F488905
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1044 | 340 | 1044 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10830975|Ga0114129_108309752 |
| Length | 200 |
| Sequence | MSTSGRAGFARASVCAAHQLTRIDSDGLNRFGMIHGRFQPFHNGHLEYLRGAAARSDELFVGITNPDPTRVREEPSDPLRHLPESNPFTYSERLLMVAAVAEDEGIRAHVIPFPVNEPELWSAYVPAGVTQYLRLFSDWGETKLDRLREAGYEVVVLDEGTDKEISGNDVRAALRSGGDWESLVPPGVARVIKSLQRVTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 113 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 114 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 193 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 231 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 232 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 233 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 237 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 238 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 239 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 240 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.77 |
| Nodule | 0 |
| Rhizoplane | 12.16 |
| Rhizosphere | 86.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARCol0yngRDRAFT_1002586 | 3300000652 | Bacteria | 1357 |
| 2 | JGI24744J21845_10002375 | 3300002077 | Bacteria | 3838 |
| 3 | JGI24742J22300_10004954 | 3300002244 | Bacteria | 2186 |
| 4 | JGI25407J50210_10003405 | 3300003373 | Bacteria | 3800 |
| 5 | JGI25407J50210_10003428 | 3300003373 | Bacteria | 3792 |
| 6 | Ga0070676_10118106 | 3300005328 | Unclassified | 1661 |
| 7 | Ga0070676_10945731 | 3300005328 | Bacteria | 644 |
| 8 | Ga0070683_100116483 | 3300005329 | Bacteria | 2523 |
| 9 | Ga0070683_100501566 | 3300005329 | Archaea | 1159 |
| 10 | Ga0070683_101416551 | 3300005329 | Bacteria | 668 |
| 11 | Ga0070690_100037841 | 3300005330 | Bacteria | 3042 |
| 12 | Ga0070690_100086345 | 3300005330 | Unclassified | 2060 |
| 13 | Ga0068869_100182735 | 3300005334 | Unclassified | 1645 |
| 14 | Ga0070666_10031090 | 3300005335 | Bacteria | 3523 |
| 15 | Ga0070680_100005260 | 3300005336 | Bacteria | 9791 |
| 16 | Ga0070680_100757823 | 3300005336 | Unclassified | 836 |
| 17 | Ga0070682_100012384 | 3300005337 | Bacteria | 4890 |
| 18 | Ga0070682_100028428 | 3300005337 | Bacteria | 3362 |
| 19 | Ga0070682_100121836 | 3300005337 | Unclassified | 1752 |
| 20 | Ga0070682_100366460 | 3300005337 | Bacteria | 1079 |
| 21 | Ga0068868_100007477 | 3300005338 | Bacteria | 7780 |
| 22 | Ga0068868_100033702 | 3300005338 | Bacteria | 3949 |
| 23 | Ga0068868_100196786 | 3300005338 | Bacteria | 1678 |
| 24 | Ga0068868_100332674 | 3300005338 | Bacteria | 1297 |
| 25 | Ga0070660_100017417 | 3300005339 | Bacteria | 5237 |
| 26 | Ga0070660_100103703 | 3300005339 | Bacteria | 2256 |
| 27 | Ga0070660_100251912 | 3300005339 | Unclassified | 1440 |
| 28 | Ga0070689_100180337 | 3300005340 | Unclassified | 1715 |
| 29 | Ga0070691_10020515 | 3300005341 | Bacteria | 3053 |
| 30 | Ga0070691_10048520 | 3300005341 | Bacteria | 2021 |
| 31 | Ga0070691_10173078 | 3300005341 | Bacteria | 1120 |
| 32 | Ga0070687_100002213 | 3300005343 | Bacteria | 7207 |
| 33 | Ga0070687_100491928 | 3300005343 | Bacteria | 824 |
| 34 | Ga0070661_100327454 | 3300005344 | Bacteria | 1198 |
| 35 | Ga0070692_10039170 | 3300005345 | Bacteria | 2419 |
| 36 | Ga0070668_100013775 | 3300005347 | Bacteria | 6040 |
| 37 | Ga0070668_100103386 | 3300005347 | Bacteria | 2260 |
| 38 | Ga0070669_100049662 | 3300005353 | Bacteria | 3063 |
| 39 | Ga0070669_100119235 | 3300005353 | Unclassified | 2011 |
| 40 | Ga0070669_100136816 | 3300005353 | Unclassified | 1885 |
| 41 | Ga0070671_100019046 | 3300005355 | Bacteria | 5583 |
| 42 | Ga0070671_100160733 | 3300005355 | Unclassified | 1899 |
| 43 | Ga0070671_100501361 | 3300005355 | Bacteria | 1044 |
| 44 | Ga0070674_100007121 | 3300005356 | Bacteria | 6578 |
| 45 | Ga0070674_100061048 | 3300005356 | Bacteria | 2629 |
| 46 | Ga0070674_100785521 | 3300005356 | Unclassified | 821 |
| 47 | Ga0070673_100111008 | 3300005364 | Bacteria | 2274 |
| 48 | Ga0070673_100436543 | 3300005364 | Bacteria | 1176 |
| 49 | Ga0070688_100027191 | 3300005365 | Bacteria | 3406 |
| 50 | Ga0070659_100006017 | 3300005366 | Bacteria | 8749 |
| 51 | Ga0070667_100807062 | 3300005367 | Unclassified | 871 |
| 52 | Ga0070703_10016248 | 3300005406 | Bacteria | 2135 |
| 53 | Ga0070703_10046578 | 3300005406 | Bacteria | 1371 |
| 54 | Ga0070703_10274980 | 3300005406 | Unclassified | 693 |
| 55 | Ga0070709_10172234 | 3300005434 | Bacteria | 1513 |
| 56 | Ga0070709_10233108 | 3300005434 | Bacteria | 1318 |
| 57 | Ga0070709_10247637 | 3300005434 | Bacteria | 1282 |
| 58 | Ga0070714_100043410 | 3300005435 | Bacteria | 3802 |
| 59 | Ga0070713_100030152 | 3300005436 | Bacteria | 4304 |
| 60 | Ga0070713_100140964 | 3300005436 | Unclassified | 2135 |
| 61 | Ga0070713_100146039 | 3300005436 | Archaea | 2100 |
| 62 | Ga0070713_100199280 | 3300005436 | Bacteria | 1807 |
| 63 | Ga0070713_100547983 | 3300005436 | Bacteria | 1095 |
| 64 | Ga0070710_10007964 | 3300005437 | Bacteria | 5151 |
| 65 | Ga0070710_10011401 | 3300005437 | Bacteria | 4391 |
| 66 | Ga0070710_10015753 | 3300005437 | Bacteria | 3833 |
| 67 | Ga0070710_10807793 | 3300005437 | Unclassified | 670 |
| 68 | Ga0070701_10143856 | 3300005438 | Bacteria | 1367 |
| 69 | Ga0070701_10407624 | 3300005438 | Bacteria | 863 |
| 70 | Ga0070701_10578796 | 3300005438 | Bacteria | 741 |
| 71 | Ga0070711_100044986 | 3300005439 | Bacteria | 2999 |
| 72 | Ga0070711_100088282 | 3300005439 | Bacteria | 2228 |
| 73 | Ga0070711_100154294 | 3300005439 | Unclassified | 1735 |
| 74 | Ga0070711_100308387 | 3300005439 | Bacteria | 1261 |
| 75 | Ga0070711_100758533 | 3300005439 | Unclassified | 820 |
| 76 | Ga0070705_100006285 | 3300005440 | Bacteria | 5821 |
| 77 | Ga0070705_100017233 | 3300005440 | Bacteria | 3768 |
| 78 | Ga0070705_100023676 | 3300005440 | Bacteria | 3302 |
| 79 | Ga0070705_100065951 | 3300005440 | Bacteria | 2169 |
| 80 | Ga0070705_100152479 | 3300005440 | Unclassified | 1535 |
| 81 | Ga0070705_100243093 | 3300005440 | Archaea | 1259 |
| 82 | Ga0070705_100628299 | 3300005440 | Unclassified | 834 |
| 83 | Ga0070705_101047777 | 3300005440 | Unclassified | 665 |
| 84 | Ga0070705_101370163 | 3300005440 | Unclassified | 589 |
| 85 | Ga0070700_100002719 | 3300005441 | Bacteria | 9037 |
| 86 | Ga0070700_100323038 | 3300005441 | Bacteria | 1135 |
| 87 | Ga0070700_100566038 | 3300005441 | Bacteria | 885 |
| 88 | Ga0070694_100010676 | 3300005444 | Bacteria | 5675 |
| 89 | Ga0070694_100093215 | 3300005444 | Bacteria | 2117 |
| 90 | Ga0070694_100155948 | 3300005444 | Bacteria | 1671 |
| 91 | Ga0070694_100193476 | 3300005444 | Unclassified | 1512 |
| 92 | Ga0070694_100825827 | 3300005444 | Bacteria | 761 |
| 93 | Ga0070708_100010130 | 3300005445 | Bacteria | 7628 |
| 94 | Ga0070708_100033519 | 3300005445 | Bacteria | 4462 |
| 95 | Ga0070708_100065685 | 3300005445 | Bacteria | 3254 |
| 96 | Ga0070708_100228256 | 3300005445 | Bacteria | 1747 |
| 97 | Ga0070708_100234230 | 3300005445 | Bacteria | 1723 |
| 98 | Ga0070708_100335223 | 3300005445 | Bacteria | 1425 |
| 99 | Ga0070708_100409001 | 3300005445 | Unclassified | 1279 |
| 100 | Ga0070708_100629584 | 3300005445 | Unclassified | 1011 |
| 101 | Ga0070708_100698584 | 3300005445 | Unclassified | 955 |
| 102 | Ga0070708_100971799 | 3300005445 | Unclassified | 796 |
| 103 | Ga0070663_100003020 | 3300005455 | Bacteria | 9610 |
| 104 | Ga0070663_100032578 | 3300005455 | Bacteria | 3594 |
| 105 | Ga0070663_101323503 | 3300005455 | Unclassified | 636 |
| 106 | Ga0070678_100004375 | 3300005456 | Bacteria | 8000 |
| 107 | Ga0070678_100116013 | 3300005456 | Bacteria | 2103 |
| 108 | Ga0070678_100526519 | 3300005456 | Unclassified | 1046 |
| 109 | Ga0070662_100034736 | 3300005457 | Bacteria | 3556 |
| 110 | Ga0070662_100426494 | 3300005457 | Bacteria | 1098 |
| 111 | Ga0070662_100633830 | 3300005457 | Bacteria | 901 |
| 112 | Ga0070681_10544258 | 3300005458 | Bacteria | 1075 |
| 113 | Ga0068867_100005708 | 3300005459 | Bacteria | 8823 |
| 114 | Ga0068867_100009137 | 3300005459 | Bacteria | 6993 |
| 115 | Ga0068867_100528928 | 3300005459 | Bacteria | 1018 |
| 116 | Ga0068867_100734118 | 3300005459 | Bacteria | 874 |
| 117 | Ga0070685_10064227 | 3300005466 | Bacteria | 2158 |
| 118 | Ga0070685_10105360 | 3300005466 | Unclassified | 1728 |
| 119 | Ga0070685_10144724 | 3300005466 | Bacteria | 1500 |
| 120 | Ga0070706_100009405 | 3300005467 | Bacteria | 9100 |
| 121 | Ga0070706_100015165 | 3300005467 | Bacteria | 7116 |
| 122 | Ga0070706_100019076 | 3300005467 | Bacteria | 6327 |
| 123 | Ga0070706_100087090 | 3300005467 | Bacteria | 2895 |
| 124 | Ga0070706_100103080 | 3300005467 | Bacteria | 2653 |
| 125 | Ga0070706_100185132 | 3300005467 | Bacteria | 1946 |
| 126 | Ga0070707_100001783 | 3300005468 | Bacteria | 20715 |
| 127 | Ga0070707_100024924 | 3300005468 | Bacteria | 5671 |
| 128 | Ga0070707_100070727 | 3300005468 | Bacteria | 3361 |
| 129 | Ga0070707_100071604 | 3300005468 | Bacteria | 3340 |
| 130 | Ga0070707_100165466 | 3300005468 | Bacteria | 2155 |
| 131 | Ga0070707_100174490 | 3300005468 | Bacteria | 2095 |
| 132 | Ga0070707_100877839 | 3300005468 | Bacteria | 861 |
| 133 | Ga0070698_100003764 | 3300005471 | Bacteria | 16676 |
| 134 | Ga0070698_100011310 | 3300005471 | Bacteria | 9475 |
| 135 | Ga0070698_100016699 | 3300005471 | Bacteria | 7745 |
| 136 | Ga0070698_100304001 | 3300005471 | Unclassified | 1526 |
| 137 | Ga0070698_100425874 | 3300005471 | Bacteria | 1262 |
| 138 | Ga0070698_100485650 | 3300005471 | Bacteria | 1172 |
| 139 | Ga0070698_100567355 | 3300005471 | Bacteria | 1075 |
| 140 | Ga0070698_101115739 | 3300005471 | Unclassified | 737 |
| 141 | Ga0070699_100048536 | 3300005518 | Bacteria | 3674 |
| 142 | Ga0070699_100080796 | 3300005518 | Bacteria | 2833 |
| 143 | Ga0070699_100101562 | 3300005518 | Bacteria | 2521 |
| 144 | Ga0070699_100267627 | 3300005518 | Bacteria | 1529 |
| 145 | Ga0070679_100048241 | 3300005530 | Bacteria | 4243 |
| 146 | Ga0070679_100105399 | 3300005530 | Bacteria | 2806 |
| 147 | Ga0070679_100185002 | 3300005530 | Bacteria | 2055 |
| 148 | Ga0070684_100034381 | 3300005535 | Bacteria | 4334 |
| 149 | Ga0070684_100045720 | 3300005535 | Bacteria | 3791 |
| 150 | Ga0070684_100076939 | 3300005535 | Bacteria | 2946 |
| 151 | Ga0070684_100082189 | 3300005535 | Bacteria | 2852 |
| 152 | Ga0070684_100172646 | 3300005535 | Bacteria | 1964 |
| 153 | Ga0070684_100295315 | 3300005535 | Bacteria | 1486 |
| 154 | Ga0070697_100080962 | 3300005536 | Unclassified | 2676 |
| 155 | Ga0070697_100124922 | 3300005536 | Unclassified | 2155 |
| 156 | Ga0070697_100307182 | 3300005536 | Bacteria | 1364 |
| 157 | Ga0068853_100003873 | 3300005539 | Bacteria | 11466 |
| 158 | Ga0068853_100931623 | 3300005539 | Bacteria | 835 |
| 159 | Ga0070672_100158034 | 3300005543 | Bacteria | 1879 |
| 160 | Ga0070672_100218507 | 3300005543 | Bacteria | 1598 |
| 161 | Ga0070686_100000943 | 3300005544 | Bacteria | 16754 |
| 162 | Ga0070686_100313735 | 3300005544 | Bacteria | 1167 |
| 163 | Ga0070686_100573985 | 3300005544 | Unclassified | 885 |
| 164 | Ga0070695_100012438 | 3300005545 | Bacteria | 5107 |
| 165 | Ga0070695_100135041 | 3300005545 | Unclassified | 1704 |
| 166 | Ga0070695_100196576 | 3300005545 | Bacteria | 1438 |
| 167 | Ga0070695_100348663 | 3300005545 | Bacteria | 1108 |
| 168 | Ga0070696_100007393 | 3300005546 | Bacteria | 7340 |
| 169 | Ga0070696_100012491 | 3300005546 | Bacteria | 5699 |
| 170 | Ga0070696_100160931 | 3300005546 | Bacteria | 1654 |
| 171 | Ga0070696_100359865 | 3300005546 | Unclassified | 1129 |
| 172 | Ga0070696_100411692 | 3300005546 | Bacteria | 1060 |
| 173 | Ga0070693_100031739 | 3300005547 | Bacteria | 2899 |
| 174 | Ga0070693_100045336 | 3300005547 | Bacteria | 2492 |
| 175 | Ga0070693_100336732 | 3300005547 | Bacteria | 1029 |
| 176 | Ga0070665_100105153 | 3300005548 | Bacteria | 2825 |
| 177 | Ga0070704_100019935 | 3300005549 | Bacteria | 4315 |
| 178 | Ga0070704_100046083 | 3300005549 | Bacteria | 3038 |
| 179 | Ga0070704_100054858 | 3300005549 | Bacteria | 2822 |
| 180 | Ga0070704_100099335 | 3300005549 | Bacteria | 2189 |
| 181 | Ga0070704_100182344 | 3300005549 | Bacteria | 1680 |
| 182 | Ga0070704_100325996 | 3300005549 | Unclassified | 1288 |
| 183 | Ga0070704_100383010 | 3300005549 | Bacteria | 1195 |
| 184 | Ga0070704_100702712 | 3300005549 | Bacteria | 897 |
| 185 | Ga0068855_100129831 | 3300005563 | Bacteria | 2879 |
| 186 | Ga0068855_100164430 | 3300005563 | Bacteria | 2516 |
| 187 | Ga0068855_100185558 | 3300005563 | Bacteria | 2349 |
| 188 | Ga0068855_100297477 | 3300005563 | Bacteria | 1788 |
| 189 | Ga0068855_101140718 | 3300005563 | Bacteria | 813 |
| 190 | Ga0070664_100231336 | 3300005564 | Bacteria | 1657 |
| 191 | Ga0068857_100002049 | 3300005577 | Bacteria | 16363 |
| 192 | Ga0068857_100330839 | 3300005577 | Bacteria | 1408 |
| 193 | Ga0068854_100114950 | 3300005578 | Bacteria | 2035 |
| 194 | Ga0068854_100145231 | 3300005578 | Unclassified | 1824 |
| 195 | Ga0068854_100405474 | 3300005578 | Unclassified | 1129 |
| 196 | Ga0068856_100024228 | 3300005614 | Bacteria | 5905 |
| 197 | Ga0068856_100104638 | 3300005614 | Bacteria | 2824 |
| 198 | Ga0068856_100126707 | 3300005614 | Bacteria | 2557 |
| 199 | Ga0068856_100286257 | 3300005614 | Bacteria | 1665 |
| 200 | Ga0068856_101335245 | 3300005614 | Unclassified | 732 |
| 201 | Ga0070702_100018435 | 3300005615 | Bacteria | 3622 |
| 202 | Ga0070702_100021765 | 3300005615 | Bacteria | 3380 |
| 203 | Ga0070702_100048163 | 3300005615 | Bacteria | 2425 |
| 204 | Ga0070702_100484537 | 3300005615 | Unclassified | 905 |
| 205 | Ga0070702_100686655 | 3300005615 | Unclassified | 779 |
| 206 | Ga0068852_101040223 | 3300005616 | Unclassified | 838 |
| 207 | Ga0068852_101279306 | 3300005616 | Bacteria | 755 |
| 208 | Ga0068859_100227040 | 3300005617 | Unclassified | 1955 |
| 209 | Ga0068864_100061528 | 3300005618 | Unclassified | 3252 |
| 210 | Ga0068864_100857961 | 3300005618 | Unclassified | 895 |
| 211 | Ga0068866_10000764 | 3300005718 | Bacteria | 14510 |
| 212 | Ga0068866_10003892 | 3300005718 | Bacteria | 6124 |
| 213 | Ga0068866_10080015 | 3300005718 | Unclassified | 1752 |
| 214 | Ga0068866_10229353 | 3300005718 | Bacteria | 1125 |
| 215 | Ga0068866_10401324 | 3300005718 | Unclassified | 884 |
| 216 | Ga0068861_100007355 | 3300005719 | Bacteria | 7544 |
| 217 | Ga0068861_100036976 | 3300005719 | Bacteria | 3628 |
| 218 | Ga0068861_100261204 | 3300005719 | Unclassified | 1482 |
| 219 | Ga0068861_101212676 | 3300005719 | Bacteria | 730 |
| 220 | Ga0068851_10455192 | 3300005834 | Bacteria | 761 |
| 221 | Ga0068870_10177054 | 3300005840 | Unclassified | 1277 |
| 222 | Ga0068870_10436417 | 3300005840 | Archaea | 860 |
| 223 | Ga0068863_100254394 | 3300005841 | Bacteria | 1697 |
| 224 | Ga0068860_100127996 | 3300005843 | Bacteria | 2435 |
| 225 | Ga0068860_101186207 | 3300005843 | Unclassified | 784 |
| 226 | Ga0068862_100100731 | 3300005844 | Bacteria | 2526 |
| 227 | Ga0068862_100128802 | 3300005844 | Unclassified | 2237 |
| 228 | Ga0068862_100238724 | 3300005844 | Bacteria | 1652 |
| 229 | Ga0068862_100353747 | 3300005844 | Unclassified | 1363 |
| 230 | Ga0081455_10001632 | 3300005937 | Bacteria | 27349 |
| 231 | Ga0081455_10010980 | 3300005937 | Bacteria | 9129 |
| 232 | Ga0081455_10020369 | 3300005937 | Bacteria | 6247 |
| 233 | Ga0081455_10073252 | 3300005937 | Bacteria | 2833 |
| 234 | Ga0081455_10355952 | 3300005937 | Bacteria | 1031 |
| 235 | Ga0081455_10704161 | 3300005937 | Bacteria | 643 |
| 236 | Ga0081538_10001314 | 3300005981 | Bacteria | 25660 |
| 237 | Ga0081538_10003640 | 3300005981 | Bacteria | 14490 |
| 238 | Ga0081538_10004394 | 3300005981 | Bacteria | 13016 |
| 239 | Ga0081538_10009243 | 3300005981 | Bacteria | 8256 |
| 240 | Ga0081538_10083532 | 3300005981 | Bacteria | 1687 |
| 241 | Ga0081538_10134011 | 3300005981 | Unclassified | 1158 |
| 242 | Ga0081540_1001832 | 3300005983 | Bacteria | 17820 |
| 243 | Ga0081540_1003731 | 3300005983 | Bacteria | 11937 |
| 244 | Ga0081540_1010067 | 3300005983 | Bacteria | 6437 |
| 245 | Ga0081540_1067503 | 3300005983 | Bacteria | 1671 |
| 246 | Ga0081539_10001744 | 3300005985 | Bacteria | 34702 |
| 247 | Ga0081539_10020490 | 3300005985 | Bacteria | 4466 |
| 248 | Ga0070717_10079377 | 3300006028 | Bacteria | 2752 |
| 249 | Ga0070717_10090381 | 3300006028 | Bacteria | 2584 |
| 250 | Ga0070717_10132606 | 3300006028 | Unclassified | 2144 |
| 251 | Ga0075365_10079265 | 3300006038 | Bacteria | 2222 |
| 252 | Ga0075365_10153619 | 3300006038 | Bacteria | 1602 |
| 253 | Ga0075364_10141501 | 3300006051 | Bacteria | 1618 |
| 254 | Ga0075432_10014738 | 3300006058 | Bacteria | 2663 |
| 255 | Ga0075432_10094351 | 3300006058 | Unclassified | 1099 |
| 256 | Ga0070715_10005627 | 3300006163 | Bacteria | 4194 |
| 257 | Ga0070715_10388258 | 3300006163 | Unclassified | 772 |
| 258 | Ga0070716_100001535 | 3300006173 | Bacteria | 10347 |
| 259 | Ga0070712_100022142 | 3300006175 | Bacteria | 4182 |
| 260 | Ga0070712_100024834 | 3300006175 | Bacteria | 3976 |
| 261 | Ga0070712_100033859 | 3300006175 | Bacteria | 3459 |
| 262 | Ga0070712_100269885 | 3300006175 | Bacteria | 1366 |
| 263 | Ga0075366_10125474 | 3300006195 | Bacteria | 1548 |
| 264 | Ga0068871_100012207 | 3300006358 | Bacteria | 6326 |
| 265 | Ga0068871_100056236 | 3300006358 | Unclassified | 3197 |
| 266 | Ga0075428_100105525 | 3300006844 | Bacteria | 3072 |
| 267 | Ga0075428_100121597 | 3300006844 | Unclassified | 2843 |
| 268 | Ga0075428_100188863 | 3300006844 | Bacteria | 2229 |
| 269 | Ga0075428_100269957 | 3300006844 | Bacteria | 1830 |
| 270 | Ga0075428_100396935 | 3300006844 | Unclassified | 1478 |
| 271 | Ga0075428_100397842 | 3300006844 | Bacteria | 1476 |
| 272 | Ga0075428_100421592 | 3300006844 | Bacteria | 1430 |
| 273 | Ga0075428_100602193 | 3300006844 | Bacteria | 1174 |
| 274 | Ga0075428_100612341 | 3300006844 | Bacteria | 1163 |
| 275 | Ga0075430_100517428 | 3300006846 | Unclassified | 985 |
| 276 | Ga0075431_100256727 | 3300006847 | Bacteria | 1775 |
| 277 | Ga0075431_100262795 | 3300006847 | Unclassified | 1751 |
| 278 | Ga0075433_10067965 | 3300006852 | Bacteria | 3127 |
| 279 | Ga0075433_10098587 | 3300006852 | Bacteria | 2587 |
| 280 | Ga0075433_10105283 | 3300006852 | Bacteria | 2499 |
| 281 | Ga0075433_10157727 | 3300006852 | Unclassified | 2019 |
| 282 | Ga0075433_10192041 | 3300006852 | Bacteria | 1816 |
| 283 | Ga0075433_10236930 | 3300006852 | Bacteria | 1620 |
| 284 | Ga0075433_10276128 | 3300006852 | Bacteria | 1489 |
| 285 | Ga0075434_100039725 | 3300006871 | Bacteria | 4661 |
| 286 | Ga0075434_100074461 | 3300006871 | Bacteria | 3389 |
| 287 | Ga0075434_100284183 | 3300006871 | Bacteria | 1674 |
| 288 | Ga0075434_100293997 | 3300006871 | Bacteria | 1644 |
| 289 | Ga0075429_100019479 | 3300006880 | Bacteria | 5878 |
| 290 | Ga0075429_100424302 | 3300006880 | Unclassified | 1165 |
| 291 | Ga0075429_100578804 | 3300006880 | Unclassified | 984 |
| 292 | Ga0068865_100123897 | 3300006881 | Bacteria | 1926 |
| 293 | Ga0068865_100160948 | 3300006881 | Bacteria | 1712 |
| 294 | Ga0068865_100230077 | 3300006881 | Bacteria | 1454 |
| 295 | Ga0068865_100326783 | 3300006881 | Bacteria | 1235 |
| 296 | Ga0068865_100848258 | 3300006881 | Unclassified | 791 |
| 297 | Ga0068865_101578123 | 3300006881 | Unclassified | 589 |
| 298 | Ga0075436_100015251 | 3300006914 | Bacteria | 5262 |
| 299 | Ga0075436_100016564 | 3300006914 | Bacteria | 5046 |
| 300 | Ga0075436_100037389 | 3300006914 | Bacteria | 3351 |
| 301 | Ga0075436_100081641 | 3300006914 | Bacteria | 2242 |
| 302 | Ga0097620_100227050 | 3300006931 | Unclassified | 1955 |
| 303 | Ga0075435_100020293 | 3300007076 | Bacteria | 5088 |
| 304 | Ga0075435_100046938 | 3300007076 | Bacteria | 3467 |
| 305 | Ga0075435_100062202 | 3300007076 | Bacteria | 3029 |
| 306 | Ga0075435_100170484 | 3300007076 | Bacteria | 1836 |
| 307 | Ga0075435_100239734 | 3300007076 | Bacteria | 1542 |
| 308 | Ga0105240_10238273 | 3300009093 | Unclassified | 2111 |
| 309 | Ga0105240_11143288 | 3300009093 | Unclassified | 827 |
| 310 | Ga0111539_10040883 | 3300009094 | Bacteria | 5579 |
| 311 | Ga0111539_10048629 | 3300009094 | Bacteria | 5062 |
| 312 | Ga0111539_10080392 | 3300009094 | Bacteria | 3834 |
| 313 | Ga0111539_10133615 | 3300009094 | Bacteria | 2905 |
| 314 | Ga0111539_10525573 | 3300009094 | Unclassified | 1378 |
| 315 | Ga0111539_10922310 | 3300009094 | Unclassified | 1016 |
| 316 | Ga0111539_11812147 | 3300009094 | Unclassified | 708 |
| 317 | Ga0105245_10003939 | 3300009098 | Bacteria | 13205 |
| 318 | Ga0105245_10010008 | 3300009098 | Bacteria | 8256 |
| 319 | Ga0105245_10020822 | 3300009098 | Bacteria | 5749 |
| 320 | Ga0105245_10034776 | 3300009098 | Bacteria | 4470 |
| 321 | Ga0105245_10065952 | 3300009098 | Bacteria | 3275 |
| 322 | Ga0105245_10084989 | 3300009098 | Bacteria | 2900 |
| 323 | Ga0105245_10103124 | 3300009098 | Bacteria | 2642 |
| 324 | Ga0105245_10746629 | 3300009098 | Unclassified | 1014 |
| 325 | Ga0105245_10821808 | 3300009098 | Bacteria | 968 |
| 326 | Ga0105247_10020070 | 3300009101 | Bacteria | 4017 |
| 327 | Ga0114129_10017054 | 3300009147 | Bacteria | 10340 |
| 328 | Ga0114129_10019724 | 3300009147 | Bacteria | 9596 |
| 329 | Ga0114129_10019762 | 3300009147 | Bacteria | 9587 |
| 330 | Ga0114129_10067861 | 3300009147 | Bacteria | 4973 |
| 331 | Ga0114129_10217085 | 3300009147 | Unclassified | 2582 |
| 332 | Ga0114129_10220430 | 3300009147 | Bacteria | 2559 |
| 333 | Ga0114129_10241643 | 3300009147 | Bacteria | 2427 |
| 334 | Ga0114129_10423208 | 3300009147 | Unclassified | 1751 |
| 335 | Ga0114129_10453248 | 3300009147 | Bacteria | 1682 |
| 336 | Ga0114129_10585608 | 3300009147 | Unclassified | 1447 |
| 337 | Ga0114129_10729481 | 3300009147 | Unclassified | 1271 |
| 338 | Ga0114129_10830975 | 3300009147 | Bacteria | 1176 |
| 339 | Ga0114129_10931918 | 3300009147 | Bacteria | 1098 |
| 340 | Ga0114129_11380734 | 3300009147 | Unclassified | 870 |
| 341 | Ga0114129_12316745 | 3300009147 | Bacteria | 644 |
| 342 | Ga0105243_10023342 | 3300009148 | Bacteria | 4709 |
| 343 | Ga0105243_10041832 | 3300009148 | Bacteria | 3584 |
| 344 | Ga0105243_10365523 | 3300009148 | Unclassified | 1329 |
| 345 | Ga0105241_10023963 | 3300009174 | Bacteria | 4531 |
| 346 | Ga0105241_10055898 | 3300009174 | Bacteria | 3024 |
| 347 | Ga0105241_10196612 | 3300009174 | Bacteria | 1682 |
| 348 | Ga0105242_10026948 | 3300009176 | Bacteria | 4559 |
| 349 | Ga0105242_10129654 | 3300009176 | Bacteria | 2175 |
| 350 | Ga0105242_10176304 | 3300009176 | Bacteria | 1882 |
| 351 | Ga0105248_10057042 | 3300009177 | Bacteria | 4383 |
| 352 | Ga0105248_10095769 | 3300009177 | Bacteria | 3342 |
| 353 | Ga0105248_10849707 | 3300009177 | Bacteria | 1030 |
| 354 | Ga0105248_11695454 | 3300009177 | Unclassified | 716 |
| 355 | Ga0105237_10085281 | 3300009545 | Bacteria | 3148 |
| 356 | Ga0105238_10195548 | 3300009551 | Bacteria | 1998 |
| 357 | Ga0105249_10000587 | 3300009553 | Bacteria | 33206 |
| 358 | Ga0105249_10023380 | 3300009553 | Bacteria | 5545 |
| 359 | Ga0105249_10239671 | 3300009553 | Bacteria | 1792 |
| 360 | Ga0105249_10848833 | 3300009553 | Unclassified | 979 |
| 361 | Ga0105249_11825997 | 3300009553 | Unclassified | 680 |
| 362 | Ga0105239_10014910 | 3300010375 | Bacteria | 8615 |
| 363 | Ga0105239_10846751 | 3300010375 | Bacteria | 1049 |
| 364 | Ga0105239_11458945 | 3300010375 | Bacteria | 790 |
| 365 | Ga0105246_10045576 | 3300011119 | Bacteria | 2987 |
| 366 | Ga0105246_10165214 | 3300011119 | Unclassified | 1690 |
| 367 | Ga0105246_10380959 | 3300011119 | Bacteria | 1165 |
| 368 | Ga0105246_10444324 | 3300011119 | Bacteria | 1088 |
| 369 | Ga0105246_10553785 | 3300011119 | Unclassified | 986 |
| 370 | Ga0157343_1007170 | 3300012488 | Bacteria | 772 |
| 371 | Ga0157313_1005592 | 3300012503 | Bacteria | 913 |
| 372 | Ga0157339_1013329 | 3300012505 | Unclassified | 784 |
| 373 | Ga0157373_10029312 | 3300013100 | Bacteria | 3964 |
| 374 | Ga0157371_10028826 | 3300013102 | Bacteria | 4019 |
| 375 | Ga0157374_10007194 | 3300013296 | Bacteria | 9479 |
| 376 | Ga0157378_10032376 | 3300013297 | Bacteria | 4620 |
| 377 | Ga0157378_10137003 | 3300013297 | Bacteria | 2270 |
| 378 | Ga0157378_10494698 | 3300013297 | Bacteria | 1220 |
| 379 | Ga0157378_10769191 | 3300013297 | Unclassified | 987 |
| 380 | Ga0163162_10001280 | 3300013306 | Bacteria | 23542 |
| 381 | Ga0163162_10043643 | 3300013306 | Bacteria | 4489 |
| 382 | Ga0163162_10210045 | 3300013306 | Bacteria | 2076 |
| 383 | Ga0157372_10125068 | 3300013307 | Bacteria | 2956 |
| 384 | Ga0157372_10871570 | 3300013307 | Bacteria | 1045 |
| 385 | Ga0157375_10004811 | 3300013308 | Bacteria | 11733 |
| 386 | Ga0157375_10085557 | 3300013308 | Bacteria | 3203 |
| 387 | Ga0157375_10097978 | 3300013308 | Bacteria | 3008 |
| 388 | Ga0157375_10099811 | 3300013308 | Bacteria | 2982 |
| 389 | Ga0157375_10119671 | 3300013308 | Bacteria | 2741 |
| 390 | Ga0157375_10391205 | 3300013308 | Bacteria | 1557 |
| 391 | Ga0157375_10599702 | 3300013308 | Unclassified | 1260 |
| 392 | Ga0163163_10065375 | 3300014325 | Unclassified | 3610 |
| 393 | Ga0163163_10134661 | 3300014325 | Bacteria | 2511 |
| 394 | Ga0163163_10138821 | 3300014325 | Bacteria | 2472 |
| 395 | Ga0157380_10003890 | 3300014326 | Bacteria | 10299 |
| 396 | Ga0157380_10720006 | 3300014326 | Unclassified | 1005 |
| 397 | Ga0157377_10000519 | 3300014745 | Bacteria | 16326 |
| 398 | Ga0157377_10298941 | 3300014745 | Bacteria | 1061 |
| 399 | Ga0157379_10717625 | 3300014968 | Unclassified | 939 |
| 400 | Ga0157376_10007715 | 3300014969 | Bacteria | 7707 |
| 401 | Ga0157376_10024449 | 3300014969 | Bacteria | 4743 |
| 402 | Ga0163161_10165989 | 3300017792 | Unclassified | 1686 |
| 403 | Ga0207653_10017886 | 3300025885 | Bacteria | 2233 |
| 404 | Ga0207653_10018918 | 3300025885 | Bacteria | 2170 |
| 405 | Ga0207692_10012193 | 3300025898 | Bacteria | 3685 |
| 406 | Ga0207692_10022049 | 3300025898 | Unclassified | 2925 |
| 407 | Ga0207692_10043401 | 3300025898 | Bacteria | 2237 |
| 408 | Ga0207692_10043955 | 3300025898 | Bacteria | 2226 |
| 409 | Ga0207692_10163298 | 3300025898 | Unclassified | 1285 |
| 410 | Ga0207642_10009110 | 3300025899 | Bacteria | 3439 |
| 411 | Ga0207642_10593416 | 3300025899 | Unclassified | 689 |
| 412 | Ga0207710_10110716 | 3300025900 | Unclassified | 1304 |
| 413 | Ga0207710_10163940 | 3300025900 | Bacteria | 1084 |
| 414 | Ga0207688_10006451 | 3300025901 | Bacteria | 6389 |
| 415 | Ga0207688_10030282 | 3300025901 | Bacteria | 2984 |
| 416 | Ga0207680_10018430 | 3300025903 | Bacteria | 3710 |
| 417 | Ga0207647_10496563 | 3300025904 | Unclassified | 681 |
| 418 | Ga0207685_10015572 | 3300025905 | Unclassified | 2412 |
| 419 | Ga0207685_10052420 | 3300025905 | Bacteria | 1581 |
| 420 | Ga0207685_10128678 | 3300025905 | Bacteria | 1121 |
| 421 | Ga0207699_10067830 | 3300025906 | Bacteria | 2170 |
| 422 | Ga0207699_10086095 | 3300025906 | Bacteria | 1962 |
| 423 | Ga0207699_10212009 | 3300025906 | Unclassified | 1318 |
| 424 | Ga0207699_10729369 | 3300025906 | Bacteria | 726 |
| 425 | Ga0207699_10855588 | 3300025906 | Unclassified | 670 |
| 426 | Ga0207643_10187933 | 3300025908 | Unclassified | 1253 |
| 427 | Ga0207684_10008644 | 3300025910 | Bacteria | 9045 |
| 428 | Ga0207684_10031315 | 3300025910 | Bacteria | 4525 |
| 429 | Ga0207684_10040129 | 3300025910 | Bacteria | 3968 |
| 430 | Ga0207684_10181532 | 3300025910 | Bacteria | 1815 |
| 431 | Ga0207684_10208437 | 3300025910 | Unclassified | 1686 |
| 432 | Ga0207684_10240516 | 3300025910 | Unclassified | 1562 |
| 433 | Ga0207654_10051469 | 3300025911 | Bacteria | 2371 |
| 434 | Ga0207707_10112150 | 3300025912 | Bacteria | 2384 |
| 435 | Ga0207695_10160002 | 3300025913 | Unclassified | 2184 |
| 436 | Ga0207671_10691863 | 3300025914 | Unclassified | 811 |
| 437 | Ga0207693_10000126 | 3300025915 | Bacteria | 68560 |
| 438 | Ga0207693_10001293 | 3300025915 | Bacteria | 22224 |
| 439 | Ga0207693_10004168 | 3300025915 | Bacteria | 12270 |
| 440 | Ga0207693_10004553 | 3300025915 | Bacteria | 11703 |
| 441 | Ga0207693_10005548 | 3300025915 | Bacteria | 10497 |
| 442 | Ga0207693_10037912 | 3300025915 | Bacteria | 3798 |
| 443 | Ga0207693_10038347 | 3300025915 | Bacteria | 3774 |
| 444 | Ga0207693_11132472 | 3300025915 | Unclassified | 593 |
| 445 | Ga0207663_10006439 | 3300025916 | Bacteria | 6008 |
| 446 | Ga0207663_10021176 | 3300025916 | Unclassified | 3697 |
| 447 | Ga0207663_10144275 | 3300025916 | Unclassified | 1662 |
| 448 | Ga0207663_10564191 | 3300025916 | Bacteria | 891 |
| 449 | Ga0207660_10110420 | 3300025917 | Bacteria | 2069 |
| 450 | Ga0207660_10151637 | 3300025917 | Bacteria | 1781 |
| 451 | Ga0207662_10004854 | 3300025918 | Bacteria | 7109 |
| 452 | Ga0207662_10221600 | 3300025918 | Bacteria | 1232 |
| 453 | Ga0207662_10785812 | 3300025918 | Unclassified | 670 |
| 454 | Ga0207657_10002174 | 3300025919 | Bacteria | 21240 |
| 455 | Ga0207657_10068766 | 3300025919 | Bacteria | 3008 |
| 456 | Ga0207657_10277141 | 3300025919 | Unclassified | 1332 |
| 457 | Ga0207649_10408558 | 3300025920 | Bacteria | 1017 |
| 458 | Ga0207649_10596891 | 3300025920 | Unclassified | 849 |
| 459 | Ga0207652_10086612 | 3300025921 | Bacteria | 2747 |
| 460 | Ga0207652_10136087 | 3300025921 | Bacteria | 2194 |
| 461 | Ga0207652_10463270 | 3300025921 | Unclassified | 1142 |
| 462 | Ga0207646_10013769 | 3300025922 | Bacteria | 7719 |
| 463 | Ga0207646_10034097 | 3300025922 | Bacteria | 4600 |
| 464 | Ga0207646_10125331 | 3300025922 | Unclassified | 2309 |
| 465 | Ga0207646_10178465 | 3300025922 | Bacteria | 1918 |
| 466 | Ga0207646_10222552 | 3300025922 | Bacteria | 1705 |
| 467 | Ga0207646_10238814 | 3300025922 | Unclassified | 1642 |
| 468 | Ga0207646_10258289 | 3300025922 | Unclassified | 1574 |
| 469 | Ga0207646_11259948 | 3300025922 | Unclassified | 647 |
| 470 | Ga0207681_10126167 | 3300025923 | Bacteria | 1885 |
| 471 | Ga0207681_10506741 | 3300025923 | Unclassified | 989 |
| 472 | Ga0207681_10976950 | 3300025923 | Bacteria | 710 |
| 473 | Ga0207687_10018369 | 3300025927 | Bacteria | 4614 |
| 474 | Ga0207687_10036360 | 3300025927 | Bacteria | 3354 |
| 475 | Ga0207687_10066568 | 3300025927 | Unclassified | 2561 |
| 476 | Ga0207687_10291005 | 3300025927 | Unclassified | 1313 |
| 477 | Ga0207687_10947775 | 3300025927 | Unclassified | 737 |
| 478 | Ga0207700_10000021 | 3300025928 | Bacteria | 168335 |
| 479 | Ga0207700_10051449 | 3300025928 | Bacteria | 3074 |
| 480 | Ga0207700_10058666 | 3300025928 | Archaea | 2908 |
| 481 | Ga0207700_10101232 | 3300025928 | Unclassified | 2298 |
| 482 | Ga0207664_10074216 | 3300025929 | Bacteria | 2747 |
| 483 | Ga0207664_10168815 | 3300025929 | Unclassified | 1871 |
| 484 | Ga0207664_10271946 | 3300025929 | Bacteria | 1484 |
| 485 | Ga0207644_10035018 | 3300025931 | Bacteria | 3516 |
| 486 | Ga0207644_10187861 | 3300025931 | Unclassified | 1623 |
| 487 | Ga0207644_10442472 | 3300025931 | Bacteria | 1067 |
| 488 | Ga0207690_10053964 | 3300025932 | Bacteria | 2700 |
| 489 | Ga0207690_10590008 | 3300025932 | Unclassified | 906 |
| 490 | Ga0207706_10004640 | 3300025933 | Bacteria | 12881 |
| 491 | Ga0207686_10001422 | 3300025934 | Bacteria | 13559 |
| 492 | Ga0207686_10152289 | 3300025934 | Bacteria | 1611 |
| 493 | Ga0207709_10000790 | 3300025935 | Bacteria | 24700 |
| 494 | Ga0207709_10148433 | 3300025935 | Bacteria | 1621 |
| 495 | Ga0207709_10167845 | 3300025935 | Unclassified | 1537 |
| 496 | Ga0207709_10549121 | 3300025935 | Bacteria | 908 |
| 497 | Ga0207670_10319459 | 3300025936 | Bacteria | 1221 |
| 498 | Ga0207669_10002149 | 3300025937 | Bacteria | 8352 |
| 499 | Ga0207669_10014952 | 3300025937 | Bacteria | 3903 |
| 500 | Ga0207704_10017089 | 3300025938 | Bacteria | 3750 |
| 501 | Ga0207704_10207153 | 3300025938 | Bacteria | 1440 |
| 502 | Ga0207704_10262359 | 3300025938 | Bacteria | 1303 |
| 503 | Ga0207704_11373733 | 3300025938 | Unclassified | 605 |
| 504 | Ga0207665_10000494 | 3300025939 | Bacteria | 26650 |
| 505 | Ga0207665_10006449 | 3300025939 | Bacteria | 7786 |
| 506 | Ga0207665_10007677 | 3300025939 | Bacteria | 7121 |
| 507 | Ga0207665_10009746 | 3300025939 | Bacteria | 6306 |
| 508 | Ga0207691_10034963 | 3300025940 | Bacteria | 4669 |
| 509 | Ga0207711_10184486 | 3300025941 | Bacteria | 1899 |
| 510 | Ga0207711_10533544 | 3300025941 | Bacteria | 1094 |
| 511 | Ga0207711_10820568 | 3300025941 | Unclassified | 866 |
| 512 | Ga0207689_10135102 | 3300025942 | Unclassified | 2031 |
| 513 | Ga0207689_10577985 | 3300025942 | Unclassified | 944 |
| 514 | Ga0207689_10754666 | 3300025942 | Bacteria | 821 |
| 515 | Ga0207661_10038335 | 3300025944 | Bacteria | 3756 |
| 516 | Ga0207661_10507392 | 3300025944 | Archaea | 1102 |
| 517 | Ga0207661_11232827 | 3300025944 | Archaea | 688 |
| 518 | Ga0207679_10266565 | 3300025945 | Archaea | 1463 |
| 519 | Ga0207679_10380518 | 3300025945 | Bacteria | 1237 |
| 520 | Ga0207667_10487910 | 3300025949 | Bacteria | 1250 |
| 521 | Ga0207667_10598603 | 3300025949 | Bacteria | 1112 |
| 522 | Ga0207667_11140454 | 3300025949 | Bacteria | 761 |
| 523 | Ga0207667_11145773 | 3300025949 | Bacteria | 759 |
| 524 | Ga0207712_10722678 | 3300025961 | Bacteria | 871 |
| 525 | Ga0207668_10165743 | 3300025972 | Bacteria | 1727 |
| 526 | Ga0207668_10445188 | 3300025972 | Bacteria | 1104 |
| 527 | Ga0207640_10111176 | 3300025981 | Unclassified | 1942 |
| 528 | Ga0207640_10121685 | 3300025981 | Bacteria | 1871 |
| 529 | Ga0207640_10123319 | 3300025981 | Bacteria | 1861 |
| 530 | Ga0207677_10023679 | 3300026023 | Bacteria | 3798 |
| 531 | Ga0207677_10407276 | 3300026023 | Bacteria | 1155 |
| 532 | Ga0207678_10047585 | 3300026067 | Bacteria | 3708 |
| 533 | Ga0207708_10000415 | 3300026075 | Bacteria | 33470 |
| 534 | Ga0207708_10010983 | 3300026075 | Bacteria | 6736 |
| 535 | Ga0207708_10336808 | 3300026075 | Bacteria | 1234 |
| 536 | Ga0207702_10045682 | 3300026078 | Bacteria | 3685 |
| 537 | Ga0207702_10053634 | 3300026078 | Unclassified | 3414 |
| 538 | Ga0207702_10316656 | 3300026078 | Bacteria | 1485 |
| 539 | Ga0207702_10378233 | 3300026078 | Bacteria | 1361 |
| 540 | Ga0207702_10378967 | 3300026078 | Archaea | 1360 |
| 541 | Ga0207702_10407837 | 3300026078 | Bacteria | 1312 |
| 542 | Ga0207702_11345312 | 3300026078 | Unclassified | 708 |
| 543 | Ga0207641_10078544 | 3300026088 | Unclassified | 2859 |
| 544 | Ga0207648_10000705 | 3300026089 | Bacteria | 37489 |
| 545 | Ga0207648_10003750 | 3300026089 | Bacteria | 15885 |
| 546 | Ga0207648_10102646 | 3300026089 | Bacteria | 2507 |
| 547 | Ga0207648_10300502 | 3300026089 | Bacteria | 1439 |
| 548 | Ga0207648_10655238 | 3300026089 | Bacteria | 971 |
| 549 | Ga0207676_10047734 | 3300026095 | Unclassified | 3320 |
| 550 | Ga0207676_10437126 | 3300026095 | Unclassified | 1231 |
| 551 | Ga0207674_10352195 | 3300026116 | Bacteria | 1423 |
| 552 | Ga0207675_100001825 | 3300026118 | Bacteria | 21355 |
| 553 | Ga0207675_100010036 | 3300026118 | Bacteria | 8877 |
| 554 | Ga0207675_100013655 | 3300026118 | Bacteria | 7579 |
| 555 | Ga0207675_100030987 | 3300026118 | Bacteria | 4981 |
| 556 | Ga0207675_100096119 | 3300026118 | Unclassified | 2788 |
| 557 | Ga0207675_100124347 | 3300026118 | Bacteria | 2443 |
| 558 | Ga0207675_101058682 | 3300026118 | Bacteria | 830 |
| 559 | Ga0207683_10003390 | 3300026121 | Bacteria | 13894 |
| 560 | Ga0207683_10023263 | 3300026121 | Bacteria | 5327 |
| 561 | Ga0207683_10392585 | 3300026121 | Bacteria | 1276 |
| 562 | Ga0207683_10570246 | 3300026121 | Unclassified | 1047 |
| 563 | Ga0207698_10073451 | 3300026142 | Bacteria | 2724 |
| 564 | Ga0207698_10321420 | 3300026142 | Bacteria | 1449 |
| 565 | Ga0207428_10012037 | 3300027907 | Bacteria | 7613 |
| 566 | Ga0207428_10012691 | 3300027907 | Bacteria | 7387 |
| 567 | Ga0207428_10013907 | 3300027907 | Bacteria | 7010 |
| 568 | Ga0207428_10112833 | 3300027907 | Bacteria | 2090 |
| 569 | Ga0268266_10006952 | 3300028379 | Bacteria | 10284 |
| 570 | Ga0268265_10038854 | 3300028380 | Bacteria | 3504 |
| 571 | Ga0268265_10078090 | 3300028380 | Unclassified | 2603 |
| 572 | Ga0268265_10112597 | 3300028380 | Bacteria | 2225 |
| 573 | Ga0268265_10220668 | 3300028380 | Bacteria | 1659 |
| 574 | Ga0268264_10322409 | 3300028381 | Bacteria | 1461 |
| 575 | Ga0268264_10565268 | 3300028381 | Bacteria | 1117 |
| 576 | Ga0307406_10126480 | 3300031901 | Unclassified | 1787 |
| 577 | Ga0307406_10798642 | 3300031901 | Unclassified | 796 |
| 578 | Ga0307409_100125511 | 3300031995 | Bacteria | 2182 |
| 579 | Ga0307409_100629392 | 3300031995 | Bacteria | 1064 |
| 580 | Ga0307416_101950520 | 3300032002 | Bacteria | 690 |
| 581 | Ga0307415_100041456 | 3300032126 | Bacteria | 3057 |
| 582 | Ga0307415_100483890 | 3300032126 | Bacteria | 1078 |
| 583 | Ga0307415_100991477 | 3300032126 | Bacteria | 780 |
| 584 | Ga0373948_0073338 | 3300034817 | Unclassified | 771 |
| 585 | Ga0373950_0043100 | 3300034818 | Unclassified | 869 |
| 586 | Ga0373958_0005198 | 3300034819 | Unclassified | 1965 |
| 587 | Ga0373959_0027491 | 3300034820 | Bacteria | 1130 |
| 588 | Ga0373959_0036083 | 3300034820 | Bacteria | 1019 |
| 589 | Ga0373938_0001272 | 3300034957 | Unclassified | 4048 |
| 590 | Ga0373929_0015768 | 3300035085 | Unclassified | 1473 |
| 591 | Ga0373940_0101763 | 3300035088 | Unclassified | 873 |
| 592 | Ga0373949_0001749 | 3300035090 | Bacteria | 5996 |
| 593 | Ga0373949_0006242 | 3300035090 | Bacteria | 2631 |
| 594 | Ga0373951_0001128 | 3300035091 | Bacteria | 7102 |
| 595 | Ga0373952_0055939 | 3300035092 | Unclassified | 953 |
| 596 | Ga0373936_0304412 | 3300035113 | Bacteria | 720 |
| 597 | Ga0373941_0001344 | 3300035115 | Bacteria | 5175 |
| 598 | Ga0373941_0078079 | 3300035115 | Bacteria | 1113 |
| 599 | Ga0373945_0014189 | 3300035116 | Bacteria | 2665 |
| 600 | Ga0373945_0151132 | 3300035116 | Bacteria | 941 |
| 601 | Ga0373960_0018706 | 3300035121 | Bacteria | 1811 |
| 602 | Ga0373960_0061038 | 3300035121 | Bacteria | 1144 |
| 603 | Ga0373960_0225761 | 3300035121 | Unclassified | 672 |
| 604 | Ga0373943_0012734 | 3300035170 | Bacteria | 3792 |
| 605 | Ga0373946_0003206 | 3300035171 | Bacteria | 5805 |
| 606 | Ga0373942_0043410 | 3300035207 | Bacteria | 1235 |
| 607 | Ga0373942_0053154 | 3300035207 | Unclassified | 1142 |
| 608 | Ga0373961_0023497 | 3300035241 | Archaea | 1659 |
| 609 | Ga0373962_0007404 | 3300035242 | Bacteria | 2687 |
| 610 | Ga0373962_0025901 | 3300035242 | Bacteria | 1577 |
| 611 | Ga0373931_0034755 | 3300035691 | Bacteria | 2618 |
| 612 | Ga0373927_0075892 | 3300035695 | Unclassified | 2177 |
| 613 | Ga0373947_0060292 | 3300035725 | Bacteria | 2303 |
| 614 | Ga0373937_0501071 | 3300036401 | Bacteria | 1154 |
| 615 | Ga0373925_0059240 | 3300037068 | Bacteria | 2872 |
| 616 | Ga0395899_0000775 | 3300037312 | Bacteria | 31562 |
| 617 | Ga0395899_0001403 | 3300037312 | Bacteria | 20652 |
| 618 | Ga0395899_0002275 | 3300037312 | Bacteria | 15690 |
| 619 | Ga0395899_0006761 | 3300037312 | Bacteria | 8881 |
| 620 | Ga0395899_0027290 | 3300037312 | Bacteria | 4306 |
| 621 | Ga0395899_0039378 | 3300037312 | Bacteria | 3538 |
| 622 | Ga0395899_0041426 | 3300037312 | Bacteria | 3441 |
| 623 | Ga0395899_0050383 | 3300037312 | Bacteria | 3091 |
| 624 | Ga0395899_0058260 | 3300037312 | Bacteria | 2849 |
| 625 | Ga0395899_0069946 | 3300037312 | Bacteria | 2569 |
| 626 | Ga0395899_0073964 | 3300037312 | Unclassified | 2490 |
| 627 | Ga0395899_0080290 | 3300037312 | Bacteria | 2374 |
| 628 | Ga0395899_0166224 | 3300037312 | Bacteria | 1556 |
| 629 | Ga0395899_0184625 | 3300037312 | Bacteria | 1462 |
| 630 | Ga0395899_0226448 | 3300037312 | Unclassified | 1293 |
| 631 | Ga0395899_0333453 | 3300037312 | Bacteria | 1019 |
| 632 | Ga0395899_0434041 | 3300037312 | Bacteria | 863 |
| 633 | Ga0395899_0462264 | 3300037312 | Archaea | 829 |
| 634 | Ga0395899_0551455 | 3300037312 | Bacteria | 741 |
| 635 | Ga0395900_0001501 | 3300037418 | Bacteria | 27705 |
| 636 | Ga0395900_0002828 | 3300037418 | Bacteria | 18940 |
| 637 | Ga0395900_0003593 | 3300037418 | Bacteria | 16669 |
| 638 | Ga0395900_0004261 | 3300037418 | Bacteria | 15184 |
| 639 | Ga0395900_0006278 | 3300037418 | Bacteria | 12400 |
| 640 | Ga0395900_0012186 | 3300037418 | Bacteria | 8788 |
| 641 | Ga0395900_0021493 | 3300037418 | Bacteria | 6599 |
| 642 | Ga0395900_0023612 | 3300037418 | Bacteria | 6291 |
| 643 | Ga0395900_0039067 | 3300037418 | Bacteria | 4891 |
| 644 | Ga0395900_0050303 | 3300037418 | Bacteria | 4293 |
| 645 | Ga0395900_0050757 | 3300037418 | Bacteria | 4272 |
| 646 | Ga0395900_0090007 | 3300037418 | Bacteria | 3154 |
| 647 | Ga0395900_0150523 | 3300037418 | Bacteria | 2377 |
| 648 | Ga0395900_0220790 | 3300037418 | Bacteria | 1910 |
| 649 | Ga0395900_0238466 | 3300037418 | Bacteria | 1825 |
| 650 | Ga0395900_0239974 | 3300037418 | Bacteria | 1819 |
| 651 | Ga0395900_0255155 | 3300037418 | Archaea | 1753 |
| 652 | Ga0395900_0425495 | 3300037418 | Bacteria | 1288 |
| 653 | Ga0395900_0461227 | 3300037418 | Bacteria | 1225 |
| 654 | Ga0395900_0491270 | 3300037418 | Bacteria | 1179 |
| 655 | Ga0395900_0572930 | 3300037418 | Unclassified | 1071 |
| 656 | Ga0395900_1083058 | 3300037418 | Unclassified | 719 |
| 657 | Ga0395900_1499972 | 3300037418 | Unclassified | 586 |
| 658 | Ga0395898_0001134 | 3300037466 | Bacteria | 40919 |
| 659 | Ga0395898_0002545 | 3300037466 | Bacteria | 21392 |
| 660 | Ga0395898_0002887 | 3300037466 | Bacteria | 19601 |
| 661 | Ga0395898_0003194 | 3300037466 | Bacteria | 18454 |
| 662 | Ga0395898_0003476 | 3300037466 | Bacteria | 17597 |
| 663 | Ga0395898_0005122 | 3300037466 | Bacteria | 14200 |
| 664 | Ga0395898_0005553 | 3300037466 | Bacteria | 13601 |
| 665 | Ga0395898_0013807 | 3300037466 | Bacteria | 8303 |
| 666 | Ga0395898_0015187 | 3300037466 | Bacteria | 7905 |
| 667 | Ga0395898_0015522 | 3300037466 | Bacteria | 7810 |
| 668 | Ga0395898_0019220 | 3300037466 | Bacteria | 6955 |
| 669 | Ga0395898_0022052 | 3300037466 | Bacteria | 6451 |
| 670 | Ga0395898_0043124 | 3300037466 | Bacteria | 4446 |
| 671 | Ga0395898_0060193 | 3300037466 | Bacteria | 3691 |
| 672 | Ga0395898_0061583 | 3300037466 | Bacteria | 3645 |
| 673 | Ga0395898_0073442 | 3300037466 | Bacteria | 3304 |
| 674 | Ga0395898_0089745 | 3300037466 | Bacteria | 2958 |
| 675 | Ga0395898_0125406 | 3300037466 | Bacteria | 2460 |
| 676 | Ga0395898_0217520 | 3300037466 | Bacteria | 1822 |
| 677 | Ga0395898_0280861 | 3300037466 | Bacteria | 1588 |
| 678 | Ga0395898_0458317 | 3300037466 | Unclassified | 1214 |
| 679 | Ga0395898_0484824 | 3300037466 | Bacteria | 1176 |
| 680 | Ga0395898_0625136 | 3300037466 | Bacteria | 1019 |
| 681 | Ga0395898_0678038 | 3300037466 | Unclassified | 973 |
| 682 | Ga0395898_0714038 | 3300037466 | Bacteria | 944 |
| 683 | Ga0395905_0001871 | 3300037471 | Bacteria | 24226 |
| 684 | Ga0395905_0002236 | 3300037471 | Bacteria | 21813 |
| 685 | Ga0395905_0010133 | 3300037471 | Bacteria | 9187 |
| 686 | Ga0395905_0012265 | 3300037471 | Bacteria | 8255 |
| 687 | Ga0395905_0014700 | 3300037471 | Bacteria | 7465 |
| 688 | Ga0395905_0015560 | 3300037471 | Bacteria | 7228 |
| 689 | Ga0395905_0018237 | 3300037471 | Bacteria | 6662 |
| 690 | Ga0395905_0019186 | 3300037471 | Bacteria | 6485 |
| 691 | Ga0395905_0025816 | 3300037471 | Bacteria | 5538 |
| 692 | Ga0395905_0061951 | 3300037471 | Bacteria | 3499 |
| 693 | Ga0395905_0065302 | 3300037471 | Bacteria | 3407 |
| 694 | Ga0395905_0070105 | 3300037471 | Bacteria | 3284 |
| 695 | Ga0395905_0093759 | 3300037471 | Bacteria | 2816 |
| 696 | Ga0395905_0108121 | 3300037471 | Bacteria | 2611 |
| 697 | Ga0395905_0184364 | 3300037471 | Bacteria | 1959 |
| 698 | Ga0395905_0184686 | 3300037471 | Bacteria | 1957 |
| 699 | Ga0395905_0243324 | 3300037471 | Bacteria | 1681 |
| 700 | Ga0395905_0309575 | 3300037471 | Unclassified | 1468 |
| 701 | Ga0395905_0322654 | 3300037471 | Bacteria | 1434 |
| 702 | Ga0395905_0634795 | 3300037471 | Unclassified | 970 |
| 703 | Ga0395905_0711747 | 3300037471 | Bacteria | 906 |
| 704 | Ga0395901_0001042 | 3300038443 | Bacteria | 29911 |
| 705 | Ga0395901_0002958 | 3300038443 | Bacteria | 17133 |
| 706 | Ga0395901_0005040 | 3300038443 | Bacteria | 13338 |
| 707 | Ga0395901_0005491 | 3300038443 | Bacteria | 12845 |
| 708 | Ga0395901_0006426 | 3300038443 | Bacteria | 11911 |
| 709 | Ga0395901_0010190 | 3300038443 | Bacteria | 9522 |
| 710 | Ga0395901_0011115 | 3300038443 | Bacteria | 9123 |
| 711 | Ga0395901_0012512 | 3300038443 | Bacteria | 8609 |
| 712 | Ga0395901_0018217 | 3300038443 | Bacteria | 7169 |
| 713 | Ga0395901_0020672 | 3300038443 | Bacteria | 6737 |
| 714 | Ga0395901_0023419 | 3300038443 | Bacteria | 6330 |
| 715 | Ga0395901_0023693 | 3300038443 | Bacteria | 6295 |
| 716 | Ga0395901_0025239 | 3300038443 | Bacteria | 6101 |
| 717 | Ga0395901_0043201 | 3300038443 | Bacteria | 4675 |
| 718 | Ga0395901_0046348 | 3300038443 | Bacteria | 4515 |
| 719 | Ga0395901_0057024 | 3300038443 | Bacteria | 4063 |
| 720 | Ga0395901_0081651 | 3300038443 | Bacteria | 3377 |
| 721 | Ga0395901_0087758 | 3300038443 | Bacteria | 3252 |
| 722 | Ga0395901_0097658 | 3300038443 | Archaea | 3080 |
| 723 | Ga0395901_0149624 | 3300038443 | Bacteria | 2453 |
| 724 | Ga0395901_0155658 | 3300038443 | Unclassified | 2400 |
| 725 | Ga0395901_0187547 | 3300038443 | Bacteria | 2169 |
| 726 | Ga0395901_0193023 | 3300038443 | Bacteria | 2135 |
| 727 | Ga0395901_0287413 | 3300038443 | Bacteria | 1707 |
| 728 | Ga0395901_0438496 | 3300038443 | Unclassified | 1337 |
| 729 | Ga0395901_0571158 | 3300038443 | Unclassified | 1144 |
| 730 | Ga0395901_0882263 | 3300038443 | Bacteria | 877 |
| 731 | Ga0395901_1568813 | 3300038443 | Unclassified | 612 |
| 732 | Ga0451789_0320105 | 3300041443 | Bacteria | 2746 |
| 733 | Ga0451793_0230547 | 3300041452 | Bacteria | 5076 |
| 734 | Ga0451797_1344230 | 3300041453 | Bacteria | 1209 |
| 735 | Ga0451795_1321968 | 3300041456 | Unclassified | 1605 |
| 736 | Ga0451798_1077237 | 3300041458 | Bacteria | 1841 |
| 737 | Ga0451800_0564701 | 3300041459 | Bacteria | 838 |
| 738 | Ga0451802_0775119 | 3300041460 | Bacteria | 2607 |
| 739 | Ga0451804_0399589 | 3300041463 | Bacteria | 2744 |
| 740 | Ga0451807_0017034 | 3300041486 | Bacteria | 1791 |
| 741 | Ga0451839_0685172 | 3300041496 | Unclassified | 1967 |
| 742 | Ga0451845_0385095 | 3300041501 | Bacteria | 1872 |
| 743 | Ga0451847_0819308 | 3300041503 | Bacteria | 2208 |
| 744 | Ga0451849_1319872 | 3300041505 | Bacteria | 740 |
| 745 | Ga0451853_0526476 | 3300041512 | Archaea | 867 |
| 746 | Ga0451853_1318362 | 3300041512 | Bacteria | 2441 |
| 747 | Ga0451853_1496837 | 3300041512 | Bacteria | 1612 |
| 748 | Ga0451853_1957809 | 3300041512 | Bacteria | 985 |
| 749 | Ga0451853_2523145 | 3300041512 | Bacteria | 1125 |
| 750 | Ga0451853_2580887 | 3300041512 | Bacteria | 1492 |
| 751 | Ga0451853_3083970 | 3300041512 | Bacteria | 1093 |
| 752 | Ga0439448_0046166 | 3300042005 | Bacteria | 1419 |
| 753 | Ga0450915_000171 | 3300042119 | Unclassified | 1834 |
| 754 | Ga0439458_0013062 | 3300042157 | Bacteria | 1867 |
| 755 | Ga0439464_0087647 | 3300042439 | Viruses | 935 |
| 756 | Ga0450893_0050378 | 3300042532 | Bacteria | 779 |
| 757 | Ga0439440_0133181 | 3300042993 | Unclassified | 701 |
| 758 | Ga0466965_0067611 | 3300044683 | Bacteria | 1794 |
| 759 | Ga0466964_0027216 | 3300044706 | Bacteria | 2244 |
| 760 | Ga0466964_0211381 | 3300044706 | Unclassified | 937 |
| 761 | Ga0466968_0045476 | 3300044735 | Bacteria | 1863 |
| 762 | Ga0466968_0062485 | 3300044735 | Bacteria | 1608 |
| 763 | Ga0466968_0062895 | 3300044735 | Bacteria | 1604 |
| 764 | Ga0466968_0423074 | 3300044735 | Unclassified | 655 |
| 765 | Ga0466960_0004277 | 3300044901 | Bacteria | 5564 |
| 766 | Ga0466960_0333241 | 3300044901 | Bacteria | 862 |
| 767 | Ga0451576_0058063 | 3300045051 | Bacteria | 4044 |
| 768 | Ga0451576_1625391 | 3300045051 | Bacteria | 670 |
| 769 | Ga0466967_0004808 | 3300045976 | Bacteria | 9205 |
| 770 | Ga0495603_0000062 | 3300046455 | Bacteria | 46880 |
| 771 | Ga0495603_0042819 | 3300046455 | Unclassified | 2705 |
| 772 | Ga0495603_0350934 | 3300046455 | Archaea | 846 |
| 773 | Ga0495641_0011742 | 3300046461 | Bacteria | 4958 |
| 774 | Ga0495641_0032927 | 3300046461 | Bacteria | 2464 |
| 775 | Ga0495641_0040948 | 3300046461 | Bacteria | 2153 |
| 776 | Ga0495580_0156072 | 3300046472 | Bacteria | 1580 |
| 777 | Ga0495582_0033727 | 3300046473 | Bacteria | 2815 |
| 778 | Ga0495582_0038176 | 3300046473 | Bacteria | 2642 |
| 779 | Ga0495582_0590757 | 3300046473 | Unclassified | 642 |
| 780 | Ga0495605_0062515 | 3300046474 | Bacteria | 1779 |
| 781 | Ga0495605_0075577 | 3300046474 | Bacteria | 1584 |
| 782 | Ga0495639_0027197 | 3300046475 | Unclassified | 2531 |
| 783 | Ga0495639_0027639 | 3300046475 | Bacteria | 2512 |
| 784 | Ga0495639_0158859 | 3300046475 | Archaea | 1093 |
| 785 | Ga0495584_0032729 | 3300046491 | Unclassified | 2631 |
| 786 | Ga0495584_0065400 | 3300046491 | Bacteria | 1829 |
| 787 | Ga0495584_0244774 | 3300046491 | Bacteria | 912 |
| 788 | Ga0495584_0257056 | 3300046491 | Bacteria | 888 |
| 789 | Ga0495585_0341657 | 3300046492 | Unclassified | 729 |
| 790 | Ga0495594_0000447 | 3300046499 | Bacteria | 20925 |
| 791 | Ga0495594_0050418 | 3300046499 | Unclassified | 2289 |
| 792 | Ga0495596_0133762 | 3300046500 | Unclassified | 962 |
| 793 | Ga0495630_0087451 | 3300046517 | Unclassified | 2353 |
| 794 | Ga0495631_0113571 | 3300046518 | Unclassified | 1165 |
| 795 | Ga0495631_0130620 | 3300046518 | Bacteria | 1079 |
| 796 | Ga0495631_0200152 | 3300046518 | Bacteria | 854 |
| 797 | Ga0495637_0158943 | 3300046520 | Archaea | 849 |
| 798 | Ga0495644_0125316 | 3300046523 | Archaea | 978 |
| 799 | Ga0495663_0001805 | 3300046525 | Bacteria | 6618 |
| 800 | Ga0495663_0013804 | 3300046525 | Bacteria | 2259 |
| 801 | Ga0495663_0024696 | 3300046525 | Bacteria | 1748 |
| 802 | Ga0495666_0036927 | 3300046526 | Unclassified | 2378 |
| 803 | Ga0495666_0226618 | 3300046526 | Bacteria | 855 |
| 804 | Ga0495642_0038014 | 3300046528 | Unclassified | 1949 |
| 805 | Ga0495665_0099189 | 3300046531 | Bacteria | 1529 |
| 806 | Ga0495609_0058356 | 3300046538 | Unclassified | 1707 |
| 807 | Ga0495656_0021925 | 3300046615 | Bacteria | 2494 |
| 808 | Ga0495656_0124863 | 3300046615 | Archaea | 1219 |
| 809 | Ga0495611_0063179 | 3300046648 | Unclassified | 1685 |
| 810 | Ga0495659_0049444 | 3300046664 | Bacteria | 1527 |
| 811 | Ga0495659_0054375 | 3300046664 | Unclassified | 1465 |
| 812 | Ga0495659_0185910 | 3300046664 | Bacteria | 848 |
| 813 | Ga0495661_0153580 | 3300046665 | Bacteria | 1242 |
| 814 | Ga0495588_0000632 | 3300046674 | Bacteria | 16378 |
| 815 | Ga0495588_0258791 | 3300046674 | Unclassified | 917 |
| 816 | Ga0495647_0004331 | 3300046681 | Bacteria | 4602 |
| 817 | Ga0495658_0054043 | 3300046683 | Bacteria | 2283 |
| 818 | Ga0495658_0169849 | 3300046683 | Bacteria | 1349 |
| 819 | Ga0495658_0264885 | 3300046683 | Bacteria | 1082 |
| 820 | Ga0495669_0003905 | 3300046684 | Bacteria | 6134 |
| 821 | Ga0495613_0116752 | 3300046689 | Bacteria | 1919 |
| 822 | Ga0495613_0165764 | 3300046689 | Bacteria | 1570 |
| 823 | Ga0495624_0278848 | 3300046690 | Bacteria | 1009 |
| 824 | Ga0495670_0546789 | 3300046691 | Bacteria | 630 |
| 825 | Ga0495671_0077488 | 3300046692 | Bacteria | 1630 |
| 826 | Ga0495589_0088044 | 3300046794 | Bacteria | 1508 |
| 827 | Ga0495581_0002069 | 3300047315 | Bacteria | 11286 |
| 828 | Ga0495581_0113815 | 3300047315 | Bacteria | 1573 |
| 829 | Ga0495676_0000253 | 3300047321 | Bacteria | 43107 |
| 830 | Ga0495676_0075995 | 3300047321 | Bacteria | 2566 |
| 831 | Ga0495683_0037965 | 3300047323 | Unclassified | 2440 |
| 832 | Ga0495683_0135840 | 3300047323 | Bacteria | 1156 |
| 833 | Ga0495677_0063284 | 3300047445 | Unclassified | 1374 |
| 834 | Ga0495677_0095312 | 3300047445 | Bacteria | 1124 |
| 835 | Ga0495685_013727 | 3300047447 | Unclassified | 2750 |
| 836 | Ga0496100_0021816 | 3300048903 | Bacteria | 3864 |
| 837 | Ga0496101_0002526 | 3300048904 | Bacteria | 11238 |
| 838 | Ga0496101_0047027 | 3300048904 | Bacteria | 3096 |
| 839 | Ga0496101_0069307 | 3300048904 | Bacteria | 2580 |
| 840 | Ga0496101_0215659 | 3300048904 | Bacteria | 1488 |
| 841 | Ga0496101_0263142 | 3300048904 | Unclassified | 1345 |
| 842 | Ga0496101_0288473 | 3300048904 | Bacteria | 1284 |
| 843 | Ga0496101_0334627 | 3300048904 | Bacteria | 1189 |
| 844 | Ga0496101_0557067 | 3300048904 | Bacteria | 906 |
| 845 | Ga0496102_0010584 | 3300048905 | Bacteria | 7944 |
| 846 | Ga0496102_0017379 | 3300048905 | Bacteria | 6301 |
| 847 | Ga0496102_0054400 | 3300048905 | Bacteria | 3649 |
| 848 | Ga0496102_0145825 | 3300048905 | Bacteria | 2222 |
| 849 | Ga0496102_0174862 | 3300048905 | Bacteria | 2022 |
| 850 | Ga0496103_0001169 | 3300048906 | Bacteria | 18049 |
| 851 | Ga0496103_0017711 | 3300048906 | Bacteria | 4265 |
| 852 | Ga0496103_0031656 | 3300048906 | Bacteria | 3224 |
| 853 | Ga0496103_0034389 | 3300048906 | Bacteria | 3099 |
| 854 | Ga0496103_0126191 | 3300048906 | Unclassified | 1632 |
| 855 | Ga0496103_0395622 | 3300048906 | Unclassified | 888 |
| 856 | Ga0496104_0002508 | 3300048907 | Bacteria | 15797 |
| 857 | Ga0496104_0003548 | 3300048907 | Bacteria | 13455 |
| 858 | Ga0496104_0007013 | 3300048907 | Bacteria | 9936 |
| 859 | Ga0496104_0094964 | 3300048907 | Bacteria | 2853 |
| 860 | Ga0496104_0125302 | 3300048907 | Bacteria | 2467 |
| 861 | Ga0496104_0448150 | 3300048907 | Bacteria | 1202 |
| 862 | Ga0496104_0834292 | 3300048907 | Unclassified | 827 |
| 863 | Ga0496105_0000042 | 3300048908 | Bacteria | 114886 |
| 864 | Ga0496105_0002088 | 3300048908 | Bacteria | 14454 |
| 865 | Ga0496105_0004474 | 3300048908 | Bacteria | 10522 |
| 866 | Ga0496105_0031817 | 3300048908 | Unclassified | 4327 |
| 867 | Ga0496105_0048021 | 3300048908 | Bacteria | 3523 |
| 868 | Ga0496105_0282175 | 3300048908 | Bacteria | 1339 |
| 869 | Ga0496105_0733278 | 3300048908 | Unclassified | 756 |
| 870 | Ga0496106_0003639 | 3300048909 | Bacteria | 11495 |
| 871 | Ga0496106_0024597 | 3300048909 | Bacteria | 4478 |
| 872 | Ga0496106_0052951 | 3300048909 | Bacteria | 3064 |
| 873 | Ga0496106_0253920 | 3300048909 | Bacteria | 1406 |
| 874 | Ga0496106_0278075 | 3300048909 | Unclassified | 1341 |
| 875 | Ga0496107_0005238 | 3300048910 | Bacteria | 8855 |
| 876 | Ga0496107_0006172 | 3300048910 | Bacteria | 8231 |
| 877 | Ga0496107_0053510 | 3300048910 | Bacteria | 2912 |
| 878 | Ga0496107_0093718 | 3300048910 | Bacteria | 2196 |
| 879 | Ga0496107_0205433 | 3300048910 | Bacteria | 1464 |
| 880 | Ga0496107_0263602 | 3300048910 | Unclassified | 1282 |
| 881 | Ga0496107_0312329 | 3300048910 | Unclassified | 1170 |
| 882 | Ga0496107_0494679 | 3300048910 | Unclassified | 907 |
| 883 | Ga0496107_0560725 | 3300048910 | Bacteria | 846 |
| 884 | Ga0496108_0001658 | 3300048911 | Bacteria | 17647 |
| 885 | Ga0496108_0002105 | 3300048911 | Bacteria | 15931 |
| 886 | Ga0496108_0005226 | 3300048911 | Bacteria | 10483 |
| 887 | Ga0496108_0027073 | 3300048911 | Bacteria | 4730 |
| 888 | Ga0496108_0033984 | 3300048911 | Bacteria | 4235 |
| 889 | Ga0496108_0053108 | 3300048911 | Unclassified | 3397 |
| 890 | Ga0496108_0074457 | 3300048911 | Bacteria | 2867 |
| 891 | Ga0496108_0089930 | 3300048911 | Bacteria | 2610 |
| 892 | Ga0496108_0392728 | 3300048911 | Bacteria | 1212 |
| 893 | Ga0496108_0433756 | 3300048911 | Bacteria | 1148 |
| 894 | Ga0496109_0001502 | 3300048912 | Bacteria | 19387 |
| 895 | Ga0496109_0001909 | 3300048912 | Bacteria | 17319 |
| 896 | Ga0496109_0024719 | 3300048912 | Bacteria | 5344 |
| 897 | Ga0496109_0045446 | 3300048912 | Bacteria | 3985 |
| 898 | Ga0496109_0048017 | 3300048912 | Bacteria | 3883 |
| 899 | Ga0496109_0075569 | 3300048912 | Unclassified | 3097 |
| 900 | Ga0496109_0113098 | 3300048912 | Bacteria | 2525 |
| 901 | Ga0496109_0129471 | 3300048912 | Bacteria | 2355 |
| 902 | Ga0496109_0218296 | 3300048912 | Bacteria | 1793 |
| 903 | Ga0496109_0241444 | 3300048912 | Archaea | 1700 |
| 904 | Ga0496110_0000050 | 3300048913 | Bacteria | 59023 |
| 905 | Ga0496110_0001137 | 3300048913 | Bacteria | 18822 |
| 906 | Ga0496110_0001795 | 3300048913 | Bacteria | 15825 |
| 907 | Ga0496110_0022287 | 3300048913 | Bacteria | 5377 |
| 908 | Ga0496110_0070475 | 3300048913 | Bacteria | 3098 |
| 909 | Ga0496110_0213997 | 3300048913 | Bacteria | 1752 |
| 910 | Ga0496110_0256436 | 3300048913 | Bacteria | 1592 |
| 911 | Ga0496110_0459417 | 3300048913 | Bacteria | 1160 |
| 912 | Ga0496110_0521517 | 3300048913 | Bacteria | 1081 |
| 913 | Ga0496110_1097967 | 3300048913 | Bacteria | 704 |
| 914 | Ga0496111_0000439 | 3300048914 | Bacteria | 21067 |
| 915 | Ga0496111_0007210 | 3300048914 | Bacteria | 7270 |
| 916 | Ga0496111_0011817 | 3300048914 | Bacteria | 5894 |
| 917 | Ga0496111_0039662 | 3300048914 | Bacteria | 3378 |
| 918 | Ga0496111_0071825 | 3300048914 | Bacteria | 2519 |
| 919 | Ga0496111_0073134 | 3300048914 | Archaea | 2496 |
| 920 | Ga0496111_0074143 | 3300048914 | Bacteria | 2478 |
| 921 | Ga0496111_0084761 | 3300048914 | Bacteria | 2317 |
| 922 | Ga0496111_0192018 | 3300048914 | Bacteria | 1518 |
| 923 | Ga0496111_0699600 | 3300048914 | Unclassified | 737 |
| 924 | Ga0496112_0002189 | 3300048915 | Bacteria | 15555 |
| 925 | Ga0496112_0026197 | 3300048915 | Bacteria | 5608 |
| 926 | Ga0496112_0045844 | 3300048915 | Unclassified | 4285 |
| 927 | Ga0496112_0116095 | 3300048915 | Bacteria | 2647 |
| 928 | Ga0496112_0120286 | 3300048915 | Bacteria | 2596 |
| 929 | Ga0496112_0153365 | 3300048915 | Bacteria | 2271 |
| 930 | Ga0496112_0175879 | 3300048915 | Unclassified | 2105 |
| 931 | Ga0496112_0324959 | 3300048915 | Bacteria | 1482 |
| 932 | Ga0496112_0396200 | 3300048915 | Bacteria | 1320 |
| 933 | Ga0496112_0488245 | 3300048915 | Bacteria | 1168 |
| 934 | Ga0496112_0506847 | 3300048915 | Bacteria | 1142 |
| 935 | Ga0496112_1508291 | 3300048915 | Archaea | 586 |
| 936 | Ga0496113_0000348 | 3300048916 | Bacteria | 22048 |
| 937 | Ga0496113_0000517 | 3300048916 | Bacteria | 19082 |
| 938 | Ga0496113_0009673 | 3300048916 | Bacteria | 6334 |
| 939 | Ga0496113_0029294 | 3300048916 | Bacteria | 3974 |
| 940 | Ga0496113_0111443 | 3300048916 | Bacteria | 2130 |
| 941 | Ga0496113_0280551 | 3300048916 | Bacteria | 1332 |
| 942 | Ga0496113_0437640 | 3300048916 | Bacteria | 1050 |
| 943 | Ga0496113_0587988 | 3300048916 | Bacteria | 892 |
| 944 | Ga0496113_0736272 | 3300048916 | Unclassified | 786 |
| 945 | Ga0496114_0006533 | 3300048917 | Bacteria | 9188 |
| 946 | Ga0496114_0040776 | 3300048917 | Bacteria | 3845 |
| 947 | Ga0496114_0049698 | 3300048917 | Bacteria | 3490 |
| 948 | Ga0496114_0103919 | 3300048917 | Bacteria | 2429 |
| 949 | Ga0496114_0146754 | 3300048917 | Archaea | 2045 |
| 950 | Ga0496114_0386149 | 3300048917 | Bacteria | 1240 |
| 951 | Ga0496115_0013945 | 3300048918 | Bacteria | 6081 |
| 952 | Ga0496115_0148931 | 3300048918 | Unclassified | 1932 |
| 953 | Ga0496115_0167086 | 3300048918 | Bacteria | 1819 |
| 954 | Ga0501031_0039879 | 3300049568 | Bacteria | 3065 |
| 955 | Ga0501033_0029867 | 3300049570 | Bacteria | 4097 |
| 956 | Ga0501034_1235817 | 3300049571 | Unclassified | 625 |
| 957 | Ga0501037_0012082 | 3300049573 | Bacteria | 6360 |
| 958 | Ga0501038_0035611 | 3300049574 | Bacteria | 4369 |
| 959 | Ga0501039_0306821 | 3300049575 | Bacteria | 1248 |
| 960 | Ga0501039_1226076 | 3300049575 | Unclassified | 580 |
| 961 | Ga0501040_0344775 | 3300049576 | Bacteria | 1067 |
| 962 | Ga0501040_1131388 | 3300049576 | Unclassified | 568 |
| 963 | Ga0501041_0479501 | 3300049577 | Unclassified | 790 |
| 964 | Ga0501043_0039517 | 3300049579 | Bacteria | 3707 |
| 965 | Ga0501046_0039413 | 3300049580 | Bacteria | 3783 |
| 966 | Ga0501048_0029528 | 3300049582 | Bacteria | 3975 |
| 967 | Ga0501067_0003623 | 3300049583 | Bacteria | 8506 |
| 968 | Ga0501067_0501486 | 3300049583 | Bacteria | 679 |
| 969 | Ga0501068_0001555 | 3300049584 | Bacteria | 12194 |
| 970 | Ga0501069_0009481 | 3300049585 | Bacteria | 5138 |
| 971 | Ga0501069_0127936 | 3300049585 | Unclassified | 1453 |
| 972 | Ga0501070_0025384 | 3300049586 | Bacteria | 4971 |
| 973 | Ga0501071_0130915 | 3300049587 | Bacteria | 1863 |
| 974 | Ga0501073_0023529 | 3300049589 | Bacteria | 4423 |
| 975 | Ga0501074_0136769 | 3300049590 | Bacteria | 1752 |
| 976 | Ga0501075_1176213 | 3300049591 | Unclassified | 582 |
| 977 | Ga0501076_0379388 | 3300049592 | Unclassified | 1162 |
| 978 | Ga0501077_0225333 | 3300049593 | Bacteria | 1191 |
| 979 | Ga0501079_0155730 | 3300049741 | Bacteria | 1781 |
| 980 | Ga0501079_0575980 | 3300049741 | Unclassified | 885 |
| 981 | Ga0501080_0301740 | 3300049742 | Unclassified | 1452 |
| 982 | Ga0501081_0132516 | 3300049743 | Bacteria | 1781 |
| 983 | Ga0501081_0754444 | 3300049743 | Unclassified | 731 |
| 984 | Ga0501044_0199243 | 3300049823 | Bacteria | 1961 |
| 985 | nmdc:mga03683_315896_c1 | 3300050489 | Bacteria | 735 |
| 986 | nmdc:mga0yw44_138644_c1 | 3300050492 | Unclassified | 1579 |
| 987 | nmdc:mga0k408_55235_c3 | 3300050493 | Unclassified | 1200 |
| 988 | nmdc:mga04h51_415833_c1 | 3300050495 | Unclassified | 565 |
| 989 | nmdc:mga05p37_1093043_c1 | 3300050507 | Bacteria | 836 |
| 990 | nmdc:mga05p37_125218_c1 | 3300050507 | Bacteria | 3156 |
| 991 | nmdc:mga05p37_144869_c1 | 3300050507 | Unclassified | 2515 |
| 992 | nmdc:mga05p37_201237_c1 | 3300050507 | Bacteria | 2412 |
| 993 | nmdc:mga05p37_24422_c1 | 3300050507 | Bacteria | 7346 |
| 994 | nmdc:mga05p37_24663_c1 | 3300050507 | Bacteria | 7310 |
| 995 | nmdc:mga05p37_334144_c1 | 3300050507 | Unclassified | 1789 |
| 996 | nmdc:mga05p37_389894_c1 | 3300050507 | Unclassified | 1629 |
| 997 | nmdc:mga05p37_396048_c1 | 3300050507 | Bacteria | 1614 |
| 998 | nmdc:mga05p37_50290_c1 | 3300050507 | Bacteria | 5126 |
| 999 | nmdc:mga05p37_543758_c1 | 3300050507 | Bacteria | 1324 |
| 1000 | nmdc:mga05p37_83026_c1 | 3300050507 | Bacteria | 3947 |
| 1001 | nmdc:mga09592_417436_c1 | 3300050508 | Bacteria | 1159 |
| 1002 | nmdc:mga09592_57738_c1 | 3300050508 | Bacteria | 3281 |
| 1003 | nmdc:mga0qj67_308794_c1 | 3300050509 | Unclassified | 1281 |
| 1004 | nmdc:mga0qj67_97880_c1 | 3300050509 | Bacteria | 2363 |
| 1005 | nmdc:mga06r32_178969_c1 | 3300050510 | Bacteria | 2106 |
| 1006 | nmdc:mga06r32_179427_c1 | 3300050510 | Bacteria | 2103 |
| 1007 | nmdc:mga06r32_239719_c1 | 3300050510 | Bacteria | 1801 |
| 1008 | nmdc:mga08y16_1009019_c1 | 3300050511 | Bacteria | 812 |
| 1009 | nmdc:mga08y16_265682_c1 | 3300050511 | Unclassified | 1771 |
| 1010 | nmdc:mga08y16_312266_c1 | 3300050511 | Unclassified | 1619 |
| 1011 | nmdc:mga08y16_35012_c1 | 3300050511 | Bacteria | 5275 |
| 1012 | nmdc:mga08y16_55059_c1 | 3300050511 | Bacteria | 4158 |
| 1013 | nmdc:mga08y16_670243_c1 | 3300050511 | Bacteria | 1040 |
| 1014 | nmdc:mga0n895_1030864_c1 | 3300050512 | Unclassified | 803 |
| 1015 | nmdc:mga0n895_109943_c1 | 3300050512 | Bacteria | 2772 |
| 1016 | nmdc:mga0n895_231138_c1 | 3300050512 | Bacteria | 1877 |
| 1017 | nmdc:mga0n895_740497_c1 | 3300050512 | Bacteria | 977 |
| 1018 | nmdc:mga0rr50_211727_c1 | 3300050513 | Bacteria | 1597 |
| 1019 | nmdc:mga0rr50_579811_c1 | 3300050513 | Unclassified | 956 |
| 1020 | nmdc:mga0rr50_7492_c1 | 3300050513 | Bacteria | 6737 |
| 1021 | nmdc:mga0rr50_84991_c1 | 3300050513 | Bacteria | 2451 |
| 1022 | nmdc:mga08x19_13594_c1 | 3300050514 | Bacteria | 4923 |
| 1023 | nmdc:mga08x19_14962_c2 | 3300050514 | Bacteria | 3315 |
| 1024 | nmdc:mga08x19_21012_c1 | 3300050514 | Unclassified | 4027 |
| 1025 | nmdc:mga08x19_272937_c1 | 3300050514 | Bacteria | 1171 |
| 1026 | nmdc:mga08x19_592281_c1 | 3300050514 | Bacteria | 786 |
| 1027 | nmdc:mga08x19_6183_c1 | 3300050514 | Bacteria | 7081 |
| 1028 | nmdc:mga08x19_98551_c1 | 3300050514 | Bacteria | 1936 |
| 1029 | nmdc:mga0a205_1081154_c1 | 3300050515 | Archaea | 649 |
| 1030 | nmdc:mga0a205_112662_c1 | 3300050515 | Bacteria | 2620 |
| 1031 | nmdc:mga0a205_1128227_c1 | 3300050515 | Bacteria | 632 |
| 1032 | nmdc:mga0a205_119284_c1 | 3300050515 | Bacteria | 2537 |
| 1033 | nmdc:mga0a205_135354_c1 | 3300050515 | Bacteria | 2364 |
| 1034 | nmdc:mga0a205_188610_c1 | 3300050515 | Unclassified | 1954 |
| 1035 | nmdc:mga0a205_40605_c1 | 3300050515 | Unclassified | 4480 |
| 1036 | nmdc:mga0a205_41461_c1 | 3300050515 | Bacteria | 4433 |
| 1037 | nmdc:mga0a205_6925_c1 | 3300050515 | Bacteria | 10250 |
| 1038 | nmdc:mga0a205_735184_c1 | 3300050515 | Unclassified | 836 |
| 1039 | Ga0501084_0026849 | 3300054114 | Bacteria | 4809 |
| 1040 | Ga0501084_0344986 | 3300054114 | Bacteria | 1258 |
| 1041 | Ga0501084_0686575 | 3300054114 | Unclassified | 864 |
| 1042 | Ga0501082_0040269 | 3300060353 | Bacteria | 4030 |
| 1043 | Ga0501082_0620675 | 3300060353 | Unclassified | 946 |
| 1044 | Ga0530510_0007885 | 3300061734 | Bacteria | 7427 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035121 | Ga0373960_0225761 | Ga0373960_0225761_199_651 | 150 |
| 2 | 3300041512 | Ga0451853_2523145 | Ga0451853_2523145_480_995 | 151 |
| 3 | 3300037418 | Ga0395900_0425495 | Ga0395900_0425495_720_1187 | 155 |
| 4 | 3300049591 | Ga0501075_1176213 | Ga0501075_1176213_28_504 | 155 |
| 5 | 3300005840 | Ga0068870_10436417 | Ga0068870_104364172 | 157 |
| 6 | 3300005616 | Ga0068852_101279306 | Ga0068852_1012793062 | 158 |
| 7 | 3300005343 | Ga0070687_100491928 | Ga0070687_1004919282 | 159 |
| 8 | 3300005440 | Ga0070705_101047777 | Ga0070705_1010477771 | 159 |
| 9 | 3300005457 | Ga0070662_100426494 | Ga0070662_1004264941 | 159 |
| 10 | 3300005466 | Ga0070685_10064227 | Ga0070685_100642272 | 159 |
| 11 | 3300005535 | Ga0070684_100082189 | Ga0070684_1000821893 | 159 |
| 12 | 3300005543 | Ga0070672_100218507 | Ga0070672_1002185072 | 159 |
| 13 | 3300005549 | Ga0070704_100099335 | Ga0070704_1000993352 | 159 |
| 14 | 3300005563 | Ga0068855_101140718 | Ga0068855_1011407182 | 159 |
| 15 | 3300005614 | Ga0068856_100286257 | Ga0068856_1002862572 | 159 |
| 16 | 3300005719 | Ga0068861_101212676 | Ga0068861_1012126762 | 159 |
| 17 | 3300005834 | Ga0068851_10455192 | Ga0068851_104551922 | 159 |
| 18 | 3300006881 | Ga0068865_100230077 | Ga0068865_1002300772 | 159 |
| 19 | 3300009098 | Ga0105245_10103124 | Ga0105245_101031242 | 159 |
| 20 | 3300009553 | Ga0105249_10239671 | Ga0105249_102396712 | 159 |
| 21 | 3300010375 | Ga0105239_10846751 | Ga0105239_108467512 | 159 |
| 22 | 3300013308 | Ga0157375_10085557 | Ga0157375_100855573 | 159 |
| 23 | 3300014745 | Ga0157377_10298941 | Ga0157377_102989412 | 159 |
| 24 | 3300025901 | Ga0207688_10006451 | Ga0207688_100064512 | 159 |
| 25 | 3300025918 | Ga0207662_10785812 | Ga0207662_107858122 | 159 |
| 26 | 3300025923 | Ga0207681_10976950 | Ga0207681_109769501 | 159 |
| 27 | 3300025927 | Ga0207687_10018369 | Ga0207687_100183694 | 159 |
| 28 | 3300025949 | Ga0207667_10598603 | Ga0207667_105986031 | 159 |
| 29 | 3300026078 | Ga0207702_10316656 | Ga0207702_103166562 | 159 |
| 30 | 3300048905 | Ga0496102_0174862 | Ga0496102_0174862_1149_1664 | 159 |
| 31 | 3300048909 | Ga0496106_0253920 | Ga0496106_0253920_449_964 | 159 |
| 32 | 3300048912 | Ga0496109_0218296 | Ga0496109_0218296_463_978 | 159 |
| 33 | 3300048913 | Ga0496110_0213997 | Ga0496110_0213997_1099_1614 | 159 |
| 34 | 3300048914 | Ga0496111_0011817 | Ga0496111_0011817_4821_5336 | 159 |
| 35 | 3300048915 | Ga0496112_0506847 | Ga0496112_0506847_523_1038 | 159 |
| 36 | 3300048916 | Ga0496113_0280551 | Ga0496113_0280551_195_710 | 159 |
| 37 | 3300048917 | Ga0496114_0386149 | Ga0496114_0386149_680_1195 | 159 |
| 38 | 3300005329 | Ga0070683_100116483 | Ga0070683_1001164832 | 160 |
| 39 | 3300005329 | Ga0070683_100501566 | Ga0070683_1005015662 | 160 |
| 40 | 3300005535 | Ga0070684_100034381 | Ga0070684_1000343812 | 160 |
| 41 | 3300005535 | Ga0070684_100045720 | Ga0070684_1000457204 | 160 |
| 42 | 3300005577 | Ga0068857_100330839 | Ga0068857_1003308392 | 160 |
| 43 | 3300005983 | Ga0081540_1001832 | Ga0081540_10018323 | 160 |
| 44 | 3300006881 | Ga0068865_100848258 | Ga0068865_1008482582 | 160 |
| 45 | 3300007076 | Ga0075435_100239734 | Ga0075435_1002397342 | 160 |
| 46 | 3300010375 | Ga0105239_11458945 | Ga0105239_114589451 | 160 |
| 47 | 3300014325 | Ga0163163_10138821 | Ga0163163_101388212 | 160 |
| 48 | 3300025920 | Ga0207649_10408558 | Ga0207649_104085582 | 160 |
| 49 | 3300025944 | Ga0207661_10507392 | Ga0207661_105073922 | 160 |
| 50 | 3300025944 | Ga0207661_11232827 | Ga0207661_112328272 | 160 |
| 51 | 3300025945 | Ga0207679_10266565 | Ga0207679_102665652 | 160 |
| 52 | 3300026078 | Ga0207702_10378967 | Ga0207702_103789672 | 160 |
| 53 | 3300026116 | Ga0207674_10352195 | Ga0207674_103521952 | 160 |
| 54 | 3300037312 | Ga0395899_0080290 | Ga0395899_0080290_833_1348 | 160 |
| 55 | 3300037312 | Ga0395899_0166224 | Ga0395899_0166224_673_1188 | 160 |
| 56 | 3300037418 | Ga0395900_0150523 | Ga0395900_0150523_1107_1622 | 160 |
| 57 | 3300037466 | Ga0395898_0013807 | Ga0395898_0013807_4844_5359 | 160 |
| 58 | 3300037466 | Ga0395898_0019220 | Ga0395898_0019220_5644_6168 | 160 |
| 59 | 3300037466 | Ga0395898_0043124 | Ga0395898_0043124_1545_2060 | 160 |
| 60 | 3300037471 | Ga0395905_0070105 | Ga0395905_0070105_1059_1574 | 160 |
| 61 | 3300037471 | Ga0395905_0093759 | Ga0395905_0093759_953_1468 | 160 |
| 62 | 3300037471 | Ga0395905_0184364 | Ga0395905_0184364_705_1220 | 160 |
| 63 | 3300038443 | Ga0395901_0005040 | Ga0395901_0005040_1838_2353 | 160 |
| 64 | 3300038443 | Ga0395901_0005491 | Ga0395901_0005491_5441_5965 | 160 |
| 65 | 3300038443 | Ga0395901_0006426 | Ga0395901_0006426_7358_7873 | 160 |
| 66 | 3300038443 | Ga0395901_0057024 | Ga0395901_0057024_2345_2860 | 160 |
| 67 | 3300042439 | Ga0439464_0087647 | Ga0439464_0087647_306_830 | 160 |
| 68 | 3300046461 | Ga0495641_0032927 | Ga0495641_0032927_902_1417 | 160 |
| 69 | 3300046473 | Ga0495582_0038176 | Ga0495582_0038176_1335_1850 | 160 |
| 70 | 3300046475 | Ga0495639_0158859 | Ga0495639_0158859_537_1052 | 160 |
| 71 | 3300046525 | Ga0495663_0024696 | Ga0495663_0024696_886_1401 | 160 |
| 72 | 3300046674 | Ga0495588_0258791 | Ga0495588_0258791_93_608 | 160 |
| 73 | 3300046683 | Ga0495658_0054043 | Ga0495658_0054043_1058_1573 | 160 |
| 74 | 3300046684 | Ga0495669_0003905 | Ga0495669_0003905_4455_4970 | 160 |
| 75 | 3300046691 | Ga0495670_0546789 | Ga0495670_0546789_40_555 | 160 |
| 76 | 3300046794 | Ga0495589_0088044 | Ga0495589_0088044_107_622 | 160 |
| 77 | 3300047315 | Ga0495581_0002069 | Ga0495581_0002069_10062_10577 | 160 |
| 78 | 3300048912 | Ga0496109_0241444 | Ga0496109_0241444_488_1003 | 160 |
| 79 | 3300048914 | Ga0496111_0073134 | Ga0496111_0073134_210_725 | 160 |
| 80 | 3300050513 | nmdc:mga0rr50_211727_c1 | nmdc:mga0rr50_211727_c1_777_1292 | 160 |
| 81 | 3300048913 | Ga0496110_0521517 | Ga0496110_0521517_89_610 | 161 |
| 82 | 3300009176 | Ga0105242_10129654 | Ga0105242_101296542 | 162 |
| 83 | 3300025935 | Ga0207709_10148433 | Ga0207709_101484332 | 162 |
| 84 | 3300025938 | Ga0207704_10262359 | Ga0207704_102623592 | 162 |
| 85 | 3300026089 | Ga0207648_10655238 | Ga0207648_106552382 | 162 |
| 86 | 3300037418 | Ga0395900_0491270 | Ga0395900_0491270_295_810 | 162 |
| 87 | 3300037466 | Ga0395898_0015187 | Ga0395898_0015187_4970_5485 | 162 |
| 88 | 3300037466 | Ga0395898_0484824 | Ga0395898_0484824_53_625 | 162 |
| 89 | 3300037466 | Ga0395898_0714038 | Ga0395898_0714038_234_749 | 162 |
| 90 | 3300038443 | Ga0395901_0023693 | Ga0395901_0023693_462_977 | 162 |
| 91 | 3300041512 | Ga0451853_1957809 | Ga0451853_1957809_84_599 | 162 |
| 92 | 3300044706 | Ga0466964_0211381 | Ga0466964_0211381_350_865 | 162 |
| 93 | 3300005981 | Ga0081538_10004394 | Ga0081538_100043942 | 163 |
| 94 | 3300049568 | Ga0501031_0039879 | Ga0501031_0039879_285_800 | 163 |
| 95 | 3300049570 | Ga0501033_0029867 | Ga0501033_0029867_3263_3778 | 163 |
| 96 | 3300049571 | Ga0501034_1235817 | Ga0501034_1235817_85_600 | 163 |
| 97 | 3300049573 | Ga0501037_0012082 | Ga0501037_0012082_4066_4581 | 163 |
| 98 | 3300049574 | Ga0501038_0035611 | Ga0501038_0035611_506_1021 | 163 |
| 99 | 3300049577 | Ga0501041_0479501 | Ga0501041_0479501_237_752 | 163 |
| 100 | 3300049579 | Ga0501043_0039517 | Ga0501043_0039517_3171_3686 | 163 |
| 101 | 3300049580 | Ga0501046_0039413 | Ga0501046_0039413_23_538 | 163 |
| 102 | 3300049582 | Ga0501048_0029528 | Ga0501048_0029528_3426_3941 | 163 |
| 103 | 3300049584 | Ga0501068_0001555 | Ga0501068_0001555_11506_12021 | 163 |
| 104 | 3300049585 | Ga0501069_0127936 | Ga0501069_0127936_244_759 | 163 |
| 105 | 3300049586 | Ga0501070_0025384 | Ga0501070_0025384_1099_1614 | 163 |
| 106 | 3300049587 | Ga0501071_0130915 | Ga0501071_0130915_1252_1767 | 163 |
| 107 | 3300049589 | Ga0501073_0023529 | Ga0501073_0023529_575_1090 | 163 |
| 108 | 3300049590 | Ga0501074_0136769 | Ga0501074_0136769_899_1414 | 163 |
| 109 | 3300049593 | Ga0501077_0225333 | Ga0501077_0225333_575_1090 | 163 |
| 110 | 3300049741 | Ga0501079_0575980 | Ga0501079_0575980_237_752 | 163 |
| 111 | 3300049742 | Ga0501080_0301740 | Ga0501080_0301740_100_615 | 163 |
| 112 | 3300049743 | Ga0501081_0132516 | Ga0501081_0132516_15_530 | 163 |
| 113 | 3300049823 | Ga0501044_0199243 | Ga0501044_0199243_459_974 | 163 |
| 114 | 3300054114 | Ga0501084_0026849 | Ga0501084_0026849_373_888 | 163 |
| 115 | 3300060353 | Ga0501082_0040269 | Ga0501082_0040269_3279_3794 | 163 |
| 116 | 3300005535 | Ga0070684_100076939 | Ga0070684_1000769392 | 164 |
| 117 | 3300005577 | Ga0068857_100002049 | Ga0068857_1000020498 | 164 |
| 118 | 3300009094 | Ga0111539_10048629 | Ga0111539_100486292 | 164 |
| 119 | 3300036401 | Ga0373937_0501071 | Ga0373937_0501071_265_759 | 164 |
| 120 | 3300041512 | Ga0451853_2580887 | Ga0451853_2580887_321_848 | 164 |
| 121 | 3300046520 | Ga0495637_0158943 | Ga0495637_0158943_26_553 | 164 |
| 122 | 3300046615 | Ga0495656_0124863 | Ga0495656_0124863_387_914 | 164 |
| 123 | 3300006844 | Ga0075428_100421592 | Ga0075428_1004215922 | 165 |
| 124 | 3300048911 | Ga0496108_0433756 | Ga0496108_0433756_139_663 | 165 |
| 125 | 3300048916 | Ga0496113_0587988 | Ga0496113_0587988_258_782 | 165 |
| 126 | 3300005329 | Ga0070683_101416551 | Ga0070683_1014165511 | 166 |
| 127 | 3300005614 | Ga0068856_101335245 | Ga0068856_1013352451 | 166 |
| 128 | 3300044735 | Ga0466968_0062895 | Ga0466968_0062895_454_984 | 166 |
| 129 | 3300046491 | Ga0495584_0244774 | Ga0495584_0244774_189_719 | 166 |
| 130 | 3300048904 | Ga0496101_0557067 | Ga0496101_0557067_294_794 | 166 |
| 131 | 3300048907 | Ga0496104_0125302 | Ga0496104_0125302_555_1055 | 166 |
| 132 | 3300048908 | Ga0496105_0004474 | Ga0496105_0004474_369_869 | 166 |
| 133 | 3300048910 | Ga0496107_0053510 | Ga0496107_0053510_1380_1880 | 166 |
| 134 | 3300048911 | Ga0496108_0033984 | Ga0496108_0033984_772_1272 | 166 |
| 135 | 3300048912 | Ga0496109_0048017 | Ga0496109_0048017_2549_3049 | 166 |
| 136 | 3300048914 | Ga0496111_0071825 | Ga0496111_0071825_805_1305 | 166 |
| 137 | 3300048915 | Ga0496112_0116095 | Ga0496112_0116095_585_1085 | 166 |
| 138 | 3300050512 | nmdc:mga0n895_1030864_c1 | nmdc:mga0n895_1030864_c1_210_779 | 166 |
| 139 | 3300005336 | Ga0070680_100757823 | Ga0070680_1007578232 | 167 |
| 140 | 3300005338 | Ga0068868_100033702 | Ga0068868_1000337023 | 167 |
| 141 | 3300005341 | Ga0070691_10048520 | Ga0070691_100485202 | 167 |
| 142 | 3300005445 | Ga0070708_100629584 | Ga0070708_1006295842 | 167 |
| 143 | 3300005614 | Ga0068856_100126707 | Ga0068856_1001267073 | 167 |
| 144 | 3300005615 | Ga0070702_100686655 | Ga0070702_1006866551 | 167 |
| 145 | 3300009098 | Ga0105245_10003939 | Ga0105245_1000393913 | 167 |
| 146 | 3300009553 | Ga0105249_11825997 | Ga0105249_118259971 | 167 |
| 147 | 3300026078 | Ga0207702_10407837 | Ga0207702_104078371 | 167 |
| 148 | 3300037471 | Ga0395905_0322654 | Ga0395905_0322654_869_1387 | 167 |
| 149 | 3300038443 | Ga0395901_0287413 | Ga0395901_0287413_790_1308 | 167 |
| 150 | 3300048912 | Ga0496109_0113098 | Ga0496109_0113098_48_578 | 167 |
| 151 | 3300048916 | Ga0496113_0029294 | Ga0496113_0029294_264_794 | 167 |
| 152 | 3300002077 | JGI24744J21845_10002375 | JGI24744J21845_100023753 | 168 |
| 153 | 3300002244 | JGI24742J22300_10004954 | JGI24742J22300_100049543 | 168 |
| 154 | 3300005334 | Ga0068869_100182735 | Ga0068869_1001827352 | 168 |
| 155 | 3300005335 | Ga0070666_10031090 | Ga0070666_100310902 | 168 |
| 156 | 3300005336 | Ga0070680_100005260 | Ga0070680_1000052603 | 168 |
| 157 | 3300005337 | Ga0070682_100012384 | Ga0070682_1000123844 | 168 |
| 158 | 3300005338 | Ga0068868_100007477 | Ga0068868_1000074778 | 168 |
| 159 | 3300005338 | Ga0068868_100196786 | Ga0068868_1001967861 | 168 |
| 160 | 3300005338 | Ga0068868_100332674 | Ga0068868_1003326741 | 168 |
| 161 | 3300005339 | Ga0070660_100017417 | Ga0070660_1000174176 | 168 |
| 162 | 3300005341 | Ga0070691_10173078 | Ga0070691_101730782 | 168 |
| 163 | 3300005343 | Ga0070687_100002213 | Ga0070687_1000022133 | 168 |
| 164 | 3300005347 | Ga0070668_100013775 | Ga0070668_1000137752 | 168 |
| 165 | 3300005347 | Ga0070668_100103386 | Ga0070668_1001033862 | 168 |
| 166 | 3300005353 | Ga0070669_100049662 | Ga0070669_1000496622 | 168 |
| 167 | 3300005353 | Ga0070669_100136816 | Ga0070669_1001368162 | 168 |
| 168 | 3300005355 | Ga0070671_100160733 | Ga0070671_1001607332 | 168 |
| 169 | 3300005355 | Ga0070671_100501361 | Ga0070671_1005013612 | 168 |
| 170 | 3300005356 | Ga0070674_100007121 | Ga0070674_1000071213 | 168 |
| 171 | 3300005364 | Ga0070673_100111008 | Ga0070673_1001110082 | 168 |
| 172 | 3300005365 | Ga0070688_100027191 | Ga0070688_1000271912 | 168 |
| 173 | 3300005366 | Ga0070659_100006017 | Ga0070659_1000060172 | 168 |
| 174 | 3300005406 | Ga0070703_10016248 | Ga0070703_100162482 | 168 |
| 175 | 3300005406 | Ga0070703_10046578 | Ga0070703_100465782 | 168 |
| 176 | 3300005406 | Ga0070703_10274980 | Ga0070703_102749801 | 168 |
| 177 | 3300005434 | Ga0070709_10172234 | Ga0070709_101722342 | 168 |
| 178 | 3300005434 | Ga0070709_10233108 | Ga0070709_102331082 | 168 |
| 179 | 3300005434 | Ga0070709_10247637 | Ga0070709_102476372 | 168 |
| 180 | 3300005435 | Ga0070714_100043410 | Ga0070714_1000434102 | 168 |
| 181 | 3300005436 | Ga0070713_100146039 | Ga0070713_1001460392 | 168 |
| 182 | 3300005436 | Ga0070713_100199280 | Ga0070713_1001992802 | 168 |
| 183 | 3300005436 | Ga0070713_100547983 | Ga0070713_1005479832 | 168 |
| 184 | 3300005437 | Ga0070710_10007964 | Ga0070710_100079644 | 168 |
| 185 | 3300005437 | Ga0070710_10807793 | Ga0070710_108077931 | 168 |
| 186 | 3300005438 | Ga0070701_10578796 | Ga0070701_105787962 | 168 |
| 187 | 3300005439 | Ga0070711_100044986 | Ga0070711_1000449862 | 168 |
| 188 | 3300005439 | Ga0070711_100088282 | Ga0070711_1000882822 | 168 |
| 189 | 3300005439 | Ga0070711_100154294 | Ga0070711_1001542942 | 168 |
| 190 | 3300005439 | Ga0070711_100308387 | Ga0070711_1003083872 | 168 |
| 191 | 3300005440 | Ga0070705_100006285 | Ga0070705_1000062855 | 168 |
| 192 | 3300005440 | Ga0070705_100023676 | Ga0070705_1000236762 | 168 |
| 193 | 3300005440 | Ga0070705_100065951 | Ga0070705_1000659512 | 168 |
| 194 | 3300005440 | Ga0070705_101370163 | Ga0070705_1013701631 | 168 |
| 195 | 3300005441 | Ga0070700_100002719 | Ga0070700_1000027192 | 168 |
| 196 | 3300005441 | Ga0070700_100566038 | Ga0070700_1005660382 | 168 |
| 197 | 3300005444 | Ga0070694_100093215 | Ga0070694_1000932152 | 168 |
| 198 | 3300005444 | Ga0070694_100155948 | Ga0070694_1001559482 | 168 |
| 199 | 3300005444 | Ga0070694_100825827 | Ga0070694_1008258272 | 168 |
| 200 | 3300005445 | Ga0070708_100234230 | Ga0070708_1002342302 | 168 |
| 201 | 3300005445 | Ga0070708_100335223 | Ga0070708_1003352232 | 168 |
| 202 | 3300005445 | Ga0070708_100698584 | Ga0070708_1006985841 | 168 |
| 203 | 3300005445 | Ga0070708_100971799 | Ga0070708_1009717992 | 168 |
| 204 | 3300005455 | Ga0070663_100032578 | Ga0070663_1000325782 | 168 |
| 205 | 3300005456 | Ga0070678_100004375 | Ga0070678_1000043755 | 168 |
| 206 | 3300005457 | Ga0070662_100633830 | Ga0070662_1006338301 | 168 |
| 207 | 3300005459 | Ga0068867_100005708 | Ga0068867_1000057087 | 168 |
| 208 | 3300005466 | Ga0070685_10105360 | Ga0070685_101053602 | 168 |
| 209 | 3300005467 | Ga0070706_100019076 | Ga0070706_1000190765 | 168 |
| 210 | 3300005467 | Ga0070706_100185132 | Ga0070706_1001851322 | 168 |
| 211 | 3300005468 | Ga0070707_100001783 | Ga0070707_10000178315 | 168 |
| 212 | 3300005468 | Ga0070707_100024924 | Ga0070707_1000249245 | 168 |
| 213 | 3300005468 | Ga0070707_100877839 | Ga0070707_1008778392 | 168 |
| 214 | 3300005471 | Ga0070698_100003764 | Ga0070698_10000376414 | 168 |
| 215 | 3300005471 | Ga0070698_100304001 | Ga0070698_1003040012 | 168 |
| 216 | 3300005471 | Ga0070698_100485650 | Ga0070698_1004856502 | 168 |
| 217 | 3300005471 | Ga0070698_100567355 | Ga0070698_1005673551 | 168 |
| 218 | 3300005518 | Ga0070699_100080796 | Ga0070699_1000807962 | 168 |
| 219 | 3300005518 | Ga0070699_100101562 | Ga0070699_1001015622 | 168 |
| 220 | 3300005518 | Ga0070699_100267627 | Ga0070699_1002676272 | 168 |
| 221 | 3300005530 | Ga0070679_100105399 | Ga0070679_1001053992 | 168 |
| 222 | 3300005535 | Ga0070684_100295315 | Ga0070684_1002953152 | 168 |
| 223 | 3300005536 | Ga0070697_100080962 | Ga0070697_1000809622 | 168 |
| 224 | 3300005539 | Ga0068853_100003873 | Ga0068853_1000038739 | 168 |
| 225 | 3300005539 | Ga0068853_100931623 | Ga0068853_1009316231 | 168 |
| 226 | 3300005544 | Ga0070686_100000943 | Ga0070686_10000094313 | 168 |
| 227 | 3300005545 | Ga0070695_100012438 | Ga0070695_1000124385 | 168 |
| 228 | 3300005545 | Ga0070695_100135041 | Ga0070695_1001350412 | 168 |
| 229 | 3300005545 | Ga0070695_100348663 | Ga0070695_1003486632 | 168 |
| 230 | 3300005546 | Ga0070696_100411692 | Ga0070696_1004116922 | 168 |
| 231 | 3300005547 | Ga0070693_100336732 | Ga0070693_1003367322 | 168 |
| 232 | 3300005548 | Ga0070665_100105153 | Ga0070665_1001051532 | 168 |
| 233 | 3300005549 | Ga0070704_100019935 | Ga0070704_1000199353 | 168 |
| 234 | 3300005549 | Ga0070704_100046083 | Ga0070704_1000460833 | 168 |
| 235 | 3300005549 | Ga0070704_100182344 | Ga0070704_1001823442 | 168 |
| 236 | 3300005549 | Ga0070704_100383010 | Ga0070704_1003830101 | 168 |
| 237 | 3300005549 | Ga0070704_100702712 | Ga0070704_1007027121 | 168 |
| 238 | 3300005563 | Ga0068855_100185558 | Ga0068855_1001855583 | 168 |
| 239 | 3300005563 | Ga0068855_100297477 | Ga0068855_1002974772 | 168 |
| 240 | 3300005578 | Ga0068854_100114950 | Ga0068854_1001149503 | 168 |
| 241 | 3300005614 | Ga0068856_100024228 | Ga0068856_1000242285 | 168 |
| 242 | 3300005615 | Ga0070702_100018435 | Ga0070702_1000184353 | 168 |
| 243 | 3300005615 | Ga0070702_100021765 | Ga0070702_1000217652 | 168 |
| 244 | 3300005618 | Ga0068864_100857961 | Ga0068864_1008579612 | 168 |
| 245 | 3300005718 | Ga0068866_10000764 | Ga0068866_100007647 | 168 |
| 246 | 3300005718 | Ga0068866_10229353 | Ga0068866_102293532 | 168 |
| 247 | 3300005718 | Ga0068866_10401324 | Ga0068866_104013241 | 168 |
| 248 | 3300005843 | Ga0068860_100127996 | Ga0068860_1001279962 | 168 |
| 249 | 3300005937 | Ga0081455_10704161 | Ga0081455_107041611 | 168 |
| 250 | 3300005985 | Ga0081539_10001744 | Ga0081539_100017444 | 168 |
| 251 | 3300005985 | Ga0081539_10020490 | Ga0081539_100204902 | 168 |
| 252 | 3300006028 | Ga0070717_10079377 | Ga0070717_100793772 | 168 |
| 253 | 3300006028 | Ga0070717_10090381 | Ga0070717_100903813 | 168 |
| 254 | 3300006163 | Ga0070715_10005627 | Ga0070715_100056274 | 168 |
| 255 | 3300006175 | Ga0070712_100022142 | Ga0070712_1000221424 | 168 |
| 256 | 3300006175 | Ga0070712_100033859 | Ga0070712_1000338595 | 168 |
| 257 | 3300006175 | Ga0070712_100269885 | Ga0070712_1002698852 | 168 |
| 258 | 3300006358 | Ga0068871_100012207 | Ga0068871_1000122072 | 168 |
| 259 | 3300006844 | Ga0075428_100105525 | Ga0075428_1001055252 | 168 |
| 260 | 3300006844 | Ga0075428_100121597 | Ga0075428_1001215972 | 168 |
| 261 | 3300006844 | Ga0075428_100188863 | Ga0075428_1001888633 | 168 |
| 262 | 3300006847 | Ga0075431_100262795 | Ga0075431_1002627953 | 168 |
| 263 | 3300006852 | Ga0075433_10067965 | Ga0075433_100679652 | 168 |
| 264 | 3300006852 | Ga0075433_10192041 | Ga0075433_101920412 | 168 |
| 265 | 3300006871 | Ga0075434_100039725 | Ga0075434_1000397254 | 168 |
| 266 | 3300006871 | Ga0075434_100074461 | Ga0075434_1000744613 | 168 |
| 267 | 3300006871 | Ga0075434_100293997 | Ga0075434_1002939971 | 168 |
| 268 | 3300006881 | Ga0068865_100123897 | Ga0068865_1001238973 | 168 |
| 269 | 3300006881 | Ga0068865_100160948 | Ga0068865_1001609481 | 168 |
| 270 | 3300006881 | Ga0068865_101578123 | Ga0068865_1015781231 | 168 |
| 271 | 3300006914 | Ga0075436_100015251 | Ga0075436_1000152515 | 168 |
| 272 | 3300006914 | Ga0075436_100016564 | Ga0075436_1000165643 | 168 |
| 273 | 3300006914 | Ga0075436_100081641 | Ga0075436_1000816412 | 168 |
| 274 | 3300007076 | Ga0075435_100020293 | Ga0075435_1000202935 | 168 |
| 275 | 3300007076 | Ga0075435_100046938 | Ga0075435_1000469383 | 168 |
| 276 | 3300007076 | Ga0075435_100170484 | Ga0075435_1001704842 | 168 |
| 277 | 3300009093 | Ga0105240_11143288 | Ga0105240_111432882 | 168 |
| 278 | 3300009094 | Ga0111539_10525573 | Ga0111539_105255732 | 168 |
| 279 | 3300009094 | Ga0111539_11812147 | Ga0111539_118121471 | 168 |
| 280 | 3300009098 | Ga0105245_10010008 | Ga0105245_100100082 | 168 |
| 281 | 3300009098 | Ga0105245_10084989 | Ga0105245_100849893 | 168 |
| 282 | 3300009098 | Ga0105245_10821808 | Ga0105245_108218082 | 168 |
| 283 | 3300009101 | Ga0105247_10020070 | Ga0105247_100200702 | 168 |
| 284 | 3300009147 | Ga0114129_10017054 | Ga0114129_100170541 | 168 |
| 285 | 3300009147 | Ga0114129_10019724 | Ga0114129_100197244 | 168 |
| 286 | 3300009147 | Ga0114129_10067861 | Ga0114129_100678613 | 168 |
| 287 | 3300009147 | Ga0114129_10217085 | Ga0114129_102170852 | 168 |
| 288 | 3300009147 | Ga0114129_10423208 | Ga0114129_104232082 | 168 |
| 289 | 3300009147 | Ga0114129_10453248 | Ga0114129_104532482 | 168 |
| 290 | 3300009147 | Ga0114129_12316745 | Ga0114129_123167451 | 168 |
| 291 | 3300009148 | Ga0105243_10023342 | Ga0105243_100233427 | 168 |
| 292 | 3300009148 | Ga0105243_10365523 | Ga0105243_103655232 | 168 |
| 293 | 3300009174 | Ga0105241_10055898 | Ga0105241_100558983 | 168 |
| 294 | 3300009176 | Ga0105242_10026948 | Ga0105242_100269483 | 168 |
| 295 | 3300009177 | Ga0105248_10057042 | Ga0105248_100570427 | 168 |
| 296 | 3300009177 | Ga0105248_10095769 | Ga0105248_100957692 | 168 |
| 297 | 3300009545 | Ga0105237_10085281 | Ga0105237_100852812 | 168 |
| 298 | 3300009551 | Ga0105238_10195548 | Ga0105238_101955482 | 168 |
| 299 | 3300009553 | Ga0105249_10000587 | Ga0105249_1000058723 | 168 |
| 300 | 3300010375 | Ga0105239_10014910 | Ga0105239_100149106 | 168 |
| 301 | 3300011119 | Ga0105246_10380959 | Ga0105246_103809592 | 168 |
| 302 | 3300011119 | Ga0105246_10444324 | Ga0105246_104443242 | 168 |
| 303 | 3300013296 | Ga0157374_10007194 | Ga0157374_100071946 | 168 |
| 304 | 3300013297 | Ga0157378_10032376 | Ga0157378_100323762 | 168 |
| 305 | 3300013306 | Ga0163162_10001280 | Ga0163162_1000128022 | 168 |
| 306 | 3300013307 | Ga0157372_10871570 | Ga0157372_108715702 | 168 |
| 307 | 3300013308 | Ga0157375_10004811 | Ga0157375_100048112 | 168 |
| 308 | 3300013308 | Ga0157375_10119671 | Ga0157375_101196712 | 168 |
| 309 | 3300013308 | Ga0157375_10599702 | Ga0157375_105997022 | 168 |
| 310 | 3300014326 | Ga0157380_10003890 | Ga0157380_1000389010 | 168 |
| 311 | 3300014745 | Ga0157377_10000519 | Ga0157377_100005192 | 168 |
| 312 | 3300014969 | Ga0157376_10007715 | Ga0157376_100077153 | 168 |
| 313 | 3300025885 | Ga0207653_10018918 | Ga0207653_100189182 | 168 |
| 314 | 3300025898 | Ga0207692_10022049 | Ga0207692_100220492 | 168 |
| 315 | 3300025898 | Ga0207692_10043401 | Ga0207692_100434012 | 168 |
| 316 | 3300025899 | Ga0207642_10009110 | Ga0207642_100091104 | 168 |
| 317 | 3300025899 | Ga0207642_10593416 | Ga0207642_105934161 | 168 |
| 318 | 3300025900 | Ga0207710_10163940 | Ga0207710_101639402 | 168 |
| 319 | 3300025903 | Ga0207680_10018430 | Ga0207680_100184304 | 168 |
| 320 | 3300025905 | Ga0207685_10052420 | Ga0207685_100524202 | 168 |
| 321 | 3300025906 | Ga0207699_10067830 | Ga0207699_100678303 | 168 |
| 322 | 3300025906 | Ga0207699_10212009 | Ga0207699_102120092 | 168 |
| 323 | 3300025906 | Ga0207699_10855588 | Ga0207699_108555881 | 168 |
| 324 | 3300025910 | Ga0207684_10008644 | Ga0207684_100086442 | 168 |
| 325 | 3300025915 | Ga0207693_10000126 | Ga0207693_1000012612 | 168 |
| 326 | 3300025915 | Ga0207693_10001293 | Ga0207693_100012937 | 168 |
| 327 | 3300025915 | Ga0207693_10004168 | Ga0207693_100041687 | 168 |
| 328 | 3300025915 | Ga0207693_10004553 | Ga0207693_100045533 | 168 |
| 329 | 3300025915 | Ga0207693_10005548 | Ga0207693_100055483 | 168 |
| 330 | 3300025915 | Ga0207693_11132472 | Ga0207693_111324721 | 168 |
| 331 | 3300025916 | Ga0207663_10006439 | Ga0207663_100064395 | 168 |
| 332 | 3300025916 | Ga0207663_10021176 | Ga0207663_100211763 | 168 |
| 333 | 3300025916 | Ga0207663_10564191 | Ga0207663_105641911 | 168 |
| 334 | 3300025918 | Ga0207662_10004854 | Ga0207662_100048547 | 168 |
| 335 | 3300025919 | Ga0207657_10002174 | Ga0207657_1000217410 | 168 |
| 336 | 3300025921 | Ga0207652_10086612 | Ga0207652_100866122 | 168 |
| 337 | 3300025922 | Ga0207646_10013769 | Ga0207646_100137692 | 168 |
| 338 | 3300025922 | Ga0207646_10238814 | Ga0207646_102388142 | 168 |
| 339 | 3300025922 | Ga0207646_11259948 | Ga0207646_112599481 | 168 |
| 340 | 3300025923 | Ga0207681_10126167 | Ga0207681_101261672 | 168 |
| 341 | 3300025927 | Ga0207687_10947775 | Ga0207687_109477751 | 168 |
| 342 | 3300025928 | Ga0207700_10000021 | Ga0207700_10000021109 | 168 |
| 343 | 3300025928 | Ga0207700_10051449 | Ga0207700_100514494 | 168 |
| 344 | 3300025928 | Ga0207700_10058666 | Ga0207700_100586663 | 168 |
| 345 | 3300025929 | Ga0207664_10271946 | Ga0207664_102719462 | 168 |
| 346 | 3300025931 | Ga0207644_10187861 | Ga0207644_101878612 | 168 |
| 347 | 3300025932 | Ga0207690_10053964 | Ga0207690_100539642 | 168 |
| 348 | 3300025934 | Ga0207686_10001422 | Ga0207686_100014227 | 168 |
| 349 | 3300025935 | Ga0207709_10000790 | Ga0207709_1000079019 | 168 |
| 350 | 3300025935 | Ga0207709_10167845 | Ga0207709_101678452 | 168 |
| 351 | 3300025937 | Ga0207669_10002149 | Ga0207669_100021498 | 168 |
| 352 | 3300025938 | Ga0207704_10017089 | Ga0207704_100170892 | 168 |
| 353 | 3300025938 | Ga0207704_11373733 | Ga0207704_113737331 | 168 |
| 354 | 3300025939 | Ga0207665_10006449 | Ga0207665_100064497 | 168 |
| 355 | 3300025939 | Ga0207665_10007677 | Ga0207665_100076776 | 168 |
| 356 | 3300025939 | Ga0207665_10009746 | Ga0207665_100097465 | 168 |
| 357 | 3300025940 | Ga0207691_10034963 | Ga0207691_100349635 | 168 |
| 358 | 3300025941 | Ga0207711_10820568 | Ga0207711_108205681 | 168 |
| 359 | 3300025942 | Ga0207689_10754666 | Ga0207689_107546661 | 168 |
| 360 | 3300025949 | Ga0207667_11145773 | Ga0207667_111457732 | 168 |
| 361 | 3300025972 | Ga0207668_10165743 | Ga0207668_101657432 | 168 |
| 362 | 3300025972 | Ga0207668_10445188 | Ga0207668_104451882 | 168 |
| 363 | 3300025981 | Ga0207640_10111176 | Ga0207640_101111762 | 168 |
| 364 | 3300026023 | Ga0207677_10023679 | Ga0207677_100236792 | 168 |
| 365 | 3300026023 | Ga0207677_10407276 | Ga0207677_104072762 | 168 |
| 366 | 3300026075 | Ga0207708_10000415 | Ga0207708_1000041521 | 168 |
| 367 | 3300026078 | Ga0207702_10053634 | Ga0207702_100536343 | 168 |
| 368 | 3300026089 | Ga0207648_10000705 | Ga0207648_1000070534 | 168 |
| 369 | 3300026095 | Ga0207676_10437126 | Ga0207676_104371262 | 168 |
| 370 | 3300026118 | Ga0207675_100013655 | Ga0207675_1000136552 | 168 |
| 371 | 3300026118 | Ga0207675_100096119 | Ga0207675_1000961193 | 168 |
| 372 | 3300026121 | Ga0207683_10003390 | Ga0207683_100033904 | 168 |
| 373 | 3300026121 | Ga0207683_10392585 | Ga0207683_103925852 | 168 |
| 374 | 3300026142 | Ga0207698_10321420 | Ga0207698_103214202 | 168 |
| 375 | 3300028379 | Ga0268266_10006952 | Ga0268266_100069528 | 168 |
| 376 | 3300028380 | Ga0268265_10112597 | Ga0268265_101125973 | 168 |
| 377 | 3300028380 | Ga0268265_10220668 | Ga0268265_102206682 | 168 |
| 378 | 3300028381 | Ga0268264_10322409 | Ga0268264_103224092 | 168 |
| 379 | 3300034818 | Ga0373950_0043100 | Ga0373950_0043100_323_850 | 168 |
| 380 | 3300034819 | Ga0373958_0005198 | Ga0373958_0005198_748_1275 | 168 |
| 381 | 3300034820 | Ga0373959_0027491 | Ga0373959_0027491_101_628 | 168 |
| 382 | 3300034957 | Ga0373938_0001272 | Ga0373938_0001272_44_571 | 168 |
| 383 | 3300035085 | Ga0373929_0015768 | Ga0373929_0015768_540_1067 | 168 |
| 384 | 3300035088 | Ga0373940_0101763 | Ga0373940_0101763_68_595 | 168 |
| 385 | 3300035090 | Ga0373949_0001749 | Ga0373949_0001749_4264_4791 | 168 |
| 386 | 3300035091 | Ga0373951_0001128 | Ga0373951_0001128_1229_1756 | 168 |
| 387 | 3300035113 | Ga0373936_0304412 | Ga0373936_0304412_26_532 | 168 |
| 388 | 3300035115 | Ga0373941_0001344 | Ga0373941_0001344_3577_4104 | 168 |
| 389 | 3300035207 | Ga0373942_0043410 | Ga0373942_0043410_621_1148 | 168 |
| 390 | 3300035241 | Ga0373961_0023497 | Ga0373961_0023497_765_1292 | 168 |
| 391 | 3300035242 | Ga0373962_0025901 | Ga0373962_0025901_380_907 | 168 |
| 392 | 3300037312 | Ga0395899_0006761 | Ga0395899_0006761_2808_3335 | 168 |
| 393 | 3300037312 | Ga0395899_0027290 | Ga0395899_0027290_2604_3110 | 168 |
| 394 | 3300037312 | Ga0395899_0050383 | Ga0395899_0050383_1238_1744 | 168 |
| 395 | 3300037312 | Ga0395899_0058260 | Ga0395899_0058260_773_1279 | 168 |
| 396 | 3300037312 | Ga0395899_0073964 | Ga0395899_0073964_933_1439 | 168 |
| 397 | 3300037312 | Ga0395899_0333453 | Ga0395899_0333453_481_987 | 168 |
| 398 | 3300037418 | Ga0395900_0001501 | Ga0395900_0001501_13677_14183 | 168 |
| 399 | 3300037418 | Ga0395900_0004261 | Ga0395900_0004261_2824_3351 | 168 |
| 400 | 3300037418 | Ga0395900_0021493 | Ga0395900_0021493_3193_3699 | 168 |
| 401 | 3300037418 | Ga0395900_0023612 | Ga0395900_0023612_2157_2684 | 168 |
| 402 | 3300037418 | Ga0395900_0050757 | Ga0395900_0050757_3323_3829 | 168 |
| 403 | 3300037418 | Ga0395900_0090007 | Ga0395900_0090007_316_822 | 168 |
| 404 | 3300037418 | Ga0395900_0220790 | Ga0395900_0220790_1357_1863 | 168 |
| 405 | 3300037418 | Ga0395900_0461227 | Ga0395900_0461227_579_1085 | 168 |
| 406 | 3300037418 | Ga0395900_0572930 | Ga0395900_0572930_490_996 | 168 |
| 407 | 3300037466 | Ga0395898_0002545 | Ga0395898_0002545_18237_18764 | 168 |
| 408 | 3300037466 | Ga0395898_0002887 | Ga0395898_0002887_9314_9820 | 168 |
| 409 | 3300037466 | Ga0395898_0003194 | Ga0395898_0003194_3028_3534 | 168 |
| 410 | 3300037466 | Ga0395898_0005122 | Ga0395898_0005122_7718_8224 | 168 |
| 411 | 3300037466 | Ga0395898_0005553 | Ga0395898_0005553_9423_9950 | 168 |
| 412 | 3300037466 | Ga0395898_0015522 | Ga0395898_0015522_4996_5502 | 168 |
| 413 | 3300037466 | Ga0395898_0022052 | Ga0395898_0022052_781_1287 | 168 |
| 414 | 3300037466 | Ga0395898_0073442 | Ga0395898_0073442_724_1230 | 168 |
| 415 | 3300037466 | Ga0395898_0458317 | Ga0395898_0458317_438_962 | 168 |
| 416 | 3300037466 | Ga0395898_0625136 | Ga0395898_0625136_150_656 | 168 |
| 417 | 3300037466 | Ga0395898_0678038 | Ga0395898_0678038_129_635 | 168 |
| 418 | 3300037471 | Ga0395905_0010133 | Ga0395905_0010133_2901_3428 | 168 |
| 419 | 3300037471 | Ga0395905_0014700 | Ga0395905_0014700_4927_5433 | 168 |
| 420 | 3300037471 | Ga0395905_0015560 | Ga0395905_0015560_3149_3655 | 168 |
| 421 | 3300037471 | Ga0395905_0019186 | Ga0395905_0019186_4485_5012 | 168 |
| 422 | 3300037471 | Ga0395905_0025816 | Ga0395905_0025816_1175_1681 | 168 |
| 423 | 3300037471 | Ga0395905_0065302 | Ga0395905_0065302_2573_3079 | 168 |
| 424 | 3300037471 | Ga0395905_0108121 | Ga0395905_0108121_946_1470 | 168 |
| 425 | 3300037471 | Ga0395905_0309575 | Ga0395905_0309575_269_775 | 168 |
| 426 | 3300037471 | Ga0395905_0634795 | Ga0395905_0634795_223_822 | 168 |
| 427 | 3300037471 | Ga0395905_0711747 | Ga0395905_0711747_58_564 | 168 |
| 428 | 3300038443 | Ga0395901_0001042 | Ga0395901_0001042_27190_27696 | 168 |
| 429 | 3300038443 | Ga0395901_0002958 | Ga0395901_0002958_2679_3206 | 168 |
| 430 | 3300038443 | Ga0395901_0010190 | Ga0395901_0010190_5707_6213 | 168 |
| 431 | 3300038443 | Ga0395901_0011115 | Ga0395901_0011115_4945_5472 | 168 |
| 432 | 3300038443 | Ga0395901_0023419 | Ga0395901_0023419_3091_3597 | 168 |
| 433 | 3300038443 | Ga0395901_0025239 | Ga0395901_0025239_4081_4587 | 168 |
| 434 | 3300038443 | Ga0395901_0046348 | Ga0395901_0046348_265_771 | 168 |
| 435 | 3300038443 | Ga0395901_0081651 | Ga0395901_0081651_572_1078 | 168 |
| 436 | 3300038443 | Ga0395901_0155658 | Ga0395901_0155658_536_1042 | 168 |
| 437 | 3300038443 | Ga0395901_0187547 | Ga0395901_0187547_1069_1575 | 168 |
| 438 | 3300038443 | Ga0395901_0882263 | Ga0395901_0882263_98_604 | 168 |
| 439 | 3300038443 | Ga0395901_1568813 | Ga0395901_1568813_31_537 | 168 |
| 440 | 3300044735 | Ga0466968_0423074 | Ga0466968_0423074_82_588 | 168 |
| 441 | 3300044901 | Ga0466960_0333241 | Ga0466960_0333241_163_669 | 168 |
| 442 | 3300046455 | Ga0495603_0042819 | Ga0495603_0042819_1272_1778 | 168 |
| 443 | 3300046461 | Ga0495641_0040948 | Ga0495641_0040948_1120_1626 | 168 |
| 444 | 3300046472 | Ga0495580_0156072 | Ga0495580_0156072_441_947 | 168 |
| 445 | 3300046474 | Ga0495605_0075577 | Ga0495605_0075577_250_756 | 168 |
| 446 | 3300046475 | Ga0495639_0027639 | Ga0495639_0027639_1181_1687 | 168 |
| 447 | 3300046491 | Ga0495584_0032729 | Ga0495584_0032729_1573_2079 | 168 |
| 448 | 3300046491 | Ga0495584_0065400 | Ga0495584_0065400_1013_1519 | 168 |
| 449 | 3300046499 | Ga0495594_0050418 | Ga0495594_0050418_1184_1690 | 168 |
| 450 | 3300046500 | Ga0495596_0133762 | Ga0495596_0133762_290_796 | 168 |
| 451 | 3300046517 | Ga0495630_0087451 | Ga0495630_0087451_1061_1567 | 168 |
| 452 | 3300046518 | Ga0495631_0130620 | Ga0495631_0130620_220_726 | 168 |
| 453 | 3300046518 | Ga0495631_0200152 | Ga0495631_0200152_323_829 | 168 |
| 454 | 3300046525 | Ga0495663_0001805 | Ga0495663_0001805_5554_6060 | 168 |
| 455 | 3300046525 | Ga0495663_0013804 | Ga0495663_0013804_1624_2130 | 168 |
| 456 | 3300046526 | Ga0495666_0226618 | Ga0495666_0226618_249_755 | 168 |
| 457 | 3300046528 | Ga0495642_0038014 | Ga0495642_0038014_826_1332 | 168 |
| 458 | 3300046531 | Ga0495665_0099189 | Ga0495665_0099189_431_937 | 168 |
| 459 | 3300046538 | Ga0495609_0058356 | Ga0495609_0058356_511_1017 | 168 |
| 460 | 3300046664 | Ga0495659_0049444 | Ga0495659_0049444_174_680 | 168 |
| 461 | 3300046664 | Ga0495659_0054375 | Ga0495659_0054375_674_1180 | 168 |
| 462 | 3300046681 | Ga0495647_0004331 | Ga0495647_0004331_716_1222 | 168 |
| 463 | 3300046683 | Ga0495658_0264885 | Ga0495658_0264885_101_607 | 168 |
| 464 | 3300046690 | Ga0495624_0278848 | Ga0495624_0278848_89_595 | 168 |
| 465 | 3300047321 | Ga0495676_0075995 | Ga0495676_0075995_1576_2082 | 168 |
| 466 | 3300047323 | Ga0495683_0037965 | Ga0495683_0037965_762_1268 | 168 |
| 467 | 3300047445 | Ga0495677_0063284 | Ga0495677_0063284_96_602 | 168 |
| 468 | 3300047447 | Ga0495685_013727 | Ga0495685_013727_119_625 | 168 |
| 469 | 3300048904 | Ga0496101_0047027 | Ga0496101_0047027_2099_2605 | 168 |
| 470 | 3300048904 | Ga0496101_0069307 | Ga0496101_0069307_1717_2223 | 168 |
| 471 | 3300048904 | Ga0496101_0215659 | Ga0496101_0215659_947_1474 | 168 |
| 472 | 3300048904 | Ga0496101_0263142 | Ga0496101_0263142_72_599 | 168 |
| 473 | 3300048904 | Ga0496101_0288473 | Ga0496101_0288473_88_594 | 168 |
| 474 | 3300048904 | Ga0496101_0334627 | Ga0496101_0334627_582_1088 | 168 |
| 475 | 3300048905 | Ga0496102_0010584 | Ga0496102_0010584_3397_3903 | 168 |
| 476 | 3300048905 | Ga0496102_0054400 | Ga0496102_0054400_2344_2871 | 168 |
| 477 | 3300048905 | Ga0496102_0145825 | Ga0496102_0145825_1354_1881 | 168 |
| 478 | 3300048906 | Ga0496103_0001169 | Ga0496103_0001169_2802_3308 | 168 |
| 479 | 3300048906 | Ga0496103_0031656 | Ga0496103_0031656_916_1443 | 168 |
| 480 | 3300048906 | Ga0496103_0395622 | Ga0496103_0395622_339_866 | 168 |
| 481 | 3300048907 | Ga0496104_0094964 | Ga0496104_0094964_642_1148 | 168 |
| 482 | 3300048907 | Ga0496104_0448150 | Ga0496104_0448150_554_1081 | 168 |
| 483 | 3300048907 | Ga0496104_0834292 | Ga0496104_0834292_240_746 | 168 |
| 484 | 3300048908 | Ga0496105_0031817 | Ga0496105_0031817_2231_2758 | 168 |
| 485 | 3300048908 | Ga0496105_0048021 | Ga0496105_0048021_2960_3466 | 168 |
| 486 | 3300048908 | Ga0496105_0282175 | Ga0496105_0282175_113_619 | 168 |
| 487 | 3300048908 | Ga0496105_0733278 | Ga0496105_0733278_82_588 | 168 |
| 488 | 3300048909 | Ga0496106_0024597 | Ga0496106_0024597_3089_3595 | 168 |
| 489 | 3300048910 | Ga0496107_0005238 | Ga0496107_0005238_5900_6406 | 168 |
| 490 | 3300048910 | Ga0496107_0093718 | Ga0496107_0093718_1067_1594 | 168 |
| 491 | 3300048910 | Ga0496107_0205433 | Ga0496107_0205433_427_933 | 168 |
| 492 | 3300048910 | Ga0496107_0312329 | Ga0496107_0312329_414_920 | 168 |
| 493 | 3300048910 | Ga0496107_0560725 | Ga0496107_0560725_167_673 | 168 |
| 494 | 3300048911 | Ga0496108_0005226 | Ga0496108_0005226_1890_2417 | 168 |
| 495 | 3300048911 | Ga0496108_0027073 | Ga0496108_0027073_3798_4304 | 168 |
| 496 | 3300048911 | Ga0496108_0053108 | Ga0496108_0053108_2441_2968 | 168 |
| 497 | 3300048911 | Ga0496108_0089930 | Ga0496108_0089930_1577_2083 | 168 |
| 498 | 3300048911 | Ga0496108_0392728 | Ga0496108_0392728_612_1127 | 168 |
| 499 | 3300048912 | Ga0496109_0001502 | Ga0496109_0001502_15370_15876 | 168 |
| 500 | 3300048912 | Ga0496109_0024719 | Ga0496109_0024719_876_1382 | 168 |
| 501 | 3300048912 | Ga0496109_0075569 | Ga0496109_0075569_1793_2320 | 168 |
| 502 | 3300048913 | Ga0496110_0001137 | Ga0496110_0001137_14686_15192 | 168 |
| 503 | 3300048913 | Ga0496110_0022287 | Ga0496110_0022287_3582_4088 | 168 |
| 504 | 3300048913 | Ga0496110_0256436 | Ga0496110_0256436_17_523 | 168 |
| 505 | 3300048913 | Ga0496110_0459417 | Ga0496110_0459417_456_983 | 168 |
| 506 | 3300048913 | Ga0496110_1097967 | Ga0496110_1097967_181_687 | 168 |
| 507 | 3300048914 | Ga0496111_0007210 | Ga0496111_0007210_3967_4473 | 168 |
| 508 | 3300048914 | Ga0496111_0039662 | Ga0496111_0039662_381_908 | 168 |
| 509 | 3300048914 | Ga0496111_0084761 | Ga0496111_0084761_840_1346 | 168 |
| 510 | 3300048914 | Ga0496111_0699600 | Ga0496111_0699600_99_626 | 168 |
| 511 | 3300048915 | Ga0496112_0026197 | Ga0496112_0026197_4205_4711 | 168 |
| 512 | 3300048915 | Ga0496112_0120286 | Ga0496112_0120286_309_815 | 168 |
| 513 | 3300048915 | Ga0496112_0175879 | Ga0496112_0175879_1537_2064 | 168 |
| 514 | 3300048915 | Ga0496112_0396200 | Ga0496112_0396200_459_986 | 168 |
| 515 | 3300048915 | Ga0496112_0488245 | Ga0496112_0488245_578_1105 | 168 |
| 516 | 3300048915 | Ga0496112_1508291 | Ga0496112_1508291_22_528 | 168 |
| 517 | 3300048916 | Ga0496113_0009673 | Ga0496113_0009673_3004_3531 | 168 |
| 518 | 3300048916 | Ga0496113_0111443 | Ga0496113_0111443_611_1138 | 168 |
| 519 | 3300048916 | Ga0496113_0437640 | Ga0496113_0437640_199_705 | 168 |
| 520 | 3300048916 | Ga0496113_0736272 | Ga0496113_0736272_82_588 | 168 |
| 521 | 3300048917 | Ga0496114_0006533 | Ga0496114_0006533_695_1201 | 168 |
| 522 | 3300048917 | Ga0496114_0040776 | Ga0496114_0040776_306_812 | 168 |
| 523 | 3300048917 | Ga0496114_0049698 | Ga0496114_0049698_291_818 | 168 |
| 524 | 3300048918 | Ga0496115_0013945 | Ga0496115_0013945_2348_2854 | 168 |
| 525 | 3300048918 | Ga0496115_0148931 | Ga0496115_0148931_441_968 | 168 |
| 526 | 3300048918 | Ga0496115_0167086 | Ga0496115_0167086_960_1487 | 168 |
| 527 | 3300049576 | Ga0501040_0344775 | Ga0501040_0344775_435_968 | 168 |
| 528 | 3300049583 | Ga0501067_0501486 | Ga0501067_0501486_15_521 | 168 |
| 529 | 3300050507 | nmdc:mga05p37_144869_c1 | nmdc:mga05p37_144869_c1_1551_2096 | 168 |
| 530 | 3300050507 | nmdc:mga05p37_201237_c1 | nmdc:mga05p37_201237_c1_630_1136 | 168 |
| 531 | 3300050507 | nmdc:mga05p37_24422_c1 | nmdc:mga05p37_24422_c1_1661_2188 | 168 |
| 532 | 3300050507 | nmdc:mga05p37_334144_c1 | nmdc:mga05p37_334144_c1_294_800 | 168 |
| 533 | 3300050507 | nmdc:mga05p37_50290_c1 | nmdc:mga05p37_50290_c1_542_1069 | 168 |
| 534 | 3300050507 | nmdc:mga05p37_543758_c1 | nmdc:mga05p37_543758_c1_592_1098 | 168 |
| 535 | 3300050508 | nmdc:mga09592_417436_c1 | nmdc:mga09592_417436_c1_369_914 | 168 |
| 536 | 3300050510 | nmdc:mga06r32_239719_c1 | nmdc:mga06r32_239719_c1_687_1214 | 168 |
| 537 | 3300050511 | nmdc:mga08y16_1009019_c1 | nmdc:mga08y16_1009019_c1_145_651 | 168 |
| 538 | 3300050511 | nmdc:mga08y16_265682_c1 | nmdc:mga08y16_265682_c1_1204_1710 | 168 |
| 539 | 3300050512 | nmdc:mga0n895_109943_c1 | nmdc:mga0n895_109943_c1_1820_2347 | 168 |
| 540 | 3300050512 | nmdc:mga0n895_231138_c1 | nmdc:mga0n895_231138_c1_996_1523 | 168 |
| 541 | 3300050512 | nmdc:mga0n895_740497_c1 | nmdc:mga0n895_740497_c1_25_552 | 168 |
| 542 | 3300050513 | nmdc:mga0rr50_579811_c1 | nmdc:mga0rr50_579811_c1_409_936 | 168 |
| 543 | 3300050513 | nmdc:mga0rr50_7492_c1 | nmdc:mga0rr50_7492_c1_2963_3490 | 168 |
| 544 | 3300050514 | nmdc:mga08x19_13594_c1 | nmdc:mga08x19_13594_c1_1992_2498 | 168 |
| 545 | 3300050514 | nmdc:mga08x19_21012_c1 | nmdc:mga08x19_21012_c1_3249_3776 | 168 |
| 546 | 3300050514 | nmdc:mga08x19_272937_c1 | nmdc:mga08x19_272937_c1_582_1109 | 168 |
| 547 | 3300050514 | nmdc:mga08x19_592281_c1 | nmdc:mga08x19_592281_c1_197_724 | 168 |
| 548 | 3300050514 | nmdc:mga08x19_6183_c1 | nmdc:mga08x19_6183_c1_518_1045 | 168 |
| 549 | 3300050515 | nmdc:mga0a205_112662_c1 | nmdc:mga0a205_112662_c1_402_929 | 168 |
| 550 | 3300050515 | nmdc:mga0a205_1128227_c1 | nmdc:mga0a205_1128227_c1_71_598 | 168 |
| 551 | 3300050515 | nmdc:mga0a205_40605_c1 | nmdc:mga0a205_40605_c1_1947_2474 | 168 |
| 552 | 3300050515 | nmdc:mga0a205_6925_c1 | nmdc:mga0a205_6925_c1_8517_9023 | 168 |
| 553 | 3300054114 | Ga0501084_0344986 | Ga0501084_0344986_100_633 | 168 |
| 554 | 3300005468 | Ga0070707_100165466 | Ga0070707_1001654662 | 169 |
| 555 | 3300025910 | Ga0207684_10181532 | Ga0207684_101815322 | 170 |
| 556 | 3300041443 | Ga0451789_0320105 | Ga0451789_0320105_1154_1669 | 170 |
| 557 | 3300041452 | Ga0451793_0230547 | Ga0451793_0230547_1195_1710 | 170 |
| 558 | 3300041456 | Ga0451795_1321968 | Ga0451795_1321968_207_722 | 170 |
| 559 | 3300041463 | Ga0451804_0399589 | Ga0451804_0399589_814_1329 | 170 |
| 560 | 3300041496 | Ga0451839_0685172 | Ga0451839_0685172_1008_1523 | 170 |
| 561 | 3300041501 | Ga0451845_0385095 | Ga0451845_0385095_121_636 | 170 |
| 562 | 3300041503 | Ga0451847_0819308 | Ga0451847_0819308_462_977 | 170 |
| 563 | 3300044735 | Ga0466968_0045476 | Ga0466968_0045476_1189_1704 | 170 |
| 564 | 3300003373 | JGI25407J50210_10003428 | JGI25407J50210_100034283 | 171 |
| 565 | 3300005328 | Ga0070676_10118106 | Ga0070676_101181062 | 171 |
| 566 | 3300005328 | Ga0070676_10945731 | Ga0070676_109457311 | 171 |
| 567 | 3300005330 | Ga0070690_100037841 | Ga0070690_1000378412 | 171 |
| 568 | 3300005330 | Ga0070690_100086345 | Ga0070690_1000863453 | 171 |
| 569 | 3300005337 | Ga0070682_100028428 | Ga0070682_1000284282 | 171 |
| 570 | 3300005337 | Ga0070682_100366460 | Ga0070682_1003664602 | 171 |
| 571 | 3300005339 | Ga0070660_100103703 | Ga0070660_1001037032 | 171 |
| 572 | 3300005339 | Ga0070660_100251912 | Ga0070660_1002519122 | 171 |
| 573 | 3300005341 | Ga0070691_10020515 | Ga0070691_100205152 | 171 |
| 574 | 3300005344 | Ga0070661_100327454 | Ga0070661_1003274542 | 171 |
| 575 | 3300005345 | Ga0070692_10039170 | Ga0070692_100391702 | 171 |
| 576 | 3300005353 | Ga0070669_100119235 | Ga0070669_1001192353 | 171 |
| 577 | 3300005355 | Ga0070671_100019046 | Ga0070671_1000190462 | 171 |
| 578 | 3300005356 | Ga0070674_100061048 | Ga0070674_1000610482 | 171 |
| 579 | 3300005356 | Ga0070674_100785521 | Ga0070674_1007855212 | 171 |
| 580 | 3300005364 | Ga0070673_100436543 | Ga0070673_1004365432 | 171 |
| 581 | 3300005367 | Ga0070667_100807062 | Ga0070667_1008070621 | 171 |
| 582 | 3300005436 | Ga0070713_100030152 | Ga0070713_1000301522 | 171 |
| 583 | 3300005438 | Ga0070701_10143856 | Ga0070701_101438562 | 171 |
| 584 | 3300005438 | Ga0070701_10407624 | Ga0070701_104076241 | 171 |
| 585 | 3300005439 | Ga0070711_100758533 | Ga0070711_1007585331 | 171 |
| 586 | 3300005440 | Ga0070705_100152479 | Ga0070705_1001524792 | 171 |
| 587 | 3300005440 | Ga0070705_100243093 | Ga0070705_1002430932 | 171 |
| 588 | 3300005441 | Ga0070700_100323038 | Ga0070700_1003230382 | 171 |
| 589 | 3300005444 | Ga0070694_100010676 | Ga0070694_1000106766 | 171 |
| 590 | 3300005445 | Ga0070708_100065685 | Ga0070708_1000656854 | 171 |
| 591 | 3300005445 | Ga0070708_100228256 | Ga0070708_1002282562 | 171 |
| 592 | 3300005455 | Ga0070663_101323503 | Ga0070663_1013235031 | 171 |
| 593 | 3300005456 | Ga0070678_100526519 | Ga0070678_1005265192 | 171 |
| 594 | 3300005457 | Ga0070662_100034736 | Ga0070662_1000347362 | 171 |
| 595 | 3300005458 | Ga0070681_10544258 | Ga0070681_105442582 | 171 |
| 596 | 3300005459 | Ga0068867_100009137 | Ga0068867_1000091372 | 171 |
| 597 | 3300005459 | Ga0068867_100528928 | Ga0068867_1005289281 | 171 |
| 598 | 3300005459 | Ga0068867_100734118 | Ga0068867_1007341181 | 171 |
| 599 | 3300005466 | Ga0070685_10144724 | Ga0070685_101447242 | 171 |
| 600 | 3300005467 | Ga0070706_100103080 | Ga0070706_1001030802 | 171 |
| 601 | 3300005468 | Ga0070707_100174490 | Ga0070707_1001744902 | 171 |
| 602 | 3300005471 | Ga0070698_100425874 | Ga0070698_1004258742 | 171 |
| 603 | 3300005530 | Ga0070679_100048241 | Ga0070679_1000482414 | 171 |
| 604 | 3300005535 | Ga0070684_100172646 | Ga0070684_1001726462 | 171 |
| 605 | 3300005536 | Ga0070697_100307182 | Ga0070697_1003071822 | 171 |
| 606 | 3300005543 | Ga0070672_100158034 | Ga0070672_1001580342 | 171 |
| 607 | 3300005544 | Ga0070686_100313735 | Ga0070686_1003137352 | 171 |
| 608 | 3300005545 | Ga0070695_100196576 | Ga0070695_1001965761 | 171 |
| 609 | 3300005546 | Ga0070696_100007393 | Ga0070696_1000073932 | 171 |
| 610 | 3300005546 | Ga0070696_100160931 | Ga0070696_1001609312 | 171 |
| 611 | 3300005546 | Ga0070696_100359865 | Ga0070696_1003598652 | 171 |
| 612 | 3300005547 | Ga0070693_100031739 | Ga0070693_1000317393 | 171 |
| 613 | 3300005547 | Ga0070693_100045336 | Ga0070693_1000453362 | 171 |
| 614 | 3300005549 | Ga0070704_100054858 | Ga0070704_1000548583 | 171 |
| 615 | 3300005563 | Ga0068855_100129831 | Ga0068855_1001298312 | 171 |
| 616 | 3300005563 | Ga0068855_100164430 | Ga0068855_1001644303 | 171 |
| 617 | 3300005578 | Ga0068854_100145231 | Ga0068854_1001452313 | 171 |
| 618 | 3300005578 | Ga0068854_100405474 | Ga0068854_1004054742 | 171 |
| 619 | 3300005616 | Ga0068852_101040223 | Ga0068852_1010402232 | 171 |
| 620 | 3300005618 | Ga0068864_100061528 | Ga0068864_1000615282 | 171 |
| 621 | 3300005718 | Ga0068866_10003892 | Ga0068866_100038923 | 171 |
| 622 | 3300005718 | Ga0068866_10080015 | Ga0068866_100800152 | 171 |
| 623 | 3300005719 | Ga0068861_100007355 | Ga0068861_1000073556 | 171 |
| 624 | 3300005719 | Ga0068861_100036976 | Ga0068861_1000369762 | 171 |
| 625 | 3300005841 | Ga0068863_100254394 | Ga0068863_1002543942 | 171 |
| 626 | 3300005843 | Ga0068860_101186207 | Ga0068860_1011862072 | 171 |
| 627 | 3300005844 | Ga0068862_100238724 | Ga0068862_1002387242 | 171 |
| 628 | 3300005844 | Ga0068862_100353747 | Ga0068862_1003537472 | 171 |
| 629 | 3300005981 | Ga0081538_10001314 | Ga0081538_1000131418 | 171 |
| 630 | 3300005981 | Ga0081538_10134011 | Ga0081538_101340112 | 171 |
| 631 | 3300005983 | Ga0081540_1067503 | Ga0081540_10675032 | 171 |
| 632 | 3300006028 | Ga0070717_10132606 | Ga0070717_101326062 | 171 |
| 633 | 3300006163 | Ga0070715_10388258 | Ga0070715_103882582 | 171 |
| 634 | 3300006358 | Ga0068871_100056236 | Ga0068871_1000562364 | 171 |
| 635 | 3300006844 | Ga0075428_100397842 | Ga0075428_1003978422 | 171 |
| 636 | 3300006844 | Ga0075428_100602193 | Ga0075428_1006021932 | 171 |
| 637 | 3300006844 | Ga0075428_100612341 | Ga0075428_1006123412 | 171 |
| 638 | 3300006846 | Ga0075430_100517428 | Ga0075430_1005174281 | 171 |
| 639 | 3300006880 | Ga0075429_100424302 | Ga0075429_1004243022 | 171 |
| 640 | 3300006881 | Ga0068865_100326783 | Ga0068865_1003267832 | 171 |
| 641 | 3300009093 | Ga0105240_10238273 | Ga0105240_102382732 | 171 |
| 642 | 3300009094 | Ga0111539_10040883 | Ga0111539_100408833 | 171 |
| 643 | 3300009094 | Ga0111539_10080392 | Ga0111539_100803922 | 171 |
| 644 | 3300009094 | Ga0111539_10922310 | Ga0111539_109223102 | 171 |
| 645 | 3300009098 | Ga0105245_10020822 | Ga0105245_100208223 | 171 |
| 646 | 3300009098 | Ga0105245_10034776 | Ga0105245_100347763 | 171 |
| 647 | 3300009098 | Ga0105245_10065952 | Ga0105245_100659524 | 171 |
| 648 | 3300009098 | Ga0105245_10746629 | Ga0105245_107466292 | 171 |
| 649 | 3300009147 | Ga0114129_10019762 | Ga0114129_100197623 | 171 |
| 650 | 3300009147 | Ga0114129_10220430 | Ga0114129_102204302 | 171 |
| 651 | 3300009147 | Ga0114129_10241643 | Ga0114129_102416431 | 171 |
| 652 | 3300009147 | Ga0114129_10729481 | Ga0114129_107294812 | 171 |
| 653 | 3300009147 | Ga0114129_11380734 | Ga0114129_113807342 | 171 |
| 654 | 3300009148 | Ga0105243_10041832 | Ga0105243_100418324 | 171 |
| 655 | 3300009174 | Ga0105241_10023963 | Ga0105241_100239633 | 171 |
| 656 | 3300009174 | Ga0105241_10196612 | Ga0105241_101966122 | 171 |
| 657 | 3300009176 | Ga0105242_10176304 | Ga0105242_101763042 | 171 |
| 658 | 3300009177 | Ga0105248_10849707 | Ga0105248_108497072 | 171 |
| 659 | 3300009177 | Ga0105248_11695454 | Ga0105248_116954542 | 171 |
| 660 | 3300009553 | Ga0105249_10023380 | Ga0105249_100233806 | 171 |
| 661 | 3300009553 | Ga0105249_10848833 | Ga0105249_108488332 | 171 |
| 662 | 3300011119 | Ga0105246_10045576 | Ga0105246_100455762 | 171 |
| 663 | 3300011119 | Ga0105246_10553785 | Ga0105246_105537852 | 171 |
| 664 | 3300012503 | Ga0157313_1005592 | Ga0157313_10055922 | 171 |
| 665 | 3300013100 | Ga0157373_10029312 | Ga0157373_100293122 | 171 |
| 666 | 3300013102 | Ga0157371_10028826 | Ga0157371_100288263 | 171 |
| 667 | 3300013297 | Ga0157378_10137003 | Ga0157378_101370031 | 171 |
| 668 | 3300013297 | Ga0157378_10494698 | Ga0157378_104946982 | 171 |
| 669 | 3300013297 | Ga0157378_10769191 | Ga0157378_107691912 | 171 |
| 670 | 3300013306 | Ga0163162_10043643 | Ga0163162_100436434 | 171 |
| 671 | 3300013306 | Ga0163162_10210045 | Ga0163162_102100451 | 171 |
| 672 | 3300013307 | Ga0157372_10125068 | Ga0157372_101250681 | 171 |
| 673 | 3300013308 | Ga0157375_10097978 | Ga0157375_100979782 | 171 |
| 674 | 3300013308 | Ga0157375_10099811 | Ga0157375_100998113 | 171 |
| 675 | 3300013308 | Ga0157375_10391205 | Ga0157375_103912052 | 171 |
| 676 | 3300014325 | Ga0163163_10065375 | Ga0163163_100653754 | 171 |
| 677 | 3300014968 | Ga0157379_10717625 | Ga0157379_107176252 | 171 |
| 678 | 3300014969 | Ga0157376_10024449 | Ga0157376_100244493 | 171 |
| 679 | 3300025885 | Ga0207653_10017886 | Ga0207653_100178863 | 171 |
| 680 | 3300025901 | Ga0207688_10030282 | Ga0207688_100302823 | 171 |
| 681 | 3300025910 | Ga0207684_10240516 | Ga0207684_102405162 | 171 |
| 682 | 3300025912 | Ga0207707_10112150 | Ga0207707_101121503 | 171 |
| 683 | 3300025913 | Ga0207695_10160002 | Ga0207695_101600023 | 171 |
| 684 | 3300025914 | Ga0207671_10691863 | Ga0207671_106918632 | 171 |
| 685 | 3300025917 | Ga0207660_10110420 | Ga0207660_101104202 | 171 |
| 686 | 3300025917 | Ga0207660_10151637 | Ga0207660_101516372 | 171 |
| 687 | 3300025918 | Ga0207662_10221600 | Ga0207662_102216001 | 171 |
| 688 | 3300025919 | Ga0207657_10068766 | Ga0207657_100687663 | 171 |
| 689 | 3300025919 | Ga0207657_10277141 | Ga0207657_102771412 | 171 |
| 690 | 3300025920 | Ga0207649_10596891 | Ga0207649_105968912 | 171 |
| 691 | 3300025921 | Ga0207652_10136087 | Ga0207652_101360872 | 171 |
| 692 | 3300025921 | Ga0207652_10463270 | Ga0207652_104632702 | 171 |
| 693 | 3300025922 | Ga0207646_10222552 | Ga0207646_102225523 | 171 |
| 694 | 3300025927 | Ga0207687_10036360 | Ga0207687_100363603 | 171 |
| 695 | 3300025927 | Ga0207687_10291005 | Ga0207687_102910052 | 171 |
| 696 | 3300025931 | Ga0207644_10035018 | Ga0207644_100350183 | 171 |
| 697 | 3300025933 | Ga0207706_10004640 | Ga0207706_1000464010 | 171 |
| 698 | 3300025934 | Ga0207686_10152289 | Ga0207686_101522892 | 171 |
| 699 | 3300025936 | Ga0207670_10319459 | Ga0207670_103194592 | 171 |
| 700 | 3300025937 | Ga0207669_10014952 | Ga0207669_100149523 | 171 |
| 701 | 3300025938 | Ga0207704_10207153 | Ga0207704_102071531 | 171 |
| 702 | 3300025941 | Ga0207711_10184486 | Ga0207711_101844862 | 171 |
| 703 | 3300025941 | Ga0207711_10533544 | Ga0207711_105335442 | 171 |
| 704 | 3300025942 | Ga0207689_10135102 | Ga0207689_101351022 | 171 |
| 705 | 3300025942 | Ga0207689_10577985 | Ga0207689_105779852 | 171 |
| 706 | 3300025944 | Ga0207661_10038335 | Ga0207661_100383352 | 171 |
| 707 | 3300025945 | Ga0207679_10380518 | Ga0207679_103805182 | 171 |
| 708 | 3300025949 | Ga0207667_10487910 | Ga0207667_104879102 | 171 |
| 709 | 3300025949 | Ga0207667_11140454 | Ga0207667_111404541 | 171 |
| 710 | 3300025981 | Ga0207640_10121685 | Ga0207640_101216853 | 171 |
| 711 | 3300025981 | Ga0207640_10123319 | Ga0207640_101233192 | 171 |
| 712 | 3300026075 | Ga0207708_10010983 | Ga0207708_100109831 | 171 |
| 713 | 3300026075 | Ga0207708_10336808 | Ga0207708_103368082 | 171 |
| 714 | 3300026078 | Ga0207702_10045682 | Ga0207702_100456823 | 171 |
| 715 | 3300026078 | Ga0207702_11345312 | Ga0207702_113453121 | 171 |
| 716 | 3300026088 | Ga0207641_10078544 | Ga0207641_100785443 | 171 |
| 717 | 3300026089 | Ga0207648_10003750 | Ga0207648_100037508 | 171 |
| 718 | 3300026089 | Ga0207648_10102646 | Ga0207648_101026463 | 171 |
| 719 | 3300026089 | Ga0207648_10300502 | Ga0207648_103005022 | 171 |
| 720 | 3300026095 | Ga0207676_10047734 | Ga0207676_100477342 | 171 |
| 721 | 3300026118 | Ga0207675_100001825 | Ga0207675_1000018259 | 171 |
| 722 | 3300026118 | Ga0207675_100010036 | Ga0207675_1000100362 | 171 |
| 723 | 3300026121 | Ga0207683_10570246 | Ga0207683_105702462 | 171 |
| 724 | 3300026142 | Ga0207698_10073451 | Ga0207698_100734512 | 171 |
| 725 | 3300028380 | Ga0268265_10038854 | Ga0268265_100388543 | 171 |
| 726 | 3300028381 | Ga0268264_10565268 | Ga0268264_105652682 | 171 |
| 727 | 3300031901 | Ga0307406_10126480 | Ga0307406_101264802 | 171 |
| 728 | 3300031995 | Ga0307409_100629392 | Ga0307409_1006293922 | 171 |
| 729 | 3300032126 | Ga0307415_100041456 | Ga0307415_1000414562 | 171 |
| 730 | 3300032126 | Ga0307415_100483890 | Ga0307415_1004838901 | 171 |
| 731 | 3300034817 | Ga0373948_0073338 | Ga0373948_0073338_226_741 | 171 |
| 732 | 3300034820 | Ga0373959_0036083 | Ga0373959_0036083_58_573 | 171 |
| 733 | 3300035090 | Ga0373949_0006242 | Ga0373949_0006242_1471_1986 | 171 |
| 734 | 3300035092 | Ga0373952_0055939 | Ga0373952_0055939_251_766 | 171 |
| 735 | 3300035115 | Ga0373941_0078079 | Ga0373941_0078079_23_538 | 171 |
| 736 | 3300035116 | Ga0373945_0014189 | Ga0373945_0014189_1137_1652 | 171 |
| 737 | 3300035116 | Ga0373945_0151132 | Ga0373945_0151132_232_759 | 171 |
| 738 | 3300035121 | Ga0373960_0018706 | Ga0373960_0018706_493_1008 | 171 |
| 739 | 3300035121 | Ga0373960_0061038 | Ga0373960_0061038_302_817 | 171 |
| 740 | 3300035170 | Ga0373943_0012734 | Ga0373943_0012734_368_883 | 171 |
| 741 | 3300035171 | Ga0373946_0003206 | Ga0373946_0003206_3559_4074 | 171 |
| 742 | 3300035207 | Ga0373942_0053154 | Ga0373942_0053154_375_890 | 171 |
| 743 | 3300035242 | Ga0373962_0007404 | Ga0373962_0007404_1131_1646 | 171 |
| 744 | 3300035691 | Ga0373931_0034755 | Ga0373931_0034755_882_1397 | 171 |
| 745 | 3300035695 | Ga0373927_0075892 | Ga0373927_0075892_1082_1597 | 171 |
| 746 | 3300035725 | Ga0373947_0060292 | Ga0373947_0060292_1464_1979 | 171 |
| 747 | 3300037068 | Ga0373925_0059240 | Ga0373925_0059240_1154_1669 | 171 |
| 748 | 3300037312 | Ga0395899_0000775 | Ga0395899_0000775_1741_2256 | 171 |
| 749 | 3300037312 | Ga0395899_0001403 | Ga0395899_0001403_16043_16558 | 171 |
| 750 | 3300037312 | Ga0395899_0002275 | Ga0395899_0002275_2605_3120 | 171 |
| 751 | 3300037312 | Ga0395899_0039378 | Ga0395899_0039378_2926_3441 | 171 |
| 752 | 3300037312 | Ga0395899_0041426 | Ga0395899_0041426_1884_2399 | 171 |
| 753 | 3300037312 | Ga0395899_0184625 | Ga0395899_0184625_675_1193 | 171 |
| 754 | 3300037312 | Ga0395899_0226448 | Ga0395899_0226448_71_601 | 171 |
| 755 | 3300037312 | Ga0395899_0462264 | Ga0395899_0462264_71_586 | 171 |
| 756 | 3300037312 | Ga0395899_0551455 | Ga0395899_0551455_151_666 | 171 |
| 757 | 3300037418 | Ga0395900_0003593 | Ga0395900_0003593_13250_13765 | 171 |
| 758 | 3300037418 | Ga0395900_0006278 | Ga0395900_0006278_539_1054 | 171 |
| 759 | 3300037418 | Ga0395900_0012186 | Ga0395900_0012186_6829_7344 | 171 |
| 760 | 3300037418 | Ga0395900_0039067 | Ga0395900_0039067_2767_3282 | 171 |
| 761 | 3300037418 | Ga0395900_0238466 | Ga0395900_0238466_565_1080 | 171 |
| 762 | 3300037418 | Ga0395900_0239974 | Ga0395900_0239974_1193_1708 | 171 |
| 763 | 3300037418 | Ga0395900_0255155 | Ga0395900_0255155_501_1016 | 171 |
| 764 | 3300037418 | Ga0395900_1083058 | Ga0395900_1083058_157_678 | 171 |
| 765 | 3300037418 | Ga0395900_1499972 | Ga0395900_1499972_16_540 | 171 |
| 766 | 3300037466 | Ga0395898_0001134 | Ga0395898_0001134_37628_38143 | 171 |
| 767 | 3300037466 | Ga0395898_0003476 | Ga0395898_0003476_14350_14865 | 171 |
| 768 | 3300037466 | Ga0395898_0060193 | Ga0395898_0060193_2061_2576 | 171 |
| 769 | 3300037466 | Ga0395898_0061583 | Ga0395898_0061583_1709_2224 | 171 |
| 770 | 3300037466 | Ga0395898_0089745 | Ga0395898_0089745_966_1484 | 171 |
| 771 | 3300037466 | Ga0395898_0125406 | Ga0395898_0125406_333_854 | 171 |
| 772 | 3300037466 | Ga0395898_0217520 | Ga0395898_0217520_746_1261 | 171 |
| 773 | 3300037471 | Ga0395905_0001871 | Ga0395905_0001871_7979_8494 | 171 |
| 774 | 3300037471 | Ga0395905_0002236 | Ga0395905_0002236_4400_4915 | 171 |
| 775 | 3300037471 | Ga0395905_0018237 | Ga0395905_0018237_2494_3009 | 171 |
| 776 | 3300037471 | Ga0395905_0061951 | Ga0395905_0061951_1741_2256 | 171 |
| 777 | 3300037471 | Ga0395905_0184686 | Ga0395905_0184686_746_1261 | 171 |
| 778 | 3300037471 | Ga0395905_0243324 | Ga0395905_0243324_152_670 | 171 |
| 779 | 3300038443 | Ga0395901_0012512 | Ga0395901_0012512_3657_4172 | 171 |
| 780 | 3300038443 | Ga0395901_0018217 | Ga0395901_0018217_3419_3934 | 171 |
| 781 | 3300038443 | Ga0395901_0020672 | Ga0395901_0020672_4979_5494 | 171 |
| 782 | 3300038443 | Ga0395901_0043201 | Ga0395901_0043201_2888_3403 | 171 |
| 783 | 3300038443 | Ga0395901_0087758 | Ga0395901_0087758_131_646 | 171 |
| 784 | 3300038443 | Ga0395901_0097658 | Ga0395901_0097658_1119_1634 | 171 |
| 785 | 3300038443 | Ga0395901_0149624 | Ga0395901_0149624_586_1104 | 171 |
| 786 | 3300038443 | Ga0395901_0193023 | Ga0395901_0193023_929_1444 | 171 |
| 787 | 3300038443 | Ga0395901_0438496 | Ga0395901_0438496_164_694 | 171 |
| 788 | 3300038443 | Ga0395901_0571158 | Ga0395901_0571158_436_957 | 171 |
| 789 | 3300041512 | Ga0451853_0526476 | Ga0451853_0526476_216_731 | 171 |
| 790 | 3300041512 | Ga0451853_1318362 | Ga0451853_1318362_1817_2332 | 171 |
| 791 | 3300041512 | Ga0451853_3083970 | Ga0451853_3083970_127_645 | 171 |
| 792 | 3300042005 | Ga0439448_0046166 | Ga0439448_0046166_799_1314 | 171 |
| 793 | 3300042993 | Ga0439440_0133181 | Ga0439440_0133181_59_574 | 171 |
| 794 | 3300045051 | Ga0451576_0058063 | Ga0451576_0058063_522_1037 | 171 |
| 795 | 3300045051 | Ga0451576_1625391 | Ga0451576_1625391_82_597 | 171 |
| 796 | 3300046455 | Ga0495603_0000062 | Ga0495603_0000062_32549_33064 | 171 |
| 797 | 3300046455 | Ga0495603_0350934 | Ga0495603_0350934_59_574 | 171 |
| 798 | 3300046461 | Ga0495641_0011742 | Ga0495641_0011742_4159_4674 | 171 |
| 799 | 3300046473 | Ga0495582_0033727 | Ga0495582_0033727_1020_1535 | 171 |
| 800 | 3300046473 | Ga0495582_0590757 | Ga0495582_0590757_12_539 | 171 |
| 801 | 3300046474 | Ga0495605_0062515 | Ga0495605_0062515_289_804 | 171 |
| 802 | 3300046475 | Ga0495639_0027197 | Ga0495639_0027197_627_1142 | 171 |
| 803 | 3300046491 | Ga0495584_0257056 | Ga0495584_0257056_56_571 | 171 |
| 804 | 3300046492 | Ga0495585_0341657 | Ga0495585_0341657_133_648 | 171 |
| 805 | 3300046499 | Ga0495594_0000447 | Ga0495594_0000447_7810_8325 | 171 |
| 806 | 3300046523 | Ga0495644_0125316 | Ga0495644_0125316_327_842 | 171 |
| 807 | 3300046526 | Ga0495666_0036927 | Ga0495666_0036927_1828_2343 | 171 |
| 808 | 3300046615 | Ga0495656_0021925 | Ga0495656_0021925_680_1204 | 171 |
| 809 | 3300046664 | Ga0495659_0185910 | Ga0495659_0185910_51_566 | 171 |
| 810 | 3300046665 | Ga0495661_0153580 | Ga0495661_0153580_571_1086 | 171 |
| 811 | 3300046674 | Ga0495588_0000632 | Ga0495588_0000632_10375_10890 | 171 |
| 812 | 3300046683 | Ga0495658_0169849 | Ga0495658_0169849_781_1296 | 171 |
| 813 | 3300046689 | Ga0495613_0116752 | Ga0495613_0116752_1166_1681 | 171 |
| 814 | 3300046689 | Ga0495613_0165764 | Ga0495613_0165764_828_1346 | 171 |
| 815 | 3300047315 | Ga0495581_0113815 | Ga0495581_0113815_900_1418 | 171 |
| 816 | 3300047321 | Ga0495676_0000253 | Ga0495676_0000253_15287_15802 | 171 |
| 817 | 3300047323 | Ga0495683_0135840 | Ga0495683_0135840_467_982 | 171 |
| 818 | 3300047445 | Ga0495677_0095312 | Ga0495677_0095312_490_1005 | 171 |
| 819 | 3300048903 | Ga0496100_0021816 | Ga0496100_0021816_1666_2181 | 171 |
| 820 | 3300048904 | Ga0496101_0002526 | Ga0496101_0002526_3015_3530 | 171 |
| 821 | 3300048905 | Ga0496102_0017379 | Ga0496102_0017379_4007_4522 | 171 |
| 822 | 3300048906 | Ga0496103_0017711 | Ga0496103_0017711_864_1379 | 171 |
| 823 | 3300048906 | Ga0496103_0034389 | Ga0496103_0034389_1614_2129 | 171 |
| 824 | 3300048906 | Ga0496103_0126191 | Ga0496103_0126191_274_789 | 171 |
| 825 | 3300048907 | Ga0496104_0002508 | Ga0496104_0002508_13696_14211 | 171 |
| 826 | 3300048907 | Ga0496104_0003548 | Ga0496104_0003548_1311_1826 | 171 |
| 827 | 3300048907 | Ga0496104_0007013 | Ga0496104_0007013_3920_4435 | 171 |
| 828 | 3300048908 | Ga0496105_0000042 | Ga0496105_0000042_89342_89857 | 171 |
| 829 | 3300048908 | Ga0496105_0002088 | Ga0496105_0002088_3778_4293 | 171 |
| 830 | 3300048909 | Ga0496106_0003639 | Ga0496106_0003639_5370_5885 | 171 |
| 831 | 3300048909 | Ga0496106_0052951 | Ga0496106_0052951_889_1404 | 171 |
| 832 | 3300048909 | Ga0496106_0278075 | Ga0496106_0278075_66_581 | 171 |
| 833 | 3300048910 | Ga0496107_0006172 | Ga0496107_0006172_2035_2550 | 171 |
| 834 | 3300048910 | Ga0496107_0263602 | Ga0496107_0263602_307_822 | 171 |
| 835 | 3300048910 | Ga0496107_0494679 | Ga0496107_0494679_47_562 | 171 |
| 836 | 3300048911 | Ga0496108_0001658 | Ga0496108_0001658_8116_8631 | 171 |
| 837 | 3300048911 | Ga0496108_0002105 | Ga0496108_0002105_2856_3371 | 171 |
| 838 | 3300048911 | Ga0496108_0074457 | Ga0496108_0074457_1031_1546 | 171 |
| 839 | 3300048912 | Ga0496109_0001909 | Ga0496109_0001909_2740_3255 | 171 |
| 840 | 3300048912 | Ga0496109_0045446 | Ga0496109_0045446_1611_2126 | 171 |
| 841 | 3300048912 | Ga0496109_0129471 | Ga0496109_0129471_858_1373 | 171 |
| 842 | 3300048913 | Ga0496110_0000050 | Ga0496110_0000050_30279_30794 | 171 |
| 843 | 3300048913 | Ga0496110_0001795 | Ga0496110_0001795_2689_3204 | 171 |
| 844 | 3300048913 | Ga0496110_0070475 | Ga0496110_0070475_1663_2178 | 171 |
| 845 | 3300048914 | Ga0496111_0000439 | Ga0496111_0000439_5543_6058 | 171 |
| 846 | 3300048914 | Ga0496111_0074143 | Ga0496111_0074143_104_619 | 171 |
| 847 | 3300048914 | Ga0496111_0192018 | Ga0496111_0192018_902_1417 | 171 |
| 848 | 3300048915 | Ga0496112_0002189 | Ga0496112_0002189_14046_14561 | 171 |
| 849 | 3300048915 | Ga0496112_0045844 | Ga0496112_0045844_3569_4084 | 171 |
| 850 | 3300048915 | Ga0496112_0153365 | Ga0496112_0153365_1048_1563 | 171 |
| 851 | 3300048915 | Ga0496112_0324959 | Ga0496112_0324959_788_1303 | 171 |
| 852 | 3300048916 | Ga0496113_0000348 | Ga0496113_0000348_12158_12673 | 171 |
| 853 | 3300048916 | Ga0496113_0000517 | Ga0496113_0000517_3972_4487 | 171 |
| 854 | 3300048917 | Ga0496114_0103919 | Ga0496114_0103919_177_692 | 171 |
| 855 | 3300048917 | Ga0496114_0146754 | Ga0496114_0146754_486_1001 | 171 |
| 856 | 3300049575 | Ga0501039_1226076 | Ga0501039_1226076_40_564 | 171 |
| 857 | 3300049576 | Ga0501040_1131388 | Ga0501040_1131388_19_543 | 171 |
| 858 | 3300049583 | Ga0501067_0003623 | Ga0501067_0003623_7858_8379 | 171 |
| 859 | 3300049585 | Ga0501069_0009481 | Ga0501069_0009481_2099_2620 | 171 |
| 860 | 3300049592 | Ga0501076_0379388 | Ga0501076_0379388_264_788 | 171 |
| 861 | 3300049743 | Ga0501081_0754444 | Ga0501081_0754444_122_646 | 171 |
| 862 | 3300050489 | nmdc:mga03683_315896_c1 | nmdc:mga03683_315896_c1_181_696 | 171 |
| 863 | 3300050492 | nmdc:mga0yw44_138644_c1 | nmdc:mga0yw44_138644_c1_67_591 | 171 |
| 864 | 3300050493 | nmdc:mga0k408_55235_c3 | nmdc:mga0k408_55235_c3_103_618 | 171 |
| 865 | 3300050495 | nmdc:mga04h51_415833_c1 | nmdc:mga04h51_415833_c1_12_527 | 171 |
| 866 | 3300050507 | nmdc:mga05p37_125218_c1 | nmdc:mga05p37_125218_c1_2156_2671 | 171 |
| 867 | 3300050507 | nmdc:mga05p37_24663_c1 | nmdc:mga05p37_24663_c1_306_821 | 171 |
| 868 | 3300050507 | nmdc:mga05p37_389894_c1 | nmdc:mga05p37_389894_c1_461_985 | 171 |
| 869 | 3300050507 | nmdc:mga05p37_396048_c1 | nmdc:mga05p37_396048_c1_1019_1534 | 171 |
| 870 | 3300050507 | nmdc:mga05p37_83026_c1 | nmdc:mga05p37_83026_c1_209_733 | 171 |
| 871 | 3300050508 | nmdc:mga09592_57738_c1 | nmdc:mga09592_57738_c1_1410_1925 | 171 |
| 872 | 3300050509 | nmdc:mga0qj67_308794_c1 | nmdc:mga0qj67_308794_c1_297_821 | 171 |
| 873 | 3300050509 | nmdc:mga0qj67_97880_c1 | nmdc:mga0qj67_97880_c1_1009_1524 | 171 |
| 874 | 3300050510 | nmdc:mga06r32_178969_c1 | nmdc:mga06r32_178969_c1_645_1160 | 171 |
| 875 | 3300050510 | nmdc:mga06r32_179427_c1 | nmdc:mga06r32_179427_c1_67_582 | 171 |
| 876 | 3300050511 | nmdc:mga08y16_35012_c1 | nmdc:mga08y16_35012_c1_1903_2418 | 171 |
| 877 | 3300050511 | nmdc:mga08y16_55059_c1 | nmdc:mga08y16_55059_c1_3185_3700 | 171 |
| 878 | 3300050511 | nmdc:mga08y16_670243_c1 | nmdc:mga08y16_670243_c1_317_832 | 171 |
| 879 | 3300050514 | nmdc:mga08x19_14962_c2 | nmdc:mga08x19_14962_c2_1052_1567 | 171 |
| 880 | 3300050514 | nmdc:mga08x19_98551_c1 | nmdc:mga08x19_98551_c1_92_607 | 171 |
| 881 | 3300050515 | nmdc:mga0a205_119284_c1 | nmdc:mga0a205_119284_c1_1551_2072 | 171 |
| 882 | 3300050515 | nmdc:mga0a205_188610_c1 | nmdc:mga0a205_188610_c1_555_1070 | 171 |
| 883 | 3300050515 | nmdc:mga0a205_41461_c1 | nmdc:mga0a205_41461_c1_1590_2105 | 171 |
| 884 | 3300050515 | nmdc:mga0a205_735184_c1 | nmdc:mga0a205_735184_c1_46_561 | 171 |
| 885 | 3300054114 | Ga0501084_0686575 | Ga0501084_0686575_62_580 | 171 |
| 886 | 3300061734 | Ga0530510_0007885 | Ga0530510_0007885_13_534 | 171 |
| 887 | 3300005337 | Ga0070682_100121836 | Ga0070682_1001218361 | 172 |
| 888 | 3300005340 | Ga0070689_100180337 | Ga0070689_1001803372 | 172 |
| 889 | 3300005436 | Ga0070713_100140964 | Ga0070713_1001409641 | 172 |
| 890 | 3300005437 | Ga0070710_10011401 | Ga0070710_100114014 | 172 |
| 891 | 3300005440 | Ga0070705_100628299 | Ga0070705_1006282991 | 172 |
| 892 | 3300005444 | Ga0070694_100193476 | Ga0070694_1001934761 | 172 |
| 893 | 3300005445 | Ga0070708_100010130 | Ga0070708_1000101307 | 172 |
| 894 | 3300005445 | Ga0070708_100409001 | Ga0070708_1004090012 | 172 |
| 895 | 3300005467 | Ga0070706_100009405 | Ga0070706_1000094057 | 172 |
| 896 | 3300005467 | Ga0070706_100087090 | Ga0070706_1000870903 | 172 |
| 897 | 3300005468 | Ga0070707_100070727 | Ga0070707_1000707273 | 172 |
| 898 | 3300005468 | Ga0070707_100071604 | Ga0070707_1000716042 | 172 |
| 899 | 3300005471 | Ga0070698_100016699 | Ga0070698_1000166995 | 172 |
| 900 | 3300005471 | Ga0070698_101115739 | Ga0070698_1011157391 | 172 |
| 901 | 3300005536 | Ga0070697_100124922 | Ga0070697_1001249222 | 172 |
| 902 | 3300005544 | Ga0070686_100573985 | Ga0070686_1005739852 | 172 |
| 903 | 3300005549 | Ga0070704_100325996 | Ga0070704_1003259962 | 172 |
| 904 | 3300005615 | Ga0070702_100048163 | Ga0070702_1000481632 | 172 |
| 905 | 3300005617 | Ga0068859_100227040 | Ga0068859_1002270402 | 172 |
| 906 | 3300005719 | Ga0068861_100261204 | Ga0068861_1002612042 | 172 |
| 907 | 3300005840 | Ga0068870_10177054 | Ga0068870_101770542 | 172 |
| 908 | 3300005844 | Ga0068862_100100731 | Ga0068862_1001007311 | 172 |
| 909 | 3300005844 | Ga0068862_100128802 | Ga0068862_1001288022 | 172 |
| 910 | 3300005937 | Ga0081455_10355952 | Ga0081455_103559522 | 172 |
| 911 | 3300006038 | Ga0075365_10079265 | Ga0075365_100792653 | 172 |
| 912 | 3300006058 | Ga0075432_10014738 | Ga0075432_100147383 | 172 |
| 913 | 3300006844 | Ga0075428_100396935 | Ga0075428_1003969351 | 172 |
| 914 | 3300006847 | Ga0075431_100256727 | Ga0075431_1002567272 | 172 |
| 915 | 3300006852 | Ga0075433_10236930 | Ga0075433_102369302 | 172 |
| 916 | 3300006852 | Ga0075433_10276128 | Ga0075433_102761281 | 172 |
| 917 | 3300006880 | Ga0075429_100578804 | Ga0075429_1005788041 | 172 |
| 918 | 3300006931 | Ga0097620_100227050 | Ga0097620_1002270502 | 172 |
| 919 | 3300007076 | Ga0075435_100062202 | Ga0075435_1000622023 | 172 |
| 920 | 3300009094 | Ga0111539_10133615 | Ga0111539_101336152 | 172 |
| 921 | 3300009147 | Ga0114129_10830975 | Ga0114129_108309752 | 172 |
| 922 | 3300009147 | Ga0114129_10931918 | Ga0114129_109319181 | 172 |
| 923 | 3300011119 | Ga0105246_10165214 | Ga0105246_101652142 | 172 |
| 924 | 3300014325 | Ga0163163_10134661 | Ga0163163_101346613 | 172 |
| 925 | 3300014326 | Ga0157380_10720006 | Ga0157380_107200062 | 172 |
| 926 | 3300017792 | Ga0163161_10165989 | Ga0163161_101659891 | 172 |
| 927 | 3300025898 | Ga0207692_10012193 | Ga0207692_100121934 | 172 |
| 928 | 3300025900 | Ga0207710_10110716 | Ga0207710_101107162 | 172 |
| 929 | 3300025904 | Ga0207647_10496563 | Ga0207647_104965631 | 172 |
| 930 | 3300025905 | Ga0207685_10015572 | Ga0207685_100155722 | 172 |
| 931 | 3300025906 | Ga0207699_10086095 | Ga0207699_100860952 | 172 |
| 932 | 3300025906 | Ga0207699_10729369 | Ga0207699_107293692 | 172 |
| 933 | 3300025910 | Ga0207684_10040129 | Ga0207684_100401292 | 172 |
| 934 | 3300025910 | Ga0207684_10208437 | Ga0207684_102084372 | 172 |
| 935 | 3300025916 | Ga0207663_10144275 | Ga0207663_101442752 | 172 |
| 936 | 3300025922 | Ga0207646_10034097 | Ga0207646_100340973 | 172 |
| 937 | 3300025922 | Ga0207646_10125331 | Ga0207646_101253313 | 172 |
| 938 | 3300025922 | Ga0207646_10258289 | Ga0207646_102582892 | 172 |
| 939 | 3300025923 | Ga0207681_10506741 | Ga0207681_105067412 | 172 |
| 940 | 3300025928 | Ga0207700_10101232 | Ga0207700_101012323 | 172 |
| 941 | 3300025929 | Ga0207664_10168815 | Ga0207664_101688152 | 172 |
| 942 | 3300025931 | Ga0207644_10442472 | Ga0207644_104424722 | 172 |
| 943 | 3300025961 | Ga0207712_10722678 | Ga0207712_107226782 | 172 |
| 944 | 3300026118 | Ga0207675_100030987 | Ga0207675_1000309873 | 172 |
| 945 | 3300026118 | Ga0207675_101058682 | Ga0207675_1010586822 | 172 |
| 946 | 3300027907 | Ga0207428_10012037 | Ga0207428_100120372 | 172 |
| 947 | 3300028380 | Ga0268265_10078090 | Ga0268265_100780902 | 172 |
| 948 | 3300037312 | Ga0395899_0069946 | Ga0395899_0069946_672_1190 | 172 |
| 949 | 3300037312 | Ga0395899_0434041 | Ga0395899_0434041_197_718 | 172 |
| 950 | 3300037418 | Ga0395900_0002828 | Ga0395900_0002828_8054_8572 | 172 |
| 951 | 3300037418 | Ga0395900_0050303 | Ga0395900_0050303_3716_4237 | 172 |
| 952 | 3300037466 | Ga0395898_0280861 | Ga0395898_0280861_1011_1529 | 172 |
| 953 | 3300037471 | Ga0395905_0012265 | Ga0395905_0012265_1040_1558 | 172 |
| 954 | 3300050507 | nmdc:mga05p37_1093043_c1 | nmdc:mga05p37_1093043_c1_103_705 | 172 |
| 955 | 3300050511 | nmdc:mga08y16_312266_c1 | nmdc:mga08y16_312266_c1_265_825 | 172 |
| 956 | 3300050515 | nmdc:mga0a205_135354_c1 | nmdc:mga0a205_135354_c1_1701_2270 | 172 |
| 957 | 3300025932 | Ga0207690_10590008 | Ga0207690_105900081 | 174 |
| 958 | 3300041453 | Ga0451797_1344230 | Ga0451797_1344230_311_838 | 174 |
| 959 | 3300041458 | Ga0451798_1077237 | Ga0451798_1077237_73_600 | 174 |
| 960 | 3300041459 | Ga0451800_0564701 | Ga0451800_0564701_93_620 | 174 |
| 961 | 3300041460 | Ga0451802_0775119 | Ga0451802_0775119_598_1125 | 174 |
| 962 | 3300041486 | Ga0451807_0017034 | Ga0451807_0017034_1244_1771 | 174 |
| 963 | 3300041505 | Ga0451849_1319872 | Ga0451849_1319872_30_557 | 174 |
| 964 | 3300041512 | Ga0451853_1496837 | Ga0451853_1496837_323_850 | 174 |
| 965 | 3300044683 | Ga0466965_0067611 | Ga0466965_0067611_245_772 | 174 |
| 966 | 3300044735 | Ga0466968_0062485 | Ga0466968_0062485_1043_1570 | 174 |
| 967 | 3300044901 | Ga0466960_0004277 | Ga0466960_0004277_4379_4906 | 174 |
| 968 | 3300045976 | Ga0466967_0004808 | Ga0466967_0004808_1906_2433 | 174 |
| 969 | 3300000652 | ARCol0yngRDRAFT_1002586 | ARCol0yngRDRAFT_10025862 | 175 |
| 970 | 3300003373 | JGI25407J50210_10003405 | JGI25407J50210_100034054 | 175 |
| 971 | 3300005437 | Ga0070710_10015753 | Ga0070710_100157535 | 175 |
| 972 | 3300005440 | Ga0070705_100017233 | Ga0070705_1000172334 | 175 |
| 973 | 3300005445 | Ga0070708_100033519 | Ga0070708_1000335192 | 175 |
| 974 | 3300005455 | Ga0070663_100003020 | Ga0070663_1000030208 | 175 |
| 975 | 3300005456 | Ga0070678_100116013 | Ga0070678_1001160132 | 175 |
| 976 | 3300005467 | Ga0070706_100015165 | Ga0070706_1000151652 | 175 |
| 977 | 3300005471 | Ga0070698_100011310 | Ga0070698_1000113108 | 175 |
| 978 | 3300005518 | Ga0070699_100048536 | Ga0070699_1000485363 | 175 |
| 979 | 3300005530 | Ga0070679_100185002 | Ga0070679_1001850022 | 175 |
| 980 | 3300005546 | Ga0070696_100012491 | Ga0070696_1000124916 | 175 |
| 981 | 3300005564 | Ga0070664_100231336 | Ga0070664_1002313362 | 175 |
| 982 | 3300005614 | Ga0068856_100104638 | Ga0068856_1001046382 | 175 |
| 983 | 3300005615 | Ga0070702_100484537 | Ga0070702_1004845372 | 175 |
| 984 | 3300005937 | Ga0081455_10001632 | Ga0081455_100016329 | 175 |
| 985 | 3300005937 | Ga0081455_10010980 | Ga0081455_100109802 | 175 |
| 986 | 3300005937 | Ga0081455_10020369 | Ga0081455_100203696 | 175 |
| 987 | 3300005937 | Ga0081455_10073252 | Ga0081455_100732524 | 175 |
| 988 | 3300005981 | Ga0081538_10003640 | Ga0081538_100036402 | 175 |
| 989 | 3300005981 | Ga0081538_10009243 | Ga0081538_100092437 | 175 |
| 990 | 3300005981 | Ga0081538_10083532 | Ga0081538_100835322 | 175 |
| 991 | 3300005983 | Ga0081540_1003731 | Ga0081540_10037318 | 175 |
| 992 | 3300005983 | Ga0081540_1010067 | Ga0081540_10100676 | 175 |
| 993 | 3300006038 | Ga0075365_10153619 | Ga0075365_101536192 | 175 |
| 994 | 3300006051 | Ga0075364_10141501 | Ga0075364_101415012 | 175 |
| 995 | 3300006058 | Ga0075432_10094351 | Ga0075432_100943511 | 175 |
| 996 | 3300006173 | Ga0070716_100001535 | Ga0070716_1000015357 | 175 |
| 997 | 3300006175 | Ga0070712_100024834 | Ga0070712_1000248342 | 175 |
| 998 | 3300006195 | Ga0075366_10125474 | Ga0075366_101254742 | 175 |
| 999 | 3300006844 | Ga0075428_100269957 | Ga0075428_1002699572 | 175 |
| 1000 | 3300006852 | Ga0075433_10098587 | Ga0075433_100985872 | 175 |
| 1001 | 3300006852 | Ga0075433_10105283 | Ga0075433_101052832 | 175 |
| 1002 | 3300006852 | Ga0075433_10157727 | Ga0075433_101577272 | 175 |
| 1003 | 3300006871 | Ga0075434_100284183 | Ga0075434_1002841832 | 175 |
| 1004 | 3300006880 | Ga0075429_100019479 | Ga0075429_1000194792 | 175 |
| 1005 | 3300006914 | Ga0075436_100037389 | Ga0075436_1000373893 | 175 |
| 1006 | 3300009147 | Ga0114129_10585608 | Ga0114129_105856082 | 175 |
| 1007 | 3300012488 | Ga0157343_1007170 | Ga0157343_10071702 | 175 |
| 1008 | 3300012505 | Ga0157339_1013329 | Ga0157339_10133291 | 175 |
| 1009 | 3300025898 | Ga0207692_10043955 | Ga0207692_100439552 | 175 |
| 1010 | 3300025898 | Ga0207692_10163298 | Ga0207692_101632982 | 175 |
| 1011 | 3300025905 | Ga0207685_10128678 | Ga0207685_101286781 | 175 |
| 1012 | 3300025908 | Ga0207643_10187933 | Ga0207643_101879331 | 175 |
| 1013 | 3300025910 | Ga0207684_10031315 | Ga0207684_100313152 | 175 |
| 1014 | 3300025911 | Ga0207654_10051469 | Ga0207654_100514693 | 175 |
| 1015 | 3300025915 | Ga0207693_10037912 | Ga0207693_100379122 | 175 |
| 1016 | 3300025915 | Ga0207693_10038347 | Ga0207693_100383475 | 175 |
| 1017 | 3300025922 | Ga0207646_10178465 | Ga0207646_101784652 | 175 |
| 1018 | 3300025927 | Ga0207687_10066568 | Ga0207687_100665683 | 175 |
| 1019 | 3300025929 | Ga0207664_10074216 | Ga0207664_100742162 | 175 |
| 1020 | 3300025935 | Ga0207709_10549121 | Ga0207709_105491211 | 175 |
| 1021 | 3300025939 | Ga0207665_10000494 | Ga0207665_100004947 | 175 |
| 1022 | 3300026067 | Ga0207678_10047585 | Ga0207678_100475853 | 175 |
| 1023 | 3300026078 | Ga0207702_10378233 | Ga0207702_103782332 | 175 |
| 1024 | 3300026118 | Ga0207675_100124347 | Ga0207675_1001243472 | 175 |
| 1025 | 3300026121 | Ga0207683_10023263 | Ga0207683_100232634 | 175 |
| 1026 | 3300027907 | Ga0207428_10012691 | Ga0207428_100126918 | 175 |
| 1027 | 3300027907 | Ga0207428_10013907 | Ga0207428_100139075 | 175 |
| 1028 | 3300027907 | Ga0207428_10112833 | Ga0207428_101128332 | 175 |
| 1029 | 3300031901 | Ga0307406_10798642 | Ga0307406_107986422 | 175 |
| 1030 | 3300031995 | Ga0307409_100125511 | Ga0307409_1001255112 | 175 |
| 1031 | 3300032002 | Ga0307416_101950520 | Ga0307416_1019505202 | 175 |
| 1032 | 3300032126 | Ga0307415_100991477 | Ga0307415_1009914771 | 175 |
| 1033 | 3300042119 | Ga0450915_000171 | Ga0450915_000171_400_927 | 175 |
| 1034 | 3300042157 | Ga0439458_0013062 | Ga0439458_0013062_1313_1843 | 175 |
| 1035 | 3300042532 | Ga0450893_0050378 | Ga0450893_0050378_72_599 | 175 |
| 1036 | 3300044706 | Ga0466964_0027216 | Ga0466964_0027216_912_1448 | 175 |
| 1037 | 3300046518 | Ga0495631_0113571 | Ga0495631_0113571_169_696 | 175 |
| 1038 | 3300046648 | Ga0495611_0063179 | Ga0495611_0063179_471_998 | 175 |
| 1039 | 3300046692 | Ga0495671_0077488 | Ga0495671_0077488_725_1252 | 175 |
| 1040 | 3300049575 | Ga0501039_0306821 | Ga0501039_0306821_665_1201 | 175 |
| 1041 | 3300049741 | Ga0501079_0155730 | Ga0501079_0155730_43_579 | 175 |
| 1042 | 3300050513 | nmdc:mga0rr50_84991_c1 | nmdc:mga0rr50_84991_c1_498_1034 | 175 |
| 1043 | 3300050515 | nmdc:mga0a205_1081154_c1 | nmdc:mga0a205_1081154_c1_82_618 | 175 |
| 1044 | 3300060353 | Ga0501082_0620675 | Ga0501082_0620675_80_616 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1iug-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus | 0.8706 | 107 | 133 |
| 3ffr-assembly1.cif.gz_A-2 | crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution | 0.8343 | 105 | 133 |
| 1m8k-assembly1.cif.gz_A | crystal structure of methanobacterium thermoautotrophicum nicotinamide mononucleotide adenylyltransferase mutant h19a complexed with nad | 0.8169 | 1 | 170 |
| 4yp7-assembly1.cif.gz_A-2 | crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp | 0.8069 | 1 | 170 |
| 4yp7-assembly1.cif.gz_C-2 | crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp | 0.8046 | 1 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1iugB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8706 | 107 | 133 | 3.40.640.10 |
| af_Q58369_38_263_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8568 | 105 | 133 | 3.40.640.10 |
| 3ffrA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8344 | 105 | 133 | 3.40.640.10 |
| af_P9WJL7_104_328_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.8284 | 100 | 131 | 3.40.1190.10 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8047 | 1 | 169 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538DKV5-F1-model_v4 | Cytidyltransferase-like domain-containing protein | 0.9712 | 2 | 170 |
GO:0009058
GO:0016779 |
| AF-A0A538MDM8-F1-model_v4 | Nicotinate-nucleotide adenylyltransferase | 0.9685 | 2 | 158 |
GO:0009058
GO:0016779 |
| AF-A0A536E9V3-F1-model_v4 | Nicotinate-nucleotide adenylyltransferase | 0.9639 | 1 | 170 |
GO:0009058
GO:0016779 |
| AF-A0A538DJF7-F1-model_v4 | Cytidyltransferase-like domain-containing protein | 0.9634 | 1 | 175 |
GO:0009058
GO:0016779 |
| AF-A0A538MDM8-F1-model_v4 | Nicotinate-nucleotide adenylyltransferase | 0.9625 | 2 | 158 |
GO:0009058
GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar