Ga0209130_1000068 | |||
| 1251 | Ga0209130_1000256 | |||
| 1252 | Ga0209130_1000364 | |||
| 1253 | Ga0209130_1019919 | |||
| 1254 | Ga0209675_1000333 | |||
| 1255 | Ga0209675_1001034 | |||
| 1256 | Ga0209676_1000004 | |||
| 1257 | Ga0209676_1000714 | |||
| 1258 | Ga0209676_1002049 | |||
| 1259 | Ga0209025_1000183 | |||
| 1260 | Ga0209025_1000203 | |||
| 1261 | Ga0209025_1000682 | |||
| 1262 | Ga0209025_1001354 | |||
| 1263 | Ga0209025_1005996 | |||
| 1264 | Ga0209025_1011535 | |||
| 1265 | Ga0209025_1031431 | |||
| 1266 | Ga0209564_1000070 | |||
| 1267 | Ga0209564_1000081 | |||
| 1268 | Ga0209564_1000116 | |||
| 1269 | Ga0209564_1000295 | |||
| 1270 | Ga0209564_1000364 | |||
| 1271 | Ga0209564_1010613 | |||
| 1272 | Ga0209564_1036282 | |||
| 1273 | Ga0209758_1000180 | |||
| 1274 | Ga0209758_1000688 | |||
| 1275 | Ga0209758_1001342 | |||
| 1276 | Ga0209758_1010245 | |||
| 1277 | Ga0209758_1012315 | |||
| 1278 | Ga0209758_1013415 | |||
| 1279 | Ga0209050_1000002 | |||
| 1280 | Ga0209050_1000270 | |||
| 1281 | Ga0209050_1002528 | |||
| 1282 | Ga0209050_1005653 | |||
| 1283 | Ga0209256_1000047 | |||
| 1284 | Ga0209256_1000157 | |||
| 1285 | Ga0209256_1000408 | |||
| 1286 | Ga0209256_1001292 | |||
| 1287 | Ga0209256_1002018 | |||
| 1288 | Ga0209256_1002320 | |||
| 1289 | Ga0209256_1033649 | |||
| 1290 | Ga0207426_1000021 | |||
| 1291 | Ga0207426_1000047 | |||
| 1292 | Ga0207426_1000155 | |||
| 1293 | Ga0207426_1000184 | |||
| 1294 | Ga0207426_1000204 | |||
| 1295 | Ga0207426_1038207 | |||
| 1296 | Ga0209051_1000002 | |||
| 1297 | Ga0209051_1001764 | |||
| 1298 | Ga0209051_1013018 | |||
| 1299 | Ga0209051_1013964 | |||
| 1300 | Ga0209051_1018471 | |||
| 1301 | Ga0209051_1026604 | |||
| 1302 | Ga0209257_1000002 | |||
| 1303 | Ga0209257_1003360 | |||
| 1304 | Ga0209257_1003606 | |||
| 1305 | Ga0209257_1005745 | |||
| 1306 | Ga0209257_1005920 | |||
| 1307 | Ga0209257_1011411 | |||
| 1308 | Ga0207692_10064647 | |||
| 1309 | Ga0207685_10124330 | |||
| 1310 | Ga0207699_10042009 | |||
| 1311 | Ga0207654_10003967 | |||
| 1312 | Ga0207695_10000740 | |||
| 1313 | Ga0207695_10001440 | |||
| 1314 | Ga0207695_10065146 | |||
| 1315 | Ga0207695_10111406 | |||
| 1316 | Ga0207671_10007548 | |||
| 1317 | Ga0207693_10019891 | |||
| 1318 | Ga0207663_10023949 | |||
| 1319 | Ga0207649_10074787 | |||
| 1320 | Ga0207694_10000223 | |||
| 1321 | Ga0207694_10010824 | |||
| 1322 | Ga0207694_10034757 | |||
| 1323 | Ga0207650_10206772 | |||
| 1324 | Ga0207700_10085538 | |||
| 1325 | Ga0207664_10054557 | |||
| 1326 | Ga0207644_10248702 | |||
| 1327 | Ga0207670_10007399 | |||
| 1328 | Ga0207670_10219686 | |||
| 1329 | Ga0207711_10004660 | |||
| 1330 | Ga0207711_10116697 | |||
| 1331 | Ga0207712_10017500 | |||
| 1332 | Ga0207712_10139195 | |||
| 1333 | Ga0207668_10323254 | |||
| 1334 | Ga0207658_10183848 | |||
| 1335 | Ga0207658_10310557 | |||
| 1336 | Ga0207639_10121648 | |||
| 1337 | Ga0207678_10031357 | |||
| 1338 | Ga0207678_10112241 | |||
| 1339 | Ga0207702_10263167 | |||
| 1340 | Ga0207641_10045191 | |||
| 1341 | Ga0207676_10242745 | |||
| 1342 | Ga0207698_10012938 | |||
| 1343 | Ga0209281_1000185 | |||
| 1344 | Ga0209389_1000111 | |||
| 1345 | Ga0209489_100220 | |||
| 1346 | Ga0209700_100041 | |||
| 1347 | Ga0207428_10081816 | |||
| 1348 | Ga0268265_10001544 | |||
| 1349 | Ga0268265_10037579 | |||
| 1350 | Ga0268265_10124646 | |||
| 1351 | Ga0268264_10643980 | |||
| 1352 | Ga0307517_10000476 | |||
| 1353 | Ga0307515_10003433 | |||
| 1354 | Ga0307515_10013332 | |||
| 1355 | Ga0307515_10052798 | |||
| 1356 | Ga0307515_10125487 | |||
| 1357 | Ga0307515_10207377 | |||
| 1358 | Ga0268256_1029578 | |||
| 1359 | Ga0265325_10029855 | |||
| 1360 | Ga0265316_10104963 | |||
| 1361 | Ga0307513_10053739 | |||
| 1362 | Ga0307513_10137433 | |||
| 1363 | Ga0307513_10405327 | |||
| 1364 | Ga0307509_10000679 | |||
| 1365 | Ga0307509_10001891 | |||
| 1366 | Ga0307509_10138137 | |||
| 1367 | Ga0307509_10177896 | |||
| 1368 | Ga0265313_10019692 | |||
| 1369 | Ga0307508_10000041 | |||
| 1370 | Ga0307508_10001204 | |||
| 1371 | Ga0307508_10205964 | |||
| 1372 | Ga0307514_10002728 | |||
| 1373 | Ga0265314_10000737 | |||
| 1374 | Ga0307413_10135470 | |||
| 1375 | Ga0307410_10393261 | |||
| 1376 | Ga0307416_100279163 | |||
| 1377 | Ga0307414_10015680 | |||
| 1378 | Ga0307411_10104151 | |||
| 1379 | Ga0307507_10016383 | |||
| 1380 | Ga0307507_10082189 | |||
| 1381 | Ga0307507_10090633 | |||
| 1382 | Ga0307510_10000049 | |||
| 1383 | Ga0307510_10000560 | |||
| 1384 | Ga0307510_10165965 | |||
| 1385 | Ga0395899_0091168 | |||
| 1386 | Ga0395900_0099882 | |||
| 1387 | Ga0395900_0118701 | |||
| 1388 | Ga0395900_0709283 | |||
| 1389 | Ga0395905_0086013 | |||
| 1390 | Ga0395905_0149246 | |||
| 1391 | Ga0395905_0210760 | |||
| 1392 | Ga0395905_0393992 | |||
| 1393 | Ga0395901_0152005 | |||
| 1394 | Ga0395901_0506308 | |||
| 1395 | Ga0436365_1664905 | |||
| 1396 | Ga0436360_0942008 | |||
| 1397 | Ga0436361_0182016 | |||
| 1398 | Ga0436361_0256750 | |||
| 1399 | Ga0436361_0311633 | |||
| 1400 | Ga0436361_0520279 | |||
| 1401 | Ga0436361_0652761 | |||
| 1402 | Ga0436361_0731048 | |||
| 1403 | Ga0436361_1204738 | |||
| 1404 | Ga0436363_1168066 | |||
| 1405 | Ga0439436_0038475 | |||
| 1406 | Ga0439465_0014148 | |||
| 1407 | Ga0439465_0023856 | |||
| 1408 | Ga0451839_0723437 | |||
| 1409 | Ga0451841_0401007 | |||
| 1410 | Ga0451845_0222913 | |||
| 1411 | Ga0451849_1504856 | |||
| 1412 | Ga0451855_0207479 | |||
| 1413 | Ga0451853_1605859 | |||
| 1414 | Ga0451853_3818750 | |||
| 1415 | Ga0439432_010858 | |||
| 1416 | Ga0439449_0020674 | |||
| 1417 | Ga0439452_020470 | |||
| 1418 | Ga0439455_0041259 | |||
| 1419 | Ga0450893_0025629 | |||
| 1420 | Ga0466958_0329285 | |||
| 1421 | Ga0495592_0002656 | |||
| 1422 | Ga0495592_0070932 | |||
| 1423 | Ga0495603_0009896 | |||
| 1424 | Ga0495591_005100 | |||
| 1425 | Ga0495629_0008162 | |||
| 1426 | Ga0495629_0008457 | |||
| 1427 | Ga0495638_0000135 | |||
| 1428 | Ga0495638_0000164 | |||
| 1429 | Ga0495638_0000248 | |||
| 1430 | Ga0495638_0000377 | |||
| 1431 | Ga0495638_0170734 | |||
| 1432 | Ga0495651_0013349 | |||
| 1433 | Ga0495651_0246269 | |||
| 1434 | Ga0495653_0008680 | |||
| 1435 | Ga0495653_0082677 | |||
| 1436 | Ga0495653_0110373 | |||
| 1437 | Ga0495650_0000078 | |||
| 1438 | Ga0495650_0000378 | |||
| 1439 | Ga0495650_0000430 | |||
| 1440 | Ga0495650_0020803 | |||
| 1441 | Ga0495650_0035439 | |||
| 1442 | Ga0495580_0000001 | |||
| 1443 | Ga0495580_0005614 | |||
| 1444 | Ga0495580_0035956 | |||
| 1445 | Ga0495580_0098316 | |||
| 1446 | Ga0495582_0001589 | |||
| 1447 | Ga0495582_0007371 | |||
| 1448 | Ga0495582_0017475 | |||
| 1449 | Ga0495582_0169531 | |||
| 1450 | Ga0495605_0001133 | |||
| 1451 | Ga0495605_0012979 | |||
| 1452 | Ga0495605_0013552 | |||
| 1453 | Ga0495605_0056390 | |||
| 1454 | Ga0495662_0000473 | |||
| 1455 | Ga0495662_0026921 | |||
| 1456 | Ga0495664_0000156 | |||
| 1457 | Ga0495664_0006200 | |||
| 1458 | Ga0495664_0019698 | |||
| 1459 | Ga0495585_0004599 | |||
| 1460 | Ga0495585_0010597 | |||
| 1461 | Ga0495585_0029304 | |||
| 1462 | Ga0495594_0002528 | |||
| 1463 | Ga0495594_0167453 | |||
| 1464 | Ga0495596_0003386 | |||
| 1465 | Ga0495607_0022789 | |||
| 1466 | Ga0495607_0221788 | |||
| 1467 | Ga0495583_0013752 | |||
| 1468 | Ga0495583_0085502 | |||
| 1469 | Ga0495606_0001316 | |||
| 1470 | Ga0495606_0002214 | |||
| 1471 | Ga0495606_0014454 | |||
| 1472 | Ga0495606_0054320 | |||
| 1473 | Ga0495608_0045646 | |||
| 1474 | Ga0495610_0029128 | |||
| 1475 | Ga0495610_0036143 | |||
| 1476 | Ga0495610_0096685 | |||
| 1477 | Ga0495616_0017890 | |||
| 1478 | Ga0495616_0132691 | |||
| 1479 | Ga0495618_0007714 | |||
| 1480 | Ga0495620_0025727 | |||
| 1481 | Ga0495620_0030226 | |||
| 1482 | Ga0495620_0053586 | |||
| 1483 | Ga0495628_0002011 | |||
| 1484 | Ga0495628_0010303 | |||
| 1485 | Ga0495628_0041134 | |||
| 1486 | Ga0495630_0016474 | |||
| 1487 | Ga0495630_0029949 | |||
| 1488 | Ga0495631_0000815 | |||
| 1489 | Ga0495631_0031340 | |||
| 1490 | Ga0495632_0044494 | |||
| 1491 | Ga0495632_0049815 | |||
| 1492 | Ga0495643_0009269 | |||
| 1493 | Ga0495643_0015548 | |||
| 1494 | Ga0495643_0018327 | |||
| 1495 | Ga0495643_0043621 | |||
| 1496 | Ga0495643_0094676 | |||
| 1497 | Ga0495648_0009862 | |||
| 1498 | Ga0495648_0010894 | |||
| 1499 | Ga0495648_0025674 | |||
| 1500 | Ga0495648_0035603 | |||
| 1501 | Ga0495648_0050389 | |||
| 1502 | Ga0495648_0056208 | |||
| 1503 | Ga0495663_0045627 | |||
| 1504 | Ga0495666_0004780 | |||
| 1505 | Ga0495666_0115133 | |||
| 1506 | Ga0495652_0009446 | |||
| 1507 | Ga0495652_0088225 | |||
| 1508 | Ga0495654_0082027 | |||
| 1509 | Ga0495654_0138648 | |||
| 1510 | Ga0495665_0003687 | |||
| 1511 | Ga0495665_0004228 | |||
| 1512 | Ga0495665_0008185 | |||
| 1513 | Ga0495640_0002199 | |||
| 1514 | Ga0495640_0008237 | |||
| 1515 | Ga0495586_0015187 | |||
| 1516 | Ga0495586_0210387 | |||
| 1517 | Ga0495587_0000900 | |||
| 1518 | Ga0495587_0001007 | |||
| 1519 | Ga0495587_0030035 | |||
| 1520 | Ga0495609_0086908 | |||
| 1521 | Ga0495597_0011930 | |||
| 1522 | Ga0495597_0025643 | |||
| 1523 | Ga0495645_0001999 | |||
| 1524 | Ga0495645_0101067 | |||
| 1525 | Ga0495622_0001061 | |||
| 1526 | Ga0495622_0007924 | |||
| 1527 | Ga0495622_0032010 | |||
| 1528 | Ga0495633_0018023 | |||
| 1529 | Ga0495633_0044644 | |||
| 1530 | Ga0495667_0000823 | |||
| 1531 | Ga0495656_0142319 | |||
| 1532 | Ga0495656_0239118 | |||
| 1533 | Ga0495668_0000186 | |||
| 1534 | Ga0495668_0005275 | |||
| 1535 | Ga0495668_0020765 | |||
| 1536 | Ga0495668_0021744 | |||
| 1537 | Ga0495668_0122942 | |||
| 1538 | Ga0495634_0017302 | |||
| 1539 | Ga0495634_0195115 | |||
| 1540 | Ga0495611_0013881 | |||
| 1541 | Ga0495625_0005983 | |||
| 1542 | Ga0495625_0017296 | |||
| 1543 | Ga0495625_0033898 | |||
| 1544 | Ga0495625_0034650 | |||
| 1545 | Ga0495625_0080837 | |||
| 1546 | Ga0495625_0108381 | |||
| 1547 | Ga0495625_0181962 | |||
| 1548 | Ga0495625_0221701 | |||
| 1549 | Ga0495635_0335328 | |||
| 1550 | Ga0495661_0039959 | |||
| 1551 | Ga0495661_0075056 | |||
| 1552 | Ga0495588_0085333 | |||
| 1553 | Ga0495588_0199122 | |||
| 1554 | Ga0495657_0162102 | |||
| 1555 | Ga0495599_0003382 | |||
| 1556 | Ga0495599_0010036 | |||
| 1557 | Ga0495599_0025519 | |||
| 1558 | Ga0495599_0029919 | |||
| 1559 | Ga0495623_0006658 | |||
| 1560 | Ga0495623_0019580 | |||
| 1561 | Ga0495646_0001465 | |||
| 1562 | Ga0495646_0005211 | |||
| 1563 | Ga0495658_0114338 | |||
| 1564 | Ga0495669_0134131 | |||
| 1565 | Ga0495613_0000806 | |||
| 1566 | Ga0495613_0012198 | |||
| 1567 | Ga0495624_0002496 | |||
| 1568 | Ga0495624_0249887 | |||
| 1569 | Ga0495670_0065818 | |||
| 1570 | Ga0495670_0113327 | |||
| 1571 | Ga0495670_0230433 | |||
| 1572 | Ga0495671_0009539 | |||
| 1573 | Ga0495671_0114402 | |||
| 1574 | Ga0495671_0143406 | |||
| 1575 | Ga0495649_0001469 | |||
| 1576 | Ga0495649_0153629 | |||
| 1577 | Ga0495589_0019075 | |||
| 1578 | Ga0495600_0002884 | |||
| 1579 | Ga0495660_0033063 | |||
| 1580 | Ga0495660_0062238 | |||
| 1581 | Ga0495660_0116281 | |||
| 1582 | Ga0495581_0001655 | |||
| 1583 | Ga0495581_0001895 | |||
| 1584 | Ga0495581_0034639 | |||
| 1585 | Ga0495604_0001350 | |||
| 1586 | Ga0495604_0007361 | |||
| 1587 | Ga0495604_0015181 | |||
| 1588 | Ga0495604_0025750 | |||
| 1589 | Ga0495636_0059516 | |||
| 1590 | Ga0495674_0009897 | |||
| 1591 | Ga0495674_0013133 | |||
| 1592 | Ga0495674_0129108 | |||
| 1593 | Ga0495674_0334512 | |||
| 1594 | Ga0495672_0001402 | |||
| 1595 | Ga0495672_0004852 | |||
| 1596 | Ga0495672_0022545 | |||
| 1597 | Ga0495672_0132564 | |||
| 1598 | Ga0495676_0000429 | |||
| 1599 | Ga0495676_0007624 | |||
| 1600 | Ga0495676_0033769 | |||
| 1601 | Ga0495680_0001304 | |||
| 1602 | Ga0495680_0032131 | |||
| 1603 | Ga0495680_0034478 | |||
| 1604 | Ga0495683_0002754 | |||
| 1605 | Ga0495683_0148359 | |||
| 1606 | Ga0495683_0165269 | |||
| 1607 | Ga0495687_010314 | |||
| 1608 | Ga0495675_0003911 | |||
| 1609 | Ga0495675_0013440 | |||
| 1610 | Ga0495675_0024369 | |||
| 1611 | Ga0495679_000456 | |||
| 1612 | Ga0495685_019047 | |||
| 1613 | Ga0495673_0019422 | |||
| 1614 | Ga0495684_0093121 | |||
| 1615 | Ga0495684_0141889 | |||
| 1616 | Ga0495684_0396946 | |||
| 1617 | Ga0495686_0000877 | |||
| 1618 | Ga0495686_0005161 | |||
| 1619 | Ga0495686_0059750 | |||
| 1620 | Ga0495602_0004273 | |||
| 1621 | Ga0495602_0007942 | |||
| 1622 | Ga0495614_0007960 | |||
| 1623 | Ga0495614_0018480 | |||
| 1624 | Ga0495615_0004875 | |||
| 1625 | Ga0495626_0020342 | |||
| 1626 | Ga0496100_0000131 | |||
| 1627 | Ga0496100_0491129 | |||
| 1628 | Ga0496101_0000444 | |||
| 1629 | Ga0496101_0032528 | |||
| 1630 | Ga0496102_0000128 | |||
| 1631 | Ga0496102_0001693 | |||
| 1632 | Ga0496102_0227002 | |||
| 1633 | Ga0496103_0002616 | |||
| 1634 | Ga0496103_0017231 | |||
| 1635 | Ga0496103_0336339 | |||
| 1636 | Ga0496104_0048897 | |||
| 1637 | Ga0496104_0128110 | |||
| 1638 | Ga0496104_0249726 | |||
| 1639 | Ga0496105_0004378 | |||
| 1640 | Ga0496105_0038156 | |||
| 1641 | Ga0496105_0112414 | |||
| 1642 | Ga0496106_0000106 | |||
| 1643 | Ga0496106_0000334 | |||
| 1644 | Ga0496106_0201489 | |||
| 1645 | Ga0496107_0024888 | |||
| 1646 | Ga0496112_0003785 | |||
| 1647 | Ga0496112_0093881 | |||
| 1648 | Ga0496113_0030941 | |||
| 1649 | Ga0496113_0092206 | |||
| 1650 | Ga0496113_0125540 | |||
| 1651 | Ga0496114_0188789 | |||
| 1652 | Ga0496114_0273799 | |||
| 1653 | Ga0496115_0000032 | |||
| 1654 | Ga0496115_0000332 | |||
| 1655 | Ga0496115_0006397 | |||
| 1656 | Ga0496115_0020633 | |||
| 1657 | Ga0496115_0175970 | |||
| 1658 | Ga0496116_0017805 | |||
| 1659 | Ga0496116_0049283 | |||
| 1660 | Ga0496116_0109845 | |||
| 1661 | Ga0496116_0118320 | |||
| 1662 | Ga0496116_0121872 | |||
| 1663 | Ga0496116_0160613 | |||
| 1664 | Ga0496117_0000203 | |||
| 1665 | Ga0496117_0003083 | |||
| 1666 | Ga0496117_0023894 | |||
| 1667 | Ga0496117_0027957 | |||
| 1668 | Ga0496117_0054184 | |||
| 1669 | Ga0496117_0076007 | |||
| 1670 | Ga0496118_0000079 | |||
| 1671 | Ga0496118_0002439 | |||
| 1672 | Ga0496118_0002629 | |||
| 1673 | Ga0496118_0016317 | |||
| 1674 | Ga0496118_0020512 | |||
| 1675 | Ga0496118_0066605 | |||
| 1676 | Ga0496119_0000537 | |||
| 1677 | Ga0496119_0025527 | |||
| 1678 | Ga0496120_0000055 | |||
| 1679 | Ga0496120_0018436 | |||
| 1680 | Ga0496120_0059146 | |||
| 1681 | Ga0496121_0000249 | |||
| 1682 | Ga0496121_0000438 | |||
| 1683 | Ga0496121_0001644 | |||
| 1684 | Ga0496121_0003905 | |||
| 1685 | Ga0496121_0018741 | |||
| 1686 | Ga0496121_0031171 | |||
| 1687 | Ga0496121_0092519 | |||
| 1688 | Ga0496121_0093372 | |||
| 1689 | Ga0496121_0239562 | |||
| 1690 | Ga0496121_0274708 | |||
| 1691 | Ga0496122_0002390 | |||
| 1692 | Ga0496122_0013403 | |||
| 1693 | Ga0496122_0043529 | |||
| 1694 | Ga0496122_0121670 | |||
| 1695 | Ga0496123_0002146 | |||
| 1696 | Ga0496123_0011515 | |||
| 1697 | Ga0496123_0033851 | |||
| 1698 | Ga0496124_0010137 | |||
| 1699 | Ga0496124_0110283 | |||
| 1700 | Ga0496124_0303054 | |||
| 1701 | Ga0496125_0003865 | |||
| 1702 | Ga0496125_0013718 | |||
| 1703 | Ga0496126_0000389 | |||
| 1704 | Ga0496126_0005898 | |||
| 1705 | Ga0496126_0238973 | |||
| 1706 | Ga0495678_006144 | |||
| 1707 | Ga0495678_022210 | |||
| 1708 | Ga0495682_0020404 | |||
| 1709 | Ga0495682_0033343 | |||
| 1710 | Ga0495682_0055902 | |||
| 1711 | Ga0495682_0099920 | |||
| 1712 | Ga0501032_0049212 | |||
| 1713 | Ga0501033_0000071 | |||
| 1714 | Ga0501043_0071412 | |||
| 1715 | Ga0501047_0646739 | |||
| 1716 | Ga0501069_0193550 | |||
| 1717 | Ga0501083_0072179 | |||
| 1718 | Ga0501266_005671 | |||
| 1719 | Ga0501044_0068024 | |||
| 1720 | nmdc:mga03683_10525_c1 | |||
| 1721 | nmdc:mga03n38_153756_c1 | |||
| 1722 | nmdc:mga0yw44_196_c1 | |||
| 1723 | nmdc:mga0yw44_45096_c1 | |||
| 1724 | nmdc:mga0k408_18468_c1 | |||
| 1725 | nmdc:mga07m45_3295_c1 | |||
| 1726 | nmdc:mga05p37_221279_c1 | |||
| 1727 | nmdc:mga0qj67_97_c1 | |||
| 1728 | nmdc:mga06r32_569_c1 | |||
| 1729 | nmdc:mga08x19_21720_c1 | |||
| 1730 | nmdc:mga0sz30_24077_c1 | |||
| 1731 | Ga0495601_0127080 | |||
| 1732 | Ga0500610_0002770 | |||
| 1733 | Ga0500610_0005738 | |||
| 1734 | Ga0500610_0037052 | |||
| 1735 | Ga0500578_0153648 | |||
| 1736 | Ga0500651_0000867 | |||
| 1737 | Ga0500556_0000065 | |||
| 1738 | Ga0500557_000361 | |||
| 1739 | Ga0500569_001114 | |||
| 1740 | Ga0500593_000137 | |||
| 1741 | Ga0500594_0009520 | |||
| 1742 | Ga0500607_000320 | |||
| 1743 | Ga0500618_000430 | |||
| 1744 | Ga0500618_001324 | |||
| 1745 | Ga0500618_012795 | |||
| 1746 | Ga0500642_0001721 | |||
| 1747 | Ga0500658_0000067 | |||
| 1748 | Ga0500658_0002046 | |||
| 1749 | Ga0500559_0228774 | |||
| 1750 | Ga0500568_0000185 | |||
| 1751 | Ga0500568_0002618 | |||
| 1752 | Ga0500577_0150634 | |||
| 1753 | Ga0500588_0004544 | |||
| 1754 | Ga0500588_0021789 | |||
| 1755 | Ga0500616_0000102 | |||
| 1756 | Ga0500616_0000526 | |||
| 1757 | Ga0500622_0000237 | |||
| 1758 | Ga0500622_0025606 | |||
| 1759 | Ga0500633_0007242 | |||
| 1760 | Ga0500636_0010399 | |||
| 1761 | Ga0500645_012767 | |||
| 1762 | Ga0501082_0052112 | |||
| 1763 | 2585393628 | |||
| 1764 | 2509111678 | |||
| 1765 | 2509378442 | |||
| 1766 | 2510134774 | |||
| 1767 | 2510303158 | |||
| 1768 | 2510896126 | |||
| 1769 | 2511172824 | |||
| 1770 | 2511198474 | |||
| 1771 | 2511390941 | |||
| 1772 | 2511497156 | |||
| 1773 | 2513572540 | |||
| 1774 | 2513581254 | |||
| 1775 | 2513631387 | |||
| 1776 | 2513710678 | |||
| 1777 | 2513869736 | |||
| 1778 | 2513882243 | |||
| 1779 | 2513901820 | |||
| 1780 | 2513924694 | |||
| 1781 | 2514022403 | |||
| 1782 | 2514050005 | |||
| 1783 | 2514592618 | |||
| 1784 | 2515634732 | |||
| 1785 | 2515645966 | |||
| 1786 | 2515656847 | |||
| 1787 | 2515681961 | |||
| 1788 | 2515743586 | |||
| 1789 | 2516205959 | |||
| 1790 | 2516895614 | |||
| 1791 | 2517037476 | |||
| 1792 | 2517096573 | |||
| 1793 | 2551693112 | |||
| 1794 | 2551699551 | |||
| 1795 | 2551712076 | |||
| 1796 | 2551716317 | |||
| 1797 | 2551730680 | |||
| 1798 | 2551735646 | |||
| 1799 | 2551741042 | |||
| 1800 | 2555246740 | |||
| 1801 | 2558861831 | |||
| 1802 | 2563060243 | |||
| 1803 | 2572255040 | |||
| 1804 | 2585224854 | |||
| 1805 | 2585227725 | |||
| 1806 | 2585269946 | |||
| 1807 | 2585332708 | |||
| 1808 | 2585390653 | |||
| 1809 | 2585403315 | |||
| 1810 | 2585530203 | |||
| 1811 | 2585547410 | |||
| 1812 | 2585823612 | |||
| 1813 | 2599416247 | |||
| 1814 | 2600197646 | |||
| 1815 | 2616295490 | |||
| 1816 | 2617385470 | |||
| 1817 | 2643809237 | |||
| 1818 | 2644064361 | |||
| 1819 | 2644105379 | |||
| 1820 | 2644147349 | |||
| 1821 | 2644191467 | |||
| 1822 | 2644311204 | |||
| 1823 | 2644335192 | |||
| 1824 | 2644378831 | |||
| 1825 | 2644416193 | |||
| 1826 | 2644449233 | |||
| 1827 | 2644543528 | |||
| 1828 | 2644614439 | |||
| 1829 | 2644672172 | |||
| 1830 | 2644688457 | |||
| 1831 | 2692318474 | |||
| 1832 | 2713475417 | |||
| 1833 | 2723847180 | |||
| 1834 | 2723878154 | |||
| 1835 | 2725947761 | |||
| 1836 | 2738723368 | |||
| 1837 | 2739284099 | |||
| 1838 | 2739731178 | |||
| 1839 | 2739732472 | |||
| 1840 | 2753461139 | |||
| 1841 | 2766065390 | |||
| 1842 | 2770198050 | |||
| 1843 | 2778176965 | |||
| 1844 | 2792584912 | |||
| 1845 | 2792619329 | |||
| 1846 | 2792627101 | |||
| 1847 | 2792637594 | |||
| 1848 | 2793319787 | |||
| 1849 | 2793328207 | |||
| 1850 | 2805930562 | |||
| 1851 | 2805934259 | |||
| 1852 | 2819607783 | |||
| 1853 | 2831267358 | |||
| 1854 | 2838036371 | |||
| 1855 | 2838060335 | |||
| 1856 | 2838080045 | |||
| 1857 | 2838671209 | |||
| 1858 | 2838703611 | |||
| 1859 | 2841741038 | |||
| 1860 | 2841866270 | |||
| 1861 | 2842113506 | |||
| 1862 | 2842149387 | |||
| 1863 | 2842169759 | |||
| 1864 | 2842197846 | |||
| 1865 | 2842220148 | |||
| 1866 | 2842253975 | |||
| 1867 | 2842321461 | |||
| 1868 | 2842342155 | |||
| 1869 | 2842365869 | |||
| 1870 | 2842493205 | |||
| 1871 | 2842499227 | |||
| 1872 | 2842874335 | |||
| 1873 | 2844166592 | |||
| 1874 | 2847423023 | |||
| 1875 | 2848997575 | |||
| 1876 | 2850084127 | |||
| 1877 | 2851186848 | |||
| 1878 | 2852391422 | |||
| 1879 | 2855829572 | |||
| 1880 | 2855875345 | |||
| 1881 | 2857518973 | |||
| 1882 | 2858805868 | |||
| 1883 | 2871475491 | |||
| 1884 | 2882461762 | |||
| 1885 | 2884412538 | |||
| 1886 | 2885416143 | |||
| 1887 | 2896387170 | |||
| 1888 | 2900636753 | |||
| 1889 | 2902688803 | |||
| 1890 | 2904543801 | |||
| 1891 | 2904580298 | |||
| 1892 | 2904615607 | |||
| 1893 | 2908757029 | |||
| 1894 | 2909399116 | |||
| 1895 | 2913301550 | |||
| 1896 | 2915991518 | |||
| 1897 | 2916000547 | |||
| 1898 | 2916005140 | |||
| 1899 | 2916016038 | |||
| 1900 | 2916021882 | |||
| 1901 | 2916030921 | |||
| 1902 | 2916037312 | |||
| 1903 | 2916042232 | |||
| 1904 | 2916053448 | |||
| 1905 | 2916057194 | |||
| 1906 | 2916068683 | |||
| 1907 | 2916080657 | |||
| 1908 | 2919104493 | |||
| 1909 | 2919120026 | |||
| 1910 | 2919174639 | |||
| 1911 | 2920826499 | |||
| 1912 | 2921203347 | |||
| 1913 | 2921212402 | |||
| 1914 | 2921242097 | |||
| 1915 | 2921246273 | |||
| 1916 | 2921259240 | |||
| 1917 | 2921269829 | |||
| 1918 | 2921286739 | |||
| 1919 | 2921644621 | |||
| 1920 | 2923558857 | |||
| 1921 | 2924147929 | |||
| 1922 | 2924152814 | |||
| 1923 | 2924165757 | |||
| 1924 | 2924175648 | |||
| 1925 | 2924184222 | |||
| 1926 | 2924186715 | |||
| 1927 | 2924194400 | |||
| 1928 | 2924200750 | |||
| 1929 | 2924207373 | |||
| 1930 | 2924214103 | |||
| 1931 | 2924222522 | |||
| 1932 | 2924229090 | |||
| 1933 | 2924755440 | |||
| 1934 | 2928043056 | |||
| 1935 | 2928050285 | |||
| 1936 | 2928964453 | |||
| 1937 | 2928965159 | |||
| 1938 | 2929162641 | |||
| 1939 | 2933589204 | |||
| 1940 | 2935906968 | |||
| 1941 | 2936374941 | |||
| 1942 | 2936380632 | |||
| 1943 | 2937003215 | |||
| 1944 | 2937010064 | |||
| 1945 | 2937020500 | |||
| 1946 | 2937025382 | |||
| 1947 | 2937045240 | |||
| 1948 | 2937060322 | |||
| 1949 | 2937064140 | |||
| 1950 | 2937076872 | |||
| 1951 | 2937096329 | |||
| 1952 | 2937109819 | |||
| 1953 | 2937115644 | |||
| 1954 | 2937119877 | |||
| 1955 | 2937132524 | |||
| 1956 | 2937825264 | |||
| 1957 | 2937841425 | |||
| 1958 | 2941481312 | |||
| 1959 | 2941505717 | |||
| 1960 | 2945910435 | |||
| 1961 | 2945987510 | |||
| 1962 | 2957382489 | |||
| 1963 | 2957400161 | |||
| 1964 | 2957404065 | |||
| 1965 | 2957411451 | |||
| 1966 | 2957416433 | |||
| 1967 | 2957425667 | |||
| 1968 | 2957432739 | |||
| 1969 | 2957445793 | |||
| 1970 | 2957450892 | |||
| 1971 | 2957460285 | |||
| 1972 | 2957465427 | |||
| 1973 | 2957474441 | |||
| 1974 | 2957478862 | |||
| 1975 | 2957485290 | |||
| 1976 | 2957493403 | |||
| 1977 | 2957498506 | |||
| 1978 | 2958075036 | |||
| 1979 | 2960588066 | |||
| 1980 | 2960600067 | |||
| 1981 | 2960607352 | |||
| 1982 | 2960611162 | |||
| 1983 | 2960622520 | |||
| 1984 | 2960627547 | |||
| 1985 | 2960644247 | |||
| 1986 | 2960647352 | |||
| 1987 | 2960657134 | |||
| 1988 | 2960663907 | |||
| 1989 | 2960667721 | |||
| 1990 | 2960679171 | |||
| 1991 | 2960691828 | |||
| 1992 | 2964611831 | |||
| 1993 | 2964618623 | |||
| 1994 | 2964626674 | |||
| 1995 | 2964634786 | |||
| 1996 | 2964636286 | |||
| 1997 | 2964643215 | |||
| 1998 | 2964662139 | |||
| 1999 | 2964663841 | |||
| 2000 | 2964674472 | |||
| 2001 | 2964683564 | |||
| 2002 | 2964685166 | |||
| 2003 | 2964694231 | |||
| 2004 | 2964699074 | |||
| 2005 | 2964710883 | |||
| 2006 | 2964716596 | |||
| 2007 | 2964722704 | |||
| 2008 | 2967669890 | |||
| 2009 | 2967671609 | |||
| 2010 | 2967703697 | |||
| 2011 | 2967708092 | |||
| 2012 | 2967721571 | |||
| 2013 | 2967737245 | |||
| 2014 | 2967742863 | |||
| 2015 | 2967749010 | |||
| 2016 | 2967755760 | |||
| 2017 | 2967769614 | |||
| 2018 | 2967781771 | |||
| 2019 | 2970023979 | |||
| 2020 | 2970033689 | |||
| 2021 | 2970050086 | |||
| 2022 | 2970065733 | |||
| 2023 | 2970068865 | |||
| 2024 | 2970078178 | |||
| 2025 | 2970084297 | |||
| 2026 | 2970092067 | |||
| 2027 | 2970095804 | |||
| 2028 | 2970102715 | |||
| 2029 | 2970111177 | |||
| 2030 | 2970136221 | |||
| 2031 | 2970160860 | |||
| 2032 | 2970169016 | |||
| 2033 | 2970171001 | |||
| 2034 | 2970183327 | |||
| 2035 | 2970189497 | |||
| 2036 | 2970192021 | |||
| 2037 | 2977518357 | |||
| 2038 | 2977526369 | |||
| 2039 | 2977543096 | |||
| 2040 | 2977560515 | |||
| 2041 | 2977566247 | |||
| 2042 | 2984559302 | |||
| 2043 | 2984595829 | |||
| 2044 | 2996340362 | |||
| 2045 | 3003935171 | |||
| 2046 | 639649932 | |||
| 2047 | 642595960 | |||
| 2048 | 642623557 | |||
| 2049 | 643822111 | |||
| 2050 | 648735680 | |||
| 2051 | 8003015796 | |||
| 2052 | 8004638808 | |||
| 2053 | 8005294371 | |||
| 2054 | 8005306451 | |||
| 2055 | 8005306744 | |||
| 2056 | 8005311237 | |||
| 2057 | 8005378264 | |||
| 2058 | 8005383910 | |||
| 2059 | 8005401236 | |||
| 2060 | 8005547211 | |||
| 2061 | 8005558453 | |||
| 2062 | 8005566703 | |||
| 2063 | 8005650645 | |||
| 2064 | 8005683660 | |||
| 2065 | 8005693561 | |||
| 2066 | 8005693849 | |||
| 2067 | 8011352063 | |||
| 2068 | 8018133682 | |||
| 2069 | 8018170147 | |||
| 2070 | 8023687621 | |||
| 2071 | 8024489105 | |||
| 2072 | 8024506012 | |||
| 2073 | 8046769257 | |||
| 2074 | 8049297753 | |||
| 2075 | 8056686232 | |||
| 2076 | 8057578566 | |||
| 2077 | 8057876755 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bmv-assembly2.cif.gz_D | short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph | 0.9693 | 12 | 264 |
| 4bmv-assembly4.cif.gz_I | short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph | 0.9667 | 12 | 263 |
| 4bmv-assembly4.cif.gz_I | short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph | 0.9555 | 12 | 263 |
| 6zdz-assembly1.cif.gz_B | tetragonal crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni | 0.9549 | 12 | 264 |
| 4bmv-assembly2.cif.gz_D | short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph | 0.9509 | 12 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bmvE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9705 | 12 | 264 | 3.40.50.720 |
| 4bmvE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.952 | 12 | 264 | 3.40.50.720 |
| af_Q4CR34_41_280_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9183 | 12 | 235 | 3.40.50.720 |
| af_Q4DKY8_26_208_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9135 | 10 | 171 | 3.40.50.720 |
| af_A0A368UI72_22_109_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9087 | 13 | 78 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4CV41-F1-model_v4 | SDR family oxidoreductase | 0.981 | 12 | 264 |
GO:0016020
GO:0016491 |
| AF-A0A3R8NDT4-F1-model_v4 | NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) | 0.9782 | 6 | 263 |
GO:0016491
|
| AF-A0A2T9J0G4-F1-model_v4 | SDR family oxidoreductase | 0.9726 | 9 | 263 |
GO:0016491
|
| AF-A0A1G5YGT2-F1-model_v4 | NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) | 0.9716 | 9 | 264 |
GO:0016491
|
| AF-A0A5A9EPS6-F1-model_v4 | Catalase (EC 1.11.1.6) | 0.9704 | 8 | 264 |
GO:0004096
GO:0005737 GO:0020037 GO:0042542 GO:0042744 GO:0046872 |