F488917

General Info

Members Datasets Scaffolds Average Seq Length
1044 477 2088 302

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0012126|Ga0501080_0012126_1570_2646
Length 358
Sequence MKARVSPVNVADAWSAIGASPFDARSIAEKPARARARRYHRGLRCDPSRERFPKETRMQLGMIGLGKMGNFMAQRLMKAGHDVVGFDPNGDARKALTDAGGKAVDSLDKLIEALQPPRAVWVMVPAGKIVDQTVAALNDKLAKGDVVIDGGNSNYKDDQRHAAELAPKGINYVDCGTSGGVWGLKEGYSMMVGGDDKVVDRLRPIFEALAPGKDQGWGHVGPVGSGHFVKMVHNGIEYGMMQAYAEGFAIFQHKDEFKLDLAQIAEIWRYGSVVRSWLLDLTADALKRNPDMQGIAPYVVDSGEGRWTVAEAIDLDVPAPIITASLIERLRSRDSDSFTDKLLSAMRNEFGGHAMKKE

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
118 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
139 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
153 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
161 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
162 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
241 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
269 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
270 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
287 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
288 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
289 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
290 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
315 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
316 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
333 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
334 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
392 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
393 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
394 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
398 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
399 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
402 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
403 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
408 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
409 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
412 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
415 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
416 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
417 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
418 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
419 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
423 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
424 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
425 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
426 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
427 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
428 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
429 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
430 2643221593 Lysobacter sp. Root690 Isolate Unclassified
431 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
432 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
433 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
434 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
435 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
436 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
437 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
438 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
439 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
440 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
441 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
442 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
443 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
444 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
445 2884411467 Dyella sp. AD56 Isolate Rhizosphere
446 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
447 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
448 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
449 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
450 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
451 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
452 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
453 2928153084 Leifsonia sp. 563 Isolate Unclassified
454 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
455 2928963466 Dyella japonica 1073 Isolate Unclassified
456 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
457 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
458 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
459 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
460 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
461 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
462 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
463 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
464 2952252522 Salinicola sp. DM10 Isolate Unclassified
465 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
466 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
467 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
468 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
469 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
470 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
471 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
472 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
473 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
474 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
475 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
476 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
477 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.39
Metatranscriptomes 1.34
Isolates 5.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 6.7
Nodule 0.1
Rhizoplane 2.68
Rhizosphere 80.08
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0012126 3300049742 Bacteria 7896
2 JGI24740J21852_10000230 3300001979 Bacteria 23717
3 JGI24739J22299_10055207 3300001989 Bacteria 1270
4 JGI24737J22298_10002869 3300001990 Bacteria 6109
5 JGI24737J22298_10016551 3300001990 Bacteria 2380
6 JGI24735J21928_10000213 3300002067 Bacteria 20363
7 JGI25156J39149_1006824 3300002705 Bacteria 3075
8 JGI25162J39368_1000653 3300002737 Bacteria 24475
9 JGI25162J39368_1001259 3300002737 Bacteria 14479
10 JGI25162J39368_1001943 3300002737 Bacteria 9331
11 JGI25162J39368_1005494 3300002737 Bacteria 2460
12 JGI25157J39369_1002739 3300002741 Bacteria 4056
13 JGI25157J39369_1003624 3300002741 Bacteria 3074
14 JGI25164J39214_1000473 3300002772 Bacteria 19954
15 JGI25164J39214_1000490 3300002772 Bacteria 19438
16 JGI25152J39213_1000103 3300002773 Bacteria 59472
17 JGI25150J39212_1000183 3300002774 Bacteria 35389
18 JGI25151J46595_10000187 3300003187 Bacteria 76949
19 JGI25151J46595_10000271 3300003187 Bacteria 59472
20 JGI25406J46586_10015012 3300003203 Bacteria 3277
21 JGI25165J46597_1000625 3300003214 Bacteria 29618
22 JGI25153J46596_10000190 3300003215 Bacteria 59472
23 Ga0006562J51391_1007922 3300003578 Bacteria 9000
24 Ga0006562J51391_1007923 3300003578 Bacteria 4170
25 Ga0055539_1000014 3300003752 Bacteria 381086
26 Ga0055533_1000002 3300003756 Bacteria 1196393
27 Ga0055533_1000962 3300003756 Bacteria 8475
28 Ga0055525_1005588 3300003759 Bacteria 1068
29 Ga0055542_1000010 3300003762 Bacteria 414813
30 Ga0055529_1001798 3300003763 Bacteria 5209
31 Ga0055526_1000005 3300003771 Bacteria 344542
32 Ga0055537_1000042 3300003773 Bacteria 91406
33 Ga0055537_1001615 3300003773 Bacteria 8475
34 Ga0055524_1000005 3300003775 Bacteria 344542
35 Ga0055536_1000773 3300003781 Bacteria 21299
36 Ga0055534_1000002 3300003784 Bacteria 390762
37 Ga0055528_1000002 3300003790 Bacteria 368879
38 Ga0055530_10002647 3300003791 Bacteria 11202
39 Ga0055541_1000497 3300003841 Bacteria 11039
40 Ga0058692_1000053 3300003856 Bacteria 107166
41 Ga0058692_1000065 3300003856 Bacteria 89723
42 Ga0058862_12823758 3300004803 Bacteria 1790
43 Ga0065714_10088992 3300005288 Bacteria 1996
44 Ga0065715_10005079 3300005293 Bacteria 4935
45 Ga0065707_10092011 3300005295 Bacteria 3842
46 Ga0070658_10000065 3300005327 Bacteria 104621
47 Ga0070658_10016063 3300005327 Bacteria 5986
48 Ga0070658_10122941 3300005327 Bacteria 2158
49 Ga0070658_10136650 3300005327 Bacteria 2046
50 Ga0070676_10002175 3300005328 Bacteria 9989
51 Ga0070676_10004260 3300005328 Bacteria 7516
52 Ga0070683_100058119 3300005329 Bacteria 3594
53 Ga0070683_100102372 3300005329 Bacteria 2697
54 Ga0070670_100086016 3300005331 Bacteria 2702
55 Ga0070670_100120801 3300005331 Bacteria 2260
56 Ga0070670_100295628 3300005331 Bacteria 1416
57 Ga0068869_100000848 3300005334 Bacteria 17540
58 Ga0068869_100005518 3300005334 Bacteria 7962
59 Ga0068869_100178597 3300005334 Bacteria 1663
60 Ga0070680_100000138 3300005336 Bacteria 44481
61 Ga0070680_100019130 3300005336 Bacteria 5423
62 Ga0070680_100026845 3300005336 Bacteria 4607
63 Ga0070680_100065060 3300005336 Bacteria 2988
64 Ga0070680_100249030 3300005336 Bacteria 1502
65 Ga0070682_100004912 3300005337 Bacteria 7422
66 Ga0070682_100013413 3300005337 Bacteria 4713
67 Ga0070682_100183929 3300005337 Bacteria 1462
68 Ga0068868_100000154 3300005338 Bacteria 44616
69 Ga0068868_100169688 3300005338 Bacteria 1806
70 Ga0070660_100355517 3300005339 Bacteria 1207
71 Ga0070689_100006130 3300005340 Bacteria 8285
72 Ga0070691_10000204 3300005341 Bacteria 19856
73 Ga0070691_10047295 3300005341 Bacteria 2045
74 Ga0070687_100001734 3300005343 Bacteria 7848
75 Ga0070687_100100108 3300005343 Bacteria 1621
76 Ga0070661_100014313 3300005344 Bacteria 5589
77 Ga0070661_100019362 3300005344 Bacteria 4851
78 Ga0070661_100022768 3300005344 Bacteria 4486
79 Ga0070661_100137945 3300005344 Bacteria 1836
80 Ga0070661_100221607 3300005344 Bacteria 1451
81 Ga0070661_100505846 3300005344 Bacteria 967
82 Ga0070692_10000826 3300005345 Bacteria 10346
83 Ga0070692_10001376 3300005345 Bacteria 8785
84 Ga0070692_10024606 3300005345 Bacteria 2960
85 Ga0070668_100002627 3300005347 Bacteria 13198
86 Ga0070668_100005675 3300005347 Bacteria 9250
87 Ga0070668_100297144 3300005347 Bacteria 1353
88 Ga0070669_100016734 3300005353 Bacteria 5233
89 Ga0070669_100021816 3300005353 Bacteria 4579
90 Ga0070675_100025078 3300005354 Bacteria 4779
91 Ga0070675_100051402 3300005354 Bacteria 3386
92 Ga0070671_100020254 3300005355 Bacteria 5423
93 Ga0070673_100000023 3300005364 Bacteria 91936
94 Ga0070688_100015057 3300005365 Bacteria 4391
95 Ga0070688_100213269 3300005365 Bacteria 1357
96 Ga0070659_100004369 3300005366 Bacteria 10091
97 Ga0070659_100005005 3300005366 Bacteria 9495
98 Ga0070659_100014512 3300005366 Bacteria 5888
99 Ga0070667_100023098 3300005367 Bacteria 5158
100 Ga0070667_100059611 3300005367 Bacteria 3229
101 Ga0070667_100273171 3300005367 Bacteria 1516
102 Ga0070714_100000007 3300005435 Bacteria 285654
103 Ga0070714_100000025 3300005435 Bacteria 147717
104 Ga0070714_100002188 3300005435 Bacteria 14379
105 Ga0070714_100179606 3300005435 Bacteria 1925
106 Ga0070714_100234025 3300005435 Bacteria 1693
107 Ga0070713_100003658 3300005436 Bacteria 10176
108 Ga0070711_100203553 3300005439 Bacteria 1529
109 Ga0070705_100176800 3300005440 Bacteria 1442
110 Ga0070700_100000015 3300005441 Bacteria 149873
111 Ga0070700_100022316 3300005441 Bacteria 3689
112 Ga0070708_100005216 3300005445 Bacteria 10289
113 Ga0070708_100382634 3300005445 Bacteria 1327
114 Ga0070663_100001998 3300005455 Bacteria 11388
115 Ga0070663_100003552 3300005455 Bacteria 9006
116 Ga0070663_100011137 3300005455 Bacteria 5632
117 Ga0070663_100030594 3300005455 Bacteria 3691
118 Ga0070663_100174476 3300005455 Bacteria 1664
119 Ga0070663_100181951 3300005455 Bacteria 1631
120 Ga0070678_100015225 3300005456 Bacteria 4881
121 Ga0070678_100040799 3300005456 Bacteria 3286
122 Ga0070662_100007688 3300005457 Bacteria 6993
123 Ga0070662_100055165 3300005457 Bacteria 2882
124 Ga0070662_100095797 3300005457 Bacteria 2238
125 Ga0070662_100105335 3300005457 Bacteria 2141
126 Ga0070662_100356393 3300005457 Bacteria 1199
127 Ga0070681_10000076 3300005458 Bacteria 73378
128 Ga0070681_10001058 3300005458 Bacteria 23417
129 Ga0070681_10005260 3300005458 Bacteria 12496
130 Ga0070681_10012818 3300005458 Bacteria 8322
131 Ga0070681_10051976 3300005458 Bacteria 4086
132 Ga0070681_10097017 3300005458 Bacteria 2895
133 Ga0070681_10231243 3300005458 Bacteria 1763
134 Ga0068867_100000007 3300005459 Bacteria 148726
135 Ga0068867_100299750 3300005459 Bacteria 1325
136 Ga0070685_10053205 3300005466 Bacteria 2345
137 Ga0070706_100017183 3300005467 Bacteria 6682
138 Ga0070706_100075262 3300005467 Bacteria 3124
139 Ga0070698_100025964 3300005471 Bacteria 6102
140 Ga0070679_100000504 3300005530 Bacteria 33271
141 Ga0070679_100005669 3300005530 Bacteria 11575
142 Ga0070679_100094827 3300005530 Bacteria 2972
143 Ga0070679_100229808 3300005530 Bacteria 1815
144 Ga0070679_100245203 3300005530 Bacteria 1748
145 Ga0070684_100142709 3300005535 Bacteria 2166
146 Ga0070684_100431134 3300005535 Bacteria 1217
147 Ga0070684_100608218 3300005535 Bacteria 1016
148 Ga0070697_100053485 3300005536 Bacteria 3281
149 Ga0070697_100147487 3300005536 Bacteria 1982
150 Ga0068853_100025947 3300005539 Bacteria 4918
151 Ga0068853_100026580 3300005539 Bacteria 4860
152 Ga0068853_100087550 3300005539 Bacteria 2733
153 Ga0068853_100195851 3300005539 Bacteria 1838
154 Ga0068853_100241865 3300005539 Bacteria 1654
155 Ga0068853_100295727 3300005539 Bacteria 1495
156 Ga0070672_100003161 3300005543 Bacteria 10646
157 Ga0070672_100021437 3300005543 Bacteria 4728
158 Ga0070686_100193262 3300005544 Bacteria 1454
159 Ga0070696_100003079 3300005546 Bacteria 11084
160 Ga0070696_100015403 3300005546 Bacteria 5134
161 Ga0070696_100027962 3300005546 Bacteria 3846
162 Ga0070693_100014051 3300005547 Bacteria 4091
163 Ga0070665_100000465 3300005548 Bacteria 58821
164 Ga0070665_100237824 3300005548 Bacteria 1822
165 Ga0070665_100503266 3300005548 Bacteria 1223
166 Ga0070704_100071046 3300005549 Bacteria 2528
167 Ga0068855_100000897 3300005563 Bacteria 36900
168 Ga0068855_100034494 3300005563 Bacteria 6035
169 Ga0068855_100059757 3300005563 Bacteria 4459
170 Ga0068855_100167742 3300005563 Bacteria 2488
171 Ga0068855_100192031 3300005563 Bacteria 2303
172 Ga0068855_100593199 3300005563 Bacteria 1195
173 Ga0068857_100014249 3300005577 Bacteria 6927
174 Ga0068857_100019539 3300005577 Bacteria 5950
175 Ga0068857_100082251 3300005577 Bacteria 2876
176 Ga0068857_100120614 3300005577 Bacteria 2360
177 Ga0068857_100150476 3300005577 Bacteria 2108
178 Ga0068854_100000027 3300005578 Bacteria 117836
179 Ga0068854_100000142 3300005578 Bacteria 49834
180 Ga0068854_100063019 3300005578 Bacteria 2690
181 Ga0068854_100368849 3300005578 Bacteria 1180
182 Ga0068856_100000462 3300005614 Bacteria 44787
183 Ga0068856_100004819 3300005614 Bacteria 13371
184 Ga0068856_100025070 3300005614 Bacteria 5811
185 Ga0068856_100336574 3300005614 Bacteria 1527
186 Ga0068852_100112354 3300005616 Bacteria 2479
187 Ga0068866_10036810 3300005718 Bacteria 2399
188 Ga0068861_100004360 3300005719 Bacteria 9490
189 Ga0068851_10026102 3300005834 Bacteria 2868
190 Ga0068863_100038707 3300005841 Bacteria 4536
191 Ga0068858_100013390 3300005842 Bacteria 7741
192 Ga0068858_100098118 3300005842 Bacteria 2732
193 Ga0068858_100128673 3300005842 Bacteria 2373
194 Ga0068860_100041224 3300005843 Bacteria 4410
195 Ga0068860_100061738 3300005843 Bacteria 3561
196 Ga0068860_100101230 3300005843 Bacteria 2749
197 Ga0068862_100070914 3300005844 Bacteria 3009
198 Ga0081539_10000105 3300005985 Bacteria 197356
199 Ga0081539_10083936 3300005985 Bacteria 1666
200 Ga0075364_10061999 3300006051 Bacteria 2454
201 Ga0070712_100056201 3300006175 Bacteria 2760
202 Ga0070712_100218002 3300006175 Bacteria 1509
203 Ga0097621_100002061 3300006237 Bacteria 13748
204 Ga0068871_100002074 3300006358 Bacteria 13555
205 Ga0068871_100137854 3300006358 Bacteria 2073
206 Ga0075428_100002309 3300006844 Bacteria 20651
207 Ga0075428_100008733 3300006844 Bacteria 11238
208 Ga0075428_100415922 3300006844 Bacteria 1440
209 Ga0075428_100713931 3300006844 Bacteria 1068
210 Ga0075430_100065318 3300006846 Bacteria 3057
211 Ga0075431_100013904 3300006847 Bacteria 8127
212 Ga0075433_10039496 3300006852 Bacteria 4082
213 Ga0075434_100007756 3300006871 Bacteria 9939
214 Ga0075434_100048328 3300006871 Bacteria 4221
215 Ga0075429_100055515 3300006880 Bacteria 3446
216 Ga0068865_100000010 3300006881 Bacteria 159548
217 Ga0068865_100007765 3300006881 Bacteria 6613
218 Ga0068865_100122851 3300006881 Bacteria 1934
219 Ga0099795_10004112 3300007788 Bacteria 3711
220 Ga0105240_10000049 3300009093 Bacteria 236718
221 Ga0105240_10000113 3300009093 Bacteria 168192
222 Ga0105240_10002816 3300009093 Bacteria 27486
223 Ga0105240_10069114 3300009093 Bacteria 4372
224 Ga0105240_10081693 3300009093 Bacteria 3970
225 Ga0105240_10228162 3300009093 Bacteria 2166
226 Ga0105240_10680974 3300009093 Bacteria 1124
227 Ga0111539_10043138 3300009094 Bacteria 5409
228 Ga0111539_10049401 3300009094 Bacteria 5017
229 Ga0111539_10063244 3300009094 Bacteria 4379
230 Ga0111539_10565172 3300009094 Bacteria 1325
231 Ga0105245_10001804 3300009098 Bacteria 19521
232 Ga0105245_10056362 3300009098 Bacteria 3532
233 Ga0105245_10062002 3300009098 Bacteria 3373
234 Ga0114129_10001539 3300009147 Bacteria 31268
235 Ga0114129_10014853 3300009147 Bacteria 11095
236 Ga0114129_10148798 3300009147 Bacteria 3205
237 Ga0105243_10000950 3300009148 Bacteria 27049
238 Ga0105243_10004757 3300009148 Bacteria 10671
239 Ga0105243_10008647 3300009148 Bacteria 7810
240 Ga0105243_10011470 3300009148 Bacteria 6704
241 Ga0105243_10014541 3300009148 Bacteria 5954
242 Ga0105241_10011546 3300009174 Bacteria 6475
243 Ga0105241_10012868 3300009174 Bacteria 6140
244 Ga0105241_10013711 3300009174 Bacteria 5938
245 Ga0105241_10282502 3300009174 Bacteria 1418
246 Ga0105242_10000210 3300009176 Bacteria 45627
247 Ga0105242_10007241 3300009176 Bacteria 8552
248 Ga0105248_10057736 3300009177 Bacteria 4356
249 Ga0105248_10262904 3300009177 Bacteria 1942
250 Ga0105237_10000230 3300009545 Bacteria 79441
251 Ga0105237_10284515 3300009545 Bacteria 1656
252 Ga0105237_10362694 3300009545 Bacteria 1453
253 Ga0105238_10002948 3300009551 Bacteria 16980
254 Ga0105238_10041071 3300009551 Bacteria 4686
255 Ga0105238_10073696 3300009551 Bacteria 3408
256 Ga0105238_10143947 3300009551 Bacteria 2360
257 Ga0105238_10543702 3300009551 Bacteria 1165
258 Ga0105249_10000195 3300009553 Bacteria 69709
259 Ga0105249_10007619 3300009553 Bacteria 9444
260 Ga0105249_10017303 3300009553 Bacteria 6400
261 Ga0105249_10030480 3300009553 Bacteria 4876
262 Ga0105249_10135624 3300009553 Bacteria 2355
263 Ga0105249_10294373 3300009553 Bacteria 1626
264 Ga0105032_101587 3300009979 Bacteria 2065
265 Ga0105028_101804 3300009993 Bacteria 2244
266 Ga0105239_10000034 3300010375 Bacteria 219430
267 Ga0105239_10004123 3300010375 Bacteria 17464
268 Ga0105239_10095696 3300010375 Bacteria 3280
269 Ga0105239_10299995 3300010375 Bacteria 1809
270 Ga0105239_10319165 3300010375 Bacteria 1751
271 Ga0105239_10485188 3300010375 Bacteria 1404
272 Ga0157373_10098054 3300013100 Bacteria 2063
273 Ga0157371_10000397 3300013102 Bacteria 54547
274 Ga0157371_10019340 3300013102 Bacteria 5024
275 Ga0157371_10070140 3300013102 Bacteria 2481
276 Ga0157371_10080697 3300013102 Bacteria 2304
277 Ga0157371_10182732 3300013102 Bacteria 1500
278 Ga0157371_10236816 3300013102 Bacteria 1312
279 Ga0157370_10010248 3300013104 Bacteria 9897
280 Ga0157370_10024020 3300013104 Bacteria 6044
281 Ga0157370_10025407 3300013104 Bacteria 5862
282 Ga0157370_10035718 3300013104 Bacteria 4828
283 Ga0157370_10065485 3300013104 Bacteria 3438
284 Ga0157370_10082723 3300013104 Bacteria 3019
285 Ga0157370_10189137 3300013104 Bacteria 1911
286 Ga0157369_10030897 3300013105 Bacteria 5904
287 Ga0157369_10045576 3300013105 Bacteria 4768
288 Ga0157369_10054676 3300013105 Bacteria 4310
289 Ga0157369_10196583 3300013105 Bacteria 2118
290 Ga0157369_10219655 3300013105 Bacteria 1990
291 Ga0157369_10248017 3300013105 Bacteria 1859
292 Ga0157369_10301602 3300013105 Bacteria 1666
293 Ga0157374_10000830 3300013296 Bacteria 27049
294 Ga0157374_10002660 3300013296 Bacteria 15048
295 Ga0157374_10079124 3300013296 Bacteria 3114
296 Ga0157374_10265052 3300013296 Bacteria 1693
297 Ga0157378_10001477 3300013297 Bacteria 21228
298 Ga0157378_10013933 3300013297 Bacteria 7034
299 Ga0157378_10144915 3300013297 Bacteria 2208
300 Ga0157378_10562746 3300013297 Bacteria 1147
301 Ga0163162_10000015 3300013306 Bacteria 261996
302 Ga0163162_10009246 3300013306 Bacteria 9588
303 Ga0163162_10033700 3300013306 Bacteria 5090
304 Ga0163162_10072625 3300013306 Bacteria 3496
305 Ga0163162_10670611 3300013306 Bacteria 1160
306 Ga0157372_10000004 3300013307 Bacteria 435659
307 Ga0157372_10008269 3300013307 Bacteria 11061
308 Ga0157372_10022871 3300013307 Bacteria 6769
309 Ga0157372_10047515 3300013307 Bacteria 4770
310 Ga0157372_10070446 3300013307 Bacteria 3934
311 Ga0157372_10118468 3300013307 Bacteria 3038
312 Ga0157372_10122484 3300013307 Bacteria 2988
313 Ga0157375_10002120 3300013308 Bacteria 17145
314 Ga0157375_10156411 3300013308 Bacteria 2418
315 Ga0157375_10234511 3300013308 Bacteria 1994
316 Ga0157375_10389508 3300013308 Bacteria 1560
317 Ga0157375_10663712 3300013308 Bacteria 1198
318 Ga0163163_10000205 3300014325 Bacteria 61330
319 Ga0163163_10091541 3300014325 Bacteria 3056
320 Ga0157380_10033964 3300014326 Bacteria 3931
321 Ga0157380_10299929 3300014326 Bacteria 1480
322 Ga0182008_10048966 3300014497 Bacteria 2098
323 Ga0182008_10069164 3300014497 Bacteria 1737
324 Ga0157377_10014848 3300014745 Bacteria 3972
325 Ga0157379_10367839 3300014968 Bacteria 1318
326 Ga0157376_10000047 3300014969 Bacteria 107974
327 Ga0157376_10112995 3300014969 Bacteria 2394
328 Ga0157376_10261459 3300014969 Bacteria 1622
329 Ga0182006_1012948 3300015261 Bacteria 3637
330 Ga0182006_1030792 3300015261 Bacteria 2166
331 Ga0182006_1032508 3300015261 Bacteria 2097
332 Ga0182006_1033197 3300015261 Bacteria 2070
333 Ga0182007_10000079 3300015262 Bacteria 73543
334 Ga0182007_10003052 3300015262 Bacteria 8072
335 Ga0182005_1000166 3300015265 Bacteria 45594
336 Ga0182005_1048792 3300015265 Bacteria 1150
337 Ga0183368_1004 3300015687 Bacteria 1211761
338 Ga0183360_10002 3300015689 Bacteria 953821
339 Ga0163161_10018593 3300017792 Bacteria 4869
340 Ga0163161_10039512 3300017792 Bacteria 3388
341 Ga0163161_10184246 3300017792 Bacteria 1602
342 Ga0197907_10031041 3300020069 Bacteria 1831
343 Ga0206356_11162436 3300020070 Bacteria 2371
344 Ga0206351_10270042 3300020077 Bacteria 1049
345 Ga0206352_10784584 3300020078 Bacteria 1230
346 Ga0206350_10514329 3300020080 Bacteria 2379
347 Ga0206354_10512197 3300020081 Bacteria 2443
348 Ga0206353_11363697 3300020082 Bacteria 1420
349 Ga0154015_1208151 3300020610 Bacteria 1257
350 Ga0154015_1499885 3300020610 Bacteria 1311
351 Ga0213876_10001632 3300021384 Bacteria 13683
352 Ga0213875_10049732 3300021388 Bacteria 1965
353 Ga0224712_10020806 3300022467 Bacteria 2235
354 Ga0224712_10028061 3300022467 Bacteria 2008
355 Ga0228598_1013405 3300024227 Bacteria 1623
356 Ga0209566_100056 3300025225 Bacteria 209595
357 Ga0209674_100001 3300025226 Bacteria 4013750
358 Ga0209674_100063 3300025226 Bacteria 275507
359 Ga0209674_100836 3300025226 Bacteria 10196
360 Ga0209672_100509 3300025228 Bacteria 21444
361 Ga0209563_100001 3300025230 Bacteria 4013775
362 Ga0207427_100132 3300025231 Bacteria 92962
363 Ga0207427_100322 3300025231 Bacteria 32298
364 Ga0207427_103057 3300025231 Bacteria 3807
365 Ga0209437_100005 3300025233 Bacteria 1071596
366 Ga0209437_100118 3300025233 Bacteria 207534
367 Ga0209437_100233 3300025233 Bacteria 93858
368 Ga0209258_100935 3300025242 Bacteria 14221
369 Ga0209258_101545 3300025242 Bacteria 7709
370 Ga0207425_1000148 3300025245 Bacteria 59862
371 Ga0207425_1001805 3300025245 Bacteria 8297
372 Ga0209646_1004787 3300025246 Bacteria 2432
373 Ga0209026_1000010 3300025250 Bacteria 511986
374 Ga0209026_1000061 3300025250 Bacteria 219572
375 Ga0209677_100001 3300025253 Bacteria 4013787
376 Ga0209148_1000005 3300025254 Bacteria 1806504
377 Ga0209759_1003743 3300025256 Bacteria 5945
378 Ga0209129_1000239 3300025258 Bacteria 59863
379 Ga0209233_1000011 3300025261 Bacteria 1071611
380 Ga0209233_1000046 3300025261 Bacteria 470971
381 Ga0209233_1011210 3300025261 Bacteria 2649
382 Ga0209233_1015398 3300025261 Bacteria 2130
383 Ga0209565_1000001 3300025263 Bacteria 2950419
384 Ga0209455_1000111 3300025272 Bacteria 188820
385 Ga0209673_1000001 3300025273 Bacteria 3176258
386 Ga0209675_1000001 3300025291 Bacteria 2950293
387 Ga0209676_1000411 3300025292 Bacteria 77084
388 Ga0209025_1000006 3300025294 Bacteria 1153444
389 Ga0209025_1000048 3300025294 Bacteria 335574
390 Ga0209564_1000001 3300025295 Bacteria 3176258
391 Ga0209758_1000056 3300025297 Bacteria 335574
392 Ga0209758_1008030 3300025297 Bacteria 6973
393 Ga0209050_1000146 3300025298 Bacteria 166930
394 Ga0209256_1000006 3300025299 Bacteria 1250310
395 Ga0209256_1003699 3300025299 Bacteria 10388
396 Ga0207656_10008749 3300025321 Bacteria 3741
397 Ga0207642_10161387 3300025899 Bacteria 1204
398 Ga0207688_10112355 3300025901 Bacteria 1583
399 Ga0207680_10047257 3300025903 Bacteria 2549
400 Ga0207680_10061889 3300025903 Bacteria 2284
401 Ga0207647_10001386 3300025904 Bacteria 18622
402 Ga0207647_10002100 3300025904 Bacteria 15252
403 Ga0207647_10003612 3300025904 Bacteria 11579
404 Ga0207647_10010284 3300025904 Bacteria 6610
405 Ga0207647_10026222 3300025904 Bacteria 3816
406 Ga0207647_10051240 3300025904 Bacteria 2552
407 Ga0207647_10054217 3300025904 Bacteria 2467
408 Ga0207645_10000737 3300025907 Bacteria 27273
409 Ga0207645_10009242 3300025907 Bacteria 6828
410 Ga0207705_10000001 3300025909 Bacteria 2061880
411 Ga0207705_10000146 3300025909 Bacteria 75353
412 Ga0207705_10000373 3300025909 Bacteria 40446
413 Ga0207705_10000788 3300025909 Bacteria 26019
414 Ga0207705_10009432 3300025909 Bacteria 7097
415 Ga0207705_10059428 3300025909 Bacteria 2759
416 Ga0207705_10081047 3300025909 Bacteria 2365
417 Ga0207705_10257657 3300025909 Bacteria 1331
418 Ga0207684_10076825 3300025910 Bacteria 2838
419 Ga0207684_10321899 3300025910 Bacteria 1333
420 Ga0207654_10024425 3300025911 Bacteria 3249
421 Ga0207707_10000018 3300025912 Bacteria 215518
422 Ga0207707_10000036 3300025912 Bacteria 146159
423 Ga0207707_10000868 3300025912 Bacteria 29545
424 Ga0207707_10000944 3300025912 Bacteria 28014
425 Ga0207707_10009741 3300025912 Bacteria 8335
426 Ga0207707_10015309 3300025912 Bacteria 6677
427 Ga0207707_10017108 3300025912 Bacteria 6317
428 Ga0207707_10023133 3300025912 Bacteria 5438
429 Ga0207707_10027620 3300025912 Bacteria 4961
430 Ga0207707_10050186 3300025912 Bacteria 3635
431 Ga0207707_10127412 3300025912 Bacteria 2226
432 Ga0207695_10000007 3300025913 Bacteria 1092551
433 Ga0207695_10000114 3300025913 Bacteria 242465
434 Ga0207695_10000816 3300025913 Bacteria 57734
435 Ga0207695_10001086 3300025913 Bacteria 47444
436 Ga0207695_10002626 3300025913 Bacteria 26298
437 Ga0207695_10027868 3300025913 Bacteria 6280
438 Ga0207695_10050538 3300025913 Bacteria 4372
439 Ga0207695_10053798 3300025913 Bacteria 4208
440 Ga0207695_10073182 3300025913 Bacteria 3493
441 Ga0207695_10115114 3300025913 Bacteria 2664
442 Ga0207695_10182106 3300025913 Bacteria 2022
443 Ga0207671_10000639 3300025914 Bacteria 45851
444 Ga0207671_10082200 3300025914 Bacteria 2417
445 Ga0207671_10321677 3300025914 Bacteria 1224
446 Ga0207660_10000389 3300025917 Bacteria 28880
447 Ga0207660_10009240 3300025917 Bacteria 6379
448 Ga0207660_10009433 3300025917 Bacteria 6317
449 Ga0207660_10009884 3300025917 Bacteria 6180
450 Ga0207660_10010720 3300025917 Bacteria 5957
451 Ga0207660_10015984 3300025917 Bacteria 4961
452 Ga0207660_10028000 3300025917 Bacteria 3851
453 Ga0207660_10048875 3300025917 Bacteria 2995
454 Ga0207660_10145550 3300025917 Bacteria 1816
455 Ga0207660_10237378 3300025917 Bacteria 1435
456 Ga0207662_10001726 3300025918 Bacteria 10708
457 Ga0207657_10022248 3300025919 Bacteria 5940
458 Ga0207649_10001271 3300025920 Bacteria 15070
459 Ga0207649_10019583 3300025920 Bacteria 3869
460 Ga0207649_10065234 3300025920 Bacteria 2304
461 Ga0207649_10150937 3300025920 Bacteria 1600
462 Ga0207652_10000409 3300025921 Bacteria 44486
463 Ga0207652_10004945 3300025921 Bacteria 10791
464 Ga0207652_10007521 3300025921 Bacteria 8769
465 Ga0207652_10038403 3300025921 Bacteria 4059
466 Ga0207652_10076977 3300025921 Bacteria 2910
467 Ga0207652_10212731 3300025921 Bacteria 1741
468 Ga0207646_10192292 3300025922 Bacteria 1843
469 Ga0207681_10027150 3300025923 Bacteria 3699
470 Ga0207694_10000930 3300025924 Bacteria 25962
471 Ga0207694_10002010 3300025924 Bacteria 16833
472 Ga0207694_10013293 3300025924 Bacteria 6199
473 Ga0207694_10085369 3300025924 Bacteria 2484
474 Ga0207694_10132693 3300025924 Bacteria 1997
475 Ga0207650_10059382 3300025925 Bacteria 2850
476 Ga0207650_10165686 3300025925 Bacteria 1754
477 Ga0207650_10244319 3300025925 Bacteria 1451
478 Ga0207659_10042135 3300025926 Bacteria 3199
479 Ga0207659_10136197 3300025926 Bacteria 1901
480 Ga0207687_10008258 3300025927 Bacteria 6810
481 Ga0207687_10062794 3300025927 Bacteria 2628
482 Ga0207700_10001535 3300025928 Bacteria 13085
483 Ga0207700_10296846 3300025928 Bacteria 1394
484 Ga0207664_10000014 3300025929 Bacteria 249865
485 Ga0207664_10000071 3300025929 Bacteria 105708
486 Ga0207664_10000601 3300025929 Bacteria 24933
487 Ga0207644_10042775 3300025931 Bacteria 3212
488 Ga0207690_10000532 3300025932 Bacteria 24801
489 Ga0207690_10001860 3300025932 Bacteria 12965
490 Ga0207690_10108815 3300025932 Bacteria 1993
491 Ga0207690_10109772 3300025932 Bacteria 1985
492 Ga0207690_10137975 3300025932 Bacteria 1793
493 Ga0207706_10008698 3300025933 Bacteria 9352
494 Ga0207706_10011915 3300025933 Bacteria 7916
495 Ga0207706_10013100 3300025933 Bacteria 7546
496 Ga0207706_10042110 3300025933 Bacteria 4047
497 Ga0207706_10049448 3300025933 Bacteria 3715
498 Ga0207706_10470496 3300025933 Bacteria 1086
499 Ga0207686_10000598 3300025934 Bacteria 22543
500 Ga0207709_10000050 3300025935 Bacteria 234391
501 Ga0207709_10000527 3300025935 Bacteria 33281
502 Ga0207709_10009913 3300025935 Bacteria 5247
503 Ga0207704_10000020 3300025938 Bacteria 148847
504 Ga0207704_10013639 3300025938 Bacteria 4076
505 Ga0207691_10003625 3300025940 Bacteria 14989
506 Ga0207691_10014108 3300025940 Bacteria 7622
507 Ga0207691_10046652 3300025940 Bacteria 3980
508 Ga0207711_10014427 3300025941 Bacteria 6563
509 Ga0207711_10023261 3300025941 Bacteria 5186
510 Ga0207689_10001541 3300025942 Bacteria 21894
511 Ga0207689_10001783 3300025942 Bacteria 20340
512 Ga0207661_10001897 3300025944 Bacteria 14342
513 Ga0207661_10045981 3300025944 Bacteria 3459
514 Ga0207661_10209699 3300025944 Bacteria 1716
515 Ga0207661_10248469 3300025944 Bacteria 1580
516 Ga0207679_10004674 3300025945 Bacteria 8528
517 Ga0207667_10000040 3300025949 Bacteria 275827
518 Ga0207667_10000947 3300025949 Bacteria 37022
519 Ga0207667_10007762 3300025949 Bacteria 12828
520 Ga0207667_10072474 3300025949 Bacteria 3580
521 Ga0207667_10103191 3300025949 Bacteria 2941
522 Ga0207667_10149101 3300025949 Bacteria 2408
523 Ga0207667_10205878 3300025949 Bacteria 2017
524 Ga0207667_10238588 3300025949 Bacteria 1861
525 Ga0207651_10000005 3300025960 Bacteria 246132
526 Ga0207712_10000277 3300025961 Bacteria 48990
527 Ga0207712_10001146 3300025961 Bacteria 18465
528 Ga0207712_10014077 3300025961 Bacteria 5135
529 Ga0207712_10021212 3300025961 Bacteria 4262
530 Ga0207668_10005154 3300025972 Bacteria 7689
531 Ga0207668_10018373 3300025972 Bacteria 4398
532 Ga0207640_10000009 3300025981 Bacteria 283101
533 Ga0207640_10000145 3300025981 Bacteria 51603
534 Ga0207640_10005290 3300025981 Bacteria 7031
535 Ga0207640_10014194 3300025981 Bacteria 4579
536 Ga0207640_10098268 3300025981 Bacteria 2046
537 Ga0207640_10133355 3300025981 Bacteria 1799
538 Ga0207658_10149525 3300025986 Bacteria 1901
539 Ga0207677_10000373 3300026023 Bacteria 31103
540 Ga0207677_10471654 3300026023 Bacteria 1080
541 Ga0207703_10004934 3300026035 Bacteria 10830
542 Ga0207639_10001840 3300026041 Bacteria 14285
543 Ga0207639_10004652 3300026041 Bacteria 9240
544 Ga0207639_10007809 3300026041 Bacteria 7304
545 Ga0207639_10014224 3300026041 Bacteria 5589
546 Ga0207639_10020933 3300026041 Bacteria 4692
547 Ga0207639_10293628 3300026041 Bacteria 1434
548 Ga0207639_10693695 3300026041 Bacteria 944
549 Ga0207678_10004979 3300026067 Bacteria 11914
550 Ga0207678_10005889 3300026067 Bacteria 10929
551 Ga0207678_10006369 3300026067 Bacteria 10480
552 Ga0207678_10020914 3300026067 Bacteria 5736
553 Ga0207678_10043979 3300026067 Bacteria 3865
554 Ga0207708_10000004 3300026075 Bacteria 293087
555 Ga0207708_10009224 3300026075 Bacteria 7302
556 Ga0207702_10000172 3300026078 Bacteria 77484
557 Ga0207702_10008380 3300026078 Bacteria 8721
558 Ga0207702_10015708 3300026078 Bacteria 6269
559 Ga0207702_10036014 3300026078 Bacteria 4138
560 Ga0207641_10025775 3300026088 Bacteria 4849
561 Ga0207641_10043596 3300026088 Bacteria 3768
562 Ga0207648_10000017 3300026089 Bacteria 148699
563 Ga0207648_10027096 3300026089 Bacteria 5090
564 Ga0207648_10030744 3300026089 Bacteria 4752
565 Ga0207648_10136587 3300026089 Bacteria 2160
566 Ga0207674_10001921 3300026116 Bacteria 26378
567 Ga0207674_10004423 3300026116 Bacteria 16915
568 Ga0207674_10012476 3300026116 Bacteria 9496
569 Ga0207674_10021680 3300026116 Bacteria 6916
570 Ga0207674_10050289 3300026116 Bacteria 4259
571 Ga0207674_10227566 3300026116 Bacteria 1813
572 Ga0207674_10258908 3300026116 Bacteria 1687
573 Ga0207674_10341215 3300026116 Bacteria 1448
574 Ga0207675_100001976 3300026118 Bacteria 20447
575 Ga0207675_100031644 3300026118 Bacteria 4929
576 Ga0207683_10232436 3300026121 Bacteria 1682
577 Ga0207698_10000931 3300026142 Bacteria 17023
578 Ga0207698_10054723 3300026142 Bacteria 3072
579 Ga0207698_10083396 3300026142 Bacteria 2587
580 Ga0207698_10332722 3300026142 Bacteria 1427
581 Ga0209371_1000018 3300027312 Bacteria 614700
582 Ga0209371_1000025 3300027312 Bacteria 450640
583 Ga0209974_10004171 3300027876 Bacteria 5169
584 Ga0268266_10000006 3300028379 Bacteria 1410021
585 Ga0268266_10026003 3300028379 Bacteria 4979
586 Ga0268266_10027010 3300028379 Bacteria 4884
587 Ga0268266_10031407 3300028379 Bacteria 4510
588 Ga0268266_10305737 3300028379 Bacteria 1485
589 Ga0268265_10061048 3300028380 Bacteria 2891
590 Ga0268265_10566371 3300028380 Bacteria 1081
591 Ga0268264_10148368 3300028381 Bacteria 2100
592 Ga0268264_10298648 3300028381 Bacteria 1515
593 Ga0265319_1000240 3300028563 Bacteria 41199
594 Ga0265318_10002424 3300028577 Bacteria 9972
595 Ga0265338_10212940 3300028800 Bacteria 1449
596 Ga0268256_1000016 3300030500 Bacteria 614700
597 Ga0268256_1000027 3300030500 Bacteria 450640
598 Ga0316181_1114053 3300030744 Bacteria 1726
599 Ga0316181_1268996 3300030744 Bacteria 2554
600 Ga0265332_10014777 3300031238 Bacteria 3451
601 Ga0265320_10000136 3300031240 Bacteria 63022
602 Ga0265325_10001525 3300031241 Bacteria 16241
603 Ga0265325_10042548 3300031241 Bacteria 2374
604 Ga0265329_10000171 3300031242 Bacteria 32652
605 Ga0265340_10003989 3300031247 Bacteria 8293
606 Ga0265339_10065646 3300031249 Bacteria 1945
607 Ga0265331_10000021 3300031250 Bacteria 242632
608 Ga0265331_10016315 3300031250 Bacteria 3902
609 Ga0265316_10001078 3300031344 Bacteria 29506
610 Ga0265316_10012682 3300031344 Bacteria 7544
611 Ga0307513_10158437 3300031456 Bacteria 2160
612 Ga0307408_100005909 3300031548 Bacteria 8152
613 Ga0307408_100073444 3300031548 Bacteria 2535
614 Ga0265313_10001348 3300031595 Bacteria 23135
615 Ga0307508_10065258 3300031616 Bacteria 3208
616 Ga0307508_10284242 3300031616 Bacteria 1248
617 Ga0265314_10007149 3300031711 Bacteria 9723
618 Ga0265342_10000555 3300031712 Bacteria 39457
619 Ga0265342_10104745 3300031712 Bacteria 1607
620 Ga0307413_10022756 3300031824 Bacteria 3384
621 Ga0307413_10085739 3300031824 Bacteria 2034
622 Ga0307413_10088902 3300031824 Bacteria 2005
623 Ga0307413_10126983 3300031824 Bacteria 1739
624 Ga0307410_10002430 3300031852 Bacteria 9007
625 Ga0307410_10029439 3300031852 Bacteria 3496
626 Ga0307410_10040470 3300031852 Bacteria 3067
627 Ga0307406_10002083 3300031901 Bacteria 10912
628 Ga0307406_10005253 3300031901 Bacteria 7079
629 Ga0307406_10186025 3300031901 Bacteria 1517
630 Ga0307407_10043860 3300031903 Bacteria 2517
631 Ga0307412_10093954 3300031911 Bacteria 2105
632 Ga0307412_10217952 3300031911 Bacteria 1461
633 Ga0307409_100049477 3300031995 Bacteria 3205
634 Ga0307409_100063613 3300031995 Bacteria 2894
635 Ga0307416_100110189 3300032002 Bacteria 2423
636 Ga0307414_10000303 3300032004 Bacteria 28561
637 Ga0307414_10002908 3300032004 Bacteria 9058
638 Ga0307414_10380382 3300032004 Bacteria 1220
639 Ga0307411_10076113 3300032005 Bacteria 2293
640 Ga0307411_10076436 3300032005 Bacteria 2289
641 Ga0307411_10084639 3300032005 Bacteria 2194
642 Ga0307415_100140021 3300032126 Bacteria 1846
643 Ga0307415_100354786 3300032126 Bacteria 1236
644 Ga0307507_10093349 3300033179 Bacteria 2564
645 Ga0373926_0027212 3300035083 Bacteria 2002
646 Ga0373952_0035064 3300035092 Bacteria 1134
647 Ga0373945_0006636 3300035116 Bacteria 3739
648 Ga0373956_0063225 3300035119 Bacteria 1678
649 Ga0373943_0002619 3300035170 Bacteria 8184
650 Ga0373935_0014070 3300035692 Bacteria 4832
651 Ga0373927_0031176 3300035695 Bacteria 3477
652 Ga0373933_0018862 3300035724 Bacteria 3886
653 Ga0373933_0093035 3300035724 Bacteria 1863
654 Ga0373947_0004896 3300035725 Bacteria 7838
655 Ga0373947_0036575 3300035725 Bacteria 2912
656 Ga0373937_0049907 3300036401 Bacteria 3832
657 Ga0373937_0366843 3300036401 Bacteria 1365
658 Ga0373925_0000649 3300037068 Bacteria 32703
659 Ga0395899_0036394 3300037312 Bacteria 3692
660 Ga0395900_0000033 3300037418 Bacteria 260271
661 Ga0395900_0000888 3300037418 Bacteria 39271
662 Ga0395900_0009693 3300037418 Bacteria 9869
663 Ga0395900_0010009 3300037418 Bacteria 9702
664 Ga0395900_0054926 3300037418 Bacteria 4100
665 Ga0395898_0000355 3300037466 Bacteria 101003
666 Ga0395898_0040116 3300037466 Bacteria 4632
667 Ga0395898_0425028 3300037466 Bacteria 1266
668 Ga0395905_0006600 3300037471 Bacteria 11643
669 Ga0395905_0041832 3300037471 Bacteria 4300
670 Ga0395905_0109833 3300037471 Bacteria 2589
671 Ga0395905_0111481 3300037471 Bacteria 2569
672 Ga0395905_0116462 3300037471 Bacteria 2512
673 Ga0436364_0570527 3300037853 Bacteria 21688
674 Ga0436364_0714734 3300037853 Bacteria 2049
675 Ga0436364_1332114 3300037853 Bacteria 1998
676 Ga0395901_0008861 3300038443 Bacteria 10186
677 Ga0395901_0015001 3300038443 Bacteria 7876
678 Ga0237819_00212 3300038705 Bacteria 21141
679 Ga0237819_06260 3300038705 Bacteria 1798
680 Ga0436365_0457258 3300039437 Bacteria 12071
681 Ga0436365_1712708 3300039437 Bacteria 68148
682 Ga0439436_0012161 3300041404 Bacteria 2612
683 Ga0439441_007876 3300042001 Bacteria 1729
684 Ga0439449_0079876 3300042007 Bacteria 1206
685 Ga0466972_0014295 3300044658 Bacteria 3977
686 Ga0466972_0020438 3300044658 Bacteria 3308
687 Ga0466965_0055600 3300044683 Bacteria 1969
688 Ga0466961_0097013 3300044693 Bacteria 1859
689 Ga0466961_0099769 3300044693 Bacteria 1830
690 Ga0453684_0121349 3300044712 Bacteria 3155
691 Ga0453684_0671748 3300044712 Bacteria 1128
692 Ga0466970_0021001 3300044765 Bacteria 3399
693 Ga0466970_0086454 3300044765 Bacteria 1699
694 Ga0466960_0007515 3300044901 Bacteria 4430
695 Ga0466959_0049070 3300045049 Bacteria 3101
696 Ga0466959_0201346 3300045049 Bacteria 1386
697 Ga0466959_0267173 3300045049 Bacteria 1177
698 Ga0451576_0049273 3300045051 Bacteria 4420
699 Ga0451576_0386162 3300045051 Bacteria 1468
700 Ga0466967_0520577 3300045976 Bacteria 1169
701 Ga0495627_003294 3300046453 Bacteria 7220
702 Ga0495627_010445 3300046453 Bacteria 3374
703 Ga0495592_0001829 3300046454 Bacteria 14953
704 Ga0495591_013499 3300046458 Bacteria 2983
705 Ga0495638_0000087 3300046460 Bacteria 152531
706 Ga0495638_0000095 3300046460 Bacteria 141825
707 Ga0495638_0000526 3300046460 Bacteria 44654
708 Ga0495651_0000112 3300046462 Bacteria 59789
709 Ga0495651_0004909 3300046462 Bacteria 10229
710 Ga0495651_0037275 3300046462 Bacteria 3785
711 Ga0495653_0008702 3300046463 Bacteria 8315
712 Ga0495653_0057144 3300046463 Bacteria 2972
713 Ga0495650_0000122 3300046471 Bacteria 182888
714 Ga0495580_0004583 3300046472 Bacteria 11600
715 Ga0495582_0000213 3300046473 Bacteria 32186
716 Ga0495639_0003220 3300046475 Bacteria 7093
717 Ga0495662_0021763 3300046476 Bacteria 3098
718 Ga0495664_0027212 3300046477 Bacteria 3333
719 Ga0495664_0029489 3300046477 Bacteria 3209
720 Ga0495664_0103014 3300046477 Bacteria 1720
721 Ga0495606_0000154 3300046507 Bacteria 119458
722 Ga0495608_0005013 3300046511 Bacteria 9472
723 Ga0495608_0015212 3300046511 Bacteria 5339
724 Ga0495628_0010075 3300046516 Bacteria 8042
725 Ga0495630_0046901 3300046517 Bacteria 3230
726 Ga0495630_0111043 3300046517 Bacteria 2077
727 Ga0495630_0172293 3300046517 Bacteria 1649
728 Ga0495632_0035825 3300046519 Bacteria 2528
729 Ga0495643_0001815 3300046522 Bacteria 18211
730 Ga0495663_0003358 3300046525 Bacteria 4627
731 Ga0495663_0004265 3300046525 Bacteria 4031
732 Ga0495642_0008250 3300046528 Bacteria 3984
733 Ga0495652_0001460 3300046529 Bacteria 26134
734 Ga0495652_0039539 3300046529 Bacteria 4078
735 Ga0495665_0000168 3300046531 Bacteria 33008
736 Ga0495665_0002975 3300046531 Bacteria 9159
737 Ga0495640_0089957 3300046533 Unclassified 2027
738 Ga0495640_0137767 3300046533 Bacteria 1575
739 Ga0495586_0007098 3300046535 Bacteria 5970
740 Ga0495586_0044609 3300046535 Bacteria 2389
741 Ga0495586_0127954 3300046535 Bacteria 1421
742 Ga0495587_0008194 3300046536 Bacteria 6734
743 Ga0495645_0018582 3300046543 Bacteria 4995
744 Ga0495622_0069635 3300046557 Bacteria 1624
745 Ga0495633_0005215 3300046558 Bacteria 8016
746 Ga0495633_0006398 3300046558 Bacteria 6986
747 Ga0495667_0002346 3300046559 Bacteria 12657
748 Ga0495667_0021853 3300046559 Bacteria 4314
749 Ga0495656_0001607 3300046615 Bacteria 7396
750 Ga0495668_0000364 3300046616 Bacteria 59836
751 Ga0495625_0010997 3300046660 Bacteria 7425
752 Ga0495625_0025870 3300046660 Bacteria 4442
753 Ga0495625_0078789 3300046660 Bacteria 2299
754 Ga0495635_0005328 3300046663 Bacteria 8955
755 Ga0495635_0181855 3300046663 Unclassified 1429
756 Ga0495657_0004093 3300046675 Bacteria 11695
757 Ga0495657_0155154 3300046675 Bacteria 1419
758 Ga0495623_0199603 3300046679 Unclassified 1151
759 Ga0495646_0004052 3300046680 Bacteria 9190
760 Ga0495647_0000124 3300046681 Bacteria 19840
761 Ga0495647_0087280 3300046681 Bacteria 1274
762 Ga0495658_0001608 3300046683 Bacteria 11762
763 Ga0495613_0002933 3300046689 Bacteria 12776
764 Ga0495613_0068659 3300046689 Bacteria 2585
765 Ga0495624_0023365 3300046690 Bacteria 4077
766 Ga0495670_0025528 3300046691 Bacteria 2923
767 Ga0495671_0033896 3300046692 Bacteria 2599
768 Ga0495649_0010401 3300046694 Bacteria 5489
769 Ga0495600_0001620 3300046809 Bacteria 12555
770 Ga0495600_0003112 3300046809 Bacteria 9714
771 Ga0495581_0000059 3300047315 Bacteria 42676
772 Ga0495581_0153730 3300047315 Bacteria 1344
773 Ga0495604_0004415 3300047317 Bacteria 11133
774 Ga0495674_0008146 3300047319 Bacteria 9996
775 Ga0495674_0142410 3300047319 Bacteria 2015
776 Ga0495672_0000087 3300047320 Bacteria 154275
777 Ga0495680_0001270 3300047322 Bacteria 27523
778 Ga0495680_0004117 3300047322 Bacteria 13982
779 Ga0495680_0014929 3300047322 Bacteria 6713
780 Ga0495675_0000121 3300047444 Bacteria 56852
781 Ga0495675_0010587 3300047444 Bacteria 5764
782 Ga0495675_0068687 3300047444 Bacteria 2238
783 Ga0495684_0002904 3300047471 Bacteria 13490
784 Ga0495684_0004922 3300047471 Bacteria 10428
785 Ga0495684_0005046 3300047471 Bacteria 10306
786 Ga0495684_0007540 3300047471 Bacteria 8420
787 Ga0495684_0036199 3300047471 Bacteria 3785
788 Ga0495686_0004003 3300047472 Bacteria 12335
789 Ga0495686_0021929 3300047472 Bacteria 4231
790 Ga0495593_0020029 3300047673 Bacteria 3746
791 Ga0495602_0002431 3300048088 Bacteria 18968
792 Ga0496100_0034593 3300048903 Bacteria 3172
793 Ga0496101_0022322 3300048904 Bacteria 4355
794 Ga0496101_0061834 3300048904 Bacteria 2721
795 Ga0496104_0013018 3300048907 Bacteria 7491
796 Ga0496104_0013159 3300048907 Bacteria 7459
797 Ga0496105_0058392 3300048908 Bacteria 3185
798 Ga0496106_0265147 3300048909 Bacteria 1375
799 Ga0496107_0196288 3300048910 Bacteria 1500
800 Ga0496108_0119623 3300048911 Bacteria 2258
801 Ga0496108_0703611 3300048911 Bacteria 876
802 Ga0496109_0083637 3300048912 Bacteria 2943
803 Ga0496109_0193734 3300048912 Bacteria 1910
804 Ga0496110_0144262 3300048913 Bacteria 2153
805 Ga0496112_0046779 3300048915 Bacteria 4245
806 Ga0496112_0204691 3300048915 Bacteria 1932
807 Ga0496112_0224091 3300048915 Bacteria 1836
808 Ga0496113_0013073 3300048916 Bacteria 5605
809 Ga0496113_0046259 3300048916 Bacteria 3230
810 Ga0496114_0011751 3300048917 Bacteria 7004
811 Ga0496114_0075849 3300048917 Bacteria 2832
812 Ga0496114_0132116 3300048917 Bacteria 2156
813 Ga0496114_0203032 3300048917 Bacteria 1736
814 Ga0496115_0000116 3300048918 Bacteria 73024
815 Ga0496115_0000233 3300048918 Bacteria 50408
816 Ga0496115_0000293 3300048918 Bacteria 43225
817 Ga0496115_0007196 3300048918 Bacteria 8175
818 Ga0496115_0231491 3300048918 Bacteria 1523
819 Ga0496115_0351060 3300048918 Bacteria 1203
820 Ga0496116_0002572 3300048919 Bacteria 18929
821 Ga0496116_0013614 3300048919 Bacteria 6541
822 Ga0496116_0014949 3300048919 Bacteria 6160
823 Ga0496116_0041201 3300048919 Bacteria 3171
824 Ga0496117_0003980 3300048920 Bacteria 16691
825 Ga0496117_0008136 3300048920 Bacteria 10024
826 Ga0496117_0013164 3300048920 Bacteria 7236
827 Ga0496117_0069791 3300048920 Bacteria 2364
828 Ga0496118_0000260 3300048921 Bacteria 92249
829 Ga0496118_0000953 3300048921 Bacteria 45266
830 Ga0496118_0006046 3300048921 Bacteria 13482
831 Ga0496118_0007889 3300048921 Bacteria 11154
832 Ga0496118_0008964 3300048921 Bacteria 10208
833 Ga0496118_0015832 3300048921 Bacteria 6955
834 Ga0496118_0023738 3300048921 Bacteria 5315
835 Ga0496118_0058708 3300048921 Bacteria 2872
836 Ga0496118_0088913 3300048921 Bacteria 2134
837 Ga0496118_0110485 3300048921 Bacteria 1826
838 Ga0496118_0239116 3300048921 Bacteria 1041
839 Ga0496119_0000048 3300048922 Bacteria 185846
840 Ga0496119_0000711 3300048922 Bacteria 44692
841 Ga0496119_0004893 3300048922 Bacteria 13104
842 Ga0496119_0023171 3300048922 Bacteria 4416
843 Ga0496119_0034191 3300048922 Bacteria 3354
844 Ga0496119_0046818 3300048922 Bacteria 2696
845 Ga0496120_0000113 3300048923 Bacteria 136672
846 Ga0496120_0000519 3300048923 Bacteria 59691
847 Ga0496120_0000727 3300048923 Bacteria 48259
848 Ga0496121_0000013 3300048924 Bacteria 614976
849 Ga0496121_0004863 3300048924 Bacteria 17653
850 Ga0496121_0005121 3300048924 Bacteria 17074
851 Ga0496121_0042740 3300048924 Bacteria 3937
852 Ga0496121_0043735 3300048924 Bacteria 3874
853 Ga0496122_0001140 3300048925 Bacteria 45568
854 Ga0496122_0014529 3300048925 Bacteria 7601
855 Ga0496122_0126649 3300048925 Bacteria 1633
856 Ga0496122_0192224 3300048925 Bacteria 1203
857 Ga0496123_0000942 3300048926 Bacteria 45419
858 Ga0496123_0056542 3300048926 Bacteria 2563
859 Ga0496124_0001552 3300048927 Bacteria 33193
860 Ga0496124_0003834 3300048927 Bacteria 18012
861 Ga0496124_0027671 3300048927 Bacteria 5083
862 Ga0496124_0089185 3300048927 Bacteria 2518
863 Ga0496124_0106341 3300048927 Bacteria 2265
864 Ga0496125_0000722 3300048928 Bacteria 54697
865 Ga0496125_0013105 3300048928 Bacteria 8174
866 Ga0496125_0018451 3300048928 Bacteria 6625
867 Ga0496125_0035604 3300048928 Bacteria 4362
868 Ga0496126_0000057 3300048929 Bacteria 276781
869 Ga0496126_0000320 3300048929 Bacteria 102586
870 Ga0496126_0003861 3300048929 Bacteria 18507
871 Ga0496126_0015014 3300048929 Bacteria 7808
872 Ga0496126_0016096 3300048929 Bacteria 7495
873 Ga0496126_0023194 3300048929 Bacteria 6016
874 Ga0496126_0023341 3300048929 Bacteria 5995
875 Ga0501031_0001796 3300049568 Bacteria 13467
876 Ga0501031_0014464 3300049568 Bacteria 5128
877 Ga0501032_0007207 3300049569 Bacteria 8134
878 Ga0501032_0010231 3300049569 Bacteria 6768
879 Ga0501032_0044695 3300049569 Bacteria 2997
880 Ga0501033_0000086 3300049570 Bacteria 88255
881 Ga0501033_0006023 3300049570 Bacteria 9512
882 Ga0501033_0024833 3300049570 Bacteria 4520
883 Ga0501033_0030820 3300049570 Bacteria 4031
884 Ga0501033_0036085 3300049570 Bacteria 3705
885 Ga0501033_0060447 3300049570 Bacteria 2795
886 Ga0501033_0063173 3300049570 Bacteria 2726
887 Ga0501034_0093322 3300049571 Bacteria 3006
888 Ga0501034_0200942 3300049571 Bacteria 1951
889 Ga0501036_0003611 3300049572 Bacteria 12365
890 Ga0501036_0011588 3300049572 Bacteria 7304
891 Ga0501036_0018586 3300049572 Bacteria 5827
892 Ga0501036_0025725 3300049572 Bacteria 4967
893 Ga0501036_0152836 3300049572 Bacteria 1947
894 Ga0501036_0350644 3300049572 Bacteria 1232
895 Ga0501037_0041500 3300049573 Bacteria 3384
896 Ga0501037_0086830 3300049573 Bacteria 2264
897 Ga0501038_0011732 3300049574 Bacteria 7993
898 Ga0501038_0016254 3300049574 Bacteria 6748
899 Ga0501038_0022471 3300049574 Bacteria 5651
900 Ga0501038_0061319 3300049574 Bacteria 3216
901 Ga0501038_0109817 3300049574 Bacteria 2285
902 Ga0501038_0172902 3300049574 Bacteria 1747
903 Ga0501039_0007126 3300049575 Bacteria 8519
904 Ga0501039_0010959 3300049575 Bacteria 6909
905 Ga0501039_0013495 3300049575 Bacteria 6247
906 Ga0501039_0045023 3300049575 Bacteria 3408
907 Ga0501040_0004213 3300049576 Bacteria 9362
908 Ga0501040_0017688 3300049576 Bacteria 4731
909 Ga0501041_0003615 3300049577 Bacteria 8891
910 Ga0501042_0001952 3300049578 Bacteria 12421
911 Ga0501042_0002596 3300049578 Bacteria 11110
912 Ga0501042_0364241 3300049578 Bacteria 1046
913 Ga0501043_0005825 3300049579 Bacteria 9912
914 Ga0501043_0045918 3300049579 Bacteria 3434
915 Ga0501043_0111954 3300049579 Bacteria 2143
916 Ga0501046_0001919 3300049580 Bacteria 19740
917 Ga0501046_0007819 3300049580 Bacteria 9381
918 Ga0501047_0011238 3300049581 Bacteria 8473
919 Ga0501047_0011692 3300049581 Bacteria 8299
920 Ga0501047_0466423 3300049581 Bacteria 1091
921 Ga0501048_0137342 3300049582 Bacteria 1728
922 Ga0501048_0209232 3300049582 Bacteria 1383
923 Ga0501068_0001687 3300049584 Bacteria 11780
924 Ga0501068_0019942 3300049584 Bacteria 3901
925 Ga0501069_0004963 3300049585 Bacteria 6903
926 Ga0501070_0000269 3300049586 Bacteria 49060
927 Ga0501070_0170031 3300049586 Bacteria 1795
928 Ga0501070_0267493 3300049586 Bacteria 1397
929 Ga0501070_0397768 3300049586 Bacteria 1114
930 Ga0501072_0019466 3300049588 Bacteria 5248
931 Ga0501072_0223635 3300049588 Bacteria 1500
932 Ga0501073_0000408 3300049589 Bacteria 29377
933 Ga0501073_0080842 3300049589 Bacteria 2261
934 Ga0501074_0011170 3300049590 Bacteria 6523
935 Ga0501074_0056693 3300049590 Bacteria 2824
936 Ga0501075_0158630 3300049591 Bacteria 1726
937 Ga0501076_0001011 3300049592 Bacteria 18469
938 Ga0501076_0007819 3300049592 Bacteria 7792
939 Ga0501076_0122416 3300049592 Bacteria 2106
940 Ga0501077_0004162 3300049593 Bacteria 8740
941 Ga0501077_0011204 3300049593 Bacteria 5594
942 Ga0501077_0020571 3300049593 Bacteria 4178
943 Ga0501079_0012719 3300049741 Bacteria 6429
944 Ga0501079_0234515 3300049741 Bacteria 1434
945 Ga0501079_0251816 3300049741 Bacteria 1380
946 Ga0501080_0030603 3300049742 Bacteria 5016
947 Ga0501080_0533340 3300049742 Bacteria 1046
948 Ga0501081_0002043 3300049743 Bacteria 12580
949 Ga0501081_0128766 3300049743 Bacteria 1807
950 Ga0501083_0000990 3300049744 Bacteria 18870
951 Ga0501035_0008776 3300049822 Bacteria 9410
952 Ga0501035_0020150 3300049822 Bacteria 6124
953 Ga0501035_0029675 3300049822 Bacteria 4987
954 Ga0501035_0072308 3300049822 Bacteria 3052
955 Ga0501035_0277633 3300049822 Bacteria 1417
956 Ga0501044_0000749 3300049823 Bacteria 39273
957 Ga0501044_0002590 3300049823 Bacteria 20558
958 Ga0501044_0013084 3300049823 Bacteria 8981
959 Ga0501044_0039363 3300049823 Bacteria 4933
960 Ga0501044_0358588 3300049823 Bacteria 1376
961 Ga0501044_0432093 3300049823 Bacteria 1226
962 Ga0501044_0481197 3300049823 Bacteria 1144
963 Ga0501044_0622771 3300049823 Bacteria 970
964 Ga0501045_0005098 3300049824 Bacteria 9093
965 Ga0501045_0010906 3300049824 Bacteria 6364
966 nmdc:mga05p37_22411_c1 3300050507 Bacteria 7662
967 nmdc:mga05p37_470558_c1 3300050507 Bacteria 1450
968 nmdc:mga09592_1422_c1 3300050508 Bacteria 19206
969 nmdc:mga09592_170495_c1 3300050508 Bacteria 1882
970 nmdc:mga0qj67_25287_c1 3300050509 Bacteria 4586
971 nmdc:mga0qj67_338480_c1 3300050509 Bacteria 1217
972 nmdc:mga06r32_20879_c1 3300050510 Bacteria 6037
973 nmdc:mga06r32_247156_c1 3300050510 Bacteria 1771
974 nmdc:mga08y16_123927_c1 3300050511 Bacteria 2689
975 nmdc:mga08y16_1627_c1 3300050511 Bacteria 22743
976 nmdc:mga0n895_30080_c1 3300050512 Bacteria 5186
977 nmdc:mga0a205_113774_c1 3300050515 Bacteria 2605
978 Ga0495619_0040301 3300053085 Bacteria 3053
979 Ga0500651_0047289 3300053093 Bacteria 2705
980 Ga0500595_000162 3300053119 Bacteria 44030
981 Ga0500568_0000316 3300053139 Bacteria 38483
982 Ga0500573_0000049 3300053140 Bacteria 96218
983 Ga0500590_000735 3300053148 Bacteria 11952
984 Ga0500634_0000377 3300053161 Bacteria 14223
985 Ga0501084_0020970 3300054114 Bacteria 5449
986 Ga0501082_0027265 3300060353 Bacteria 4919
987 Ga0501082_0334484 3300060353 Bacteria 1319
988 Ga0530510_0002588 3300061734 Bacteria 12423
989 Ga0530510_0004408 3300061734 Bacteria 9747
990 2538835230 2537561836 Bacteria 3910579
991 2547503584 2547132130 Bacteria 4660562
992 2578456972 2576861471 Bacteria 4648976
993 2643828613 2643221562 Bacteria 4048635
994 2643896244 2643221577 Bacteria 3710843
995 2643909325 2643221579 Bacteria 4443405
996 2643914826 2643221581 Bacteria 3893603
997 2643973271 2643221593 Bacteria 6296053
998 2644181827 2643221632 Bacteria 3406696
999 2644478458 2643221685 Bacteria 3673288
1000 2687582201 2687453130 Bacteria 4227172
1001 2747949938 2747842428 Bacteria 4689383
1002 2748019670 2747842501 Bacteria 5293829
1003 2765580534 2765235840 Bacteria 4663337
1004 2816518442 2816332141 Bacteria 4436036
1005 2842394449 2842391507 Bacteria 4486072
1006 2844844335 2844841374 Bacteria 3917147
1007 2844853635 2844852863 Bacteria 3849151
1008 2852652124 2852649853 Bacteria 4036942
1009 2852687184 2852684882 Bacteria 5463342
1010 2857446854 2857442823 Bacteria 4562550
1011 2874223197 2874220319 Bacteria 4594709
1012 2884414161 2884411467 Bacteria 5246714
1013 2895397974 2895395659 Bacteria 3983269
1014 2919056285 2919055335 Bacteria 3875751
1015 2919093232 2919089067 Bacteria 4560942
1016 2919131059 2919130084 Bacteria 5301837
1017 2919138747 2919134579 Bacteria 4480386
1018 2919526287 2919523602 Bacteria 3788128
1019 2923517265 2923516293 Bacteria 3716336
1020 2928154418 2928153084 Bacteria 4020257
1021 2928499863 2928496128 Bacteria 4631123
1022 2928963689 2928963466 Bacteria 5165703
1023 2929196299 2929195423 Bacteria 5325372
1024 2931383366 2931380184 Bacteria 4455911
1025 2937614339 2937610967 Bacteria 4618818
1026 2939589835 2939589442 Bacteria 4214238
1027 2939613570 2939611941 Bacteria 3892017
1028 2939630929 2939626828 Bacteria 4695272
1029 2941478747 2941475908 Bacteria 4145589
1030 2941492614 2941489479 Bacteria 6313767
1031 2952255999 2952252522 Bacteria 4171745
1032 2961049961 2961047084 Bacteria 4594415
1033 2961064876 2961064222 Bacteria 4749990
1034 2974307620 2974307012 Bacteria 4172388
1035 2977248331 2977247770 Bacteria 4160543
1036 2984517176 2984514374 Bacteria 4172479
1037 2987608822 2987605356 Bacteria 4187822
1038 2995949724 2995948881 Bacteria 6358104
1039 3003003577 3002998708 Bacteria 11715108
1040 8021625567 8021622325 Bacteria 4844743
1041 8021630554 8021626552 Bacteria 4665214
1042 8021649736 8021648035 Bacteria 4772378
1043 8053951975 8053945823 Bacteria 8962862
1044 8056040431 8056037122 Bacteria 3854319
1045 Ga0501080_0012126
1046 JGI24740J21852_10000230
1047 JGI24739J22299_10055207
1048 JGI24737J22298_10002869
1049 JGI24737J22298_10016551
1050 JGI24735J21928_10000213
1051 JGI25156J39149_1006824
1052 JGI25162J39368_1000653
1053 JGI25162J39368_1001259
1054 JGI25162J39368_1001943
1055 JGI25162J39368_1005494
1056 JGI25157J39369_1002739
1057 JGI25157J39369_1003624
1058 JGI25164J39214_1000473
1059 JGI25164J39214_1000490
1060 JGI25152J39213_1000103
1061 JGI25150J39212_1000183
1062 JGI25151J46595_10000187
1063 JGI25151J46595_10000271
1064 JGI25406J46586_10015012
1065 JGI25165J46597_1000625
1066 JGI25153J46596_10000190
1067 Ga0006562J51391_1007922
1068 Ga0006562J51391_1007923
1069 Ga0055539_1000014
1070 Ga0055533_1000002
1071 Ga0055533_1000962
1072 Ga0055525_1005588
1073 Ga0055542_1000010
1074 Ga0055529_1001798
1075 Ga0055526_1000005
1076 Ga0055537_1000042
1077 Ga0055537_1001615
1078 Ga0055524_1000005
1079 Ga0055536_1000773
1080 Ga0055534_1000002
1081 Ga0055528_1000002
1082 Ga0055530_10002647
1083 Ga0055541_1000497
1084 Ga0058692_1000053
1085 Ga0058692_1000065
1086 Ga0058862_12823758
1087 Ga0065714_10088992
1088 Ga0065715_10005079
1089 Ga0065707_10092011
1090 Ga0070658_10000065
1091 Ga0070658_10016063
1092 Ga0070658_10122941
1093 Ga0070658_10136650
1094 Ga0070676_10002175
1095 Ga0070676_10004260
1096 Ga0070683_100058119
1097 Ga0070683_100102372
1098 Ga0070670_100086016
1099 Ga0070670_100120801
1100 Ga0070670_100295628
1101 Ga0068869_100000848
1102 Ga0068869_100005518
1103 Ga0068869_100178597
1104 Ga0070680_100000138
1105 Ga0070680_100019130
1106 Ga0070680_100026845
1107 Ga0070680_100065060
1108 Ga0070680_100249030
1109 Ga0070682_100004912
1110 Ga0070682_100013413
1111 Ga0070682_100183929
1112 Ga0068868_100000154
1113 Ga0068868_100169688
1114 Ga0070660_100355517
1115 Ga0070689_100006130
1116 Ga0070691_10000204
1117 Ga0070691_10047295
1118 Ga0070687_100001734
1119 Ga0070687_100100108
1120 Ga0070661_100014313
1121 Ga0070661_100019362
1122 Ga0070661_100022768
1123 Ga0070661_100137945
1124 Ga0070661_100221607
1125 Ga0070661_100505846
1126 Ga0070692_10000826
1127 Ga0070692_10001376
1128 Ga0070692_10024606
1129 Ga0070668_100002627
1130 Ga0070668_100005675
1131 Ga0070668_100297144
1132 Ga0070669_100016734
1133 Ga0070669_100021816
1134 Ga0070675_100025078
1135 Ga0070675_100051402
1136 Ga0070671_100020254
1137 Ga0070673_100000023
1138 Ga0070688_100015057
1139 Ga0070688_100213269
1140 Ga0070659_100004369
1141 Ga0070659_100005005
1142 Ga0070659_100014512
1143 Ga0070667_100023098
1144 Ga0070667_100059611
1145 Ga0070667_100273171
1146 Ga0070714_100000007
1147 Ga0070714_100000025
1148 Ga0070714_100002188
1149 Ga0070714_100179606
1150 Ga0070714_100234025
1151 Ga0070713_100003658
1152 Ga0070711_100203553
1153 Ga0070705_100176800
1154 Ga0070700_100000015
1155 Ga0070700_100022316
1156 Ga0070708_100005216
1157 Ga0070708_100382634
1158 Ga0070663_100001998
1159 Ga0070663_100003552
1160 Ga0070663_100011137
1161 Ga0070663_100030594
1162 Ga0070663_100174476
1163 Ga0070663_100181951
1164 Ga0070678_100015225
1165 Ga0070678_100040799
1166 Ga0070662_100007688
1167 Ga0070662_100055165
1168 Ga0070662_100095797
1169 Ga0070662_100105335
1170 Ga0070662_100356393
1171 Ga0070681_10000076
1172 Ga0070681_10001058
1173 Ga0070681_10005260
1174 Ga0070681_10012818
1175 Ga0070681_10051976
1176 Ga0070681_10097017
1177 Ga0070681_10231243
1178 Ga0068867_100000007
1179 Ga0068867_100299750
1180 Ga0070685_10053205
1181 Ga0070706_100017183
1182 Ga0070706_100075262
1183 Ga0070698_100025964
1184 Ga0070679_100000504
1185 Ga0070679_100005669
1186 Ga0070679_100094827
1187 Ga0070679_100229808
1188 Ga0070679_100245203
1189 Ga0070684_100142709
1190 Ga0070684_100431134
1191 Ga0070684_100608218
1192 Ga0070697_100053485
1193 Ga0070697_100147487
1194 Ga0068853_100025947
1195 Ga0068853_100026580
1196 Ga0068853_100087550
1197 Ga0068853_100195851
1198 Ga0068853_100241865
1199 Ga0068853_100295727
1200 Ga0070672_100003161
1201 Ga0070672_100021437
1202 Ga0070686_100193262
1203 Ga0070696_100003079
1204 Ga0070696_100015403
1205 Ga0070696_100027962
1206 Ga0070693_100014051
1207 Ga0070665_100000465
1208 Ga0070665_100237824
1209 Ga0070665_100503266
1210 Ga0070704_100071046
1211 Ga0068855_100000897
1212 Ga0068855_100034494
1213 Ga0068855_100059757
1214 Ga0068855_100167742
1215 Ga0068855_100192031
1216 Ga0068855_100593199
1217 Ga0068857_100014249
1218 Ga0068857_100019539
1219 Ga0068857_100082251
1220 Ga0068857_100120614
1221 Ga0068857_100150476
1222 Ga0068854_100000027
1223 Ga0068854_100000142
1224 Ga0068854_100063019
1225 Ga0068854_100368849
1226 Ga0068856_100000462
1227 Ga0068856_100004819
1228 Ga0068856_100025070
1229 Ga0068856_100336574
1230 Ga0068852_100112354
1231 Ga0068866_10036810
1232 Ga0068861_100004360
1233 Ga0068851_10026102
1234 Ga0068863_100038707
1235 Ga0068858_100013390
1236 Ga0068858_100098118
1237 Ga0068858_100128673
1238 Ga0068860_100041224
1239 Ga0068860_100061738
1240 Ga0068860_100101230
1241 Ga0068862_100070914
1242 Ga0081539_10000105
1243 Ga0081539_10083936
1244 Ga0075364_10061999
1245 Ga0070712_100056201
1246 Ga0070712_100218002
1247 Ga0097621_100002061
1248 Ga0068871_100002074
1249 Ga0068871_100137854
1250 Ga0075428_100002309
1251 Ga0075428_100008733
1252 Ga0075428_100415922
1253 Ga0075428_100713931
1254 Ga0075430_100065318
1255 Ga0075431_100013904
1256 Ga0075433_10039496
1257 Ga0075434_100007756
1258 Ga0075434_100048328
1259 Ga0075429_100055515
1260 Ga0068865_100000010
1261 Ga0068865_100007765
1262 Ga0068865_100122851
1263 Ga0099795_10004112
1264 Ga0105240_10000049
1265 Ga0105240_10000113
1266 Ga0105240_10002816
1267 Ga0105240_10069114
1268 Ga0105240_10081693
1269 Ga0105240_10228162
1270 Ga0105240_10680974
1271 Ga0111539_10043138
1272 Ga0111539_10049401
1273 Ga0111539_10063244
1274 Ga0111539_10565172
1275 Ga0105245_10001804
1276 Ga0105245_10056362
1277 Ga0105245_10062002
1278 Ga0114129_10001539
1279 Ga0114129_10014853
1280 Ga0114129_10148798
1281 Ga0105243_10000950
1282 Ga0105243_10004757
1283 Ga0105243_10008647
1284 Ga0105243_10011470
1285 Ga0105243_10014541
1286 Ga0105241_10011546
1287 Ga0105241_10012868
1288 Ga0105241_10013711
1289 Ga0105241_10282502
1290 Ga0105242_10000210
1291 Ga0105242_10007241
1292 Ga0105248_10057736
1293 Ga0105248_10262904
1294 Ga0105237_10000230
1295 Ga0105237_10284515
1296 Ga0105237_10362694
1297 Ga0105238_10002948
1298 Ga0105238_10041071
1299 Ga0105238_10073696
1300 Ga0105238_10143947
1301 Ga0105238_10543702
1302 Ga0105249_10000195
1303 Ga0105249_10007619
1304 Ga0105249_10017303
1305 Ga0105249_10030480
1306 Ga0105249_10135624
1307 Ga0105249_10294373
1308 Ga0105032_101587
1309 Ga0105028_101804
1310 Ga0105239_10000034
1311 Ga0105239_10004123
1312 Ga0105239_10095696
1313 Ga0105239_10299995
1314 Ga0105239_10319165
1315 Ga0105239_10485188
1316 Ga0157373_10098054
1317 Ga0157371_10000397
1318 Ga0157371_10019340
1319 Ga0157371_10070140
1320 Ga0157371_10080697
1321 Ga0157371_10182732
1322 Ga0157371_10236816
1323 Ga0157370_10010248
1324 Ga0157370_10024020
1325 Ga0157370_10025407
1326 Ga0157370_10035718
1327 Ga0157370_10065485
1328 Ga0157370_10082723
1329 Ga0157370_10189137
1330 Ga0157369_10030897
1331 Ga0157369_10045576
1332 Ga0157369_10054676
1333 Ga0157369_10196583
1334 Ga0157369_10219655
1335 Ga0157369_10248017
1336 Ga0157369_10301602
1337 Ga0157374_10000830
1338 Ga0157374_10002660
1339 Ga0157374_10079124
1340 Ga0157374_10265052
1341 Ga0157378_10001477
1342 Ga0157378_10013933
1343 Ga0157378_10144915
1344 Ga0157378_10562746
1345 Ga0163162_10000015
1346 Ga0163162_10009246
1347 Ga0163162_10033700
1348 Ga0163162_10072625
1349 Ga0163162_10670611
1350 Ga0157372_10000004
1351 Ga0157372_10008269
1352 Ga0157372_10022871
1353 Ga0157372_10047515
1354 Ga0157372_10070446
1355 Ga0157372_10118468
1356 Ga0157372_10122484
1357 Ga0157375_10002120
1358 Ga0157375_10156411
1359 Ga0157375_10234511
1360 Ga0157375_10389508
1361 Ga0157375_10663712
1362 Ga0163163_10000205
1363 Ga0163163_10091541
1364 Ga0157380_10033964
1365 Ga0157380_10299929
1366 Ga0182008_10048966
1367 Ga0182008_10069164
1368 Ga0157377_10014848
1369 Ga0157379_10367839
1370 Ga0157376_10000047
1371 Ga0157376_10112995
1372 Ga0157376_10261459
1373 Ga0182006_1012948
1374 Ga0182006_1030792
1375 Ga0182006_1032508
1376 Ga0182006_1033197
1377 Ga0182007_10000079
1378 Ga0182007_10003052
1379 Ga0182005_1000166
1380 Ga0182005_1048792
1381 Ga0183368_1004
1382 Ga0183360_10002
1383 Ga0163161_10018593
1384 Ga0163161_10039512
1385 Ga0163161_10184246
1386 Ga0197907_10031041
1387 Ga0206356_11162436
1388 Ga0206351_10270042
1389 Ga0206352_10784584
1390 Ga0206350_10514329
1391 Ga0206354_10512197
1392 Ga0206353_11363697
1393 Ga0154015_1208151
1394 Ga0154015_1499885
1395 Ga0213876_10001632
1396 Ga0213875_10049732
1397 Ga0224712_10020806
1398 Ga0224712_10028061
1399 Ga0228598_1013405
1400 Ga0209566_100056
1401 Ga0209674_100001
1402 Ga0209674_100063
1403 Ga0209674_100836
1404 Ga0209672_100509
1405 Ga0209563_100001
1406 Ga0207427_100132
1407 Ga0207427_100322
1408 Ga0207427_103057
1409 Ga0209437_100005
1410 Ga0209437_100118
1411 Ga0209437_100233
1412 Ga0209258_100935
1413 Ga0209258_101545
1414 Ga0207425_1000148
1415 Ga0207425_1001805
1416 Ga0209646_1004787
1417 Ga0209026_1000010
1418 Ga0209026_1000061
1419 Ga0209677_100001
1420 Ga0209148_1000005
1421 Ga0209759_1003743
1422 Ga0209129_1000239
1423 Ga0209233_1000011
1424 Ga0209233_1000046
1425 Ga0209233_1011210
1426 Ga0209233_1015398
1427 Ga0209565_1000001
1428 Ga0209455_1000111
1429 Ga0209673_1000001
1430 Ga0209675_1000001
1431 Ga0209676_1000411
1432 Ga0209025_1000006
1433 Ga0209025_1000048
1434 Ga0209564_1000001
1435 Ga0209758_1000056
1436 Ga0209758_1008030
1437 Ga0209050_1000146
1438 Ga0209256_1000006
1439 Ga0209256_1003699
1440 Ga0207656_10008749
1441 Ga0207642_10161387
1442 Ga0207688_10112355
1443 Ga0207680_10047257
1444 Ga0207680_10061889
1445 Ga0207647_10001386
1446 Ga0207647_10002100
1447 Ga0207647_10003612
1448 Ga0207647_10010284
1449 Ga0207647_10026222
1450 Ga0207647_10051240
1451 Ga0207647_10054217
1452 Ga0207645_10000737
1453 Ga0207645_10009242
1454 Ga0207705_10000001
1455 Ga0207705_10000146
1456 Ga0207705_10000373
1457 Ga0207705_10000788
1458 Ga0207705_10009432
1459 Ga0207705_10059428
1460 Ga0207705_10081047
1461 Ga0207705_10257657
1462 Ga0207684_10076825
1463 Ga0207684_10321899
1464 Ga0207654_10024425
1465 Ga0207707_10000018
1466 Ga0207707_10000036
1467 Ga0207707_10000868
1468 Ga0207707_10000944
1469 Ga0207707_10009741
1470 Ga0207707_10015309
1471 Ga0207707_10017108
1472 Ga0207707_10023133
1473 Ga0207707_10027620
1474 Ga0207707_10050186
1475 Ga0207707_10127412
1476 Ga0207695_10000007
1477 Ga0207695_10000114
1478 Ga0207695_10000816
1479 Ga0207695_10001086
1480 Ga0207695_10002626
1481 Ga0207695_10027868
1482 Ga0207695_10050538
1483 Ga0207695_10053798
1484 Ga0207695_10073182
1485 Ga0207695_10115114
1486 Ga0207695_10182106
1487 Ga0207671_10000639
1488 Ga0207671_10082200
1489 Ga0207671_10321677
1490 Ga0207660_10000389
1491 Ga0207660_10009240
1492 Ga0207660_10009433
1493 Ga0207660_10009884
1494 Ga0207660_10010720
1495 Ga0207660_10015984
1496 Ga0207660_10028000
1497 Ga0207660_10048875
1498 Ga0207660_10145550
1499 Ga0207660_10237378
1500 Ga0207662_10001726
1501 Ga0207657_10022248
1502 Ga0207649_10001271
1503 Ga0207649_10019583
1504 Ga0207649_10065234
1505 Ga0207649_10150937
1506 Ga0207652_10000409
1507 Ga0207652_10004945
1508 Ga0207652_10007521
1509 Ga0207652_10038403
1510 Ga0207652_10076977
1511 Ga0207652_10212731
1512 Ga0207646_10192292
1513 Ga0207681_10027150
1514 Ga0207694_10000930
1515 Ga0207694_10002010
1516 Ga0207694_10013293
1517 Ga0207694_10085369
1518 Ga0207694_10132693
1519 Ga0207650_10059382
1520 Ga0207650_10165686
1521 Ga0207650_10244319
1522 Ga0207659_10042135
1523 Ga0207659_10136197
1524 Ga0207687_10008258
1525 Ga0207687_10062794
1526 Ga0207700_10001535
1527 Ga0207700_10296846
1528 Ga0207664_10000014
1529 Ga0207664_10000071
1530 Ga0207664_10000601
1531 Ga0207644_10042775
1532 Ga0207690_10000532
1533 Ga0207690_10001860
1534 Ga0207690_10108815
1535 Ga0207690_10109772
1536 Ga0207690_10137975
1537 Ga0207706_10008698
1538 Ga0207706_10011915
1539 Ga0207706_10013100
1540 Ga0207706_10042110
1541 Ga0207706_10049448
1542 Ga0207706_10470496
1543 Ga0207686_10000598
1544 Ga0207709_10000050
1545 Ga0207709_10000527
1546 Ga0207709_10009913
1547 Ga0207704_10000020
1548 Ga0207704_10013639
1549 Ga0207691_10003625
1550 Ga0207691_10014108
1551 Ga0207691_10046652
1552 Ga0207711_10014427
1553 Ga0207711_10023261
1554 Ga0207689_10001541
1555 Ga0207689_10001783
1556 Ga0207661_10001897
1557 Ga0207661_10045981
1558 Ga0207661_10209699
1559 Ga0207661_10248469
1560 Ga0207679_10004674
1561 Ga0207667_10000040
1562 Ga0207667_10000947
1563 Ga0207667_10007762
1564 Ga0207667_10072474
1565 Ga0207667_10103191
1566 Ga0207667_10149101
1567 Ga0207667_10205878
1568 Ga0207667_10238588
1569 Ga0207651_10000005
1570 Ga0207712_10000277
1571 Ga0207712_10001146
1572 Ga0207712_10014077
1573 Ga0207712_10021212
1574 Ga0207668_10005154
1575 Ga0207668_10018373
1576 Ga0207640_10000009
1577 Ga0207640_10000145
1578 Ga0207640_10005290
1579 Ga0207640_10014194
1580 Ga0207640_10098268
1581 Ga0207640_10133355
1582 Ga0207658_10149525
1583 Ga0207677_10000373
1584 Ga0207677_10471654
1585 Ga0207703_10004934
1586 Ga0207639_10001840
1587 Ga0207639_10004652
1588 Ga0207639_10007809
1589 Ga0207639_10014224
1590 Ga0207639_10020933
1591 Ga0207639_10293628
1592 Ga0207639_10693695
1593 Ga0207678_10004979
1594 Ga0207678_10005889
1595 Ga0207678_10006369
1596 Ga0207678_10020914
1597 Ga0207678_10043979
1598 Ga0207708_10000004
1599 Ga0207708_10009224
1600 Ga0207702_10000172
1601 Ga0207702_10008380
1602 Ga0207702_10015708
1603 Ga0207702_10036014
1604 Ga0207641_10025775
1605 Ga0207641_10043596
1606 Ga0207648_10000017
1607 Ga0207648_10027096
1608 Ga0207648_10030744
1609 Ga0207648_10136587
1610 Ga0207674_10001921
1611 Ga0207674_10004423
1612 Ga0207674_10012476
1613 Ga0207674_10021680
1614 Ga0207674_10050289
1615 Ga0207674_10227566
1616 Ga0207674_10258908
1617 Ga0207674_10341215
1618 Ga0207675_100001976
1619 Ga0207675_100031644
1620 Ga0207683_10232436
1621 Ga0207698_10000931
1622 Ga0207698_10054723
1623 Ga0207698_10083396
1624 Ga0207698_10332722
1625 Ga0209371_1000018
1626 Ga0209371_1000025
1627 Ga0209974_10004171
1628 Ga0268266_10000006
1629 Ga0268266_10026003
1630 Ga0268266_10027010
1631 Ga0268266_10031407
1632 Ga0268266_10305737
1633 Ga0268265_10061048
1634 Ga0268265_10566371
1635 Ga0268264_10148368
1636 Ga0268264_10298648
1637 Ga0265319_1000240
1638 Ga0265318_10002424
1639 Ga0265338_10212940
1640 Ga0268256_1000016
1641 Ga0268256_1000027
1642 Ga0316181_1114053
1643 Ga0316181_1268996
1644 Ga0265332_10014777
1645 Ga0265320_10000136
1646 Ga0265325_10001525
1647 Ga0265325_10042548
1648 Ga0265329_10000171
1649 Ga0265340_10003989
1650 Ga0265339_10065646
1651 Ga0265331_10000021
1652 Ga0265331_10016315
1653 Ga0265316_10001078
1654 Ga0265316_10012682
1655 Ga0307513_10158437
1656 Ga0307408_100005909
1657 Ga0307408_100073444
1658 Ga0265313_10001348
1659 Ga0307508_10065258
1660 Ga0307508_10284242
1661 Ga0265314_10007149
1662 Ga0265342_10000555
1663 Ga0265342_10104745
1664 Ga0307413_10022756
1665 Ga0307413_10085739
1666 Ga0307413_10088902
1667 Ga0307413_10126983
1668 Ga0307410_10002430
1669 Ga0307410_10029439
1670 Ga0307410_10040470
1671 Ga0307406_10002083
1672 Ga0307406_10005253
1673 Ga0307406_10186025
1674 Ga0307407_10043860
1675 Ga0307412_10093954
1676 Ga0307412_10217952
1677 Ga0307409_100049477
1678 Ga0307409_100063613
1679 Ga0307416_100110189
1680 Ga0307414_10000303
1681 Ga0307414_10002908
1682 Ga0307414_10380382
1683 Ga0307411_10076113
1684 Ga0307411_10076436
1685 Ga0307411_10084639
1686 Ga0307415_100140021
1687 Ga0307415_100354786
1688 Ga0307507_10093349
1689 Ga0373926_0027212
1690 Ga0373952_0035064
1691 Ga0373945_0006636
1692 Ga0373956_0063225
1693 Ga0373943_0002619
1694 Ga0373935_0014070
1695 Ga0373927_0031176
1696 Ga0373933_0018862
1697 Ga0373933_0093035
1698 Ga0373947_0004896
1699 Ga0373947_0036575
1700 Ga0373937_0049907
1701 Ga0373937_0366843
1702 Ga0373925_0000649
1703 Ga0395899_0036394
1704 Ga0395900_0000033
1705 Ga0395900_0000888
1706 Ga0395900_0009693
1707 Ga0395900_0010009
1708 Ga0395900_0054926
1709 Ga0395898_0000355
1710 Ga0395898_0040116
1711 Ga0395898_0425028
1712 Ga0395905_0006600
1713 Ga0395905_0041832
1714 Ga0395905_0109833
1715 Ga0395905_0111481
1716 Ga0395905_0116462
1717 Ga0436364_0570527
1718 Ga0436364_0714734
1719 Ga0436364_1332114
1720 Ga0395901_0008861
1721 Ga0395901_0015001
1722 Ga0237819_00212
1723 Ga0237819_06260
1724 Ga0436365_0457258
1725 Ga0436365_1712708
1726 Ga0439436_0012161
1727 Ga0439441_007876
1728 Ga0439449_0079876
1729 Ga0466972_0014295
1730 Ga0466972_0020438
1731 Ga0466965_0055600
1732 Ga0466961_0097013
1733 Ga0466961_0099769
1734 Ga0453684_0121349
1735 Ga0453684_0671748
1736 Ga0466970_0021001
1737 Ga0466970_0086454
1738 Ga0466960_0007515
1739 Ga0466959_0049070
1740 Ga0466959_0201346
1741 Ga0466959_0267173
1742 Ga0451576_0049273
1743 Ga0451576_0386162
1744 Ga0466967_0520577
1745 Ga0495627_003294
1746 Ga0495627_010445
1747 Ga0495592_0001829
1748 Ga0495591_013499
1749 Ga0495638_0000087
1750 Ga0495638_0000095
1751 Ga0495638_0000526
1752 Ga0495651_0000112
1753 Ga0495651_0004909
1754 Ga0495651_0037275
1755 Ga0495653_0008702
1756 Ga0495653_0057144
1757 Ga0495650_0000122
1758 Ga0495580_0004583
1759 Ga0495582_0000213
1760 Ga0495639_0003220
1761 Ga0495662_0021763
1762 Ga0495664_0027212
1763 Ga0495664_0029489
1764 Ga0495664_0103014
1765 Ga0495606_0000154
1766 Ga0495608_0005013
1767 Ga0495608_0015212
1768 Ga0495628_0010075
1769 Ga0495630_0046901
1770 Ga0495630_0111043
1771 Ga0495630_0172293
1772 Ga0495632_0035825
1773 Ga0495643_0001815
1774 Ga0495663_0003358
1775 Ga0495663_0004265
1776 Ga0495642_0008250
1777 Ga0495652_0001460
1778 Ga0495652_0039539
1779 Ga0495665_0000168
1780 Ga0495665_0002975
1781 Ga0495640_0089957
1782 Ga0495640_0137767
1783 Ga0495586_0007098
1784 Ga0495586_0044609
1785 Ga0495586_0127954
1786 Ga0495587_0008194
1787 Ga0495645_0018582
1788 Ga0495622_0069635
1789 Ga0495633_0005215
1790 Ga0495633_0006398
1791 Ga0495667_0002346
1792 Ga0495667_0021853
1793 Ga0495656_0001607
1794 Ga0495668_0000364
1795 Ga0495625_0010997
1796 Ga0495625_0025870
1797 Ga0495625_0078789
1798 Ga0495635_0005328
1799 Ga0495635_0181855
1800 Ga0495657_0004093
1801 Ga0495657_0155154
1802 Ga0495623_0199603
1803 Ga0495646_0004052
1804 Ga0495647_0000124
1805 Ga0495647_0087280
1806 Ga0495658_0001608
1807 Ga0495613_0002933
1808 Ga0495613_0068659
1809 Ga0495624_0023365
1810 Ga0495670_0025528
1811 Ga0495671_0033896
1812 Ga0495649_0010401
1813 Ga0495600_0001620
1814 Ga0495600_0003112
1815 Ga0495581_0000059
1816 Ga0495581_0153730
1817 Ga0495604_0004415
1818 Ga0495674_0008146
1819 Ga0495674_0142410
1820 Ga0495672_0000087
1821 Ga0495680_0001270
1822 Ga0495680_0004117
1823 Ga0495680_0014929
1824 Ga0495675_0000121
1825 Ga0495675_0010587
1826 Ga0495675_0068687
1827 Ga0495684_0002904
1828 Ga0495684_0004922
1829 Ga0495684_0005046
1830 Ga0495684_0007540
1831 Ga0495684_0036199
1832 Ga0495686_0004003
1833 Ga0495686_0021929
1834 Ga0495593_0020029
1835 Ga0495602_0002431
1836 Ga0496100_0034593
1837 Ga0496101_0022322
1838 Ga0496101_0061834
1839 Ga0496104_0013018
1840 Ga0496104_0013159
1841 Ga0496105_0058392
1842 Ga0496106_0265147
1843 Ga0496107_0196288
1844 Ga0496108_0119623
1845 Ga0496108_0703611
1846 Ga0496109_0083637
1847 Ga0496109_0193734
1848 Ga0496110_0144262
1849 Ga0496112_0046779
1850 Ga0496112_0204691
1851 Ga0496112_0224091
1852 Ga0496113_0013073
1853 Ga0496113_0046259
1854 Ga0496114_0011751
1855 Ga0496114_0075849
1856 Ga0496114_0132116
1857 Ga0496114_0203032
1858 Ga0496115_0000116
1859 Ga0496115_0000233
1860 Ga0496115_0000293
1861 Ga0496115_0007196
1862 Ga0496115_0231491
1863 Ga0496115_0351060
1864 Ga0496116_0002572
1865 Ga0496116_0013614
1866 Ga0496116_0014949
1867 Ga0496116_0041201
1868 Ga0496117_0003980
1869 Ga0496117_0008136
1870 Ga0496117_0013164
1871 Ga0496117_0069791
1872 Ga0496118_0000260
1873 Ga0496118_0000953
1874 Ga0496118_0006046
1875 Ga0496118_0007889
1876 Ga0496118_0008964
1877 Ga0496118_0015832
1878 Ga0496118_0023738
1879 Ga0496118_0058708
1880 Ga0496118_0088913
1881 Ga0496118_0110485
1882 Ga0496118_0239116
1883 Ga0496119_0000048
1884 Ga0496119_0000711
1885 Ga0496119_0004893
1886 Ga0496119_0023171
1887 Ga0496119_0034191
1888 Ga0496119_0046818
1889 Ga0496120_0000113
1890 Ga0496120_0000519
1891 Ga0496120_0000727
1892 Ga0496121_0000013
1893 Ga0496121_0004863
1894 Ga0496121_0005121
1895 Ga0496121_0042740
1896 Ga0496121_0043735
1897 Ga0496122_0001140
1898 Ga0496122_0014529
1899 Ga0496122_0126649
1900 Ga0496122_0192224
1901 Ga0496123_0000942
1902 Ga0496123_0056542
1903 Ga0496124_0001552
1904 Ga0496124_0003834
1905 Ga0496124_0027671
1906 Ga0496124_0089185
1907 Ga0496124_0106341
1908 Ga0496125_0000722
1909 Ga0496125_0013105
1910 Ga0496125_0018451
1911 Ga0496125_0035604
1912 Ga0496126_0000057
1913 Ga0496126_0000320
1914 Ga0496126_0003861
1915 Ga0496126_0015014
1916 Ga0496126_0016096
1917 Ga0496126_0023194
1918 Ga0496126_0023341
1919 Ga0501031_0001796
1920 Ga0501031_0014464
1921 Ga0501032_0007207
1922 Ga0501032_0010231
1923 Ga0501032_0044695
1924 Ga0501033_0000086
1925 Ga0501033_0006023
1926 Ga0501033_0024833
1927 Ga0501033_0030820
1928 Ga0501033_0036085
1929 Ga0501033_0060447
1930 Ga0501033_0063173
1931 Ga0501034_0093322
1932 Ga0501034_0200942
1933 Ga0501036_0003611
1934 Ga0501036_0011588
1935 Ga0501036_0018586
1936 Ga0501036_0025725
1937 Ga0501036_0152836
1938 Ga0501036_0350644
1939 Ga0501037_0041500
1940 Ga0501037_0086830
1941 Ga0501038_0011732
1942 Ga0501038_0016254
1943 Ga0501038_0022471
1944 Ga0501038_0061319
1945 Ga0501038_0109817
1946 Ga0501038_0172902
1947 Ga0501039_0007126
1948 Ga0501039_0010959
1949 Ga0501039_0013495
1950 Ga0501039_0045023
1951 Ga0501040_0004213
1952 Ga0501040_0017688
1953 Ga0501041_0003615
1954 Ga0501042_0001952
1955 Ga0501042_0002596
1956 Ga0501042_0364241
1957 Ga0501043_0005825
1958 Ga0501043_0045918
1959 Ga0501043_0111954
1960 Ga0501046_0001919
1961 Ga0501046_0007819
1962 Ga0501047_0011238
1963 Ga0501047_0011692
1964 Ga0501047_0466423
1965 Ga0501048_0137342
1966 Ga0501048_0209232
1967 Ga0501068_0001687
1968 Ga0501068_0019942
1969 Ga0501069_0004963
1970 Ga0501070_0000269
1971 Ga0501070_0170031
1972 Ga0501070_0267493
1973 Ga0501070_0397768
1974 Ga0501072_0019466
1975 Ga0501072_0223635
1976 Ga0501073_0000408
1977 Ga0501073_0080842
1978 Ga0501074_0011170
1979 Ga0501074_0056693
1980 Ga0501075_0158630
1981 Ga0501076_0001011
1982 Ga0501076_0007819
1983 Ga0501076_0122416
1984 Ga0501077_0004162
1985 Ga0501077_0011204
1986 Ga0501077_0020571
1987 Ga0501079_0012719
1988 Ga0501079_0234515
1989 Ga0501079_0251816
1990 Ga0501080_0030603
1991 Ga0501080_0533340
1992 Ga0501081_0002043
1993 Ga0501081_0128766
1994 Ga0501083_0000990
1995 Ga0501035_0008776
1996 Ga0501035_0020150
1997 Ga0501035_0029675
1998 Ga0501035_0072308
1999 Ga0501035_0277633
2000 Ga0501044_0000749
2001 Ga0501044_0002590
2002 Ga0501044_0013084
2003 Ga0501044_0039363
2004 Ga0501044_0358588
2005 Ga0501044_0432093
2006 Ga0501044_0481197
2007 Ga0501044_0622771
2008 Ga0501045_0005098
2009 Ga0501045_0010906
2010 nmdc:mga05p37_22411_c1
2011 nmdc:mga05p37_470558_c1
2012 nmdc:mga09592_1422_c1
2013 nmdc:mga09592_170495_c1
2014 nmdc:mga0qj67_25287_c1
2015 nmdc:mga0qj67_338480_c1
2016 nmdc:mga06r32_20879_c1
2017 nmdc:mga06r32_247156_c1
2018 nmdc:mga08y16_123927_c1
2019 nmdc:mga08y16_1627_c1
2020 nmdc:mga0n895_30080_c1
2021 nmdc:mga0a205_113774_c1
2022 Ga0495619_0040301
2023 Ga0500651_0047289
2024 Ga0500595_000162
2025 Ga0500568_0000316
2026 Ga0500573_0000049
2027 Ga0500590_000735
2028 Ga0500634_0000377
2029 Ga0501084_0020970
2030 Ga0501082_0027265
2031 Ga0501082_0334484
2032 Ga0530510_0002588
2033 Ga0530510_0004408
2034 2538835230
2035 2547503584
2036 2578456972
2037 2643828613
2038 2643896244
2039 2643909325
2040 2643914826
2041 2643973271
2042 2644181827
2043 2644478458
2044 2687582201
2045 2747949938
2046 2748019670
2047 2765580534
2048 2816518442
2049 2842394449
2050 2844844335
2051 2844853635
2052 2852652124
2053 2852687184
2054 2857446854
2055 2874223197
2056 2884414161
2057 2895397974
2058 2919056285
2059 2919093232
2060 2919131059
2061 2919138747
2062 2919526287
2063 2923517265
2064 2928154418
2065 2928499863
2066 2928963689
2067 2929196299
2068 2931383366
2069 2937614339
2070 2939589835
2071 2939613570
2072 2939630929
2073 2941478747
2074 2941492614
2075 2952255999
2076 2961049961
2077 2961064876
2078 2974307620
2079 2977248331
2080 2984517176
2081 2987608822
2082 2995949724
2083 3003003577
2084 8021625567
2085 8021630554
2086 8021649736
2087 8053951975
2088 8056040431

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

59

221

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

226

358

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

59

153

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.967 1 32
6vpb-assembly1.cif.gz_B-2 a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) 0.9533 1 293
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9514 1 33
4e21-assembly1.cif.gz_B-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9496 2 293
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9485 2 290
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9478 3 30 3.50.50.60
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9427 2 169 3.40.50.720
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9405 2 30 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9386 2 33 3.50.50.60
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 2 164 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9949 47 154 GO:0004616
GO:0050661
AF-T1B9E1-F1-model_v4 6-phosphogluconate dehydrogenase, NAD-binding domain protein (EC 1.1.-.-) 0.9865 1 67 GO:0016491
GO:0050661
AF-A0A328P4C0-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9862 1 301 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A2D6IMQ2-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9862 1 301 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A6A0JM29-F1-model_v4 6-phosphogluconate dehydrogenase 0.9857 1 75 GO:0016491
GO:0050661

Map