F488809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1040 | 408 | 2080 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100165148|Ga0070711_1001651482 |
| Length | 334 |
| Sequence | MVGQTPSIRILKSLNPLIKMLCSIADSRAARFRRGDNGQKLRAGGPSDRYALVMENFVFLAVLFAAACHAGWNALIKVGLDPLSTTTLISIGSGAVALVFTPLVGAPAGAAWPWLVASVAIHLVYFASLIETYRTGDLGQVYPIARGAAPLMTATVTTFFIGEKLSVVGWVGIFALIAGVLLLSARGGRELARIDRRAIGFAFFTALTVCAYSVVDGVGARLSANPNAYSVWLFIGIAVVMLPYALFRDGREVIPAMQRFWQRGLAGGALQFLSYGIAIWAMTAAPIAVVATLRETSVLFGAVIAVVVLKEPLRAVRIIAACLIVFGLILIRLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 233 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 236 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 241 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0 |
| Rhizoplane | 10.67 |
| Rhizosphere | 88.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100165148 | 3300005439 | Unclassified | 1682 |
| 2 | 2214745210 | 2209111006 | Bacteria | 15141 |
| 3 | ARcpr5oldR_c000144 | 3300000041 | Bacteria | 12262 |
| 4 | ARSoilYngRDRAFT_c00009 | 3300000042 | Bacteria | 30468 |
| 5 | ARcpr5yngRDRAFT_c000006 | 3300000043 | Bacteria | 44193 |
| 6 | ARSoilOldRDRAFT_c000102 | 3300000044 | Bacteria | 16000 |
| 7 | ARCol0oldRDRAFT_c00372 | 3300000045 | Bacteria | 4333 |
| 8 | ARCol0yngRDRAFT_1000031 | 3300000652 | Bacteria | 25026 |
| 9 | JGI24032J14994_100083 | 3300001430 | Bacteria | 4098 |
| 10 | JGI24752J21851_1003042 | 3300001976 | Bacteria | 2222 |
| 11 | JGI24746J21847_1002186 | 3300001977 | Bacteria | 3125 |
| 12 | JGI24747J21853_1006367 | 3300001978 | Bacteria | 1115 |
| 13 | JGI24739J22299_10001142 | 3300001989 | Bacteria | 9904 |
| 14 | JGI24739J22299_10001990 | 3300001989 | Bacteria | 7825 |
| 15 | JGI24737J22298_10001546 | 3300001990 | Bacteria | 8175 |
| 16 | JGI24737J22298_10010151 | 3300001990 | Unclassified | 3117 |
| 17 | JGI24743J22301_10026307 | 3300001991 | Bacteria | 1132 |
| 18 | JGI24750J21931_1000491 | 3300002070 | Bacteria | 6207 |
| 19 | JGI24738J21930_10000010 | 3300002075 | Bacteria | 37976 |
| 20 | JGI24749J21850_1000579 | 3300002076 | Bacteria | 5347 |
| 21 | JGI24744J21845_10006762 | 3300002077 | Bacteria | 2373 |
| 22 | JGI24035J26624_1000653 | 3300002126 | Bacteria | 3209 |
| 23 | JGI24033J26618_1000465 | 3300002155 | Bacteria | 3989 |
| 24 | JGI24034J26672_10000494 | 3300002239 | Bacteria | 5114 |
| 25 | JGI24742J22300_10000278 | 3300002244 | Bacteria | 7696 |
| 26 | Ga0065717_1001969 | 3300005276 | Bacteria | 4623 |
| 27 | Ga0065704_10076177 | 3300005289 | Bacteria | 5232 |
| 28 | Ga0065712_10010165 | 3300005290 | Unclassified | 3514 |
| 29 | Ga0065712_10082229 | 3300005290 | Bacteria | 2930 |
| 30 | Ga0065712_10170888 | 3300005290 | Bacteria | 1244 |
| 31 | Ga0065715_10089173 | 3300005293 | Bacteria | 13131 |
| 32 | Ga0065715_10120090 | 3300005293 | Bacteria | 2267 |
| 33 | Ga0070658_10026708 | 3300005327 | Bacteria | 4634 |
| 34 | Ga0070676_10000978 | 3300005328 | Bacteria | 14208 |
| 35 | Ga0070676_10090580 | 3300005328 | Bacteria | 1873 |
| 36 | Ga0070683_100001166 | 3300005329 | Bacteria | 19905 |
| 37 | Ga0070683_100215473 | 3300005329 | Unclassified | 1824 |
| 38 | Ga0070690_100001038 | 3300005330 | Bacteria | 14220 |
| 39 | Ga0070690_100015198 | 3300005330 | Bacteria | 4586 |
| 40 | Ga0070690_100029526 | 3300005330 | Bacteria | 3402 |
| 41 | Ga0070690_100042920 | 3300005330 | Bacteria | 2865 |
| 42 | Ga0070670_100003635 | 3300005331 | Bacteria | 12843 |
| 43 | Ga0070670_100012172 | 3300005331 | Bacteria | 7359 |
| 44 | Ga0070670_100294418 | 3300005331 | Unclassified | 1419 |
| 45 | Ga0070677_10000126 | 3300005333 | Bacteria | 25482 |
| 46 | Ga0068869_100002872 | 3300005334 | Bacteria | 10456 |
| 47 | Ga0068869_100122501 | 3300005334 | Bacteria | 1990 |
| 48 | Ga0068869_100555603 | 3300005334 | Bacteria | 965 |
| 49 | Ga0070666_10007115 | 3300005335 | Bacteria | 6901 |
| 50 | Ga0070666_10042300 | 3300005335 | Bacteria | 3048 |
| 51 | Ga0070680_100003349 | 3300005336 | Bacteria | 11958 |
| 52 | Ga0070680_100008343 | 3300005336 | Bacteria | 7929 |
| 53 | Ga0070680_100041804 | 3300005336 | Bacteria | 3717 |
| 54 | Ga0070680_100069911 | 3300005336 | Bacteria | 2883 |
| 55 | Ga0070682_100000641 | 3300005337 | Bacteria | 21233 |
| 56 | Ga0068868_100003027 | 3300005338 | Bacteria | 11693 |
| 57 | Ga0070660_100002411 | 3300005339 | Bacteria | 12843 |
| 58 | Ga0070660_100034540 | 3300005339 | Bacteria | 3822 |
| 59 | Ga0070660_100049153 | 3300005339 | Bacteria | 3241 |
| 60 | Ga0070660_100204578 | 3300005339 | Bacteria | 1602 |
| 61 | Ga0070689_100004089 | 3300005340 | Bacteria | 9825 |
| 62 | Ga0070689_100004527 | 3300005340 | Bacteria | 9413 |
| 63 | Ga0070689_100040803 | 3300005340 | Bacteria | 3559 |
| 64 | Ga0070691_10049070 | 3300005341 | Bacteria | 2010 |
| 65 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 66 | Ga0070687_100028353 | 3300005343 | Bacteria | 2715 |
| 67 | Ga0070661_100000307 | 3300005344 | Bacteria | 39479 |
| 68 | Ga0070661_100025875 | 3300005344 | Bacteria | 4217 |
| 69 | Ga0070661_100105180 | 3300005344 | Unclassified | 2103 |
| 70 | Ga0070661_100405484 | 3300005344 | Bacteria | 1078 |
| 71 | Ga0070692_10003918 | 3300005345 | Bacteria | 6137 |
| 72 | Ga0070692_10035591 | 3300005345 | Bacteria | 2522 |
| 73 | Ga0070668_100001248 | 3300005347 | Bacteria | 18134 |
| 74 | Ga0070668_100054836 | 3300005347 | Bacteria | 3076 |
| 75 | Ga0070669_100000571 | 3300005353 | Bacteria | 27367 |
| 76 | Ga0070675_100008609 | 3300005354 | Bacteria | 7923 |
| 77 | Ga0070675_100020365 | 3300005354 | Bacteria | 5295 |
| 78 | Ga0070675_100063073 | 3300005354 | Bacteria | 3063 |
| 79 | Ga0070675_100246924 | 3300005354 | Unclassified | 1561 |
| 80 | Ga0070671_100000104 | 3300005355 | Bacteria | 53922 |
| 81 | Ga0070671_100072021 | 3300005355 | Unclassified | 2885 |
| 82 | Ga0070674_100000238 | 3300005356 | Bacteria | 27260 |
| 83 | Ga0070674_100035821 | 3300005356 | Bacteria | 3326 |
| 84 | Ga0070674_100066460 | 3300005356 | Bacteria | 2534 |
| 85 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 86 | Ga0070673_100118963 | 3300005364 | Bacteria | 2200 |
| 87 | Ga0070673_100136582 | 3300005364 | Bacteria | 2064 |
| 88 | Ga0070688_100005902 | 3300005365 | Bacteria | 6485 |
| 89 | Ga0070688_100008100 | 3300005365 | Bacteria | 5693 |
| 90 | Ga0070688_100039619 | 3300005365 | Bacteria | 2884 |
| 91 | Ga0070659_100000551 | 3300005366 | Bacteria | 27372 |
| 92 | Ga0070659_100053119 | 3300005366 | Unclassified | 3189 |
| 93 | Ga0070667_100009897 | 3300005367 | Bacteria | 7904 |
| 94 | Ga0070667_100031049 | 3300005367 | Bacteria | 4454 |
| 95 | Ga0070667_100054697 | 3300005367 | Unclassified | 3370 |
| 96 | Ga0070667_100326336 | 3300005367 | Bacteria | 1386 |
| 97 | Ga0070703_10004978 | 3300005406 | Bacteria | 3708 |
| 98 | Ga0070709_10062929 | 3300005434 | Bacteria | 2367 |
| 99 | Ga0070714_100045087 | 3300005435 | Bacteria | 3735 |
| 100 | Ga0070714_100045879 | 3300005435 | Bacteria | 3705 |
| 101 | Ga0070714_100151122 | 3300005435 | Bacteria | 2093 |
| 102 | Ga0070714_100164539 | 3300005435 | Unclassified | 2009 |
| 103 | Ga0070713_100007389 | 3300005436 | Bacteria | 7708 |
| 104 | Ga0070713_100099207 | 3300005436 | Bacteria | 2519 |
| 105 | Ga0070713_100135912 | 3300005436 | Unclassified | 2172 |
| 106 | Ga0070713_100456005 | 3300005436 | Unclassified | 1201 |
| 107 | Ga0070710_10041960 | 3300005437 | Bacteria | 2528 |
| 108 | Ga0070710_10070468 | 3300005437 | Bacteria | 2014 |
| 109 | Ga0070710_10103898 | 3300005437 | Bacteria | 1696 |
| 110 | Ga0070701_10087275 | 3300005438 | Bacteria | 1702 |
| 111 | Ga0070701_10190757 | 3300005438 | Bacteria | 1206 |
| 112 | Ga0070711_100158736 | 3300005439 | Unclassified | 1712 |
| 113 | Ga0070711_100300453 | 3300005439 | Unclassified | 1276 |
| 114 | Ga0070705_100000148 | 3300005440 | Bacteria | 41687 |
| 115 | Ga0070705_100066789 | 3300005440 | Bacteria | 2158 |
| 116 | Ga0070705_100286652 | 3300005440 | Bacteria | 1173 |
| 117 | Ga0070705_100349918 | 3300005440 | Bacteria | 1077 |
| 118 | Ga0070700_100000277 | 3300005441 | Bacteria | 27391 |
| 119 | Ga0070700_100031131 | 3300005441 | Bacteria | 3194 |
| 120 | Ga0070694_100001507 | 3300005444 | Bacteria | 13661 |
| 121 | Ga0070694_100016824 | 3300005444 | Bacteria | 4610 |
| 122 | Ga0070694_100021063 | 3300005444 | Bacteria | 4161 |
| 123 | Ga0070694_100073471 | 3300005444 | Unclassified | 2362 |
| 124 | Ga0070708_100027462 | 3300005445 | Bacteria | 4884 |
| 125 | Ga0070663_100000522 | 3300005455 | Bacteria | 20244 |
| 126 | Ga0070663_100017769 | 3300005455 | Bacteria | 4649 |
| 127 | Ga0070663_100028232 | 3300005455 | Unclassified | 3818 |
| 128 | Ga0070663_100494731 | 3300005455 | Bacteria | 1014 |
| 129 | Ga0070678_100000718 | 3300005456 | Bacteria | 16435 |
| 130 | Ga0070678_100011460 | 3300005456 | Bacteria | 5470 |
| 131 | Ga0070678_100042025 | 3300005456 | Bacteria | 3246 |
| 132 | Ga0070662_100001666 | 3300005457 | Bacteria | 13661 |
| 133 | Ga0070662_100015894 | 3300005457 | Bacteria | 5047 |
| 134 | Ga0070662_100060423 | 3300005457 | Bacteria | 2764 |
| 135 | Ga0070681_10014569 | 3300005458 | Bacteria | 7825 |
| 136 | Ga0070681_10052540 | 3300005458 | Bacteria | 4064 |
| 137 | Ga0070681_10306708 | 3300005458 | Bacteria | 1497 |
| 138 | Ga0070681_10320548 | 3300005458 | Bacteria | 1459 |
| 139 | Ga0068867_100006623 | 3300005459 | Bacteria | 8186 |
| 140 | Ga0068867_100012024 | 3300005459 | Bacteria | 6112 |
| 141 | Ga0070685_10002221 | 3300005466 | Bacteria | 10015 |
| 142 | Ga0070685_10004005 | 3300005466 | Bacteria | 7442 |
| 143 | Ga0070685_10024466 | 3300005466 | Bacteria | 3317 |
| 144 | Ga0070706_100147399 | 3300005467 | Bacteria | 2198 |
| 145 | Ga0070699_100011505 | 3300005518 | Bacteria | 7639 |
| 146 | Ga0070699_100320219 | 3300005518 | Bacteria | 1394 |
| 147 | Ga0070679_100014561 | 3300005530 | Bacteria | 7557 |
| 148 | Ga0070679_100082633 | 3300005530 | Bacteria | 3202 |
| 149 | Ga0070679_100397378 | 3300005530 | Bacteria | 1324 |
| 150 | Ga0070684_100000894 | 3300005535 | Bacteria | 21105 |
| 151 | Ga0070684_100127730 | 3300005535 | Bacteria | 2291 |
| 152 | Ga0070684_100224857 | 3300005535 | Bacteria | 1713 |
| 153 | Ga0070684_100750412 | 3300005535 | Bacteria | 911 |
| 154 | Ga0070697_100023189 | 3300005536 | Bacteria | 4935 |
| 155 | Ga0070697_100174431 | 3300005536 | Bacteria | 1821 |
| 156 | Ga0068853_100020627 | 3300005539 | Bacteria | 5480 |
| 157 | Ga0068853_100191830 | 3300005539 | Bacteria | 1857 |
| 158 | Ga0068853_100209643 | 3300005539 | Bacteria | 1776 |
| 159 | Ga0070672_100000088 | 3300005543 | Bacteria | 44394 |
| 160 | Ga0070672_100172591 | 3300005543 | Bacteria | 1799 |
| 161 | Ga0070686_100000719 | 3300005544 | Bacteria | 19252 |
| 162 | Ga0070686_100028453 | 3300005544 | Bacteria | 3390 |
| 163 | Ga0070686_100029585 | 3300005544 | Bacteria | 3333 |
| 164 | Ga0070686_100040116 | 3300005544 | Bacteria | 2920 |
| 165 | Ga0070696_100020775 | 3300005546 | Bacteria | 4448 |
| 166 | Ga0070696_100068057 | 3300005546 | Bacteria | 2499 |
| 167 | Ga0070696_100227825 | 3300005546 | Bacteria | 1401 |
| 168 | Ga0070693_100000134 | 3300005547 | Bacteria | 33408 |
| 169 | Ga0070693_100151858 | 3300005547 | Bacteria | 1468 |
| 170 | Ga0070665_100032403 | 3300005548 | Bacteria | 5259 |
| 171 | Ga0070665_100144488 | 3300005548 | Bacteria | 2382 |
| 172 | Ga0070665_100352336 | 3300005548 | Bacteria | 1478 |
| 173 | Ga0070665_100469798 | 3300005548 | Bacteria | 1268 |
| 174 | Ga0070704_100000428 | 3300005549 | Bacteria | 19609 |
| 175 | Ga0070704_100027693 | 3300005549 | Unclassified | 3762 |
| 176 | Ga0068855_100007545 | 3300005563 | Bacteria | 13158 |
| 177 | Ga0068855_100031321 | 3300005563 | Bacteria | 6351 |
| 178 | Ga0068855_100127457 | 3300005563 | Bacteria | 2909 |
| 179 | Ga0068855_100203384 | 3300005563 | Bacteria | 2229 |
| 180 | Ga0068855_100634939 | 3300005563 | Bacteria | 1148 |
| 181 | Ga0070664_100002234 | 3300005564 | Bacteria | 15585 |
| 182 | Ga0070664_100045631 | 3300005564 | Bacteria | 3701 |
| 183 | Ga0070664_100097454 | 3300005564 | Bacteria | 2553 |
| 184 | Ga0070664_100121692 | 3300005564 | Unclassified | 2286 |
| 185 | Ga0068857_100002935 | 3300005577 | Bacteria | 14058 |
| 186 | Ga0068857_100708826 | 3300005577 | Bacteria | 957 |
| 187 | Ga0068854_100308029 | 3300005578 | Bacteria | 1284 |
| 188 | Ga0068856_100002000 | 3300005614 | Bacteria | 21261 |
| 189 | Ga0068856_100307550 | 3300005614 | Bacteria | 1603 |
| 190 | Ga0070702_100000638 | 3300005615 | Bacteria | 12987 |
| 191 | Ga0070702_100002467 | 3300005615 | Bacteria | 7998 |
| 192 | Ga0070702_100011329 | 3300005615 | Bacteria | 4432 |
| 193 | Ga0070702_100023246 | 3300005615 | Bacteria | 3291 |
| 194 | Ga0068852_100002115 | 3300005616 | Bacteria | 13595 |
| 195 | Ga0068852_100077859 | 3300005616 | Bacteria | 2932 |
| 196 | Ga0068859_100021325 | 3300005617 | Bacteria | 6500 |
| 197 | Ga0068859_100080532 | 3300005617 | Bacteria | 3297 |
| 198 | Ga0068859_100243543 | 3300005617 | Unclassified | 1888 |
| 199 | Ga0068864_100014592 | 3300005618 | Bacteria | 6526 |
| 200 | Ga0068866_10000301 | 3300005718 | Bacteria | 23583 |
| 201 | Ga0068866_10002757 | 3300005718 | Bacteria | 7244 |
| 202 | Ga0068866_10124413 | 3300005718 | Bacteria | 1458 |
| 203 | Ga0068861_100016840 | 3300005719 | Bacteria | 5179 |
| 204 | Ga0068861_100018418 | 3300005719 | Bacteria | 4975 |
| 205 | Ga0068851_10058471 | 3300005834 | Bacteria | 1970 |
| 206 | Ga0068870_10000354 | 3300005840 | Bacteria | 17200 |
| 207 | Ga0068870_10001545 | 3300005840 | Bacteria | 9356 |
| 208 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 209 | Ga0068863_100018623 | 3300005841 | Bacteria | 6643 |
| 210 | Ga0068863_100272427 | 3300005841 | Bacteria | 1639 |
| 211 | Ga0068858_100000295 | 3300005842 | Bacteria | 53892 |
| 212 | Ga0068858_100011371 | 3300005842 | Bacteria | 8405 |
| 213 | Ga0068858_100025797 | 3300005842 | Bacteria | 5467 |
| 214 | Ga0068858_100128333 | 3300005842 | Bacteria | 2376 |
| 215 | Ga0068858_100160619 | 3300005842 | Bacteria | 2116 |
| 216 | Ga0068860_100001285 | 3300005843 | Bacteria | 27247 |
| 217 | Ga0068860_100084443 | 3300005843 | Bacteria | 3021 |
| 218 | Ga0068862_100003236 | 3300005844 | Bacteria | 14093 |
| 219 | Ga0068862_100012543 | 3300005844 | Bacteria | 7016 |
| 220 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 221 | Ga0081455_10001479 | 3300005937 | Bacteria | 29079 |
| 222 | Ga0081455_10009018 | 3300005937 | Bacteria | 10296 |
| 223 | Ga0081455_10017104 | 3300005937 | Bacteria | 6968 |
| 224 | Ga0081455_10033388 | 3300005937 | Bacteria | 4625 |
| 225 | Ga0081455_10143080 | 3300005937 | Bacteria | 1854 |
| 226 | Ga0081538_10022998 | 3300005981 | Bacteria | 4493 |
| 227 | Ga0070717_10007640 | 3300006028 | Bacteria | 8037 |
| 228 | Ga0075365_10022333 | 3300006038 | Bacteria | 3964 |
| 229 | Ga0075432_10000272 | 3300006058 | Bacteria | 14285 |
| 230 | Ga0075432_10094683 | 3300006058 | Bacteria | 1097 |
| 231 | Ga0070715_10005495 | 3300006163 | Bacteria | 4230 |
| 232 | Ga0070716_100148747 | 3300006173 | Bacteria | 1503 |
| 233 | Ga0070716_100251765 | 3300006173 | Bacteria | 1204 |
| 234 | Ga0070712_100028432 | 3300006175 | Bacteria | 3740 |
| 235 | Ga0070712_100061683 | 3300006175 | Unclassified | 2649 |
| 236 | Ga0070712_100204349 | 3300006175 | Bacteria | 1554 |
| 237 | Ga0075367_10049729 | 3300006178 | Bacteria | 2472 |
| 238 | Ga0075366_10028947 | 3300006195 | Bacteria | 3252 |
| 239 | Ga0097621_100000040 | 3300006237 | Bacteria | 66339 |
| 240 | Ga0097621_100022646 | 3300006237 | Bacteria | 4879 |
| 241 | Ga0097621_100053322 | 3300006237 | Bacteria | 3296 |
| 242 | Ga0075370_10040679 | 3300006353 | Bacteria | 2622 |
| 243 | Ga0068871_100000301 | 3300006358 | Bacteria | 34368 |
| 244 | Ga0075428_100003180 | 3300006844 | Bacteria | 17952 |
| 245 | Ga0075428_100015358 | 3300006844 | Bacteria | 8491 |
| 246 | Ga0075428_100045005 | 3300006844 | Bacteria | 4850 |
| 247 | Ga0075428_100100352 | 3300006844 | Bacteria | 3156 |
| 248 | Ga0075428_100416948 | 3300006844 | Bacteria | 1439 |
| 249 | Ga0075430_100000201 | 3300006846 | Bacteria | 40551 |
| 250 | Ga0075431_100000260 | 3300006847 | Bacteria | 40551 |
| 251 | Ga0075431_100329512 | 3300006847 | Bacteria | 1538 |
| 252 | Ga0075431_100509470 | 3300006847 | Bacteria | 1194 |
| 253 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 254 | Ga0075433_10006753 | 3300006852 | Bacteria | 9093 |
| 255 | Ga0075433_10009620 | 3300006852 | Bacteria | 7735 |
| 256 | Ga0075433_10492088 | 3300006852 | Bacteria | 1080 |
| 257 | Ga0075434_100000091 | 3300006871 | Bacteria | 49489 |
| 258 | Ga0075434_100019587 | 3300006871 | Bacteria | 6551 |
| 259 | Ga0075434_100067068 | 3300006871 | Bacteria | 3575 |
| 260 | Ga0075434_100094300 | 3300006871 | Bacteria | 2998 |
| 261 | Ga0075434_100183234 | 3300006871 | Bacteria | 2115 |
| 262 | Ga0075429_100001824 | 3300006880 | Bacteria | 17627 |
| 263 | Ga0068865_100000275 | 3300006881 | Bacteria | 28270 |
| 264 | Ga0068865_100024369 | 3300006881 | Bacteria | 3969 |
| 265 | Ga0068865_100050689 | 3300006881 | Unclassified | 2869 |
| 266 | Ga0068865_100100150 | 3300006881 | Bacteria | 2120 |
| 267 | Ga0075436_100039496 | 3300006914 | Bacteria | 3257 |
| 268 | Ga0075436_100107605 | 3300006914 | Bacteria | 1945 |
| 269 | Ga0097620_100021325 | 3300006931 | Bacteria | 6500 |
| 270 | Ga0097620_100080540 | 3300006931 | Bacteria | 3297 |
| 271 | Ga0097620_100243538 | 3300006931 | Unclassified | 1888 |
| 272 | Ga0075435_100017727 | 3300007076 | Bacteria | 5396 |
| 273 | Ga0075435_100040818 | 3300007076 | Bacteria | 3707 |
| 274 | Ga0075435_100286057 | 3300007076 | Bacteria | 1408 |
| 275 | Ga0099794_10046157 | 3300007265 | Bacteria | 2086 |
| 276 | Ga0105251_10020085 | 3300009011 | Bacteria | 3515 |
| 277 | Ga0105244_10133680 | 3300009036 | Bacteria | 1196 |
| 278 | Ga0105250_10018576 | 3300009092 | Bacteria | 2815 |
| 279 | Ga0105240_10646330 | 3300009093 | Bacteria | 1160 |
| 280 | Ga0105240_10743379 | 3300009093 | Bacteria | 1067 |
| 281 | Ga0111539_10000394 | 3300009094 | Bacteria | 54170 |
| 282 | Ga0111539_10001672 | 3300009094 | Bacteria | 29559 |
| 283 | Ga0111539_10017527 | 3300009094 | Bacteria | 8865 |
| 284 | Ga0111539_10040786 | 3300009094 | Bacteria | 5586 |
| 285 | Ga0111539_10109172 | 3300009094 | Bacteria | 3247 |
| 286 | Ga0111539_10187414 | 3300009094 | Bacteria | 2416 |
| 287 | Ga0111539_10409500 | 3300009094 | Bacteria | 1579 |
| 288 | Ga0111539_10828611 | 3300009094 | Unclassified | 1076 |
| 289 | Ga0105245_10000462 | 3300009098 | Bacteria | 37242 |
| 290 | Ga0105245_10020090 | 3300009098 | Bacteria | 5855 |
| 291 | Ga0105245_10350384 | 3300009098 | Bacteria | 1463 |
| 292 | Ga0105247_10001920 | 3300009101 | Bacteria | 14500 |
| 293 | Ga0105247_10022379 | 3300009101 | Bacteria | 3807 |
| 294 | Ga0105247_10309243 | 3300009101 | Bacteria | 1099 |
| 295 | Ga0114129_10001111 | 3300009147 | Bacteria | 35464 |
| 296 | Ga0114129_10003047 | 3300009147 | Bacteria | 23477 |
| 297 | Ga0114129_10007767 | 3300009147 | Bacteria | 15259 |
| 298 | Ga0114129_10069532 | 3300009147 | Bacteria | 4908 |
| 299 | Ga0114129_10991037 | 3300009147 | Bacteria | 1059 |
| 300 | Ga0105243_10000282 | 3300009148 | Bacteria | 56666 |
| 301 | Ga0105243_10030614 | 3300009148 | Bacteria | 4145 |
| 302 | Ga0105243_10033566 | 3300009148 | Bacteria | 3969 |
| 303 | Ga0105243_10123865 | 3300009148 | Bacteria | 2184 |
| 304 | Ga0105241_10000652 | 3300009174 | Bacteria | 26004 |
| 305 | Ga0105242_10011119 | 3300009176 | Bacteria | 6917 |
| 306 | Ga0105242_10298969 | 3300009176 | Bacteria | 1468 |
| 307 | Ga0105248_10011410 | 3300009177 | Bacteria | 9793 |
| 308 | Ga0105248_10027731 | 3300009177 | Bacteria | 6306 |
| 309 | Ga0105248_10093852 | 3300009177 | Bacteria | 3380 |
| 310 | Ga0105248_10262268 | 3300009177 | Bacteria | 1945 |
| 311 | Ga0105237_10043527 | 3300009545 | Bacteria | 4522 |
| 312 | Ga0105237_10237597 | 3300009545 | Bacteria | 1823 |
| 313 | Ga0105238_10713221 | 3300009551 | Bacteria | 1015 |
| 314 | Ga0105249_10001210 | 3300009553 | Bacteria | 22796 |
| 315 | Ga0105249_10071575 | 3300009553 | Bacteria | 3204 |
| 316 | Ga0105249_10153953 | 3300009553 | Bacteria | 2216 |
| 317 | Ga0105249_10173060 | 3300009553 | Bacteria | 2095 |
| 318 | Ga0105249_10332376 | 3300009553 | Bacteria | 1534 |
| 319 | Ga0105239_10028214 | 3300010375 | Bacteria | 6174 |
| 320 | Ga0105239_10067368 | 3300010375 | Bacteria | 3933 |
| 321 | Ga0105239_10154111 | 3300010375 | Bacteria | 2565 |
| 322 | Ga0105239_10486636 | 3300010375 | Unclassified | 1402 |
| 323 | Ga0105246_10009002 | 3300011119 | Bacteria | 6147 |
| 324 | Ga0105246_10026829 | 3300011119 | Bacteria | 3769 |
| 325 | Ga0105246_10122864 | 3300011119 | Bacteria | 1926 |
| 326 | Ga0157346_1000445 | 3300012480 | Bacteria | 1749 |
| 327 | Ga0157373_10010359 | 3300013100 | Bacteria | 6863 |
| 328 | Ga0157371_10019421 | 3300013102 | Bacteria | 5014 |
| 329 | Ga0157370_10164555 | 3300013104 | Bacteria | 2063 |
| 330 | Ga0157374_10006038 | 3300013296 | Bacteria | 10248 |
| 331 | Ga0157374_10120686 | 3300013296 | Bacteria | 2530 |
| 332 | Ga0157374_10148398 | 3300013296 | Unclassified | 2279 |
| 333 | Ga0157374_10195927 | 3300013296 | Bacteria | 1977 |
| 334 | Ga0157378_10000270 | 3300013297 | Bacteria | 50517 |
| 335 | Ga0157378_10494906 | 3300013297 | Bacteria | 1220 |
| 336 | Ga0163162_10000145 | 3300013306 | Bacteria | 65191 |
| 337 | Ga0163162_10143726 | 3300013306 | Bacteria | 2500 |
| 338 | Ga0157372_10012191 | 3300013307 | Bacteria | 9156 |
| 339 | Ga0157372_10254765 | 3300013307 | Bacteria | 2038 |
| 340 | Ga0157375_10000332 | 3300013308 | Bacteria | 42513 |
| 341 | Ga0157375_10009000 | 3300013308 | Bacteria | 8739 |
| 342 | Ga0157375_10049349 | 3300013308 | Bacteria | 4123 |
| 343 | Ga0157375_10748389 | 3300013308 | Bacteria | 1129 |
| 344 | Ga0163163_10000865 | 3300014325 | Bacteria | 25811 |
| 345 | Ga0163163_10005560 | 3300014325 | Bacteria | 10916 |
| 346 | Ga0163163_10069639 | 3300014325 | Bacteria | 3502 |
| 347 | Ga0163163_10768790 | 3300014325 | Bacteria | 1027 |
| 348 | Ga0157380_10000891 | 3300014326 | Bacteria | 18753 |
| 349 | Ga0157380_10059658 | 3300014326 | Bacteria | 3045 |
| 350 | Ga0157380_10473230 | 3300014326 | Bacteria | 1209 |
| 351 | Ga0157377_10000137 | 3300014745 | Bacteria | 46698 |
| 352 | Ga0157377_10039626 | 3300014745 | Bacteria | 2607 |
| 353 | Ga0157377_10128440 | 3300014745 | Bacteria | 1545 |
| 354 | Ga0157379_10001761 | 3300014968 | Bacteria | 17895 |
| 355 | Ga0157379_10012181 | 3300014968 | Bacteria | 7512 |
| 356 | Ga0157379_10032861 | 3300014968 | Unclassified | 4626 |
| 357 | Ga0157379_10071950 | 3300014968 | Bacteria | 3093 |
| 358 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 359 | Ga0157376_10083873 | 3300014969 | Bacteria | 2742 |
| 360 | Ga0157376_10270273 | 3300014969 | Bacteria | 1597 |
| 361 | Ga0157376_10422725 | 3300014969 | Bacteria | 1294 |
| 362 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 363 | Ga0163161_10049602 | 3300017792 | Bacteria | 3034 |
| 364 | Ga0213876_10026729 | 3300021384 | Bacteria | 3044 |
| 365 | Ga0228598_1007345 | 3300024227 | Bacteria | 2246 |
| 366 | Ga0207666_1000048 | 3300025271 | Bacteria | 23535 |
| 367 | Ga0207666_1000627 | 3300025271 | Bacteria | 4229 |
| 368 | Ga0207697_10003423 | 3300025315 | Bacteria | 7856 |
| 369 | Ga0207697_10014016 | 3300025315 | Bacteria | 3337 |
| 370 | Ga0207713_1061801 | 3300025735 | Unclassified | 1423 |
| 371 | Ga0207653_10015888 | 3300025885 | Bacteria | 2362 |
| 372 | Ga0207653_10034319 | 3300025885 | Bacteria | 1648 |
| 373 | Ga0207682_10000509 | 3300025893 | Bacteria | 17874 |
| 374 | Ga0207692_10007140 | 3300025898 | Bacteria | 4565 |
| 375 | Ga0207692_10052953 | 3300025898 | Bacteria | 2065 |
| 376 | Ga0207692_10058464 | 3300025898 | Bacteria | 1986 |
| 377 | Ga0207642_10000762 | 3300025899 | Bacteria | 9965 |
| 378 | Ga0207642_10006361 | 3300025899 | Bacteria | 3921 |
| 379 | Ga0207710_10003986 | 3300025900 | Bacteria | 6510 |
| 380 | Ga0207688_10000033 | 3300025901 | Bacteria | 46898 |
| 381 | Ga0207688_10004167 | 3300025901 | Bacteria | 7880 |
| 382 | Ga0207680_10030693 | 3300025903 | Bacteria | 3035 |
| 383 | Ga0207680_10035788 | 3300025903 | Bacteria | 2854 |
| 384 | Ga0207680_10262312 | 3300025903 | Bacteria | 1196 |
| 385 | Ga0207647_10020884 | 3300025904 | Bacteria | 4383 |
| 386 | Ga0207699_10008794 | 3300025906 | Bacteria | 5000 |
| 387 | Ga0207699_10186194 | 3300025906 | Bacteria | 1398 |
| 388 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 389 | Ga0207645_10087683 | 3300025907 | Bacteria | 2000 |
| 390 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 391 | Ga0207643_10000671 | 3300025908 | Bacteria | 21326 |
| 392 | Ga0207705_10061675 | 3300025909 | Bacteria | 2708 |
| 393 | Ga0207684_10023683 | 3300025910 | Bacteria | 5241 |
| 394 | Ga0207654_10000314 | 3300025911 | Bacteria | 29106 |
| 395 | Ga0207654_10152486 | 3300025911 | Bacteria | 1485 |
| 396 | Ga0207707_10037222 | 3300025912 | Bacteria | 4251 |
| 397 | Ga0207707_10079630 | 3300025912 | Bacteria | 2861 |
| 398 | Ga0207707_10121335 | 3300025912 | Bacteria | 2285 |
| 399 | Ga0207707_10216102 | 3300025912 | Bacteria | 1669 |
| 400 | Ga0207707_10323939 | 3300025912 | Bacteria | 1330 |
| 401 | Ga0207695_10146209 | 3300025913 | Bacteria | 2308 |
| 402 | Ga0207671_10025600 | 3300025914 | Bacteria | 4431 |
| 403 | Ga0207671_10095297 | 3300025914 | Bacteria | 2247 |
| 404 | Ga0207693_10007799 | 3300025915 | Bacteria | 8785 |
| 405 | Ga0207693_10026013 | 3300025915 | Bacteria | 4634 |
| 406 | Ga0207693_10037280 | 3300025915 | Bacteria | 3832 |
| 407 | Ga0207693_10042697 | 3300025915 | Unclassified | 3569 |
| 408 | Ga0207663_10033165 | 3300025916 | Bacteria | 3073 |
| 409 | Ga0207663_10122808 | 3300025916 | Unclassified | 1781 |
| 410 | Ga0207663_10148936 | 3300025916 | Bacteria | 1639 |
| 411 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 412 | Ga0207660_10015546 | 3300025917 | Bacteria | 5024 |
| 413 | Ga0207660_10032163 | 3300025917 | Bacteria | 3619 |
| 414 | Ga0207660_10130351 | 3300025917 | Bacteria | 1913 |
| 415 | Ga0207660_10165018 | 3300025917 | Bacteria | 1711 |
| 416 | Ga0207660_10443574 | 3300025917 | Bacteria | 1049 |
| 417 | Ga0207662_10000282 | 3300025918 | Bacteria | 23540 |
| 418 | Ga0207662_10004598 | 3300025918 | Bacteria | 7276 |
| 419 | Ga0207662_10018861 | 3300025918 | Bacteria | 3918 |
| 420 | Ga0207662_10053389 | 3300025918 | Bacteria | 2408 |
| 421 | Ga0207657_10009921 | 3300025919 | Bacteria | 9530 |
| 422 | Ga0207657_10013952 | 3300025919 | Bacteria | 7861 |
| 423 | Ga0207657_10022759 | 3300025919 | Bacteria | 5853 |
| 424 | Ga0207657_10030177 | 3300025919 | Bacteria | 4925 |
| 425 | Ga0207657_10046445 | 3300025919 | Bacteria | 3803 |
| 426 | Ga0207657_10076831 | 3300025919 | Bacteria | 2816 |
| 427 | Ga0207649_10001482 | 3300025920 | Bacteria | 13783 |
| 428 | Ga0207649_10077097 | 3300025920 | Bacteria | 2147 |
| 429 | Ga0207649_10097948 | 3300025920 | Bacteria | 1935 |
| 430 | Ga0207649_10501719 | 3300025920 | Bacteria | 923 |
| 431 | Ga0207652_10002995 | 3300025921 | Bacteria | 14105 |
| 432 | Ga0207652_10049186 | 3300025921 | Bacteria | 3608 |
| 433 | Ga0207652_10077001 | 3300025921 | Bacteria | 2909 |
| 434 | Ga0207652_10229057 | 3300025921 | Unclassified | 1675 |
| 435 | Ga0207652_10229888 | 3300025921 | Bacteria | 1671 |
| 436 | Ga0207652_10426192 | 3300025921 | Bacteria | 1196 |
| 437 | Ga0207652_10428879 | 3300025921 | Bacteria | 1192 |
| 438 | Ga0207681_10001546 | 3300025923 | Bacteria | 14821 |
| 439 | Ga0207681_10412728 | 3300025923 | Bacteria | 1092 |
| 440 | Ga0207694_10273369 | 3300025924 | Bacteria | 1386 |
| 441 | Ga0207694_10344105 | 3300025924 | Unclassified | 1233 |
| 442 | Ga0207650_10001317 | 3300025925 | Bacteria | 17984 |
| 443 | Ga0207650_10015921 | 3300025925 | Bacteria | 5246 |
| 444 | Ga0207659_10005767 | 3300025926 | Bacteria | 7546 |
| 445 | Ga0207659_10019879 | 3300025926 | Bacteria | 4429 |
| 446 | Ga0207659_10045708 | 3300025926 | Bacteria | 3089 |
| 447 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 448 | Ga0207687_10029549 | 3300025927 | Bacteria | 3688 |
| 449 | Ga0207687_10105562 | 3300025927 | Bacteria | 2082 |
| 450 | Ga0207687_10447810 | 3300025927 | Bacteria | 1070 |
| 451 | Ga0207700_10001532 | 3300025928 | Bacteria | 13089 |
| 452 | Ga0207700_10014414 | 3300025928 | Bacteria | 5179 |
| 453 | Ga0207700_10062990 | 3300025928 | Bacteria | 2819 |
| 454 | Ga0207664_10016973 | 3300025929 | Bacteria | 5325 |
| 455 | Ga0207664_10092306 | 3300025929 | Bacteria | 2485 |
| 456 | Ga0207664_10139891 | 3300025929 | Unclassified | 2046 |
| 457 | Ga0207664_10326158 | 3300025929 | Bacteria | 1355 |
| 458 | Ga0207644_10001292 | 3300025931 | Bacteria | 16118 |
| 459 | Ga0207644_10221613 | 3300025931 | Bacteria | 1499 |
| 460 | Ga0207690_10000140 | 3300025932 | Bacteria | 58923 |
| 461 | Ga0207690_10070065 | 3300025932 | Bacteria | 2414 |
| 462 | Ga0207690_10383322 | 3300025932 | Bacteria | 1118 |
| 463 | Ga0207706_10002144 | 3300025933 | Bacteria | 19302 |
| 464 | Ga0207706_10012048 | 3300025933 | Bacteria | 7880 |
| 465 | Ga0207706_10042505 | 3300025933 | Unclassified | 4028 |
| 466 | Ga0207706_10109084 | 3300025933 | Bacteria | 2436 |
| 467 | Ga0207686_10001034 | 3300025934 | Bacteria | 16473 |
| 468 | Ga0207686_10120810 | 3300025934 | Bacteria | 1783 |
| 469 | Ga0207709_10001423 | 3300025935 | Bacteria | 16760 |
| 470 | Ga0207709_10015190 | 3300025935 | Bacteria | 4268 |
| 471 | Ga0207670_10005263 | 3300025936 | Bacteria | 7084 |
| 472 | Ga0207670_10015623 | 3300025936 | Bacteria | 4541 |
| 473 | Ga0207670_10066092 | 3300025936 | Bacteria | 2483 |
| 474 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 475 | Ga0207704_10000086 | 3300025938 | Bacteria | 54866 |
| 476 | Ga0207704_10009100 | 3300025938 | Bacteria | 4776 |
| 477 | Ga0207665_10000872 | 3300025939 | Bacteria | 20402 |
| 478 | Ga0207665_10135014 | 3300025939 | Bacteria | 1755 |
| 479 | Ga0207665_10159348 | 3300025939 | Bacteria | 1622 |
| 480 | Ga0207665_10207106 | 3300025939 | Bacteria | 1431 |
| 481 | Ga0207691_10000214 | 3300025940 | Bacteria | 56205 |
| 482 | Ga0207691_10003307 | 3300025940 | Bacteria | 15702 |
| 483 | Ga0207711_10001106 | 3300025941 | Bacteria | 25759 |
| 484 | Ga0207711_10006359 | 3300025941 | Bacteria | 9959 |
| 485 | Ga0207711_10036936 | 3300025941 | Bacteria | 4146 |
| 486 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 487 | Ga0207689_10114162 | 3300025942 | Bacteria | 2220 |
| 488 | Ga0207689_10505602 | 3300025942 | Bacteria | 1013 |
| 489 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 490 | Ga0207661_10470341 | 3300025944 | Bacteria | 1147 |
| 491 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 492 | Ga0207679_10061554 | 3300025945 | Bacteria | 2794 |
| 493 | Ga0207679_10090278 | 3300025945 | Unclassified | 2368 |
| 494 | Ga0207667_10009257 | 3300025949 | Bacteria | 11628 |
| 495 | Ga0207667_10255367 | 3300025949 | Bacteria | 1793 |
| 496 | Ga0207667_10345730 | 3300025949 | Bacteria | 1517 |
| 497 | Ga0207651_10000264 | 3300025960 | Bacteria | 22299 |
| 498 | Ga0207651_10355951 | 3300025960 | Bacteria | 1234 |
| 499 | Ga0207651_10411686 | 3300025960 | Unclassified | 1152 |
| 500 | Ga0207712_10001547 | 3300025961 | Bacteria | 15511 |
| 501 | Ga0207712_10013434 | 3300025961 | Bacteria | 5249 |
| 502 | Ga0207712_10584713 | 3300025961 | Unclassified | 964 |
| 503 | Ga0207668_10005954 | 3300025972 | Bacteria | 7187 |
| 504 | Ga0207640_10001474 | 3300025981 | Bacteria | 12692 |
| 505 | Ga0207640_10046782 | 3300025981 | Bacteria | 2787 |
| 506 | Ga0207658_10034469 | 3300025986 | Bacteria | 3618 |
| 507 | Ga0207658_10274950 | 3300025986 | Bacteria | 1441 |
| 508 | Ga0207658_10754531 | 3300025986 | Bacteria | 881 |
| 509 | Ga0207677_10001187 | 3300026023 | Bacteria | 14156 |
| 510 | Ga0207677_10403070 | 3300026023 | Bacteria | 1160 |
| 511 | Ga0207703_10003109 | 3300026035 | Bacteria | 14015 |
| 512 | Ga0207703_10030388 | 3300026035 | Bacteria | 4269 |
| 513 | Ga0207703_10262331 | 3300026035 | Bacteria | 1562 |
| 514 | Ga0207639_10012878 | 3300026041 | Bacteria | 5836 |
| 515 | Ga0207639_10096051 | 3300026041 | Unclassified | 2383 |
| 516 | Ga0207639_10204912 | 3300026041 | Bacteria | 1694 |
| 517 | Ga0207678_10011175 | 3300026067 | Bacteria | 7885 |
| 518 | Ga0207678_10012004 | 3300026067 | Bacteria | 7608 |
| 519 | Ga0207678_10038765 | 3300026067 | Bacteria | 4138 |
| 520 | Ga0207678_10051057 | 3300026067 | Bacteria | 3571 |
| 521 | Ga0207708_10000124 | 3300026075 | Bacteria | 59953 |
| 522 | Ga0207708_10007956 | 3300026075 | Bacteria | 7856 |
| 523 | Ga0207708_10025817 | 3300026075 | Bacteria | 4445 |
| 524 | Ga0207641_10000476 | 3300026088 | Bacteria | 45413 |
| 525 | Ga0207641_10183043 | 3300026088 | Bacteria | 1920 |
| 526 | Ga0207648_10000072 | 3300026089 | Bacteria | 94957 |
| 527 | Ga0207676_10000512 | 3300026095 | Bacteria | 32630 |
| 528 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 529 | Ga0207674_10228157 | 3300026116 | Bacteria | 1810 |
| 530 | Ga0207674_10570773 | 3300026116 | Bacteria | 1093 |
| 531 | Ga0207675_100005225 | 3300026118 | Bacteria | 12497 |
| 532 | Ga0207675_100030237 | 3300026118 | Bacteria | 5044 |
| 533 | Ga0207675_100171642 | 3300026118 | Bacteria | 2073 |
| 534 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 535 | Ga0207683_10010209 | 3300026121 | Bacteria | 8009 |
| 536 | Ga0207683_10049139 | 3300026121 | Bacteria | 3692 |
| 537 | Ga0207683_10058105 | 3300026121 | Bacteria | 3396 |
| 538 | Ga0207698_10000523 | 3300026142 | Bacteria | 22323 |
| 539 | Ga0207698_10006814 | 3300026142 | Bacteria | 7145 |
| 540 | Ga0207698_10105850 | 3300026142 | Bacteria | 2345 |
| 541 | Ga0209973_1002360 | 3300027252 | Unclassified | 1760 |
| 542 | Ga0210002_1000355 | 3300027617 | Bacteria | 6256 |
| 543 | Ga0209966_1012566 | 3300027695 | Bacteria | 1557 |
| 544 | Ga0209998_10002116 | 3300027717 | Bacteria | 4622 |
| 545 | Ga0209974_10002631 | 3300027876 | Bacteria | 6512 |
| 546 | Ga0209974_10037946 | 3300027876 | Bacteria | 1600 |
| 547 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 548 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 549 | Ga0207428_10000228 | 3300027907 | Bacteria | 77812 |
| 550 | Ga0207428_10237846 | 3300027907 | Bacteria | 1361 |
| 551 | Ga0268266_10127554 | 3300028379 | Bacteria | 2272 |
| 552 | Ga0268266_10466338 | 3300028379 | Bacteria | 1202 |
| 553 | Ga0268265_10001240 | 3300028380 | Bacteria | 22083 |
| 554 | Ga0268265_10011857 | 3300028380 | Bacteria | 5892 |
| 555 | Ga0268264_10002968 | 3300028381 | Bacteria | 14738 |
| 556 | Ga0268264_10098649 | 3300028381 | Bacteria | 2534 |
| 557 | Ga0265325_10000533 | 3300031241 | Bacteria | 27589 |
| 558 | Ga0265340_10008415 | 3300031247 | Bacteria | 5574 |
| 559 | Ga0265313_10010623 | 3300031595 | Bacteria | 5799 |
| 560 | Ga0316579_10140845 | 3300031691 | Bacteria | 1162 |
| 561 | Ga0265342_10000896 | 3300031712 | Bacteria | 29642 |
| 562 | Ga0265342_10127184 | 3300031712 | Bacteria | 1430 |
| 563 | Ga0373930_0000262 | 3300034816 | Bacteria | 6703 |
| 564 | Ga0373930_0016837 | 3300034816 | Bacteria | 1387 |
| 565 | Ga0373948_0003895 | 3300034817 | Bacteria | 2329 |
| 566 | Ga0373948_0010128 | 3300034817 | Bacteria | 1640 |
| 567 | Ga0373948_0024216 | 3300034817 | Bacteria | 1183 |
| 568 | Ga0373950_0005031 | 3300034818 | Bacteria | 1959 |
| 569 | Ga0373958_0001890 | 3300034819 | Bacteria | 2876 |
| 570 | Ga0373958_0006596 | 3300034819 | Bacteria | 1814 |
| 571 | Ga0373959_0003651 | 3300034820 | Bacteria | 2462 |
| 572 | Ga0373959_0019894 | 3300034820 | Bacteria | 1276 |
| 573 | Ga0373938_0000290 | 3300034957 | Bacteria | 8088 |
| 574 | Ga0373938_0000662 | 3300034957 | Bacteria | 5520 |
| 575 | Ga0373926_0090927 | 3300035083 | Bacteria | 1135 |
| 576 | Ga0373928_0000789 | 3300035084 | Bacteria | 6152 |
| 577 | Ga0373928_0006995 | 3300035084 | Unclassified | 2175 |
| 578 | Ga0373928_0009522 | 3300035084 | Bacteria | 1897 |
| 579 | Ga0373929_0002403 | 3300035085 | Bacteria | 3439 |
| 580 | Ga0373929_0006971 | 3300035085 | Bacteria | 2054 |
| 581 | Ga0373934_0046329 | 3300035086 | Unclassified | 1720 |
| 582 | Ga0373940_0050600 | 3300035088 | Bacteria | 1166 |
| 583 | Ga0373940_0071890 | 3300035088 | Bacteria | 1009 |
| 584 | Ga0373949_0000938 | 3300035090 | Bacteria | 9087 |
| 585 | Ga0373949_0001649 | 3300035090 | Bacteria | 6227 |
| 586 | Ga0373951_0000715 | 3300035091 | Bacteria | 9107 |
| 587 | Ga0373951_0005147 | 3300035091 | Bacteria | 3054 |
| 588 | Ga0373951_0035857 | 3300035091 | Bacteria | 1182 |
| 589 | Ga0373952_0000298 | 3300035092 | Bacteria | 8236 |
| 590 | Ga0373952_0002466 | 3300035092 | Bacteria | 3339 |
| 591 | Ga0373923_0054370 | 3300035111 | Bacteria | 1685 |
| 592 | Ga0373932_0000172 | 3300035112 | Bacteria | 18943 |
| 593 | Ga0373932_0008064 | 3300035112 | Bacteria | 2514 |
| 594 | Ga0373936_0004177 | 3300035113 | Bacteria | 5443 |
| 595 | Ga0373936_0059349 | 3300035113 | Bacteria | 1559 |
| 596 | Ga0373936_0096497 | 3300035113 | Bacteria | 1244 |
| 597 | Ga0373939_0000500 | 3300035114 | Bacteria | 9849 |
| 598 | Ga0373939_0007393 | 3300035114 | Bacteria | 2668 |
| 599 | Ga0373941_0001751 | 3300035115 | Bacteria | 4665 |
| 600 | Ga0373941_0013482 | 3300035115 | Bacteria | 2162 |
| 601 | Ga0373945_0002996 | 3300035116 | Bacteria | 5310 |
| 602 | Ga0373945_0010893 | 3300035116 | Bacteria | 2999 |
| 603 | Ga0373945_0076277 | 3300035116 | Unclassified | 1277 |
| 604 | Ga0373953_0001475 | 3300035117 | Bacteria | 6830 |
| 605 | Ga0373954_0050033 | 3300035118 | Bacteria | 1960 |
| 606 | Ga0373956_0142721 | 3300035119 | Bacteria | 1125 |
| 607 | Ga0373956_0181184 | 3300035119 | Unclassified | 996 |
| 608 | Ga0373957_0028243 | 3300035120 | Unclassified | 2043 |
| 609 | Ga0373960_0001140 | 3300035121 | Bacteria | 5759 |
| 610 | Ga0373960_0001458 | 3300035121 | Bacteria | 5233 |
| 611 | Ga0373943_0015808 | 3300035170 | Bacteria | 3432 |
| 612 | Ga0373943_0017540 | 3300035170 | Bacteria | 3275 |
| 613 | Ga0373946_0021621 | 3300035171 | Unclassified | 2496 |
| 614 | Ga0373955_0011599 | 3300035172 | Bacteria | 4207 |
| 615 | Ga0373955_0023581 | 3300035172 | Bacteria | 3136 |
| 616 | Ga0373955_0027187 | 3300035172 | Unclassified | 2955 |
| 617 | Ga0373955_0107444 | 3300035172 | Unclassified | 1610 |
| 618 | Ga0373955_0129822 | 3300035172 | Unclassified | 1470 |
| 619 | Ga0373942_0001552 | 3300035207 | Bacteria | 5891 |
| 620 | Ga0373961_0000196 | 3300035241 | Bacteria | 28662 |
| 621 | Ga0373961_0001345 | 3300035241 | Bacteria | 7386 |
| 622 | Ga0373961_0003263 | 3300035241 | Bacteria | 4041 |
| 623 | Ga0373962_0000310 | 3300035242 | Bacteria | 10526 |
| 624 | Ga0373962_0001593 | 3300035242 | Bacteria | 5381 |
| 625 | Ga0373962_0071476 | 3300035242 | Bacteria | 1038 |
| 626 | Ga0373924_0027636 | 3300035410 | Bacteria | 2257 |
| 627 | Ga0373924_0071717 | 3300035410 | Unclassified | 1462 |
| 628 | Ga0373931_0004010 | 3300035691 | Bacteria | 6667 |
| 629 | Ga0373931_0008212 | 3300035691 | Bacteria | 4946 |
| 630 | Ga0373931_0031253 | 3300035691 | Bacteria | 2747 |
| 631 | Ga0373931_0032881 | 3300035691 | Bacteria | 2686 |
| 632 | Ga0373931_0088107 | 3300035691 | Unclassified | 1724 |
| 633 | Ga0373931_0164382 | 3300035691 | Bacteria | 1303 |
| 634 | Ga0373935_0012655 | 3300035692 | Bacteria | 5077 |
| 635 | Ga0373935_0020024 | 3300035692 | Bacteria | 4084 |
| 636 | Ga0373927_0042280 | 3300035695 | Bacteria | 2952 |
| 637 | Ga0373927_0095358 | 3300035695 | Bacteria | 1933 |
| 638 | Ga0373927_0444526 | 3300035695 | Bacteria | 856 |
| 639 | Ga0373933_0001949 | 3300035724 | Bacteria | 11918 |
| 640 | Ga0373933_0006597 | 3300035724 | Bacteria | 6325 |
| 641 | Ga0373933_0008978 | 3300035724 | Bacteria | 5454 |
| 642 | Ga0373933_0032120 | 3300035724 | Unclassified | 3050 |
| 643 | Ga0373933_0162105 | 3300035724 | Bacteria | 1420 |
| 644 | Ga0373947_0000288 | 3300035725 | Bacteria | 28482 |
| 645 | Ga0373947_0008353 | 3300035725 | Bacteria | 5962 |
| 646 | Ga0373947_0103872 | 3300035725 | Bacteria | 1788 |
| 647 | Ga0373937_0005192 | 3300036401 | Bacteria | 11115 |
| 648 | Ga0373937_0014259 | 3300036401 | Bacteria | 7014 |
| 649 | Ga0373937_0025577 | 3300036401 | Bacteria | 5330 |
| 650 | Ga0373937_0266689 | 3300036401 | Bacteria | 1615 |
| 651 | Ga0373937_0286285 | 3300036401 | Unclassified | 1557 |
| 652 | Ga0373925_0001787 | 3300037068 | Bacteria | 17936 |
| 653 | Ga0373925_0007364 | 3300037068 | Bacteria | 8030 |
| 654 | Ga0373925_0043674 | 3300037068 | Unclassified | 3327 |
| 655 | Ga0373925_0173237 | 3300037068 | Unclassified | 1704 |
| 656 | Ga0373925_0211362 | 3300037068 | Bacteria | 1545 |
| 657 | Ga0395899_0223910 | 3300037312 | Bacteria | 1302 |
| 658 | Ga0395898_0112889 | 3300037466 | Bacteria | 2604 |
| 659 | Ga0395901_0057774 | 3300038443 | Bacteria | 4035 |
| 660 | Ga0436365_1087995 | 3300039437 | Bacteria | 4307 |
| 661 | Ga0439460_0007277 | 3300042461 | Bacteria | 2762 |
| 662 | Ga0451577_0010248 | 3300042876 | Bacteria | 8976 |
| 663 | Ga0495592_0009025 | 3300046454 | Bacteria | 7493 |
| 664 | Ga0495592_0049987 | 3300046454 | Bacteria | 3107 |
| 665 | Ga0495592_0262206 | 3300046454 | Unclassified | 1138 |
| 666 | Ga0495603_0047130 | 3300046455 | Bacteria | 2567 |
| 667 | Ga0495629_0000183 | 3300046459 | Bacteria | 56534 |
| 668 | Ga0495629_0020325 | 3300046459 | Unclassified | 4742 |
| 669 | Ga0495641_0016655 | 3300046461 | Bacteria | 3863 |
| 670 | Ga0495641_0019503 | 3300046461 | Unclassified | 3467 |
| 671 | Ga0495641_0052430 | 3300046461 | Unclassified | 1860 |
| 672 | Ga0495651_0001256 | 3300046462 | Bacteria | 19642 |
| 673 | Ga0495651_0004540 | 3300046462 | Bacteria | 10616 |
| 674 | Ga0495651_0023671 | 3300046462 | Bacteria | 4776 |
| 675 | Ga0495651_0064250 | 3300046462 | Bacteria | 2805 |
| 676 | Ga0495653_0046543 | 3300046463 | Unclassified | 3359 |
| 677 | Ga0495653_0057318 | 3300046463 | Bacteria | 2965 |
| 678 | Ga0495653_0117328 | 3300046463 | Bacteria | 1902 |
| 679 | Ga0495580_0080566 | 3300046472 | Bacteria | 2269 |
| 680 | Ga0495580_0120946 | 3300046472 | Bacteria | 1818 |
| 681 | Ga0495580_0123433 | 3300046472 | Bacteria | 1797 |
| 682 | Ga0495582_0001748 | 3300046473 | Bacteria | 12256 |
| 683 | Ga0495582_0002465 | 3300046473 | Bacteria | 10315 |
| 684 | Ga0495582_0097571 | 3300046473 | Unclassified | 1643 |
| 685 | Ga0495639_0015609 | 3300046475 | Bacteria | 3294 |
| 686 | Ga0495662_0019936 | 3300046476 | Unclassified | 3244 |
| 687 | Ga0495662_0052366 | 3300046476 | Bacteria | 1971 |
| 688 | Ga0495664_0007322 | 3300046477 | Bacteria | 6125 |
| 689 | Ga0495664_0007547 | 3300046477 | Bacteria | 6046 |
| 690 | Ga0495664_0026199 | 3300046477 | Bacteria | 3396 |
| 691 | Ga0495664_0071039 | 3300046477 | Unclassified | 2079 |
| 692 | Ga0495584_0023574 | 3300046491 | Bacteria | 3120 |
| 693 | Ga0495584_0065458 | 3300046491 | Bacteria | 1828 |
| 694 | Ga0495585_0017046 | 3300046492 | Bacteria | 4203 |
| 695 | Ga0495594_0068785 | 3300046499 | Bacteria | 1967 |
| 696 | Ga0495594_0081400 | 3300046499 | Bacteria | 1808 |
| 697 | Ga0495594_0087707 | 3300046499 | Bacteria | 1741 |
| 698 | Ga0495607_0019505 | 3300046501 | Bacteria | 4306 |
| 699 | Ga0495608_0000646 | 3300046511 | Bacteria | 24033 |
| 700 | Ga0495608_0019174 | 3300046511 | Bacteria | 4711 |
| 701 | Ga0495608_0073236 | 3300046511 | Unclassified | 2234 |
| 702 | Ga0495618_0025077 | 3300046514 | Bacteria | 3699 |
| 703 | Ga0495628_0001902 | 3300046516 | Bacteria | 18942 |
| 704 | Ga0495628_0105447 | 3300046516 | Bacteria | 2171 |
| 705 | Ga0495628_0246548 | 3300046516 | Unclassified | 1335 |
| 706 | Ga0495630_0086143 | 3300046517 | Bacteria | 2372 |
| 707 | Ga0495630_0137814 | 3300046517 | Unclassified | 1855 |
| 708 | Ga0495637_0049397 | 3300046520 | Unclassified | 1768 |
| 709 | Ga0495643_0132716 | 3300046522 | Bacteria | 1249 |
| 710 | Ga0495644_0000234 | 3300046523 | Bacteria | 26118 |
| 711 | Ga0495666_0019944 | 3300046526 | Bacteria | 3326 |
| 712 | Ga0495652_0012330 | 3300046529 | Bacteria | 7715 |
| 713 | Ga0495652_0039217 | 3300046529 | Bacteria | 4096 |
| 714 | Ga0495652_0055115 | 3300046529 | Bacteria | 3382 |
| 715 | Ga0495665_0039729 | 3300046531 | Bacteria | 2505 |
| 716 | Ga0495640_0018843 | 3300046533 | Bacteria | 5107 |
| 717 | Ga0495586_0102700 | 3300046535 | Bacteria | 1587 |
| 718 | Ga0495587_0000770 | 3300046536 | Bacteria | 21359 |
| 719 | Ga0495621_0082200 | 3300046539 | Bacteria | 1203 |
| 720 | Ga0495645_0010241 | 3300046543 | Bacteria | 6569 |
| 721 | Ga0495645_0067555 | 3300046543 | Bacteria | 2581 |
| 722 | Ga0495645_0074432 | 3300046543 | Bacteria | 2445 |
| 723 | Ga0495622_0026407 | 3300046557 | Bacteria | 2712 |
| 724 | Ga0495622_0036966 | 3300046557 | Bacteria | 2275 |
| 725 | Ga0495622_0115235 | 3300046557 | Bacteria | 1229 |
| 726 | Ga0495633_0055300 | 3300046558 | Bacteria | 1866 |
| 727 | Ga0495633_0132744 | 3300046558 | Unclassified | 1152 |
| 728 | Ga0495667_0012785 | 3300046559 | Bacteria | 5687 |
| 729 | Ga0495667_0013632 | 3300046559 | Bacteria | 5496 |
| 730 | Ga0495667_0021370 | 3300046559 | Bacteria | 4367 |
| 731 | Ga0495667_0231034 | 3300046559 | Unclassified | 1179 |
| 732 | Ga0495656_0000502 | 3300046615 | Bacteria | 12828 |
| 733 | Ga0495634_0005519 | 3300046642 | Bacteria | 9712 |
| 734 | Ga0495634_0029394 | 3300046642 | Bacteria | 3805 |
| 735 | Ga0495635_0000812 | 3300046663 | Bacteria | 20468 |
| 736 | Ga0495635_0068842 | 3300046663 | Unclassified | 2427 |
| 737 | Ga0495635_0078343 | 3300046663 | Bacteria | 2262 |
| 738 | Ga0495635_0090134 | 3300046663 | Bacteria | 2098 |
| 739 | Ga0495659_0019422 | 3300046664 | Unclassified | 2274 |
| 740 | Ga0495661_0133436 | 3300046665 | Bacteria | 1358 |
| 741 | Ga0495588_0018849 | 3300046674 | Unclassified | 3372 |
| 742 | Ga0495588_0049139 | 3300046674 | Unclassified | 2168 |
| 743 | Ga0495657_0005959 | 3300046675 | Bacteria | 9575 |
| 744 | Ga0495657_0073198 | 3300046675 | Bacteria | 2232 |
| 745 | Ga0495599_0003370 | 3300046678 | Bacteria | 9341 |
| 746 | Ga0495623_0001381 | 3300046679 | Bacteria | 16475 |
| 747 | Ga0495623_0007001 | 3300046679 | Bacteria | 7328 |
| 748 | Ga0495646_0006169 | 3300046680 | Bacteria | 7601 |
| 749 | Ga0495646_0101675 | 3300046680 | Bacteria | 1647 |
| 750 | Ga0495646_0225582 | 3300046680 | Unclassified | 1011 |
| 751 | Ga0495647_0010732 | 3300046681 | Bacteria | 3125 |
| 752 | Ga0495658_0026339 | 3300046683 | Unclassified | 3115 |
| 753 | Ga0495658_0033999 | 3300046683 | Bacteria | 2795 |
| 754 | Ga0495658_0100438 | 3300046683 | Bacteria | 1726 |
| 755 | Ga0495669_0025004 | 3300046684 | Unclassified | 2603 |
| 756 | Ga0495613_0103367 | 3300046689 | Bacteria | 2057 |
| 757 | Ga0495613_0174224 | 3300046689 | Bacteria | 1525 |
| 758 | Ga0495624_0022854 | 3300046690 | Bacteria | 4128 |
| 759 | Ga0495624_0040556 | 3300046690 | Unclassified | 2981 |
| 760 | Ga0495624_0043892 | 3300046690 | Unclassified | 2850 |
| 761 | Ga0495670_0001992 | 3300046691 | Bacteria | 10026 |
| 762 | Ga0495600_0001477 | 3300046809 | Bacteria | 13024 |
| 763 | Ga0495600_0071321 | 3300046809 | Bacteria | 2269 |
| 764 | Ga0495600_0122193 | 3300046809 | Unclassified | 1693 |
| 765 | Ga0495581_0129470 | 3300047315 | Bacteria | 1470 |
| 766 | Ga0495604_0079050 | 3300047317 | Bacteria | 2467 |
| 767 | Ga0495604_0093021 | 3300047317 | Bacteria | 2232 |
| 768 | Ga0495674_0058715 | 3300047319 | Bacteria | 3362 |
| 769 | Ga0495674_0147612 | 3300047319 | Bacteria | 1973 |
| 770 | Ga0495674_0254663 | 3300047319 | Bacteria | 1444 |
| 771 | Ga0495676_0031961 | 3300047321 | Bacteria | 4447 |
| 772 | Ga0495676_0047264 | 3300047321 | Bacteria | 3482 |
| 773 | Ga0495680_0006835 | 3300047322 | Bacteria | 10539 |
| 774 | Ga0495680_0025234 | 3300047322 | Bacteria | 4922 |
| 775 | Ga0495680_0045027 | 3300047322 | Bacteria | 3486 |
| 776 | Ga0495680_0047807 | 3300047322 | Bacteria | 3363 |
| 777 | Ga0495680_0150937 | 3300047322 | Unclassified | 1694 |
| 778 | Ga0495675_0007988 | 3300047444 | Bacteria | 6544 |
| 779 | Ga0495679_018405 | 3300047446 | Unclassified | 2480 |
| 780 | Ga0495684_0008581 | 3300047471 | Bacteria | 7911 |
| 781 | Ga0495684_0019509 | 3300047471 | Bacteria | 5223 |
| 782 | Ga0495684_0140377 | 3300047471 | Unclassified | 1811 |
| 783 | Ga0495684_0152115 | 3300047471 | Unclassified | 1729 |
| 784 | Ga0495684_0248375 | 3300047471 | Bacteria | 1295 |
| 785 | Ga0495684_0262639 | 3300047471 | Bacteria | 1252 |
| 786 | Ga0495593_0011432 | 3300047673 | Bacteria | 5100 |
| 787 | Ga0495602_0020689 | 3300048088 | Bacteria | 6498 |
| 788 | Ga0495602_0195930 | 3300048088 | Bacteria | 1545 |
| 789 | Ga0495614_0024203 | 3300048089 | Unclassified | 2622 |
| 790 | Ga0495614_0052376 | 3300048089 | Bacteria | 1749 |
| 791 | Ga0496100_0000530 | 3300048903 | Bacteria | 18154 |
| 792 | Ga0496100_0011766 | 3300048903 | Bacteria | 4992 |
| 793 | Ga0496100_0042055 | 3300048903 | Unclassified | 2916 |
| 794 | Ga0496100_0055648 | 3300048903 | Bacteria | 2585 |
| 795 | Ga0496100_0261903 | 3300048903 | Unclassified | 1283 |
| 796 | Ga0496101_0000189 | 3300048904 | Bacteria | 48416 |
| 797 | Ga0496101_0003519 | 3300048904 | Bacteria | 9766 |
| 798 | Ga0496101_0024583 | 3300048904 | Bacteria | 4170 |
| 799 | Ga0496101_0070644 | 3300048904 | Unclassified | 2557 |
| 800 | Ga0496101_0338230 | 3300048904 | Unclassified | 1182 |
| 801 | Ga0496101_0460570 | 3300048904 | Bacteria | 1003 |
| 802 | Ga0496102_0006150 | 3300048905 | Bacteria | 10232 |
| 803 | Ga0496102_0011115 | 3300048905 | Bacteria | 7754 |
| 804 | Ga0496102_0022131 | 3300048905 | Bacteria | 5632 |
| 805 | Ga0496102_0043206 | 3300048905 | Bacteria | 4086 |
| 806 | Ga0496102_0052973 | 3300048905 | Bacteria | 3698 |
| 807 | Ga0496102_0123061 | 3300048905 | Bacteria | 2423 |
| 808 | Ga0496102_0664937 | 3300048905 | Bacteria | 965 |
| 809 | Ga0496103_0001693 | 3300048906 | Bacteria | 14412 |
| 810 | Ga0496103_0006234 | 3300048906 | Bacteria | 7127 |
| 811 | Ga0496103_0056304 | 3300048906 | Bacteria | 2440 |
| 812 | Ga0496103_0124913 | 3300048906 | Unclassified | 1640 |
| 813 | Ga0496104_0001051 | 3300048907 | Bacteria | 23567 |
| 814 | Ga0496104_0001268 | 3300048907 | Bacteria | 21768 |
| 815 | Ga0496104_0011783 | 3300048907 | Bacteria | 7845 |
| 816 | Ga0496104_0032205 | 3300048907 | Bacteria | 4878 |
| 817 | Ga0496104_0032453 | 3300048907 | Bacteria | 4860 |
| 818 | Ga0496104_0077033 | 3300048907 | Bacteria | 3177 |
| 819 | Ga0496104_0086587 | 3300048907 | Bacteria | 2991 |
| 820 | Ga0496104_0110711 | 3300048907 | Bacteria | 2632 |
| 821 | Ga0496104_0175946 | 3300048907 | Bacteria | 2050 |
| 822 | Ga0496105_0010093 | 3300048908 | Bacteria | 7415 |
| 823 | Ga0496105_0017656 | 3300048908 | Bacteria | 5723 |
| 824 | Ga0496105_0030416 | 3300048908 | Bacteria | 4424 |
| 825 | Ga0496105_0039608 | 3300048908 | Bacteria | 3884 |
| 826 | Ga0496105_0045225 | 3300048908 | Bacteria | 3632 |
| 827 | Ga0496105_0051601 | 3300048908 | Bacteria | 3398 |
| 828 | Ga0496105_0147278 | 3300048908 | Bacteria | 1936 |
| 829 | Ga0496105_0243614 | 3300048908 | Bacteria | 1458 |
| 830 | Ga0496106_0002185 | 3300048909 | Bacteria | 14611 |
| 831 | Ga0496106_0002661 | 3300048909 | Bacteria | 13293 |
| 832 | Ga0496106_0039568 | 3300048909 | Bacteria | 3531 |
| 833 | Ga0496106_0059857 | 3300048909 | Bacteria | 2886 |
| 834 | Ga0496106_0060539 | 3300048909 | Bacteria | 2870 |
| 835 | Ga0496106_0062439 | 3300048909 | Bacteria | 2828 |
| 836 | Ga0496106_0119200 | 3300048909 | Bacteria | 2061 |
| 837 | Ga0496106_0151220 | 3300048909 | Unclassified | 1831 |
| 838 | Ga0496106_0171433 | 3300048909 | Bacteria | 1720 |
| 839 | Ga0496107_0005021 | 3300048910 | Bacteria | 9014 |
| 840 | Ga0496107_0007982 | 3300048910 | Bacteria | 7305 |
| 841 | Ga0496107_0042731 | 3300048910 | Bacteria | 3255 |
| 842 | Ga0496107_0059642 | 3300048910 | Bacteria | 2761 |
| 843 | Ga0496107_0063686 | 3300048910 | Bacteria | 2672 |
| 844 | Ga0496107_0082326 | 3300048910 | Bacteria | 2347 |
| 845 | Ga0496107_0123007 | 3300048910 | Bacteria | 1912 |
| 846 | Ga0496107_0224208 | 3300048910 | Bacteria | 1398 |
| 847 | Ga0496107_0266786 | 3300048910 | Unclassified | 1274 |
| 848 | Ga0496108_0004716 | 3300048911 | Bacteria | 10994 |
| 849 | Ga0496108_0007288 | 3300048911 | Bacteria | 8967 |
| 850 | Ga0496108_0020178 | 3300048911 | Bacteria | 5476 |
| 851 | Ga0496108_0022285 | 3300048911 | Bacteria | 5208 |
| 852 | Ga0496108_0048722 | 3300048911 | Bacteria | 3543 |
| 853 | Ga0496108_0052007 | 3300048911 | Unclassified | 3432 |
| 854 | Ga0496108_0079257 | 3300048911 | Bacteria | 2780 |
| 855 | Ga0496108_0155726 | 3300048911 | Bacteria | 1973 |
| 856 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 857 | Ga0496109_0000937 | 3300048912 | Bacteria | 24155 |
| 858 | Ga0496109_0006180 | 3300048912 | Bacteria | 10066 |
| 859 | Ga0496109_0006447 | 3300048912 | Bacteria | 9883 |
| 860 | Ga0496109_0076359 | 3300048912 | Unclassified | 3081 |
| 861 | Ga0496109_0131284 | 3300048912 | Bacteria | 2338 |
| 862 | Ga0496109_0134090 | 3300048912 | Bacteria | 2313 |
| 863 | Ga0496109_0161236 | 3300048912 | Bacteria | 2101 |
| 864 | Ga0496110_0010267 | 3300048913 | Bacteria | 7609 |
| 865 | Ga0496110_0011374 | 3300048913 | Bacteria | 7281 |
| 866 | Ga0496110_0060950 | 3300048913 | Bacteria | 3328 |
| 867 | Ga0496110_0087623 | 3300048913 | Bacteria | 2780 |
| 868 | Ga0496110_0176013 | 3300048913 | Bacteria | 1942 |
| 869 | Ga0496110_0186075 | 3300048913 | Bacteria | 1886 |
| 870 | Ga0496111_0043412 | 3300048914 | Bacteria | 3231 |
| 871 | Ga0496111_0054114 | 3300048914 | Unclassified | 2900 |
| 872 | Ga0496111_0073899 | 3300048914 | Bacteria | 2482 |
| 873 | Ga0496111_0186421 | 3300048914 | Bacteria | 1542 |
| 874 | Ga0496111_0290393 | 3300048914 | Bacteria | 1213 |
| 875 | Ga0496112_0002119 | 3300048915 | Bacteria | 15754 |
| 876 | Ga0496112_0030238 | 3300048915 | Bacteria | 5240 |
| 877 | Ga0496112_0042689 | 3300048915 | Plasmid | 4437 |
| 878 | Ga0496112_0072283 | 3300048915 | Bacteria | 3409 |
| 879 | Ga0496112_0150683 | 3300048915 | Bacteria | 2293 |
| 880 | Ga0496112_0382388 | 3300048915 | Unclassified | 1348 |
| 881 | Ga0496112_0650680 | 3300048915 | Bacteria | 983 |
| 882 | Ga0496113_0007034 | 3300048916 | Bacteria | 7196 |
| 883 | Ga0496113_0008963 | 3300048916 | Bacteria | 6550 |
| 884 | Ga0496113_0036654 | 3300048916 | Bacteria | 3594 |
| 885 | Ga0496113_0094768 | 3300048916 | Unclassified | 2306 |
| 886 | Ga0496114_0001444 | 3300048917 | Bacteria | 18027 |
| 887 | Ga0496114_0056180 | 3300048917 | Bacteria | 3284 |
| 888 | Ga0496114_0067813 | 3300048917 | Unclassified | 2993 |
| 889 | Ga0496114_0108540 | 3300048917 | Bacteria | 2376 |
| 890 | Ga0496114_0147267 | 3300048917 | Unclassified | 2042 |
| 891 | Ga0496114_0243562 | 3300048917 | Bacteria | 1582 |
| 892 | Ga0496114_0256679 | 3300048917 | Bacteria | 1538 |
| 893 | Ga0496115_0010890 | 3300048918 | Bacteria | 6809 |
| 894 | Ga0496115_0011115 | 3300048918 | Bacteria | 6746 |
| 895 | Ga0496115_0023856 | 3300048918 | Bacteria | 4750 |
| 896 | Ga0496115_0024977 | 3300048918 | Bacteria | 4649 |
| 897 | Ga0496115_0052993 | 3300048918 | Bacteria | 3255 |
| 898 | Ga0496115_0061694 | 3300048918 | Bacteria | 3023 |
| 899 | Ga0496115_0062463 | 3300048918 | Unclassified | 3004 |
| 900 | Ga0496115_0116398 | 3300048918 | Bacteria | 2198 |
| 901 | Ga0496115_0309304 | 3300048918 | Bacteria | 1294 |
| 902 | Ga0501032_0032146 | 3300049569 | Bacteria | 3595 |
| 903 | Ga0501032_0127112 | 3300049569 | Bacteria | 1683 |
| 904 | Ga0501032_0161794 | 3300049569 | Bacteria | 1470 |
| 905 | Ga0501033_0022284 | 3300049570 | Bacteria | 4778 |
| 906 | Ga0501034_0041862 | 3300049571 | Bacteria | 4635 |
| 907 | Ga0501034_0062271 | 3300049571 | Bacteria | 3746 |
| 908 | Ga0501034_0075137 | 3300049571 | Bacteria | 3387 |
| 909 | Ga0501034_0079867 | 3300049571 | Bacteria | 3275 |
| 910 | Ga0501034_0496032 | 3300049571 | Bacteria | 1135 |
| 911 | Ga0501036_0075408 | 3300049572 | Bacteria | 2852 |
| 912 | Ga0501036_0133421 | 3300049572 | Bacteria | 2096 |
| 913 | Ga0501037_0008863 | 3300049573 | Bacteria | 7366 |
| 914 | Ga0501037_0153724 | 3300049573 | Bacteria | 1643 |
| 915 | Ga0501038_0091952 | 3300049574 | Bacteria | 2541 |
| 916 | Ga0501038_0365413 | 3300049574 | Unclassified | 1122 |
| 917 | Ga0501039_0066340 | 3300049575 | Bacteria | 2801 |
| 918 | Ga0501039_0072285 | 3300049575 | Bacteria | 2680 |
| 919 | Ga0501042_0018045 | 3300049578 | Bacteria | 4881 |
| 920 | Ga0501043_0058825 | 3300049579 | Bacteria | 3016 |
| 921 | Ga0501046_0008348 | 3300049580 | Bacteria | 9033 |
| 922 | Ga0501047_0005574 | 3300049581 | Bacteria | 11854 |
| 923 | Ga0501047_0020602 | 3300049581 | Bacteria | 6332 |
| 924 | Ga0501048_0011858 | 3300049582 | Bacteria | 6497 |
| 925 | Ga0501067_0019941 | 3300049583 | Bacteria | 3709 |
| 926 | Ga0501067_0029331 | 3300049583 | Bacteria | 3049 |
| 927 | Ga0501067_0083058 | 3300049583 | Bacteria | 1777 |
| 928 | Ga0501068_0021379 | 3300049584 | Bacteria | 3777 |
| 929 | Ga0501068_0084807 | 3300049584 | Bacteria | 1949 |
| 930 | Ga0501069_0008627 | 3300049585 | Bacteria | 5365 |
| 931 | Ga0501069_0050869 | 3300049585 | Unclassified | 2305 |
| 932 | Ga0501070_0037325 | 3300049586 | Bacteria | 4056 |
| 933 | Ga0501070_0039332 | 3300049586 | Bacteria | 3945 |
| 934 | Ga0501070_0042299 | 3300049586 | Bacteria | 3794 |
| 935 | Ga0501070_0335857 | 3300049586 | Bacteria | 1228 |
| 936 | Ga0501071_0045909 | 3300049587 | Bacteria | 3137 |
| 937 | Ga0501071_0150128 | 3300049587 | Bacteria | 1738 |
| 938 | Ga0501072_0025367 | 3300049588 | Bacteria | 4618 |
| 939 | Ga0501073_0052097 | 3300049589 | Bacteria | 2866 |
| 940 | Ga0501074_0060323 | 3300049590 | Bacteria | 2732 |
| 941 | Ga0501074_0066377 | 3300049590 | Bacteria | 2595 |
| 942 | Ga0501076_0019979 | 3300049592 | Bacteria | 5125 |
| 943 | Ga0501076_0106849 | 3300049592 | Bacteria | 2260 |
| 944 | Ga0501077_0044390 | 3300049593 | Bacteria | 2824 |
| 945 | Ga0501077_0053596 | 3300049593 | Unclassified | 2561 |
| 946 | Ga0501077_0059008 | 3300049593 | Bacteria | 2436 |
| 947 | Ga0501077_0104465 | 3300049593 | Bacteria | 1795 |
| 948 | Ga0501079_0029585 | 3300049741 | Bacteria | 4206 |
| 949 | Ga0501079_0104827 | 3300049741 | Bacteria | 2194 |
| 950 | Ga0501079_0181819 | 3300049741 | Bacteria | 1641 |
| 951 | Ga0501080_0137924 | 3300049742 | Bacteria | 2256 |
| 952 | Ga0501081_0077791 | 3300049743 | Bacteria | 2319 |
| 953 | Ga0501083_0142979 | 3300049744 | Bacteria | 1566 |
| 954 | Ga0501083_0147279 | 3300049744 | Bacteria | 1542 |
| 955 | Ga0501035_0096281 | 3300049822 | Bacteria | 2601 |
| 956 | Ga0501035_0161843 | 3300049822 | Bacteria | 1937 |
| 957 | Ga0501035_0255216 | 3300049822 | Unclassified | 1488 |
| 958 | Ga0501035_0277780 | 3300049822 | Bacteria | 1416 |
| 959 | Ga0501044_0000212 | 3300049823 | Bacteria | 73807 |
| 960 | Ga0501044_0075245 | 3300049823 | Bacteria | 3428 |
| 961 | Ga0501044_0115183 | 3300049823 | Bacteria | 2693 |
| 962 | Ga0501044_0586978 | 3300049823 | Unclassified | 1008 |
| 963 | nmdc:mga00v17_25398_c1 | 3300050491 | Bacteria | 3443 |
| 964 | nmdc:mga0yw44_13330_c1 | 3300050492 | Bacteria | 4325 |
| 965 | nmdc:mga0yw44_23092_c1 | 3300050492 | Bacteria | 3500 |
| 966 | nmdc:mga0yw44_72764_c1 | 3300050492 | Bacteria | 2137 |
| 967 | nmdc:mga06z11_129052_c1 | 3300050494 | Bacteria | 1418 |
| 968 | nmdc:mga07m45_64769_c1 | 3300050496 | Bacteria | 2074 |
| 969 | nmdc:mga05p37_22407_c1 | 3300050507 | Bacteria | 7662 |
| 970 | nmdc:mga05p37_249482_c1 | 3300050507 | Bacteria | 2130 |
| 971 | nmdc:mga05p37_40101_c1 | 3300050507 | Bacteria | 5750 |
| 972 | nmdc:mga05p37_436714_c1 | 3300050507 | Bacteria | 1183 |
| 973 | nmdc:mga05p37_505_c1 | 3300050507 | Bacteria | 42970 |
| 974 | nmdc:mga05p37_9120_c1 | 3300050507 | Bacteria | 11724 |
| 975 | nmdc:mga09592_772_c1 | 3300050508 | Bacteria | 24711 |
| 976 | nmdc:mga0qj67_165_c1 | 3300050509 | Bacteria | 44307 |
| 977 | nmdc:mga0qj67_64449_c1 | 3300050509 | Bacteria | 2914 |
| 978 | nmdc:mga06r32_212095_c1 | 3300050510 | Bacteria | 1924 |
| 979 | nmdc:mga06r32_272949_c1 | 3300050510 | Bacteria | 1678 |
| 980 | nmdc:mga06r32_363440_c1 | 3300050510 | Bacteria | 1431 |
| 981 | nmdc:mga06r32_6147_c1 | 3300050510 | Bacteria | 10781 |
| 982 | nmdc:mga06r32_660729_c1 | 3300050510 | Bacteria | 1013 |
| 983 | nmdc:mga06r32_78142_c1 | 3300050510 | Bacteria | 3216 |
| 984 | nmdc:mga08y16_1045_c1 | 3300050511 | Bacteria | 27157 |
| 985 | nmdc:mga08y16_12959_c1 | 3300050511 | Bacteria | 8773 |
| 986 | nmdc:mga08y16_19941_c1 | 3300050511 | Bacteria | 7074 |
| 987 | nmdc:mga08y16_264944_c1 | 3300050511 | Bacteria | 1774 |
| 988 | nmdc:mga08y16_2844_c1 | 3300050511 | Bacteria | 17794 |
| 989 | nmdc:mga08y16_333700_c1 | 3300050511 | Bacteria | 1559 |
| 990 | nmdc:mga08y16_497493_c1 | 3300050511 | Bacteria | 1239 |
| 991 | nmdc:mga0n895_122515_c1 | 3300050512 | Bacteria | 2622 |
| 992 | nmdc:mga0n895_189060_c1 | 3300050512 | Bacteria | 2090 |
| 993 | nmdc:mga0n895_24562_c1 | 3300050512 | Bacteria | 5681 |
| 994 | nmdc:mga0n895_2649_c1 | 3300050512 | Bacteria | 14116 |
| 995 | nmdc:mga0n895_45935_c1 | 3300050512 | Bacteria | 4265 |
| 996 | nmdc:mga0n895_597460_c1 | 3300050512 | Bacteria | 1106 |
| 997 | nmdc:mga0n895_613787_c1 | 3300050512 | Bacteria | 1089 |
| 998 | nmdc:mga0n895_76480_c1 | 3300050512 | Bacteria | 3329 |
| 999 | nmdc:mga0rr50_124153_c1 | 3300050513 | Bacteria | 2059 |
| 1000 | nmdc:mga0rr50_1278_c1 | 3300050513 | Bacteria | 13714 |
| 1001 | nmdc:mga0rr50_16037_c1 | 3300050513 | Bacteria | 4108 |
| 1002 | nmdc:mga0rr50_192693_c1 | 3300050513 | Unclassified | 1671 |
| 1003 | nmdc:mga08x19_211521_c1 | 3300050514 | Bacteria | 1331 |
| 1004 | nmdc:mga08x19_23872_c1 | 3300050514 | Bacteria | 3795 |
| 1005 | nmdc:mga08x19_95929_c1 | 3300050514 | Bacteria | 1962 |
| 1006 | nmdc:mga0a205_15415_c1 | 3300050515 | Bacteria | 7143 |
| 1007 | nmdc:mga0a205_1632_c1 | 3300050515 | Bacteria | 19295 |
| 1008 | nmdc:mga0a205_20147_c1 | 3300050515 | Bacteria | 6292 |
| 1009 | nmdc:mga0a205_237148_c1 | 3300050515 | Bacteria | 1706 |
| 1010 | nmdc:mga0a205_565274_c1 | 3300050515 | Bacteria | 992 |
| 1011 | nmdc:mga0a205_81954_c1 | 3300050515 | Bacteria | 3116 |
| 1012 | Ga0495601_0000075 | 3300053077 | Bacteria | 54434 |
| 1013 | Ga0495601_0000961 | 3300053077 | Bacteria | 15756 |
| 1014 | Ga0495601_0001420 | 3300053077 | Bacteria | 13193 |
| 1015 | Ga0495601_0018671 | 3300053077 | Bacteria | 4221 |
| 1016 | Ga0495601_0048186 | 3300053077 | Bacteria | 2684 |
| 1017 | Ga0495612_0001336 | 3300053078 | Bacteria | 10158 |
| 1018 | Ga0495612_0002112 | 3300053078 | Bacteria | 8162 |
| 1019 | Ga0495612_0006592 | 3300053078 | Bacteria | 4764 |
| 1020 | Ga0495612_0008176 | 3300053078 | Bacteria | 4251 |
| 1021 | Ga0495612_0009466 | 3300053078 | Unclassified | 3950 |
| 1022 | Ga0495655_0005569 | 3300053083 | Bacteria | 2234 |
| 1023 | Ga0495595_0004598 | 3300053084 | Bacteria | 5550 |
| 1024 | Ga0495595_0005026 | 3300053084 | Bacteria | 5341 |
| 1025 | Ga0495595_0005375 | 3300053084 | Bacteria | 5187 |
| 1026 | Ga0495595_0023737 | 3300053084 | Bacteria | 2703 |
| 1027 | Ga0495595_0034986 | 3300053084 | Unclassified | 2274 |
| 1028 | Ga0495619_0000211 | 3300053085 | Bacteria | 42390 |
| 1029 | Ga0495619_0000315 | 3300053085 | Bacteria | 33904 |
| 1030 | Ga0495619_0000907 | 3300053085 | Bacteria | 19405 |
| 1031 | Ga0495619_0005328 | 3300053085 | Bacteria | 8144 |
| 1032 | Ga0495619_0033900 | 3300053085 | Bacteria | 3317 |
| 1033 | Ga0495619_0060054 | 3300053085 | Bacteria | 2526 |
| 1034 | Ga0495619_0185501 | 3300053085 | Unclassified | 1439 |
| 1035 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1036 | Ga0501084_0033284 | 3300054114 | Bacteria | 4312 |
| 1037 | Ga0501084_0116228 | 3300054114 | Bacteria | 2249 |
| 1038 | Ga0501082_0010759 | 3300060353 | Bacteria | 7877 |
| 1039 | Ga0501082_0390742 | 3300060353 | Unclassified | 1214 |
| 1040 | Ga0530510_0323109 | 3300061734 | Unclassified | 1157 |
| 1041 | Ga0070711_100165148 | |||
| 1042 | 2214745210 | |||
| 1043 | ARcpr5oldR_c000144 | |||
| 1044 | ARSoilYngRDRAFT_c00009 | |||
| 1045 | ARcpr5yngRDRAFT_c000006 | |||
| 1046 | ARSoilOldRDRAFT_c000102 | |||
| 1047 | ARCol0oldRDRAFT_c00372 | |||
| 1048 | ARCol0yngRDRAFT_1000031 | |||
| 1049 | JGI24032J14994_100083 | |||
| 1050 | JGI24752J21851_1003042 | |||
| 1051 | JGI24746J21847_1002186 | |||
| 1052 | JGI24747J21853_1006367 | |||
| 1053 | JGI24739J22299_10001142 | |||
| 1054 | JGI24739J22299_10001990 | |||
| 1055 | JGI24737J22298_10001546 | |||
| 1056 | JGI24737J22298_10010151 | |||
| 1057 | JGI24743J22301_10026307 | |||
| 1058 | JGI24750J21931_1000491 | |||
| 1059 | JGI24738J21930_10000010 | |||
| 1060 | JGI24749J21850_1000579 | |||
| 1061 | JGI24744J21845_10006762 | |||
| 1062 | JGI24035J26624_1000653 | |||
| 1063 | JGI24033J26618_1000465 | |||
| 1064 | JGI24034J26672_10000494 | |||
| 1065 | JGI24742J22300_10000278 | |||
| 1066 | Ga0065717_1001969 | |||
| 1067 | Ga0065704_10076177 | |||
| 1068 | Ga0065712_10010165 | |||
| 1069 | Ga0065712_10082229 | |||
| 1070 | Ga0065712_10170888 | |||
| 1071 | Ga0065715_10089173 | |||
| 1072 | Ga0065715_10120090 | |||
| 1073 | Ga0070658_10026708 | |||
| 1074 | Ga0070676_10000978 | |||
| 1075 | Ga0070676_10090580 | |||
| 1076 | Ga0070683_100001166 | |||
| 1077 | Ga0070683_100215473 | |||
| 1078 | Ga0070690_100001038 | |||
| 1079 | Ga0070690_100015198 | |||
| 1080 | Ga0070690_100029526 | |||
| 1081 | Ga0070690_100042920 | |||
| 1082 | Ga0070670_100003635 | |||
| 1083 | Ga0070670_100012172 | |||
| 1084 | Ga0070670_100294418 | |||
| 1085 | Ga0070677_10000126 | |||
| 1086 | Ga0068869_100002872 | |||
| 1087 | Ga0068869_100122501 | |||
| 1088 | Ga0068869_100555603 | |||
| 1089 | Ga0070666_10007115 | |||
| 1090 | Ga0070666_10042300 | |||
| 1091 | Ga0070680_100003349 | |||
| 1092 | Ga0070680_100008343 | |||
| 1093 | Ga0070680_100041804 | |||
| 1094 | Ga0070680_100069911 | |||
| 1095 | Ga0070682_100000641 | |||
| 1096 | Ga0068868_100003027 | |||
| 1097 | Ga0070660_100002411 | |||
| 1098 | Ga0070660_100034540 | |||
| 1099 | Ga0070660_100049153 | |||
| 1100 | Ga0070660_100204578 | |||
| 1101 | Ga0070689_100004089 | |||
| 1102 | Ga0070689_100004527 | |||
| 1103 | Ga0070689_100040803 | |||
| 1104 | Ga0070691_10049070 | |||
| 1105 | Ga0070687_100000085 | |||
| 1106 | Ga0070687_100028353 | |||
| 1107 | Ga0070661_100000307 | |||
| 1108 | Ga0070661_100025875 | |||
| 1109 | Ga0070661_100105180 | |||
| 1110 | Ga0070661_100405484 | |||
| 1111 | Ga0070692_10003918 | |||
| 1112 | Ga0070692_10035591 | |||
| 1113 | Ga0070668_100001248 | |||
| 1114 | Ga0070668_100054836 | |||
| 1115 | Ga0070669_100000571 | |||
| 1116 | Ga0070675_100008609 | |||
| 1117 | Ga0070675_100020365 | |||
| 1118 | Ga0070675_100063073 | |||
| 1119 | Ga0070675_100246924 | |||
| 1120 | Ga0070671_100000104 | |||
| 1121 | Ga0070671_100072021 | |||
| 1122 | Ga0070674_100000238 | |||
| 1123 | Ga0070674_100035821 | |||
| 1124 | Ga0070674_100066460 | |||
| 1125 | Ga0070673_100000152 | |||
| 1126 | Ga0070673_100118963 | |||
| 1127 | Ga0070673_100136582 | |||
| 1128 | Ga0070688_100005902 | |||
| 1129 | Ga0070688_100008100 | |||
| 1130 | Ga0070688_100039619 | |||
| 1131 | Ga0070659_100000551 | |||
| 1132 | Ga0070659_100053119 | |||
| 1133 | Ga0070667_100009897 | |||
| 1134 | Ga0070667_100031049 | |||
| 1135 | Ga0070667_100054697 | |||
| 1136 | Ga0070667_100326336 | |||
| 1137 | Ga0070703_10004978 | |||
| 1138 | Ga0070709_10062929 | |||
| 1139 | Ga0070714_100045087 | |||
| 1140 | Ga0070714_100045879 | |||
| 1141 | Ga0070714_100151122 | |||
| 1142 | Ga0070714_100164539 | |||
| 1143 | Ga0070713_100007389 | |||
| 1144 | Ga0070713_100099207 | |||
| 1145 | Ga0070713_100135912 | |||
| 1146 | Ga0070713_100456005 | |||
| 1147 | Ga0070710_10041960 | |||
| 1148 | Ga0070710_10070468 | |||
| 1149 | Ga0070710_10103898 | |||
| 1150 | Ga0070701_10087275 | |||
| 1151 | Ga0070701_10190757 | |||
| 1152 | Ga0070711_100158736 | |||
| 1153 | Ga0070711_100300453 | |||
| 1154 | Ga0070705_100000148 | |||
| 1155 | Ga0070705_100066789 | |||
| 1156 | Ga0070705_100286652 | |||
| 1157 | Ga0070705_100349918 | |||
| 1158 | Ga0070700_100000277 | |||
| 1159 | Ga0070700_100031131 | |||
| 1160 | Ga0070694_100001507 | |||
| 1161 | Ga0070694_100016824 | |||
| 1162 | Ga0070694_100021063 | |||
| 1163 | Ga0070694_100073471 | |||
| 1164 | Ga0070708_100027462 | |||
| 1165 | Ga0070663_100000522 | |||
| 1166 | Ga0070663_100017769 | |||
| 1167 | Ga0070663_100028232 | |||
| 1168 | Ga0070663_100494731 | |||
| 1169 | Ga0070678_100000718 | |||
| 1170 | Ga0070678_100011460 | |||
| 1171 | Ga0070678_100042025 | |||
| 1172 | Ga0070662_100001666 | |||
| 1173 | Ga0070662_100015894 | |||
| 1174 | Ga0070662_100060423 | |||
| 1175 | Ga0070681_10014569 | |||
| 1176 | Ga0070681_10052540 | |||
| 1177 | Ga0070681_10306708 | |||
| 1178 | Ga0070681_10320548 | |||
| 1179 | Ga0068867_100006623 | |||
| 1180 | Ga0068867_100012024 | |||
| 1181 | Ga0070685_10002221 | |||
| 1182 | Ga0070685_10004005 | |||
| 1183 | Ga0070685_10024466 | |||
| 1184 | Ga0070706_100147399 | |||
| 1185 | Ga0070699_100011505 | |||
| 1186 | Ga0070699_100320219 | |||
| 1187 | Ga0070679_100014561 | |||
| 1188 | Ga0070679_100082633 | |||
| 1189 | Ga0070679_100397378 | |||
| 1190 | Ga0070684_100000894 | |||
| 1191 | Ga0070684_100127730 | |||
| 1192 | Ga0070684_100224857 | |||
| 1193 | Ga0070684_100750412 | |||
| 1194 | Ga0070697_100023189 | |||
| 1195 | Ga0070697_100174431 | |||
| 1196 | Ga0068853_100020627 | |||
| 1197 | Ga0068853_100191830 | |||
| 1198 | Ga0068853_100209643 | |||
| 1199 | Ga0070672_100000088 | |||
| 1200 | Ga0070672_100172591 | |||
| 1201 | Ga0070686_100000719 | |||
| 1202 | Ga0070686_100028453 | |||
| 1203 | Ga0070686_100029585 | |||
| 1204 | Ga0070686_100040116 | |||
| 1205 | Ga0070696_100020775 | |||
| 1206 | Ga0070696_100068057 | |||
| 1207 | Ga0070696_100227825 | |||
| 1208 | Ga0070693_100000134 | |||
| 1209 | Ga0070693_100151858 | |||
| 1210 | Ga0070665_100032403 | |||
| 1211 | Ga0070665_100144488 | |||
| 1212 | Ga0070665_100352336 | |||
| 1213 | Ga0070665_100469798 | |||
| 1214 | Ga0070704_100000428 | |||
| 1215 | Ga0070704_100027693 | |||
| 1216 | Ga0068855_100007545 | |||
| 1217 | Ga0068855_100031321 | |||
| 1218 | Ga0068855_100127457 | |||
| 1219 | Ga0068855_100203384 | |||
| 1220 | Ga0068855_100634939 | |||
| 1221 | Ga0070664_100002234 | |||
| 1222 | Ga0070664_100045631 | |||
| 1223 | Ga0070664_100097454 | |||
| 1224 | Ga0070664_100121692 | |||
| 1225 | Ga0068857_100002935 | |||
| 1226 | Ga0068857_100708826 | |||
| 1227 | Ga0068854_100308029 | |||
| 1228 | Ga0068856_100002000 | |||
| 1229 | Ga0068856_100307550 | |||
| 1230 | Ga0070702_100000638 | |||
| 1231 | Ga0070702_100002467 | |||
| 1232 | Ga0070702_100011329 | |||
| 1233 | Ga0070702_100023246 | |||
| 1234 | Ga0068852_100002115 | |||
| 1235 | Ga0068852_100077859 | |||
| 1236 | Ga0068859_100021325 | |||
| 1237 | Ga0068859_100080532 | |||
| 1238 | Ga0068859_100243543 | |||
| 1239 | Ga0068864_100014592 | |||
| 1240 | Ga0068866_10000301 | |||
| 1241 | Ga0068866_10002757 | |||
| 1242 | Ga0068866_10124413 | |||
| 1243 | Ga0068861_100016840 | |||
| 1244 | Ga0068861_100018418 | |||
| 1245 | Ga0068851_10058471 | |||
| 1246 | Ga0068870_10000354 | |||
| 1247 | Ga0068870_10001545 | |||
| 1248 | Ga0068863_100000340 | |||
| 1249 | Ga0068863_100018623 | |||
| 1250 | Ga0068863_100272427 | |||
| 1251 | Ga0068858_100000295 | |||
| 1252 | Ga0068858_100011371 | |||
| 1253 | Ga0068858_100025797 | |||
| 1254 | Ga0068858_100128333 | |||
| 1255 | Ga0068858_100160619 | |||
| 1256 | Ga0068860_100001285 | |||
| 1257 | Ga0068860_100084443 | |||
| 1258 | Ga0068862_100003236 | |||
| 1259 | Ga0068862_100012543 | |||
| 1260 | Ga0081455_10000007 | |||
| 1261 | Ga0081455_10001479 | |||
| 1262 | Ga0081455_10009018 | |||
| 1263 | Ga0081455_10017104 | |||
| 1264 | Ga0081455_10033388 | |||
| 1265 | Ga0081455_10143080 | |||
| 1266 | Ga0081538_10022998 | |||
| 1267 | Ga0070717_10007640 | |||
| 1268 | Ga0075365_10022333 | |||
| 1269 | Ga0075432_10000272 | |||
| 1270 | Ga0075432_10094683 | |||
| 1271 | Ga0070715_10005495 | |||
| 1272 | Ga0070716_100148747 | |||
| 1273 | Ga0070716_100251765 | |||
| 1274 | Ga0070712_100028432 | |||
| 1275 | Ga0070712_100061683 | |||
| 1276 | Ga0070712_100204349 | |||
| 1277 | Ga0075367_10049729 | |||
| 1278 | Ga0075366_10028947 | |||
| 1279 | Ga0097621_100000040 | |||
| 1280 | Ga0097621_100022646 | |||
| 1281 | Ga0097621_100053322 | |||
| 1282 | Ga0075370_10040679 | |||
| 1283 | Ga0068871_100000301 | |||
| 1284 | Ga0075428_100003180 | |||
| 1285 | Ga0075428_100015358 | |||
| 1286 | Ga0075428_100045005 | |||
| 1287 | Ga0075428_100100352 | |||
| 1288 | Ga0075428_100416948 | |||
| 1289 | Ga0075430_100000201 | |||
| 1290 | Ga0075431_100000260 | |||
| 1291 | Ga0075431_100329512 | |||
| 1292 | Ga0075431_100509470 | |||
| 1293 | Ga0075433_10000007 | |||
| 1294 | Ga0075433_10006753 | |||
| 1295 | Ga0075433_10009620 | |||
| 1296 | Ga0075433_10492088 | |||
| 1297 | Ga0075434_100000091 | |||
| 1298 | Ga0075434_100019587 | |||
| 1299 | Ga0075434_100067068 | |||
| 1300 | Ga0075434_100094300 | |||
| 1301 | Ga0075434_100183234 | |||
| 1302 | Ga0075429_100001824 | |||
| 1303 | Ga0068865_100000275 | |||
| 1304 | Ga0068865_100024369 | |||
| 1305 | Ga0068865_100050689 | |||
| 1306 | Ga0068865_100100150 | |||
| 1307 | Ga0075436_100039496 | |||
| 1308 | Ga0075436_100107605 | |||
| 1309 | Ga0097620_100021325 | |||
| 1310 | Ga0097620_100080540 | |||
| 1311 | Ga0097620_100243538 | |||
| 1312 | Ga0075435_100017727 | |||
| 1313 | Ga0075435_100040818 | |||
| 1314 | Ga0075435_100286057 | |||
| 1315 | Ga0099794_10046157 | |||
| 1316 | Ga0105251_10020085 | |||
| 1317 | Ga0105244_10133680 | |||
| 1318 | Ga0105250_10018576 | |||
| 1319 | Ga0105240_10646330 | |||
| 1320 | Ga0105240_10743379 | |||
| 1321 | Ga0111539_10000394 | |||
| 1322 | Ga0111539_10001672 | |||
| 1323 | Ga0111539_10017527 | |||
| 1324 | Ga0111539_10040786 | |||
| 1325 | Ga0111539_10109172 | |||
| 1326 | Ga0111539_10187414 | |||
| 1327 | Ga0111539_10409500 | |||
| 1328 | Ga0111539_10828611 | |||
| 1329 | Ga0105245_10000462 | |||
| 1330 | Ga0105245_10020090 | |||
| 1331 | Ga0105245_10350384 | |||
| 1332 | Ga0105247_10001920 | |||
| 1333 | Ga0105247_10022379 | |||
| 1334 | Ga0105247_10309243 | |||
| 1335 | Ga0114129_10001111 | |||
| 1336 | Ga0114129_10003047 | |||
| 1337 | Ga0114129_10007767 | |||
| 1338 | Ga0114129_10069532 | |||
| 1339 | Ga0114129_10991037 | |||
| 1340 | Ga0105243_10000282 | |||
| 1341 | Ga0105243_10030614 | |||
| 1342 | Ga0105243_10033566 | |||
| 1343 | Ga0105243_10123865 | |||
| 1344 | Ga0105241_10000652 | |||
| 1345 | Ga0105242_10011119 | |||
| 1346 | Ga0105242_10298969 | |||
| 1347 | Ga0105248_10011410 | |||
| 1348 | Ga0105248_10027731 | |||
| 1349 | Ga0105248_10093852 | |||
| 1350 | Ga0105248_10262268 | |||
| 1351 | Ga0105237_10043527 | |||
| 1352 | Ga0105237_10237597 | |||
| 1353 | Ga0105238_10713221 | |||
| 1354 | Ga0105249_10001210 | |||
| 1355 | Ga0105249_10071575 | |||
| 1356 | Ga0105249_10153953 | |||
| 1357 | Ga0105249_10173060 | |||
| 1358 | Ga0105249_10332376 | |||
| 1359 | Ga0105239_10028214 | |||
| 1360 | Ga0105239_10067368 | |||
| 1361 | Ga0105239_10154111 | |||
| 1362 | Ga0105239_10486636 | |||
| 1363 | Ga0105246_10009002 | |||
| 1364 | Ga0105246_10026829 | |||
| 1365 | Ga0105246_10122864 | |||
| 1366 | Ga0157346_1000445 | |||
| 1367 | Ga0157373_10010359 | |||
| 1368 | Ga0157371_10019421 | |||
| 1369 | Ga0157370_10164555 | |||
| 1370 | Ga0157374_10006038 | |||
| 1371 | Ga0157374_10120686 | |||
| 1372 | Ga0157374_10148398 | |||
| 1373 | Ga0157374_10195927 | |||
| 1374 | Ga0157378_10000270 | |||
| 1375 | Ga0157378_10494906 | |||
| 1376 | Ga0163162_10000145 | |||
| 1377 | Ga0163162_10143726 | |||
| 1378 | Ga0157372_10012191 | |||
| 1379 | Ga0157372_10254765 | |||
| 1380 | Ga0157375_10000332 | |||
| 1381 | Ga0157375_10009000 | |||
| 1382 | Ga0157375_10049349 | |||
| 1383 | Ga0157375_10748389 | |||
| 1384 | Ga0163163_10000865 | |||
| 1385 | Ga0163163_10005560 | |||
| 1386 | Ga0163163_10069639 | |||
| 1387 | Ga0163163_10768790 | |||
| 1388 | Ga0157380_10000891 | |||
| 1389 | Ga0157380_10059658 | |||
| 1390 | Ga0157380_10473230 | |||
| 1391 | Ga0157377_10000137 | |||
| 1392 | Ga0157377_10039626 | |||
| 1393 | Ga0157377_10128440 | |||
| 1394 | Ga0157379_10001761 | |||
| 1395 | Ga0157379_10012181 | |||
| 1396 | Ga0157379_10032861 | |||
| 1397 | Ga0157379_10071950 | |||
| 1398 | Ga0157376_10000088 | |||
| 1399 | Ga0157376_10083873 | |||
| 1400 | Ga0157376_10270273 | |||
| 1401 | Ga0157376_10422725 | |||
| 1402 | Ga0163161_10000144 | |||
| 1403 | Ga0163161_10049602 | |||
| 1404 | Ga0213876_10026729 | |||
| 1405 | Ga0228598_1007345 | |||
| 1406 | Ga0207666_1000048 | |||
| 1407 | Ga0207666_1000627 | |||
| 1408 | Ga0207697_10003423 | |||
| 1409 | Ga0207697_10014016 | |||
| 1410 | Ga0207713_1061801 | |||
| 1411 | Ga0207653_10015888 | |||
| 1412 | Ga0207653_10034319 | |||
| 1413 | Ga0207682_10000509 | |||
| 1414 | Ga0207692_10007140 | |||
| 1415 | Ga0207692_10052953 | |||
| 1416 | Ga0207692_10058464 | |||
| 1417 | Ga0207642_10000762 | |||
| 1418 | Ga0207642_10006361 | |||
| 1419 | Ga0207710_10003986 | |||
| 1420 | Ga0207688_10000033 | |||
| 1421 | Ga0207688_10004167 | |||
| 1422 | Ga0207680_10030693 | |||
| 1423 | Ga0207680_10035788 | |||
| 1424 | Ga0207680_10262312 | |||
| 1425 | Ga0207647_10020884 | |||
| 1426 | Ga0207699_10008794 | |||
| 1427 | Ga0207699_10186194 | |||
| 1428 | Ga0207645_10000100 | |||
| 1429 | Ga0207645_10087683 | |||
| 1430 | Ga0207643_10000007 | |||
| 1431 | Ga0207643_10000671 | |||
| 1432 | Ga0207705_10061675 | |||
| 1433 | Ga0207684_10023683 | |||
| 1434 | Ga0207654_10000314 | |||
| 1435 | Ga0207654_10152486 | |||
| 1436 | Ga0207707_10037222 | |||
| 1437 | Ga0207707_10079630 | |||
| 1438 | Ga0207707_10121335 | |||
| 1439 | Ga0207707_10216102 | |||
| 1440 | Ga0207707_10323939 | |||
| 1441 | Ga0207695_10146209 | |||
| 1442 | Ga0207671_10025600 | |||
| 1443 | Ga0207671_10095297 | |||
| 1444 | Ga0207693_10007799 | |||
| 1445 | Ga0207693_10026013 | |||
| 1446 | Ga0207693_10037280 | |||
| 1447 | Ga0207693_10042697 | |||
| 1448 | Ga0207663_10033165 | |||
| 1449 | Ga0207663_10122808 | |||
| 1450 | Ga0207663_10148936 | |||
| 1451 | Ga0207660_10000041 | |||
| 1452 | Ga0207660_10015546 | |||
| 1453 | Ga0207660_10032163 | |||
| 1454 | Ga0207660_10130351 | |||
| 1455 | Ga0207660_10165018 | |||
| 1456 | Ga0207660_10443574 | |||
| 1457 | Ga0207662_10000282 | |||
| 1458 | Ga0207662_10004598 | |||
| 1459 | Ga0207662_10018861 | |||
| 1460 | Ga0207662_10053389 | |||
| 1461 | Ga0207657_10009921 | |||
| 1462 | Ga0207657_10013952 | |||
| 1463 | Ga0207657_10022759 | |||
| 1464 | Ga0207657_10030177 | |||
| 1465 | Ga0207657_10046445 | |||
| 1466 | Ga0207657_10076831 | |||
| 1467 | Ga0207649_10001482 | |||
| 1468 | Ga0207649_10077097 | |||
| 1469 | Ga0207649_10097948 | |||
| 1470 | Ga0207649_10501719 | |||
| 1471 | Ga0207652_10002995 | |||
| 1472 | Ga0207652_10049186 | |||
| 1473 | Ga0207652_10077001 | |||
| 1474 | Ga0207652_10229057 | |||
| 1475 | Ga0207652_10229888 | |||
| 1476 | Ga0207652_10426192 | |||
| 1477 | Ga0207652_10428879 | |||
| 1478 | Ga0207681_10001546 | |||
| 1479 | Ga0207681_10412728 | |||
| 1480 | Ga0207694_10273369 | |||
| 1481 | Ga0207694_10344105 | |||
| 1482 | Ga0207650_10001317 | |||
| 1483 | Ga0207650_10015921 | |||
| 1484 | Ga0207659_10005767 | |||
| 1485 | Ga0207659_10019879 | |||
| 1486 | Ga0207659_10045708 | |||
| 1487 | Ga0207687_10000072 | |||
| 1488 | Ga0207687_10029549 | |||
| 1489 | Ga0207687_10105562 | |||
| 1490 | Ga0207687_10447810 | |||
| 1491 | Ga0207700_10001532 | |||
| 1492 | Ga0207700_10014414 | |||
| 1493 | Ga0207700_10062990 | |||
| 1494 | Ga0207664_10016973 | |||
| 1495 | Ga0207664_10092306 | |||
| 1496 | Ga0207664_10139891 | |||
| 1497 | Ga0207664_10326158 | |||
| 1498 | Ga0207644_10001292 | |||
| 1499 | Ga0207644_10221613 | |||
| 1500 | Ga0207690_10000140 | |||
| 1501 | Ga0207690_10070065 | |||
| 1502 | Ga0207690_10383322 | |||
| 1503 | Ga0207706_10002144 | |||
| 1504 | Ga0207706_10012048 | |||
| 1505 | Ga0207706_10042505 | |||
| 1506 | Ga0207706_10109084 | |||
| 1507 | Ga0207686_10001034 | |||
| 1508 | Ga0207686_10120810 | |||
| 1509 | Ga0207709_10001423 | |||
| 1510 | Ga0207709_10015190 | |||
| 1511 | Ga0207670_10005263 | |||
| 1512 | Ga0207670_10015623 | |||
| 1513 | Ga0207670_10066092 | |||
| 1514 | Ga0207669_10000176 | |||
| 1515 | Ga0207704_10000086 | |||
| 1516 | Ga0207704_10009100 | |||
| 1517 | Ga0207665_10000872 | |||
| 1518 | Ga0207665_10135014 | |||
| 1519 | Ga0207665_10159348 | |||
| 1520 | Ga0207665_10207106 | |||
| 1521 | Ga0207691_10000214 | |||
| 1522 | Ga0207691_10003307 | |||
| 1523 | Ga0207711_10001106 | |||
| 1524 | Ga0207711_10006359 | |||
| 1525 | Ga0207711_10036936 | |||
| 1526 | Ga0207689_10000366 | |||
| 1527 | Ga0207689_10114162 | |||
| 1528 | Ga0207689_10505602 | |||
| 1529 | Ga0207661_10000087 | |||
| 1530 | Ga0207661_10470341 | |||
| 1531 | Ga0207679_10000029 | |||
| 1532 | Ga0207679_10061554 | |||
| 1533 | Ga0207679_10090278 | |||
| 1534 | Ga0207667_10009257 | |||
| 1535 | Ga0207667_10255367 | |||
| 1536 | Ga0207667_10345730 | |||
| 1537 | Ga0207651_10000264 | |||
| 1538 | Ga0207651_10355951 | |||
| 1539 | Ga0207651_10411686 | |||
| 1540 | Ga0207712_10001547 | |||
| 1541 | Ga0207712_10013434 | |||
| 1542 | Ga0207712_10584713 | |||
| 1543 | Ga0207668_10005954 | |||
| 1544 | Ga0207640_10001474 | |||
| 1545 | Ga0207640_10046782 | |||
| 1546 | Ga0207658_10034469 | |||
| 1547 | Ga0207658_10274950 | |||
| 1548 | Ga0207658_10754531 | |||
| 1549 | Ga0207677_10001187 | |||
| 1550 | Ga0207677_10403070 | |||
| 1551 | Ga0207703_10003109 | |||
| 1552 | Ga0207703_10030388 | |||
| 1553 | Ga0207703_10262331 | |||
| 1554 | Ga0207639_10012878 | |||
| 1555 | Ga0207639_10096051 | |||
| 1556 | Ga0207639_10204912 | |||
| 1557 | Ga0207678_10011175 | |||
| 1558 | Ga0207678_10012004 | |||
| 1559 | Ga0207678_10038765 | |||
| 1560 | Ga0207678_10051057 | |||
| 1561 | Ga0207708_10000124 | |||
| 1562 | Ga0207708_10007956 | |||
| 1563 | Ga0207708_10025817 | |||
| 1564 | Ga0207641_10000476 | |||
| 1565 | Ga0207641_10183043 | |||
| 1566 | Ga0207648_10000072 | |||
| 1567 | Ga0207676_10000512 | |||
| 1568 | Ga0207674_10000697 | |||
| 1569 | Ga0207674_10228157 | |||
| 1570 | Ga0207674_10570773 | |||
| 1571 | Ga0207675_100005225 | |||
| 1572 | Ga0207675_100030237 | |||
| 1573 | Ga0207675_100171642 | |||
| 1574 | Ga0207683_10000029 | |||
| 1575 | Ga0207683_10010209 | |||
| 1576 | Ga0207683_10049139 | |||
| 1577 | Ga0207683_10058105 | |||
| 1578 | Ga0207698_10000523 | |||
| 1579 | Ga0207698_10006814 | |||
| 1580 | Ga0207698_10105850 | |||
| 1581 | Ga0209973_1002360 | |||
| 1582 | Ga0210002_1000355 | |||
| 1583 | Ga0209966_1012566 | |||
| 1584 | Ga0209998_10002116 | |||
| 1585 | Ga0209974_10002631 | |||
| 1586 | Ga0209974_10037946 | |||
| 1587 | Ga0207428_10000100 | |||
| 1588 | Ga0207428_10000115 | |||
| 1589 | Ga0207428_10000228 | |||
| 1590 | Ga0207428_10237846 | |||
| 1591 | Ga0268266_10127554 | |||
| 1592 | Ga0268266_10466338 | |||
| 1593 | Ga0268265_10001240 | |||
| 1594 | Ga0268265_10011857 | |||
| 1595 | Ga0268264_10002968 | |||
| 1596 | Ga0268264_10098649 | |||
| 1597 | Ga0265325_10000533 | |||
| 1598 | Ga0265340_10008415 | |||
| 1599 | Ga0265313_10010623 | |||
| 1600 | Ga0316579_10140845 | |||
| 1601 | Ga0265342_10000896 | |||
| 1602 | Ga0265342_10127184 | |||
| 1603 | Ga0373930_0000262 | |||
| 1604 | Ga0373930_0016837 | |||
| 1605 | Ga0373948_0003895 | |||
| 1606 | Ga0373948_0010128 | |||
| 1607 | Ga0373948_0024216 | |||
| 1608 | Ga0373950_0005031 | |||
| 1609 | Ga0373958_0001890 | |||
| 1610 | Ga0373958_0006596 | |||
| 1611 | Ga0373959_0003651 | |||
| 1612 | Ga0373959_0019894 | |||
| 1613 | Ga0373938_0000290 | |||
| 1614 | Ga0373938_0000662 | |||
| 1615 | Ga0373926_0090927 | |||
| 1616 | Ga0373928_0000789 | |||
| 1617 | Ga0373928_0006995 | |||
| 1618 | Ga0373928_0009522 | |||
| 1619 | Ga0373929_0002403 | |||
| 1620 | Ga0373929_0006971 | |||
| 1621 | Ga0373934_0046329 | |||
| 1622 | Ga0373940_0050600 | |||
| 1623 | Ga0373940_0071890 | |||
| 1624 | Ga0373949_0000938 | |||
| 1625 | Ga0373949_0001649 | |||
| 1626 | Ga0373951_0000715 | |||
| 1627 | Ga0373951_0005147 | |||
| 1628 | Ga0373951_0035857 | |||
| 1629 | Ga0373952_0000298 | |||
| 1630 | Ga0373952_0002466 | |||
| 1631 | Ga0373923_0054370 | |||
| 1632 | Ga0373932_0000172 | |||
| 1633 | Ga0373932_0008064 | |||
| 1634 | Ga0373936_0004177 | |||
| 1635 | Ga0373936_0059349 | |||
| 1636 | Ga0373936_0096497 | |||
| 1637 | Ga0373939_0000500 | |||
| 1638 | Ga0373939_0007393 | |||
| 1639 | Ga0373941_0001751 | |||
| 1640 | Ga0373941_0013482 | |||
| 1641 | Ga0373945_0002996 | |||
| 1642 | Ga0373945_0010893 | |||
| 1643 | Ga0373945_0076277 | |||
| 1644 | Ga0373953_0001475 | |||
| 1645 | Ga0373954_0050033 | |||
| 1646 | Ga0373956_0142721 | |||
| 1647 | Ga0373956_0181184 | |||
| 1648 | Ga0373957_0028243 | |||
| 1649 | Ga0373960_0001140 | |||
| 1650 | Ga0373960_0001458 | |||
| 1651 | Ga0373943_0015808 | |||
| 1652 | Ga0373943_0017540 | |||
| 1653 | Ga0373946_0021621 | |||
| 1654 | Ga0373955_0011599 | |||
| 1655 | Ga0373955_0023581 | |||
| 1656 | Ga0373955_0027187 | |||
| 1657 | Ga0373955_0107444 | |||
| 1658 | Ga0373955_0129822 | |||
| 1659 | Ga0373942_0001552 | |||
| 1660 | Ga0373961_0000196 | |||
| 1661 | Ga0373961_0001345 | |||
| 1662 | Ga0373961_0003263 | |||
| 1663 | Ga0373962_0000310 | |||
| 1664 | Ga0373962_0001593 | |||
| 1665 | Ga0373962_0071476 | |||
| 1666 | Ga0373924_0027636 | |||
| 1667 | Ga0373924_0071717 | |||
| 1668 | Ga0373931_0004010 | |||
| 1669 | Ga0373931_0008212 | |||
| 1670 | Ga0373931_0031253 | |||
| 1671 | Ga0373931_0032881 | |||
| 1672 | Ga0373931_0088107 | |||
| 1673 | Ga0373931_0164382 | |||
| 1674 | Ga0373935_0012655 | |||
| 1675 | Ga0373935_0020024 | |||
| 1676 | Ga0373927_0042280 | |||
| 1677 | Ga0373927_0095358 | |||
| 1678 | Ga0373927_0444526 | |||
| 1679 | Ga0373933_0001949 | |||
| 1680 | Ga0373933_0006597 | |||
| 1681 | Ga0373933_0008978 | |||
| 1682 | Ga0373933_0032120 | |||
| 1683 | Ga0373933_0162105 | |||
| 1684 | Ga0373947_0000288 | |||
| 1685 | Ga0373947_0008353 | |||
| 1686 | Ga0373947_0103872 | |||
| 1687 | Ga0373937_0005192 | |||
| 1688 | Ga0373937_0014259 | |||
| 1689 | Ga0373937_0025577 | |||
| 1690 | Ga0373937_0266689 | |||
| 1691 | Ga0373937_0286285 | |||
| 1692 | Ga0373925_0001787 | |||
| 1693 | Ga0373925_0007364 | |||
| 1694 | Ga0373925_0043674 | |||
| 1695 | Ga0373925_0173237 | |||
| 1696 | Ga0373925_0211362 | |||
| 1697 | Ga0395899_0223910 | |||
| 1698 | Ga0395898_0112889 | |||
| 1699 | Ga0395901_0057774 | |||
| 1700 | Ga0436365_1087995 | |||
| 1701 | Ga0439460_0007277 | |||
| 1702 | Ga0451577_0010248 | |||
| 1703 | Ga0495592_0009025 | |||
| 1704 | Ga0495592_0049987 | |||
| 1705 | Ga0495592_0262206 | |||
| 1706 | Ga0495603_0047130 | |||
| 1707 | Ga0495629_0000183 | |||
| 1708 | Ga0495629_0020325 | |||
| 1709 | Ga0495641_0016655 | |||
| 1710 | Ga0495641_0019503 | |||
| 1711 | Ga0495641_0052430 | |||
| 1712 | Ga0495651_0001256 | |||
| 1713 | Ga0495651_0004540 | |||
| 1714 | Ga0495651_0023671 | |||
| 1715 | Ga0495651_0064250 | |||
| 1716 | Ga0495653_0046543 | |||
| 1717 | Ga0495653_0057318 | |||
| 1718 | Ga0495653_0117328 | |||
| 1719 | Ga0495580_0080566 | |||
| 1720 | Ga0495580_0120946 | |||
| 1721 | Ga0495580_0123433 | |||
| 1722 | Ga0495582_0001748 | |||
| 1723 | Ga0495582_0002465 | |||
| 1724 | Ga0495582_0097571 | |||
| 1725 | Ga0495639_0015609 | |||
| 1726 | Ga0495662_0019936 | |||
| 1727 | Ga0495662_0052366 | |||
| 1728 | Ga0495664_0007322 | |||
| 1729 | Ga0495664_0007547 | |||
| 1730 | Ga0495664_0026199 | |||
| 1731 | Ga0495664_0071039 | |||
| 1732 | Ga0495584_0023574 | |||
| 1733 | Ga0495584_0065458 | |||
| 1734 | Ga0495585_0017046 | |||
| 1735 | Ga0495594_0068785 | |||
| 1736 | Ga0495594_0081400 | |||
| 1737 | Ga0495594_0087707 | |||
| 1738 | Ga0495607_0019505 | |||
| 1739 | Ga0495608_0000646 | |||
| 1740 | Ga0495608_0019174 | |||
| 1741 | Ga0495608_0073236 | |||
| 1742 | Ga0495618_0025077 | |||
| 1743 | Ga0495628_0001902 | |||
| 1744 | Ga0495628_0105447 | |||
| 1745 | Ga0495628_0246548 | |||
| 1746 | Ga0495630_0086143 | |||
| 1747 | Ga0495630_0137814 | |||
| 1748 | Ga0495637_0049397 | |||
| 1749 | Ga0495643_0132716 | |||
| 1750 | Ga0495644_0000234 | |||
| 1751 | Ga0495666_0019944 | |||
| 1752 | Ga0495652_0012330 | |||
| 1753 | Ga0495652_0039217 | |||
| 1754 | Ga0495652_0055115 | |||
| 1755 | Ga0495665_0039729 | |||
| 1756 | Ga0495640_0018843 | |||
| 1757 | Ga0495586_0102700 | |||
| 1758 | Ga0495587_0000770 | |||
| 1759 | Ga0495621_0082200 | |||
| 1760 | Ga0495645_0010241 | |||
| 1761 | Ga0495645_0067555 | |||
| 1762 | Ga0495645_0074432 | |||
| 1763 | Ga0495622_0026407 | |||
| 1764 | Ga0495622_0036966 | |||
| 1765 | Ga0495622_0115235 | |||
| 1766 | Ga0495633_0055300 | |||
| 1767 | Ga0495633_0132744 | |||
| 1768 | Ga0495667_0012785 | |||
| 1769 | Ga0495667_0013632 | |||
| 1770 | Ga0495667_0021370 | |||
| 1771 | Ga0495667_0231034 | |||
| 1772 | Ga0495656_0000502 | |||
| 1773 | Ga0495634_0005519 | |||
| 1774 | Ga0495634_0029394 | |||
| 1775 | Ga0495635_0000812 | |||
| 1776 | Ga0495635_0068842 | |||
| 1777 | Ga0495635_0078343 | |||
| 1778 | Ga0495635_0090134 | |||
| 1779 | Ga0495659_0019422 | |||
| 1780 | Ga0495661_0133436 | |||
| 1781 | Ga0495588_0018849 | |||
| 1782 | Ga0495588_0049139 | |||
| 1783 | Ga0495657_0005959 | |||
| 1784 | Ga0495657_0073198 | |||
| 1785 | Ga0495599_0003370 | |||
| 1786 | Ga0495623_0001381 | |||
| 1787 | Ga0495623_0007001 | |||
| 1788 | Ga0495646_0006169 | |||
| 1789 | Ga0495646_0101675 | |||
| 1790 | Ga0495646_0225582 | |||
| 1791 | Ga0495647_0010732 | |||
| 1792 | Ga0495658_0026339 | |||
| 1793 | Ga0495658_0033999 | |||
| 1794 | Ga0495658_0100438 | |||
| 1795 | Ga0495669_0025004 | |||
| 1796 | Ga0495613_0103367 | |||
| 1797 | Ga0495613_0174224 | |||
| 1798 | Ga0495624_0022854 | |||
| 1799 | Ga0495624_0040556 | |||
| 1800 | Ga0495624_0043892 | |||
| 1801 | Ga0495670_0001992 | |||
| 1802 | Ga0495600_0001477 | |||
| 1803 | Ga0495600_0071321 | |||
| 1804 | Ga0495600_0122193 | |||
| 1805 | Ga0495581_0129470 | |||
| 1806 | Ga0495604_0079050 | |||
| 1807 | Ga0495604_0093021 | |||
| 1808 | Ga0495674_0058715 | |||
| 1809 | Ga0495674_0147612 | |||
| 1810 | Ga0495674_0254663 | |||
| 1811 | Ga0495676_0031961 | |||
| 1812 | Ga0495676_0047264 | |||
| 1813 | Ga0495680_0006835 | |||
| 1814 | Ga0495680_0025234 | |||
| 1815 | Ga0495680_0045027 | |||
| 1816 | Ga0495680_0047807 | |||
| 1817 | Ga0495680_0150937 | |||
| 1818 | Ga0495675_0007988 | |||
| 1819 | Ga0495679_018405 | |||
| 1820 | Ga0495684_0008581 | |||
| 1821 | Ga0495684_0019509 | |||
| 1822 | Ga0495684_0140377 | |||
| 1823 | Ga0495684_0152115 | |||
| 1824 | Ga0495684_0248375 | |||
| 1825 | Ga0495684_0262639 | |||
| 1826 | Ga0495593_0011432 | |||
| 1827 | Ga0495602_0020689 | |||
| 1828 | Ga0495602_0195930 | |||
| 1829 | Ga0495614_0024203 | |||
| 1830 | Ga0495614_0052376 | |||
| 1831 | Ga0496100_0000530 | |||
| 1832 | Ga0496100_0011766 | |||
| 1833 | Ga0496100_0042055 | |||
| 1834 | Ga0496100_0055648 | |||
| 1835 | Ga0496100_0261903 | |||
| 1836 | Ga0496101_0000189 | |||
| 1837 | Ga0496101_0003519 | |||
| 1838 | Ga0496101_0024583 | |||
| 1839 | Ga0496101_0070644 | |||
| 1840 | Ga0496101_0338230 | |||
| 1841 | Ga0496101_0460570 | |||
| 1842 | Ga0496102_0006150 | |||
| 1843 | Ga0496102_0011115 | |||
| 1844 | Ga0496102_0022131 | |||
| 1845 | Ga0496102_0043206 | |||
| 1846 | Ga0496102_0052973 | |||
| 1847 | Ga0496102_0123061 | |||
| 1848 | Ga0496102_0664937 | |||
| 1849 | Ga0496103_0001693 | |||
| 1850 | Ga0496103_0006234 | |||
| 1851 | Ga0496103_0056304 | |||
| 1852 | Ga0496103_0124913 | |||
| 1853 | Ga0496104_0001051 | |||
| 1854 | Ga0496104_0001268 | |||
| 1855 | Ga0496104_0011783 | |||
| 1856 | Ga0496104_0032205 | |||
| 1857 | Ga0496104_0032453 | |||
| 1858 | Ga0496104_0077033 | |||
| 1859 | Ga0496104_0086587 | |||
| 1860 | Ga0496104_0110711 | |||
| 1861 | Ga0496104_0175946 | |||
| 1862 | Ga0496105_0010093 | |||
| 1863 | Ga0496105_0017656 | |||
| 1864 | Ga0496105_0030416 | |||
| 1865 | Ga0496105_0039608 | |||
| 1866 | Ga0496105_0045225 | |||
| 1867 | Ga0496105_0051601 | |||
| 1868 | Ga0496105_0147278 | |||
| 1869 | Ga0496105_0243614 | |||
| 1870 | Ga0496106_0002185 | |||
| 1871 | Ga0496106_0002661 | |||
| 1872 | Ga0496106_0039568 | |||
| 1873 | Ga0496106_0059857 | |||
| 1874 | Ga0496106_0060539 | |||
| 1875 | Ga0496106_0062439 | |||
| 1876 | Ga0496106_0119200 | |||
| 1877 | Ga0496106_0151220 | |||
| 1878 | Ga0496106_0171433 | |||
| 1879 | Ga0496107_0005021 | |||
| 1880 | Ga0496107_0007982 | |||
| 1881 | Ga0496107_0042731 | |||
| 1882 | Ga0496107_0059642 | |||
| 1883 | Ga0496107_0063686 | |||
| 1884 | Ga0496107_0082326 | |||
| 1885 | Ga0496107_0123007 | |||
| 1886 | Ga0496107_0224208 | |||
| 1887 | Ga0496107_0266786 | |||
| 1888 | Ga0496108_0004716 | |||
| 1889 | Ga0496108_0007288 | |||
| 1890 | Ga0496108_0020178 | |||
| 1891 | Ga0496108_0022285 | |||
| 1892 | Ga0496108_0048722 | |||
| 1893 | Ga0496108_0052007 | |||
| 1894 | Ga0496108_0079257 | |||
| 1895 | Ga0496108_0155726 | |||
| 1896 | Ga0496109_0000488 | |||
| 1897 | Ga0496109_0000937 | |||
| 1898 | Ga0496109_0006180 | |||
| 1899 | Ga0496109_0006447 | |||
| 1900 | Ga0496109_0076359 | |||
| 1901 | Ga0496109_0131284 | |||
| 1902 | Ga0496109_0134090 | |||
| 1903 | Ga0496109_0161236 | |||
| 1904 | Ga0496110_0010267 | |||
| 1905 | Ga0496110_0011374 | |||
| 1906 | Ga0496110_0060950 | |||
| 1907 | Ga0496110_0087623 | |||
| 1908 | Ga0496110_0176013 | |||
| 1909 | Ga0496110_0186075 | |||
| 1910 | Ga0496111_0043412 | |||
| 1911 | Ga0496111_0054114 | |||
| 1912 | Ga0496111_0073899 | |||
| 1913 | Ga0496111_0186421 | |||
| 1914 | Ga0496111_0290393 | |||
| 1915 | Ga0496112_0002119 | |||
| 1916 | Ga0496112_0030238 | |||
| 1917 | Ga0496112_0042689 | |||
| 1918 | Ga0496112_0072283 | |||
| 1919 | Ga0496112_0150683 | |||
| 1920 | Ga0496112_0382388 | |||
| 1921 | Ga0496112_0650680 | |||
| 1922 | Ga0496113_0007034 | |||
| 1923 | Ga0496113_0008963 | |||
| 1924 | Ga0496113_0036654 | |||
| 1925 | Ga0496113_0094768 | |||
| 1926 | Ga0496114_0001444 | |||
| 1927 | Ga0496114_0056180 | |||
| 1928 | Ga0496114_0067813 | |||
| 1929 | Ga0496114_0108540 | |||
| 1930 | Ga0496114_0147267 | |||
| 1931 | Ga0496114_0243562 | |||
| 1932 | Ga0496114_0256679 | |||
| 1933 | Ga0496115_0010890 | |||
| 1934 | Ga0496115_0011115 | |||
| 1935 | Ga0496115_0023856 | |||
| 1936 | Ga0496115_0024977 | |||
| 1937 | Ga0496115_0052993 | |||
| 1938 | Ga0496115_0061694 | |||
| 1939 | Ga0496115_0062463 | |||
| 1940 | Ga0496115_0116398 | |||
| 1941 | Ga0496115_0309304 | |||
| 1942 | Ga0501032_0032146 | |||
| 1943 | Ga0501032_0127112 | |||
| 1944 | Ga0501032_0161794 | |||
| 1945 | Ga0501033_0022284 | |||
| 1946 | Ga0501034_0041862 | |||
| 1947 | Ga0501034_0062271 | |||
| 1948 | Ga0501034_0075137 | |||
| 1949 | Ga0501034_0079867 | |||
| 1950 | Ga0501034_0496032 | |||
| 1951 | Ga0501036_0075408 | |||
| 1952 | Ga0501036_0133421 | |||
| 1953 | Ga0501037_0008863 | |||
| 1954 | Ga0501037_0153724 | |||
| 1955 | Ga0501038_0091952 | |||
| 1956 | Ga0501038_0365413 | |||
| 1957 | Ga0501039_0066340 | |||
| 1958 | Ga0501039_0072285 | |||
| 1959 | Ga0501042_0018045 | |||
| 1960 | Ga0501043_0058825 | |||
| 1961 | Ga0501046_0008348 | |||
| 1962 | Ga0501047_0005574 | |||
| 1963 | Ga0501047_0020602 | |||
| 1964 | Ga0501048_0011858 | |||
| 1965 | Ga0501067_0019941 | |||
| 1966 | Ga0501067_0029331 | |||
| 1967 | Ga0501067_0083058 | |||
| 1968 | Ga0501068_0021379 | |||
| 1969 | Ga0501068_0084807 | |||
| 1970 | Ga0501069_0008627 | |||
| 1971 | Ga0501069_0050869 | |||
| 1972 | Ga0501070_0037325 | |||
| 1973 | Ga0501070_0039332 | |||
| 1974 | Ga0501070_0042299 | |||
| 1975 | Ga0501070_0335857 | |||
| 1976 | Ga0501071_0045909 | |||
| 1977 | Ga0501071_0150128 | |||
| 1978 | Ga0501072_0025367 | |||
| 1979 | Ga0501073_0052097 | |||
| 1980 | Ga0501074_0060323 | |||
| 1981 | Ga0501074_0066377 | |||
| 1982 | Ga0501076_0019979 | |||
| 1983 | Ga0501076_0106849 | |||
| 1984 | Ga0501077_0044390 | |||
| 1985 | Ga0501077_0053596 | |||
| 1986 | Ga0501077_0059008 | |||
| 1987 | Ga0501077_0104465 | |||
| 1988 | Ga0501079_0029585 | |||
| 1989 | Ga0501079_0104827 | |||
| 1990 | Ga0501079_0181819 | |||
| 1991 | Ga0501080_0137924 | |||
| 1992 | Ga0501081_0077791 | |||
| 1993 | Ga0501083_0142979 | |||
| 1994 | Ga0501083_0147279 | |||
| 1995 | Ga0501035_0096281 | |||
| 1996 | Ga0501035_0161843 | |||
| 1997 | Ga0501035_0255216 | |||
| 1998 | Ga0501035_0277780 | |||
| 1999 | Ga0501044_0000212 | |||
| 2000 | Ga0501044_0075245 | |||
| 2001 | Ga0501044_0115183 | |||
| 2002 | Ga0501044_0586978 | |||
| 2003 | nmdc:mga00v17_25398_c1 | |||
| 2004 | nmdc:mga0yw44_13330_c1 | |||
| 2005 | nmdc:mga0yw44_23092_c1 | |||
| 2006 | nmdc:mga0yw44_72764_c1 | |||
| 2007 | nmdc:mga06z11_129052_c1 | |||
| 2008 | nmdc:mga07m45_64769_c1 | |||
| 2009 | nmdc:mga05p37_22407_c1 | |||
| 2010 | nmdc:mga05p37_249482_c1 | |||
| 2011 | nmdc:mga05p37_40101_c1 | |||
| 2012 | nmdc:mga05p37_436714_c1 | |||
| 2013 | nmdc:mga05p37_505_c1 | |||
| 2014 | nmdc:mga05p37_9120_c1 | |||
| 2015 | nmdc:mga09592_772_c1 | |||
| 2016 | nmdc:mga0qj67_165_c1 | |||
| 2017 | nmdc:mga0qj67_64449_c1 | |||
| 2018 | nmdc:mga06r32_212095_c1 | |||
| 2019 | nmdc:mga06r32_272949_c1 | |||
| 2020 | nmdc:mga06r32_363440_c1 | |||
| 2021 | nmdc:mga06r32_6147_c1 | |||
| 2022 | nmdc:mga06r32_660729_c1 | |||
| 2023 | nmdc:mga06r32_78142_c1 | |||
| 2024 | nmdc:mga08y16_1045_c1 | |||
| 2025 | nmdc:mga08y16_12959_c1 | |||
| 2026 | nmdc:mga08y16_19941_c1 | |||
| 2027 | nmdc:mga08y16_264944_c1 | |||
| 2028 | nmdc:mga08y16_2844_c1 | |||
| 2029 | nmdc:mga08y16_333700_c1 | |||
| 2030 | nmdc:mga08y16_497493_c1 | |||
| 2031 | nmdc:mga0n895_122515_c1 | |||
| 2032 | nmdc:mga0n895_189060_c1 | |||
| 2033 | nmdc:mga0n895_24562_c1 | |||
| 2034 | nmdc:mga0n895_2649_c1 | |||
| 2035 | nmdc:mga0n895_45935_c1 | |||
| 2036 | nmdc:mga0n895_597460_c1 | |||
| 2037 | nmdc:mga0n895_613787_c1 | |||
| 2038 | nmdc:mga0n895_76480_c1 | |||
| 2039 | nmdc:mga0rr50_124153_c1 | |||
| 2040 | nmdc:mga0rr50_1278_c1 | |||
| 2041 | nmdc:mga0rr50_16037_c1 | |||
| 2042 | nmdc:mga0rr50_192693_c1 | |||
| 2043 | nmdc:mga08x19_211521_c1 | |||
| 2044 | nmdc:mga08x19_23872_c1 | |||
| 2045 | nmdc:mga08x19_95929_c1 | |||
| 2046 | nmdc:mga0a205_15415_c1 | |||
| 2047 | nmdc:mga0a205_1632_c1 | |||
| 2048 | nmdc:mga0a205_20147_c1 | |||
| 2049 | nmdc:mga0a205_237148_c1 | |||
| 2050 | nmdc:mga0a205_565274_c1 | |||
| 2051 | nmdc:mga0a205_81954_c1 | |||
| 2052 | Ga0495601_0000075 | |||
| 2053 | Ga0495601_0000961 | |||
| 2054 | Ga0495601_0001420 | |||
| 2055 | Ga0495601_0018671 | |||
| 2056 | Ga0495601_0048186 | |||
| 2057 | Ga0495612_0001336 | |||
| 2058 | Ga0495612_0002112 | |||
| 2059 | Ga0495612_0006592 | |||
| 2060 | Ga0495612_0008176 | |||
| 2061 | Ga0495612_0009466 | |||
| 2062 | Ga0495655_0005569 | |||
| 2063 | Ga0495595_0004598 | |||
| 2064 | Ga0495595_0005026 | |||
| 2065 | Ga0495595_0005375 | |||
| 2066 | Ga0495595_0023737 | |||
| 2067 | Ga0495595_0034986 | |||
| 2068 | Ga0495619_0000211 | |||
| 2069 | Ga0495619_0000315 | |||
| 2070 | Ga0495619_0000907 | |||
| 2071 | Ga0495619_0005328 | |||
| 2072 | Ga0495619_0033900 | |||
| 2073 | Ga0495619_0060054 | |||
| 2074 | Ga0495619_0185501 | |||
| 2075 | Ga0500616_0000028 | |||
| 2076 | Ga0501084_0033284 | |||
| 2077 | Ga0501084_0116228 | |||
| 2078 | Ga0501082_0010759 | |||
| 2079 | Ga0501082_0390742 | |||
| 2080 | Ga0530510_0323109 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oge-assembly4.cif.gz_D | crystal structure of a nucleotide sugar transporter | 0.8272 | 2 | 280 |
| 5oge-assembly2.cif.gz_B | crystal structure of a nucleotide sugar transporter | 0.8195 | 2 | 280 |
| 5oge-assembly4.cif.gz_D | crystal structure of a nucleotide sugar transporter | 0.8194 | 2 | 280 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.8189 | 5 | 278 |
| 5oge-assembly3.cif.gz_H-2 | crystal structure of a nucleotide sugar transporter | 0.8182 | 2 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MX93_4_118_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8039 | 198 | 281 | 1.10.3730.20 |
| af_A0A0R0GBE4_5_124_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8008 | 197 | 281 | 1.10.3730.20 |
| af_Q8RWH8_5_118_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.7979 | 198 | 281 | 1.10.3730.20 |
| af_Q20583_6_327_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.731 | 5 | 280 | 1.20.1740.10 |
| af_Q20583_6_327_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7176 | 5 | 280 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V7H9D7-F1-model_v4 | EamA domain-containing protein | 0.9785 | 1 | 281 |
GO:0016020
|
| AF-A0A090DDL3-F1-model_v4 | EamA domain-containing protein | 0.9781 | 1 | 281 |
GO:0016020
|
| AF-A0A1I5ETQ7-F1-model_v4 | EamA-like transporter family protein | 0.9775 | 1 | 281 |
GO:0016020
|
| AF-A0A3Q8YGF5-F1-model_v4 | EamA family transporter | 0.9768 | 1 | 281 |
GO:0016020
|
| AF-A0A4U6C9U7-F1-model_v4 | EamA family transporter | 0.9762 | 1 | 281 |
GO:0016020
|