F488917
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1044 | 477 | 2088 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0012126|Ga0501080_0012126_1570_2646 |
| Length | 358 |
| Sequence | MKARVSPVNVADAWSAIGASPFDARSIAEKPARARARRYHRGLRCDPSRERFPKETRMQLGMIGLGKMGNFMAQRLMKAGHDVVGFDPNGDARKALTDAGGKAVDSLDKLIEALQPPRAVWVMVPAGKIVDQTVAALNDKLAKGDVVIDGGNSNYKDDQRHAAELAPKGINYVDCGTSGGVWGLKEGYSMMVGGDDKVVDRLRPIFEALAPGKDQGWGHVGPVGSGHFVKMVHNGIEYGMMQAYAEGFAIFQHKDEFKLDLAQIAEIWRYGSVVRSWLLDLTADALKRNPDMQGIAPYVVDSGEGRWTVAEAIDLDVPAPIITASLIERLRSRDSDSFTDKLLSAMRNEFGGHAMKKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 118 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 139 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 153 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 242 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 245 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 262 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 263 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 264 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 265 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 266 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 274 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 275 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 282 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 287 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 288 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 289 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 290 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 415 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 416 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 419 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 420 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 423 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 424 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 425 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 426 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 427 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 428 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 429 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 430 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 431 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 432 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 433 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 434 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 435 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 436 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 437 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 438 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 439 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 440 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 441 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 442 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 443 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 444 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 445 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 446 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 447 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 448 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 449 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 450 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 451 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 452 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 453 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 454 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 455 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 456 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 457 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 458 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 459 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 460 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 461 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 462 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 463 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 464 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 465 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 466 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 467 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 468 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 469 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 470 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 471 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 472 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 473 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 474 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 475 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 476 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 477 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.39 |
| Metatranscriptomes | 1.34 |
| Isolates | 5.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 6.7 |
| Nodule | 0.1 |
| Rhizoplane | 2.68 |
| Rhizosphere | 80.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501080_0012126 | 3300049742 | Bacteria | 7896 |
| 2 | JGI24740J21852_10000230 | 3300001979 | Bacteria | 23717 |
| 3 | JGI24739J22299_10055207 | 3300001989 | Bacteria | 1270 |
| 4 | JGI24737J22298_10002869 | 3300001990 | Bacteria | 6109 |
| 5 | JGI24737J22298_10016551 | 3300001990 | Bacteria | 2380 |
| 6 | JGI24735J21928_10000213 | 3300002067 | Bacteria | 20363 |
| 7 | JGI25156J39149_1006824 | 3300002705 | Bacteria | 3075 |
| 8 | JGI25162J39368_1000653 | 3300002737 | Bacteria | 24475 |
| 9 | JGI25162J39368_1001259 | 3300002737 | Bacteria | 14479 |
| 10 | JGI25162J39368_1001943 | 3300002737 | Bacteria | 9331 |
| 11 | JGI25162J39368_1005494 | 3300002737 | Bacteria | 2460 |
| 12 | JGI25157J39369_1002739 | 3300002741 | Bacteria | 4056 |
| 13 | JGI25157J39369_1003624 | 3300002741 | Bacteria | 3074 |
| 14 | JGI25164J39214_1000473 | 3300002772 | Bacteria | 19954 |
| 15 | JGI25164J39214_1000490 | 3300002772 | Bacteria | 19438 |
| 16 | JGI25152J39213_1000103 | 3300002773 | Bacteria | 59472 |
| 17 | JGI25150J39212_1000183 | 3300002774 | Bacteria | 35389 |
| 18 | JGI25151J46595_10000187 | 3300003187 | Bacteria | 76949 |
| 19 | JGI25151J46595_10000271 | 3300003187 | Bacteria | 59472 |
| 20 | JGI25406J46586_10015012 | 3300003203 | Bacteria | 3277 |
| 21 | JGI25165J46597_1000625 | 3300003214 | Bacteria | 29618 |
| 22 | JGI25153J46596_10000190 | 3300003215 | Bacteria | 59472 |
| 23 | Ga0006562J51391_1007922 | 3300003578 | Bacteria | 9000 |
| 24 | Ga0006562J51391_1007923 | 3300003578 | Bacteria | 4170 |
| 25 | Ga0055539_1000014 | 3300003752 | Bacteria | 381086 |
| 26 | Ga0055533_1000002 | 3300003756 | Bacteria | 1196393 |
| 27 | Ga0055533_1000962 | 3300003756 | Bacteria | 8475 |
| 28 | Ga0055525_1005588 | 3300003759 | Bacteria | 1068 |
| 29 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 30 | Ga0055529_1001798 | 3300003763 | Bacteria | 5209 |
| 31 | Ga0055526_1000005 | 3300003771 | Bacteria | 344542 |
| 32 | Ga0055537_1000042 | 3300003773 | Bacteria | 91406 |
| 33 | Ga0055537_1001615 | 3300003773 | Bacteria | 8475 |
| 34 | Ga0055524_1000005 | 3300003775 | Bacteria | 344542 |
| 35 | Ga0055536_1000773 | 3300003781 | Bacteria | 21299 |
| 36 | Ga0055534_1000002 | 3300003784 | Bacteria | 390762 |
| 37 | Ga0055528_1000002 | 3300003790 | Bacteria | 368879 |
| 38 | Ga0055530_10002647 | 3300003791 | Bacteria | 11202 |
| 39 | Ga0055541_1000497 | 3300003841 | Bacteria | 11039 |
| 40 | Ga0058692_1000053 | 3300003856 | Bacteria | 107166 |
| 41 | Ga0058692_1000065 | 3300003856 | Bacteria | 89723 |
| 42 | Ga0058862_12823758 | 3300004803 | Bacteria | 1790 |
| 43 | Ga0065714_10088992 | 3300005288 | Bacteria | 1996 |
| 44 | Ga0065715_10005079 | 3300005293 | Bacteria | 4935 |
| 45 | Ga0065707_10092011 | 3300005295 | Bacteria | 3842 |
| 46 | Ga0070658_10000065 | 3300005327 | Bacteria | 104621 |
| 47 | Ga0070658_10016063 | 3300005327 | Bacteria | 5986 |
| 48 | Ga0070658_10122941 | 3300005327 | Bacteria | 2158 |
| 49 | Ga0070658_10136650 | 3300005327 | Bacteria | 2046 |
| 50 | Ga0070676_10002175 | 3300005328 | Bacteria | 9989 |
| 51 | Ga0070676_10004260 | 3300005328 | Bacteria | 7516 |
| 52 | Ga0070683_100058119 | 3300005329 | Bacteria | 3594 |
| 53 | Ga0070683_100102372 | 3300005329 | Bacteria | 2697 |
| 54 | Ga0070670_100086016 | 3300005331 | Bacteria | 2702 |
| 55 | Ga0070670_100120801 | 3300005331 | Bacteria | 2260 |
| 56 | Ga0070670_100295628 | 3300005331 | Bacteria | 1416 |
| 57 | Ga0068869_100000848 | 3300005334 | Bacteria | 17540 |
| 58 | Ga0068869_100005518 | 3300005334 | Bacteria | 7962 |
| 59 | Ga0068869_100178597 | 3300005334 | Bacteria | 1663 |
| 60 | Ga0070680_100000138 | 3300005336 | Bacteria | 44481 |
| 61 | Ga0070680_100019130 | 3300005336 | Bacteria | 5423 |
| 62 | Ga0070680_100026845 | 3300005336 | Bacteria | 4607 |
| 63 | Ga0070680_100065060 | 3300005336 | Bacteria | 2988 |
| 64 | Ga0070680_100249030 | 3300005336 | Bacteria | 1502 |
| 65 | Ga0070682_100004912 | 3300005337 | Bacteria | 7422 |
| 66 | Ga0070682_100013413 | 3300005337 | Bacteria | 4713 |
| 67 | Ga0070682_100183929 | 3300005337 | Bacteria | 1462 |
| 68 | Ga0068868_100000154 | 3300005338 | Bacteria | 44616 |
| 69 | Ga0068868_100169688 | 3300005338 | Bacteria | 1806 |
| 70 | Ga0070660_100355517 | 3300005339 | Bacteria | 1207 |
| 71 | Ga0070689_100006130 | 3300005340 | Bacteria | 8285 |
| 72 | Ga0070691_10000204 | 3300005341 | Bacteria | 19856 |
| 73 | Ga0070691_10047295 | 3300005341 | Bacteria | 2045 |
| 74 | Ga0070687_100001734 | 3300005343 | Bacteria | 7848 |
| 75 | Ga0070687_100100108 | 3300005343 | Bacteria | 1621 |
| 76 | Ga0070661_100014313 | 3300005344 | Bacteria | 5589 |
| 77 | Ga0070661_100019362 | 3300005344 | Bacteria | 4851 |
| 78 | Ga0070661_100022768 | 3300005344 | Bacteria | 4486 |
| 79 | Ga0070661_100137945 | 3300005344 | Bacteria | 1836 |
| 80 | Ga0070661_100221607 | 3300005344 | Bacteria | 1451 |
| 81 | Ga0070661_100505846 | 3300005344 | Bacteria | 967 |
| 82 | Ga0070692_10000826 | 3300005345 | Bacteria | 10346 |
| 83 | Ga0070692_10001376 | 3300005345 | Bacteria | 8785 |
| 84 | Ga0070692_10024606 | 3300005345 | Bacteria | 2960 |
| 85 | Ga0070668_100002627 | 3300005347 | Bacteria | 13198 |
| 86 | Ga0070668_100005675 | 3300005347 | Bacteria | 9250 |
| 87 | Ga0070668_100297144 | 3300005347 | Bacteria | 1353 |
| 88 | Ga0070669_100016734 | 3300005353 | Bacteria | 5233 |
| 89 | Ga0070669_100021816 | 3300005353 | Bacteria | 4579 |
| 90 | Ga0070675_100025078 | 3300005354 | Bacteria | 4779 |
| 91 | Ga0070675_100051402 | 3300005354 | Bacteria | 3386 |
| 92 | Ga0070671_100020254 | 3300005355 | Bacteria | 5423 |
| 93 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 94 | Ga0070688_100015057 | 3300005365 | Bacteria | 4391 |
| 95 | Ga0070688_100213269 | 3300005365 | Bacteria | 1357 |
| 96 | Ga0070659_100004369 | 3300005366 | Bacteria | 10091 |
| 97 | Ga0070659_100005005 | 3300005366 | Bacteria | 9495 |
| 98 | Ga0070659_100014512 | 3300005366 | Bacteria | 5888 |
| 99 | Ga0070667_100023098 | 3300005367 | Bacteria | 5158 |
| 100 | Ga0070667_100059611 | 3300005367 | Bacteria | 3229 |
| 101 | Ga0070667_100273171 | 3300005367 | Bacteria | 1516 |
| 102 | Ga0070714_100000007 | 3300005435 | Bacteria | 285654 |
| 103 | Ga0070714_100000025 | 3300005435 | Bacteria | 147717 |
| 104 | Ga0070714_100002188 | 3300005435 | Bacteria | 14379 |
| 105 | Ga0070714_100179606 | 3300005435 | Bacteria | 1925 |
| 106 | Ga0070714_100234025 | 3300005435 | Bacteria | 1693 |
| 107 | Ga0070713_100003658 | 3300005436 | Bacteria | 10176 |
| 108 | Ga0070711_100203553 | 3300005439 | Bacteria | 1529 |
| 109 | Ga0070705_100176800 | 3300005440 | Bacteria | 1442 |
| 110 | Ga0070700_100000015 | 3300005441 | Bacteria | 149873 |
| 111 | Ga0070700_100022316 | 3300005441 | Bacteria | 3689 |
| 112 | Ga0070708_100005216 | 3300005445 | Bacteria | 10289 |
| 113 | Ga0070708_100382634 | 3300005445 | Bacteria | 1327 |
| 114 | Ga0070663_100001998 | 3300005455 | Bacteria | 11388 |
| 115 | Ga0070663_100003552 | 3300005455 | Bacteria | 9006 |
| 116 | Ga0070663_100011137 | 3300005455 | Bacteria | 5632 |
| 117 | Ga0070663_100030594 | 3300005455 | Bacteria | 3691 |
| 118 | Ga0070663_100174476 | 3300005455 | Bacteria | 1664 |
| 119 | Ga0070663_100181951 | 3300005455 | Bacteria | 1631 |
| 120 | Ga0070678_100015225 | 3300005456 | Bacteria | 4881 |
| 121 | Ga0070678_100040799 | 3300005456 | Bacteria | 3286 |
| 122 | Ga0070662_100007688 | 3300005457 | Bacteria | 6993 |
| 123 | Ga0070662_100055165 | 3300005457 | Bacteria | 2882 |
| 124 | Ga0070662_100095797 | 3300005457 | Bacteria | 2238 |
| 125 | Ga0070662_100105335 | 3300005457 | Bacteria | 2141 |
| 126 | Ga0070662_100356393 | 3300005457 | Bacteria | 1199 |
| 127 | Ga0070681_10000076 | 3300005458 | Bacteria | 73378 |
| 128 | Ga0070681_10001058 | 3300005458 | Bacteria | 23417 |
| 129 | Ga0070681_10005260 | 3300005458 | Bacteria | 12496 |
| 130 | Ga0070681_10012818 | 3300005458 | Bacteria | 8322 |
| 131 | Ga0070681_10051976 | 3300005458 | Bacteria | 4086 |
| 132 | Ga0070681_10097017 | 3300005458 | Bacteria | 2895 |
| 133 | Ga0070681_10231243 | 3300005458 | Bacteria | 1763 |
| 134 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 135 | Ga0068867_100299750 | 3300005459 | Bacteria | 1325 |
| 136 | Ga0070685_10053205 | 3300005466 | Bacteria | 2345 |
| 137 | Ga0070706_100017183 | 3300005467 | Bacteria | 6682 |
| 138 | Ga0070706_100075262 | 3300005467 | Bacteria | 3124 |
| 139 | Ga0070698_100025964 | 3300005471 | Bacteria | 6102 |
| 140 | Ga0070679_100000504 | 3300005530 | Bacteria | 33271 |
| 141 | Ga0070679_100005669 | 3300005530 | Bacteria | 11575 |
| 142 | Ga0070679_100094827 | 3300005530 | Bacteria | 2972 |
| 143 | Ga0070679_100229808 | 3300005530 | Bacteria | 1815 |
| 144 | Ga0070679_100245203 | 3300005530 | Bacteria | 1748 |
| 145 | Ga0070684_100142709 | 3300005535 | Bacteria | 2166 |
| 146 | Ga0070684_100431134 | 3300005535 | Bacteria | 1217 |
| 147 | Ga0070684_100608218 | 3300005535 | Bacteria | 1016 |
| 148 | Ga0070697_100053485 | 3300005536 | Bacteria | 3281 |
| 149 | Ga0070697_100147487 | 3300005536 | Bacteria | 1982 |
| 150 | Ga0068853_100025947 | 3300005539 | Bacteria | 4918 |
| 151 | Ga0068853_100026580 | 3300005539 | Bacteria | 4860 |
| 152 | Ga0068853_100087550 | 3300005539 | Bacteria | 2733 |
| 153 | Ga0068853_100195851 | 3300005539 | Bacteria | 1838 |
| 154 | Ga0068853_100241865 | 3300005539 | Bacteria | 1654 |
| 155 | Ga0068853_100295727 | 3300005539 | Bacteria | 1495 |
| 156 | Ga0070672_100003161 | 3300005543 | Bacteria | 10646 |
| 157 | Ga0070672_100021437 | 3300005543 | Bacteria | 4728 |
| 158 | Ga0070686_100193262 | 3300005544 | Bacteria | 1454 |
| 159 | Ga0070696_100003079 | 3300005546 | Bacteria | 11084 |
| 160 | Ga0070696_100015403 | 3300005546 | Bacteria | 5134 |
| 161 | Ga0070696_100027962 | 3300005546 | Bacteria | 3846 |
| 162 | Ga0070693_100014051 | 3300005547 | Bacteria | 4091 |
| 163 | Ga0070665_100000465 | 3300005548 | Bacteria | 58821 |
| 164 | Ga0070665_100237824 | 3300005548 | Bacteria | 1822 |
| 165 | Ga0070665_100503266 | 3300005548 | Bacteria | 1223 |
| 166 | Ga0070704_100071046 | 3300005549 | Bacteria | 2528 |
| 167 | Ga0068855_100000897 | 3300005563 | Bacteria | 36900 |
| 168 | Ga0068855_100034494 | 3300005563 | Bacteria | 6035 |
| 169 | Ga0068855_100059757 | 3300005563 | Bacteria | 4459 |
| 170 | Ga0068855_100167742 | 3300005563 | Bacteria | 2488 |
| 171 | Ga0068855_100192031 | 3300005563 | Bacteria | 2303 |
| 172 | Ga0068855_100593199 | 3300005563 | Bacteria | 1195 |
| 173 | Ga0068857_100014249 | 3300005577 | Bacteria | 6927 |
| 174 | Ga0068857_100019539 | 3300005577 | Bacteria | 5950 |
| 175 | Ga0068857_100082251 | 3300005577 | Bacteria | 2876 |
| 176 | Ga0068857_100120614 | 3300005577 | Bacteria | 2360 |
| 177 | Ga0068857_100150476 | 3300005577 | Bacteria | 2108 |
| 178 | Ga0068854_100000027 | 3300005578 | Bacteria | 117836 |
| 179 | Ga0068854_100000142 | 3300005578 | Bacteria | 49834 |
| 180 | Ga0068854_100063019 | 3300005578 | Bacteria | 2690 |
| 181 | Ga0068854_100368849 | 3300005578 | Bacteria | 1180 |
| 182 | Ga0068856_100000462 | 3300005614 | Bacteria | 44787 |
| 183 | Ga0068856_100004819 | 3300005614 | Bacteria | 13371 |
| 184 | Ga0068856_100025070 | 3300005614 | Bacteria | 5811 |
| 185 | Ga0068856_100336574 | 3300005614 | Bacteria | 1527 |
| 186 | Ga0068852_100112354 | 3300005616 | Bacteria | 2479 |
| 187 | Ga0068866_10036810 | 3300005718 | Bacteria | 2399 |
| 188 | Ga0068861_100004360 | 3300005719 | Bacteria | 9490 |
| 189 | Ga0068851_10026102 | 3300005834 | Bacteria | 2868 |
| 190 | Ga0068863_100038707 | 3300005841 | Bacteria | 4536 |
| 191 | Ga0068858_100013390 | 3300005842 | Bacteria | 7741 |
| 192 | Ga0068858_100098118 | 3300005842 | Bacteria | 2732 |
| 193 | Ga0068858_100128673 | 3300005842 | Bacteria | 2373 |
| 194 | Ga0068860_100041224 | 3300005843 | Bacteria | 4410 |
| 195 | Ga0068860_100061738 | 3300005843 | Bacteria | 3561 |
| 196 | Ga0068860_100101230 | 3300005843 | Bacteria | 2749 |
| 197 | Ga0068862_100070914 | 3300005844 | Bacteria | 3009 |
| 198 | Ga0081539_10000105 | 3300005985 | Bacteria | 197356 |
| 199 | Ga0081539_10083936 | 3300005985 | Bacteria | 1666 |
| 200 | Ga0075364_10061999 | 3300006051 | Bacteria | 2454 |
| 201 | Ga0070712_100056201 | 3300006175 | Bacteria | 2760 |
| 202 | Ga0070712_100218002 | 3300006175 | Bacteria | 1509 |
| 203 | Ga0097621_100002061 | 3300006237 | Bacteria | 13748 |
| 204 | Ga0068871_100002074 | 3300006358 | Bacteria | 13555 |
| 205 | Ga0068871_100137854 | 3300006358 | Bacteria | 2073 |
| 206 | Ga0075428_100002309 | 3300006844 | Bacteria | 20651 |
| 207 | Ga0075428_100008733 | 3300006844 | Bacteria | 11238 |
| 208 | Ga0075428_100415922 | 3300006844 | Bacteria | 1440 |
| 209 | Ga0075428_100713931 | 3300006844 | Bacteria | 1068 |
| 210 | Ga0075430_100065318 | 3300006846 | Bacteria | 3057 |
| 211 | Ga0075431_100013904 | 3300006847 | Bacteria | 8127 |
| 212 | Ga0075433_10039496 | 3300006852 | Bacteria | 4082 |
| 213 | Ga0075434_100007756 | 3300006871 | Bacteria | 9939 |
| 214 | Ga0075434_100048328 | 3300006871 | Bacteria | 4221 |
| 215 | Ga0075429_100055515 | 3300006880 | Bacteria | 3446 |
| 216 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 217 | Ga0068865_100007765 | 3300006881 | Bacteria | 6613 |
| 218 | Ga0068865_100122851 | 3300006881 | Bacteria | 1934 |
| 219 | Ga0099795_10004112 | 3300007788 | Bacteria | 3711 |
| 220 | Ga0105240_10000049 | 3300009093 | Bacteria | 236718 |
| 221 | Ga0105240_10000113 | 3300009093 | Bacteria | 168192 |
| 222 | Ga0105240_10002816 | 3300009093 | Bacteria | 27486 |
| 223 | Ga0105240_10069114 | 3300009093 | Bacteria | 4372 |
| 224 | Ga0105240_10081693 | 3300009093 | Bacteria | 3970 |
| 225 | Ga0105240_10228162 | 3300009093 | Bacteria | 2166 |
| 226 | Ga0105240_10680974 | 3300009093 | Bacteria | 1124 |
| 227 | Ga0111539_10043138 | 3300009094 | Bacteria | 5409 |
| 228 | Ga0111539_10049401 | 3300009094 | Bacteria | 5017 |
| 229 | Ga0111539_10063244 | 3300009094 | Bacteria | 4379 |
| 230 | Ga0111539_10565172 | 3300009094 | Bacteria | 1325 |
| 231 | Ga0105245_10001804 | 3300009098 | Bacteria | 19521 |
| 232 | Ga0105245_10056362 | 3300009098 | Bacteria | 3532 |
| 233 | Ga0105245_10062002 | 3300009098 | Bacteria | 3373 |
| 234 | Ga0114129_10001539 | 3300009147 | Bacteria | 31268 |
| 235 | Ga0114129_10014853 | 3300009147 | Bacteria | 11095 |
| 236 | Ga0114129_10148798 | 3300009147 | Bacteria | 3205 |
| 237 | Ga0105243_10000950 | 3300009148 | Bacteria | 27049 |
| 238 | Ga0105243_10004757 | 3300009148 | Bacteria | 10671 |
| 239 | Ga0105243_10008647 | 3300009148 | Bacteria | 7810 |
| 240 | Ga0105243_10011470 | 3300009148 | Bacteria | 6704 |
| 241 | Ga0105243_10014541 | 3300009148 | Bacteria | 5954 |
| 242 | Ga0105241_10011546 | 3300009174 | Bacteria | 6475 |
| 243 | Ga0105241_10012868 | 3300009174 | Bacteria | 6140 |
| 244 | Ga0105241_10013711 | 3300009174 | Bacteria | 5938 |
| 245 | Ga0105241_10282502 | 3300009174 | Bacteria | 1418 |
| 246 | Ga0105242_10000210 | 3300009176 | Bacteria | 45627 |
| 247 | Ga0105242_10007241 | 3300009176 | Bacteria | 8552 |
| 248 | Ga0105248_10057736 | 3300009177 | Bacteria | 4356 |
| 249 | Ga0105248_10262904 | 3300009177 | Bacteria | 1942 |
| 250 | Ga0105237_10000230 | 3300009545 | Bacteria | 79441 |
| 251 | Ga0105237_10284515 | 3300009545 | Bacteria | 1656 |
| 252 | Ga0105237_10362694 | 3300009545 | Bacteria | 1453 |
| 253 | Ga0105238_10002948 | 3300009551 | Bacteria | 16980 |
| 254 | Ga0105238_10041071 | 3300009551 | Bacteria | 4686 |
| 255 | Ga0105238_10073696 | 3300009551 | Bacteria | 3408 |
| 256 | Ga0105238_10143947 | 3300009551 | Bacteria | 2360 |
| 257 | Ga0105238_10543702 | 3300009551 | Bacteria | 1165 |
| 258 | Ga0105249_10000195 | 3300009553 | Bacteria | 69709 |
| 259 | Ga0105249_10007619 | 3300009553 | Bacteria | 9444 |
| 260 | Ga0105249_10017303 | 3300009553 | Bacteria | 6400 |
| 261 | Ga0105249_10030480 | 3300009553 | Bacteria | 4876 |
| 262 | Ga0105249_10135624 | 3300009553 | Bacteria | 2355 |
| 263 | Ga0105249_10294373 | 3300009553 | Bacteria | 1626 |
| 264 | Ga0105032_101587 | 3300009979 | Bacteria | 2065 |
| 265 | Ga0105028_101804 | 3300009993 | Bacteria | 2244 |
| 266 | Ga0105239_10000034 | 3300010375 | Bacteria | 219430 |
| 267 | Ga0105239_10004123 | 3300010375 | Bacteria | 17464 |
| 268 | Ga0105239_10095696 | 3300010375 | Bacteria | 3280 |
| 269 | Ga0105239_10299995 | 3300010375 | Bacteria | 1809 |
| 270 | Ga0105239_10319165 | 3300010375 | Bacteria | 1751 |
| 271 | Ga0105239_10485188 | 3300010375 | Bacteria | 1404 |
| 272 | Ga0157373_10098054 | 3300013100 | Bacteria | 2063 |
| 273 | Ga0157371_10000397 | 3300013102 | Bacteria | 54547 |
| 274 | Ga0157371_10019340 | 3300013102 | Bacteria | 5024 |
| 275 | Ga0157371_10070140 | 3300013102 | Bacteria | 2481 |
| 276 | Ga0157371_10080697 | 3300013102 | Bacteria | 2304 |
| 277 | Ga0157371_10182732 | 3300013102 | Bacteria | 1500 |
| 278 | Ga0157371_10236816 | 3300013102 | Bacteria | 1312 |
| 279 | Ga0157370_10010248 | 3300013104 | Bacteria | 9897 |
| 280 | Ga0157370_10024020 | 3300013104 | Bacteria | 6044 |
| 281 | Ga0157370_10025407 | 3300013104 | Bacteria | 5862 |
| 282 | Ga0157370_10035718 | 3300013104 | Bacteria | 4828 |
| 283 | Ga0157370_10065485 | 3300013104 | Bacteria | 3438 |
| 284 | Ga0157370_10082723 | 3300013104 | Bacteria | 3019 |
| 285 | Ga0157370_10189137 | 3300013104 | Bacteria | 1911 |
| 286 | Ga0157369_10030897 | 3300013105 | Bacteria | 5904 |
| 287 | Ga0157369_10045576 | 3300013105 | Bacteria | 4768 |
| 288 | Ga0157369_10054676 | 3300013105 | Bacteria | 4310 |
| 289 | Ga0157369_10196583 | 3300013105 | Bacteria | 2118 |
| 290 | Ga0157369_10219655 | 3300013105 | Bacteria | 1990 |
| 291 | Ga0157369_10248017 | 3300013105 | Bacteria | 1859 |
| 292 | Ga0157369_10301602 | 3300013105 | Bacteria | 1666 |
| 293 | Ga0157374_10000830 | 3300013296 | Bacteria | 27049 |
| 294 | Ga0157374_10002660 | 3300013296 | Bacteria | 15048 |
| 295 | Ga0157374_10079124 | 3300013296 | Bacteria | 3114 |
| 296 | Ga0157374_10265052 | 3300013296 | Bacteria | 1693 |
| 297 | Ga0157378_10001477 | 3300013297 | Bacteria | 21228 |
| 298 | Ga0157378_10013933 | 3300013297 | Bacteria | 7034 |
| 299 | Ga0157378_10144915 | 3300013297 | Bacteria | 2208 |
| 300 | Ga0157378_10562746 | 3300013297 | Bacteria | 1147 |
| 301 | Ga0163162_10000015 | 3300013306 | Bacteria | 261996 |
| 302 | Ga0163162_10009246 | 3300013306 | Bacteria | 9588 |
| 303 | Ga0163162_10033700 | 3300013306 | Bacteria | 5090 |
| 304 | Ga0163162_10072625 | 3300013306 | Bacteria | 3496 |
| 305 | Ga0163162_10670611 | 3300013306 | Bacteria | 1160 |
| 306 | Ga0157372_10000004 | 3300013307 | Bacteria | 435659 |
| 307 | Ga0157372_10008269 | 3300013307 | Bacteria | 11061 |
| 308 | Ga0157372_10022871 | 3300013307 | Bacteria | 6769 |
| 309 | Ga0157372_10047515 | 3300013307 | Bacteria | 4770 |
| 310 | Ga0157372_10070446 | 3300013307 | Bacteria | 3934 |
| 311 | Ga0157372_10118468 | 3300013307 | Bacteria | 3038 |
| 312 | Ga0157372_10122484 | 3300013307 | Bacteria | 2988 |
| 313 | Ga0157375_10002120 | 3300013308 | Bacteria | 17145 |
| 314 | Ga0157375_10156411 | 3300013308 | Bacteria | 2418 |
| 315 | Ga0157375_10234511 | 3300013308 | Bacteria | 1994 |
| 316 | Ga0157375_10389508 | 3300013308 | Bacteria | 1560 |
| 317 | Ga0157375_10663712 | 3300013308 | Bacteria | 1198 |
| 318 | Ga0163163_10000205 | 3300014325 | Bacteria | 61330 |
| 319 | Ga0163163_10091541 | 3300014325 | Bacteria | 3056 |
| 320 | Ga0157380_10033964 | 3300014326 | Bacteria | 3931 |
| 321 | Ga0157380_10299929 | 3300014326 | Bacteria | 1480 |
| 322 | Ga0182008_10048966 | 3300014497 | Bacteria | 2098 |
| 323 | Ga0182008_10069164 | 3300014497 | Bacteria | 1737 |
| 324 | Ga0157377_10014848 | 3300014745 | Bacteria | 3972 |
| 325 | Ga0157379_10367839 | 3300014968 | Bacteria | 1318 |
| 326 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 327 | Ga0157376_10112995 | 3300014969 | Bacteria | 2394 |
| 328 | Ga0157376_10261459 | 3300014969 | Bacteria | 1622 |
| 329 | Ga0182006_1012948 | 3300015261 | Bacteria | 3637 |
| 330 | Ga0182006_1030792 | 3300015261 | Bacteria | 2166 |
| 331 | Ga0182006_1032508 | 3300015261 | Bacteria | 2097 |
| 332 | Ga0182006_1033197 | 3300015261 | Bacteria | 2070 |
| 333 | Ga0182007_10000079 | 3300015262 | Bacteria | 73543 |
| 334 | Ga0182007_10003052 | 3300015262 | Bacteria | 8072 |
| 335 | Ga0182005_1000166 | 3300015265 | Bacteria | 45594 |
| 336 | Ga0182005_1048792 | 3300015265 | Bacteria | 1150 |
| 337 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 338 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 339 | Ga0163161_10018593 | 3300017792 | Bacteria | 4869 |
| 340 | Ga0163161_10039512 | 3300017792 | Bacteria | 3388 |
| 341 | Ga0163161_10184246 | 3300017792 | Bacteria | 1602 |
| 342 | Ga0197907_10031041 | 3300020069 | Bacteria | 1831 |
| 343 | Ga0206356_11162436 | 3300020070 | Bacteria | 2371 |
| 344 | Ga0206351_10270042 | 3300020077 | Bacteria | 1049 |
| 345 | Ga0206352_10784584 | 3300020078 | Bacteria | 1230 |
| 346 | Ga0206350_10514329 | 3300020080 | Bacteria | 2379 |
| 347 | Ga0206354_10512197 | 3300020081 | Bacteria | 2443 |
| 348 | Ga0206353_11363697 | 3300020082 | Bacteria | 1420 |
| 349 | Ga0154015_1208151 | 3300020610 | Bacteria | 1257 |
| 350 | Ga0154015_1499885 | 3300020610 | Bacteria | 1311 |
| 351 | Ga0213876_10001632 | 3300021384 | Bacteria | 13683 |
| 352 | Ga0213875_10049732 | 3300021388 | Bacteria | 1965 |
| 353 | Ga0224712_10020806 | 3300022467 | Bacteria | 2235 |
| 354 | Ga0224712_10028061 | 3300022467 | Bacteria | 2008 |
| 355 | Ga0228598_1013405 | 3300024227 | Bacteria | 1623 |
| 356 | Ga0209566_100056 | 3300025225 | Bacteria | 209595 |
| 357 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 358 | Ga0209674_100063 | 3300025226 | Bacteria | 275507 |
| 359 | Ga0209674_100836 | 3300025226 | Bacteria | 10196 |
| 360 | Ga0209672_100509 | 3300025228 | Bacteria | 21444 |
| 361 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 362 | Ga0207427_100132 | 3300025231 | Bacteria | 92962 |
| 363 | Ga0207427_100322 | 3300025231 | Bacteria | 32298 |
| 364 | Ga0207427_103057 | 3300025231 | Bacteria | 3807 |
| 365 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 366 | Ga0209437_100118 | 3300025233 | Bacteria | 207534 |
| 367 | Ga0209437_100233 | 3300025233 | Bacteria | 93858 |
| 368 | Ga0209258_100935 | 3300025242 | Bacteria | 14221 |
| 369 | Ga0209258_101545 | 3300025242 | Bacteria | 7709 |
| 370 | Ga0207425_1000148 | 3300025245 | Bacteria | 59862 |
| 371 | Ga0207425_1001805 | 3300025245 | Bacteria | 8297 |
| 372 | Ga0209646_1004787 | 3300025246 | Bacteria | 2432 |
| 373 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 374 | Ga0209026_1000061 | 3300025250 | Bacteria | 219572 |
| 375 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 376 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 377 | Ga0209759_1003743 | 3300025256 | Bacteria | 5945 |
| 378 | Ga0209129_1000239 | 3300025258 | Bacteria | 59863 |
| 379 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 380 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 381 | Ga0209233_1011210 | 3300025261 | Bacteria | 2649 |
| 382 | Ga0209233_1015398 | 3300025261 | Bacteria | 2130 |
| 383 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 384 | Ga0209455_1000111 | 3300025272 | Bacteria | 188820 |
| 385 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 386 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 387 | Ga0209676_1000411 | 3300025292 | Bacteria | 77084 |
| 388 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 389 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 390 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 391 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 392 | Ga0209758_1008030 | 3300025297 | Bacteria | 6973 |
| 393 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 394 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 395 | Ga0209256_1003699 | 3300025299 | Bacteria | 10388 |
| 396 | Ga0207656_10008749 | 3300025321 | Bacteria | 3741 |
| 397 | Ga0207642_10161387 | 3300025899 | Bacteria | 1204 |
| 398 | Ga0207688_10112355 | 3300025901 | Bacteria | 1583 |
| 399 | Ga0207680_10047257 | 3300025903 | Bacteria | 2549 |
| 400 | Ga0207680_10061889 | 3300025903 | Bacteria | 2284 |
| 401 | Ga0207647_10001386 | 3300025904 | Bacteria | 18622 |
| 402 | Ga0207647_10002100 | 3300025904 | Bacteria | 15252 |
| 403 | Ga0207647_10003612 | 3300025904 | Bacteria | 11579 |
| 404 | Ga0207647_10010284 | 3300025904 | Bacteria | 6610 |
| 405 | Ga0207647_10026222 | 3300025904 | Bacteria | 3816 |
| 406 | Ga0207647_10051240 | 3300025904 | Bacteria | 2552 |
| 407 | Ga0207647_10054217 | 3300025904 | Bacteria | 2467 |
| 408 | Ga0207645_10000737 | 3300025907 | Bacteria | 27273 |
| 409 | Ga0207645_10009242 | 3300025907 | Bacteria | 6828 |
| 410 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 411 | Ga0207705_10000146 | 3300025909 | Bacteria | 75353 |
| 412 | Ga0207705_10000373 | 3300025909 | Bacteria | 40446 |
| 413 | Ga0207705_10000788 | 3300025909 | Bacteria | 26019 |
| 414 | Ga0207705_10009432 | 3300025909 | Bacteria | 7097 |
| 415 | Ga0207705_10059428 | 3300025909 | Bacteria | 2759 |
| 416 | Ga0207705_10081047 | 3300025909 | Bacteria | 2365 |
| 417 | Ga0207705_10257657 | 3300025909 | Bacteria | 1331 |
| 418 | Ga0207684_10076825 | 3300025910 | Bacteria | 2838 |
| 419 | Ga0207684_10321899 | 3300025910 | Bacteria | 1333 |
| 420 | Ga0207654_10024425 | 3300025911 | Bacteria | 3249 |
| 421 | Ga0207707_10000018 | 3300025912 | Bacteria | 215518 |
| 422 | Ga0207707_10000036 | 3300025912 | Bacteria | 146159 |
| 423 | Ga0207707_10000868 | 3300025912 | Bacteria | 29545 |
| 424 | Ga0207707_10000944 | 3300025912 | Bacteria | 28014 |
| 425 | Ga0207707_10009741 | 3300025912 | Bacteria | 8335 |
| 426 | Ga0207707_10015309 | 3300025912 | Bacteria | 6677 |
| 427 | Ga0207707_10017108 | 3300025912 | Bacteria | 6317 |
| 428 | Ga0207707_10023133 | 3300025912 | Bacteria | 5438 |
| 429 | Ga0207707_10027620 | 3300025912 | Bacteria | 4961 |
| 430 | Ga0207707_10050186 | 3300025912 | Bacteria | 3635 |
| 431 | Ga0207707_10127412 | 3300025912 | Bacteria | 2226 |
| 432 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 433 | Ga0207695_10000114 | 3300025913 | Bacteria | 242465 |
| 434 | Ga0207695_10000816 | 3300025913 | Bacteria | 57734 |
| 435 | Ga0207695_10001086 | 3300025913 | Bacteria | 47444 |
| 436 | Ga0207695_10002626 | 3300025913 | Bacteria | 26298 |
| 437 | Ga0207695_10027868 | 3300025913 | Bacteria | 6280 |
| 438 | Ga0207695_10050538 | 3300025913 | Bacteria | 4372 |
| 439 | Ga0207695_10053798 | 3300025913 | Bacteria | 4208 |
| 440 | Ga0207695_10073182 | 3300025913 | Bacteria | 3493 |
| 441 | Ga0207695_10115114 | 3300025913 | Bacteria | 2664 |
| 442 | Ga0207695_10182106 | 3300025913 | Bacteria | 2022 |
| 443 | Ga0207671_10000639 | 3300025914 | Bacteria | 45851 |
| 444 | Ga0207671_10082200 | 3300025914 | Bacteria | 2417 |
| 445 | Ga0207671_10321677 | 3300025914 | Bacteria | 1224 |
| 446 | Ga0207660_10000389 | 3300025917 | Bacteria | 28880 |
| 447 | Ga0207660_10009240 | 3300025917 | Bacteria | 6379 |
| 448 | Ga0207660_10009433 | 3300025917 | Bacteria | 6317 |
| 449 | Ga0207660_10009884 | 3300025917 | Bacteria | 6180 |
| 450 | Ga0207660_10010720 | 3300025917 | Bacteria | 5957 |
| 451 | Ga0207660_10015984 | 3300025917 | Bacteria | 4961 |
| 452 | Ga0207660_10028000 | 3300025917 | Bacteria | 3851 |
| 453 | Ga0207660_10048875 | 3300025917 | Bacteria | 2995 |
| 454 | Ga0207660_10145550 | 3300025917 | Bacteria | 1816 |
| 455 | Ga0207660_10237378 | 3300025917 | Bacteria | 1435 |
| 456 | Ga0207662_10001726 | 3300025918 | Bacteria | 10708 |
| 457 | Ga0207657_10022248 | 3300025919 | Bacteria | 5940 |
| 458 | Ga0207649_10001271 | 3300025920 | Bacteria | 15070 |
| 459 | Ga0207649_10019583 | 3300025920 | Bacteria | 3869 |
| 460 | Ga0207649_10065234 | 3300025920 | Bacteria | 2304 |
| 461 | Ga0207649_10150937 | 3300025920 | Bacteria | 1600 |
| 462 | Ga0207652_10000409 | 3300025921 | Bacteria | 44486 |
| 463 | Ga0207652_10004945 | 3300025921 | Bacteria | 10791 |
| 464 | Ga0207652_10007521 | 3300025921 | Bacteria | 8769 |
| 465 | Ga0207652_10038403 | 3300025921 | Bacteria | 4059 |
| 466 | Ga0207652_10076977 | 3300025921 | Bacteria | 2910 |
| 467 | Ga0207652_10212731 | 3300025921 | Bacteria | 1741 |
| 468 | Ga0207646_10192292 | 3300025922 | Bacteria | 1843 |
| 469 | Ga0207681_10027150 | 3300025923 | Bacteria | 3699 |
| 470 | Ga0207694_10000930 | 3300025924 | Bacteria | 25962 |
| 471 | Ga0207694_10002010 | 3300025924 | Bacteria | 16833 |
| 472 | Ga0207694_10013293 | 3300025924 | Bacteria | 6199 |
| 473 | Ga0207694_10085369 | 3300025924 | Bacteria | 2484 |
| 474 | Ga0207694_10132693 | 3300025924 | Bacteria | 1997 |
| 475 | Ga0207650_10059382 | 3300025925 | Bacteria | 2850 |
| 476 | Ga0207650_10165686 | 3300025925 | Bacteria | 1754 |
| 477 | Ga0207650_10244319 | 3300025925 | Bacteria | 1451 |
| 478 | Ga0207659_10042135 | 3300025926 | Bacteria | 3199 |
| 479 | Ga0207659_10136197 | 3300025926 | Bacteria | 1901 |
| 480 | Ga0207687_10008258 | 3300025927 | Bacteria | 6810 |
| 481 | Ga0207687_10062794 | 3300025927 | Bacteria | 2628 |
| 482 | Ga0207700_10001535 | 3300025928 | Bacteria | 13085 |
| 483 | Ga0207700_10296846 | 3300025928 | Bacteria | 1394 |
| 484 | Ga0207664_10000014 | 3300025929 | Bacteria | 249865 |
| 485 | Ga0207664_10000071 | 3300025929 | Bacteria | 105708 |
| 486 | Ga0207664_10000601 | 3300025929 | Bacteria | 24933 |
| 487 | Ga0207644_10042775 | 3300025931 | Bacteria | 3212 |
| 488 | Ga0207690_10000532 | 3300025932 | Bacteria | 24801 |
| 489 | Ga0207690_10001860 | 3300025932 | Bacteria | 12965 |
| 490 | Ga0207690_10108815 | 3300025932 | Bacteria | 1993 |
| 491 | Ga0207690_10109772 | 3300025932 | Bacteria | 1985 |
| 492 | Ga0207690_10137975 | 3300025932 | Bacteria | 1793 |
| 493 | Ga0207706_10008698 | 3300025933 | Bacteria | 9352 |
| 494 | Ga0207706_10011915 | 3300025933 | Bacteria | 7916 |
| 495 | Ga0207706_10013100 | 3300025933 | Bacteria | 7546 |
| 496 | Ga0207706_10042110 | 3300025933 | Bacteria | 4047 |
| 497 | Ga0207706_10049448 | 3300025933 | Bacteria | 3715 |
| 498 | Ga0207706_10470496 | 3300025933 | Bacteria | 1086 |
| 499 | Ga0207686_10000598 | 3300025934 | Bacteria | 22543 |
| 500 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 501 | Ga0207709_10000527 | 3300025935 | Bacteria | 33281 |
| 502 | Ga0207709_10009913 | 3300025935 | Bacteria | 5247 |
| 503 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 504 | Ga0207704_10013639 | 3300025938 | Bacteria | 4076 |
| 505 | Ga0207691_10003625 | 3300025940 | Bacteria | 14989 |
| 506 | Ga0207691_10014108 | 3300025940 | Bacteria | 7622 |
| 507 | Ga0207691_10046652 | 3300025940 | Bacteria | 3980 |
| 508 | Ga0207711_10014427 | 3300025941 | Bacteria | 6563 |
| 509 | Ga0207711_10023261 | 3300025941 | Bacteria | 5186 |
| 510 | Ga0207689_10001541 | 3300025942 | Bacteria | 21894 |
| 511 | Ga0207689_10001783 | 3300025942 | Bacteria | 20340 |
| 512 | Ga0207661_10001897 | 3300025944 | Bacteria | 14342 |
| 513 | Ga0207661_10045981 | 3300025944 | Bacteria | 3459 |
| 514 | Ga0207661_10209699 | 3300025944 | Bacteria | 1716 |
| 515 | Ga0207661_10248469 | 3300025944 | Bacteria | 1580 |
| 516 | Ga0207679_10004674 | 3300025945 | Bacteria | 8528 |
| 517 | Ga0207667_10000040 | 3300025949 | Bacteria | 275827 |
| 518 | Ga0207667_10000947 | 3300025949 | Bacteria | 37022 |
| 519 | Ga0207667_10007762 | 3300025949 | Bacteria | 12828 |
| 520 | Ga0207667_10072474 | 3300025949 | Bacteria | 3580 |
| 521 | Ga0207667_10103191 | 3300025949 | Bacteria | 2941 |
| 522 | Ga0207667_10149101 | 3300025949 | Bacteria | 2408 |
| 523 | Ga0207667_10205878 | 3300025949 | Bacteria | 2017 |
| 524 | Ga0207667_10238588 | 3300025949 | Bacteria | 1861 |
| 525 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 526 | Ga0207712_10000277 | 3300025961 | Bacteria | 48990 |
| 527 | Ga0207712_10001146 | 3300025961 | Bacteria | 18465 |
| 528 | Ga0207712_10014077 | 3300025961 | Bacteria | 5135 |
| 529 | Ga0207712_10021212 | 3300025961 | Bacteria | 4262 |
| 530 | Ga0207668_10005154 | 3300025972 | Bacteria | 7689 |
| 531 | Ga0207668_10018373 | 3300025972 | Bacteria | 4398 |
| 532 | Ga0207640_10000009 | 3300025981 | Bacteria | 283101 |
| 533 | Ga0207640_10000145 | 3300025981 | Bacteria | 51603 |
| 534 | Ga0207640_10005290 | 3300025981 | Bacteria | 7031 |
| 535 | Ga0207640_10014194 | 3300025981 | Bacteria | 4579 |
| 536 | Ga0207640_10098268 | 3300025981 | Bacteria | 2046 |
| 537 | Ga0207640_10133355 | 3300025981 | Bacteria | 1799 |
| 538 | Ga0207658_10149525 | 3300025986 | Bacteria | 1901 |
| 539 | Ga0207677_10000373 | 3300026023 | Bacteria | 31103 |
| 540 | Ga0207677_10471654 | 3300026023 | Bacteria | 1080 |
| 541 | Ga0207703_10004934 | 3300026035 | Bacteria | 10830 |
| 542 | Ga0207639_10001840 | 3300026041 | Bacteria | 14285 |
| 543 | Ga0207639_10004652 | 3300026041 | Bacteria | 9240 |
| 544 | Ga0207639_10007809 | 3300026041 | Bacteria | 7304 |
| 545 | Ga0207639_10014224 | 3300026041 | Bacteria | 5589 |
| 546 | Ga0207639_10020933 | 3300026041 | Bacteria | 4692 |
| 547 | Ga0207639_10293628 | 3300026041 | Bacteria | 1434 |
| 548 | Ga0207639_10693695 | 3300026041 | Bacteria | 944 |
| 549 | Ga0207678_10004979 | 3300026067 | Bacteria | 11914 |
| 550 | Ga0207678_10005889 | 3300026067 | Bacteria | 10929 |
| 551 | Ga0207678_10006369 | 3300026067 | Bacteria | 10480 |
| 552 | Ga0207678_10020914 | 3300026067 | Bacteria | 5736 |
| 553 | Ga0207678_10043979 | 3300026067 | Bacteria | 3865 |
| 554 | Ga0207708_10000004 | 3300026075 | Bacteria | 293087 |
| 555 | Ga0207708_10009224 | 3300026075 | Bacteria | 7302 |
| 556 | Ga0207702_10000172 | 3300026078 | Bacteria | 77484 |
| 557 | Ga0207702_10008380 | 3300026078 | Bacteria | 8721 |
| 558 | Ga0207702_10015708 | 3300026078 | Bacteria | 6269 |
| 559 | Ga0207702_10036014 | 3300026078 | Bacteria | 4138 |
| 560 | Ga0207641_10025775 | 3300026088 | Bacteria | 4849 |
| 561 | Ga0207641_10043596 | 3300026088 | Bacteria | 3768 |
| 562 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 563 | Ga0207648_10027096 | 3300026089 | Bacteria | 5090 |
| 564 | Ga0207648_10030744 | 3300026089 | Bacteria | 4752 |
| 565 | Ga0207648_10136587 | 3300026089 | Bacteria | 2160 |
| 566 | Ga0207674_10001921 | 3300026116 | Bacteria | 26378 |
| 567 | Ga0207674_10004423 | 3300026116 | Bacteria | 16915 |
| 568 | Ga0207674_10012476 | 3300026116 | Bacteria | 9496 |
| 569 | Ga0207674_10021680 | 3300026116 | Bacteria | 6916 |
| 570 | Ga0207674_10050289 | 3300026116 | Bacteria | 4259 |
| 571 | Ga0207674_10227566 | 3300026116 | Bacteria | 1813 |
| 572 | Ga0207674_10258908 | 3300026116 | Bacteria | 1687 |
| 573 | Ga0207674_10341215 | 3300026116 | Bacteria | 1448 |
| 574 | Ga0207675_100001976 | 3300026118 | Bacteria | 20447 |
| 575 | Ga0207675_100031644 | 3300026118 | Bacteria | 4929 |
| 576 | Ga0207683_10232436 | 3300026121 | Bacteria | 1682 |
| 577 | Ga0207698_10000931 | 3300026142 | Bacteria | 17023 |
| 578 | Ga0207698_10054723 | 3300026142 | Bacteria | 3072 |
| 579 | Ga0207698_10083396 | 3300026142 | Bacteria | 2587 |
| 580 | Ga0207698_10332722 | 3300026142 | Bacteria | 1427 |
| 581 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 582 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 583 | Ga0209974_10004171 | 3300027876 | Bacteria | 5169 |
| 584 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 585 | Ga0268266_10026003 | 3300028379 | Bacteria | 4979 |
| 586 | Ga0268266_10027010 | 3300028379 | Bacteria | 4884 |
| 587 | Ga0268266_10031407 | 3300028379 | Bacteria | 4510 |
| 588 | Ga0268266_10305737 | 3300028379 | Bacteria | 1485 |
| 589 | Ga0268265_10061048 | 3300028380 | Bacteria | 2891 |
| 590 | Ga0268265_10566371 | 3300028380 | Bacteria | 1081 |
| 591 | Ga0268264_10148368 | 3300028381 | Bacteria | 2100 |
| 592 | Ga0268264_10298648 | 3300028381 | Bacteria | 1515 |
| 593 | Ga0265319_1000240 | 3300028563 | Bacteria | 41199 |
| 594 | Ga0265318_10002424 | 3300028577 | Bacteria | 9972 |
| 595 | Ga0265338_10212940 | 3300028800 | Bacteria | 1449 |
| 596 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 597 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 598 | Ga0316181_1114053 | 3300030744 | Bacteria | 1726 |
| 599 | Ga0316181_1268996 | 3300030744 | Bacteria | 2554 |
| 600 | Ga0265332_10014777 | 3300031238 | Bacteria | 3451 |
| 601 | Ga0265320_10000136 | 3300031240 | Bacteria | 63022 |
| 602 | Ga0265325_10001525 | 3300031241 | Bacteria | 16241 |
| 603 | Ga0265325_10042548 | 3300031241 | Bacteria | 2374 |
| 604 | Ga0265329_10000171 | 3300031242 | Bacteria | 32652 |
| 605 | Ga0265340_10003989 | 3300031247 | Bacteria | 8293 |
| 606 | Ga0265339_10065646 | 3300031249 | Bacteria | 1945 |
| 607 | Ga0265331_10000021 | 3300031250 | Bacteria | 242632 |
| 608 | Ga0265331_10016315 | 3300031250 | Bacteria | 3902 |
| 609 | Ga0265316_10001078 | 3300031344 | Bacteria | 29506 |
| 610 | Ga0265316_10012682 | 3300031344 | Bacteria | 7544 |
| 611 | Ga0307513_10158437 | 3300031456 | Bacteria | 2160 |
| 612 | Ga0307408_100005909 | 3300031548 | Bacteria | 8152 |
| 613 | Ga0307408_100073444 | 3300031548 | Bacteria | 2535 |
| 614 | Ga0265313_10001348 | 3300031595 | Bacteria | 23135 |
| 615 | Ga0307508_10065258 | 3300031616 | Bacteria | 3208 |
| 616 | Ga0307508_10284242 | 3300031616 | Bacteria | 1248 |
| 617 | Ga0265314_10007149 | 3300031711 | Bacteria | 9723 |
| 618 | Ga0265342_10000555 | 3300031712 | Bacteria | 39457 |
| 619 | Ga0265342_10104745 | 3300031712 | Bacteria | 1607 |
| 620 | Ga0307413_10022756 | 3300031824 | Bacteria | 3384 |
| 621 | Ga0307413_10085739 | 3300031824 | Bacteria | 2034 |
| 622 | Ga0307413_10088902 | 3300031824 | Bacteria | 2005 |
| 623 | Ga0307413_10126983 | 3300031824 | Bacteria | 1739 |
| 624 | Ga0307410_10002430 | 3300031852 | Bacteria | 9007 |
| 625 | Ga0307410_10029439 | 3300031852 | Bacteria | 3496 |
| 626 | Ga0307410_10040470 | 3300031852 | Bacteria | 3067 |
| 627 | Ga0307406_10002083 | 3300031901 | Bacteria | 10912 |
| 628 | Ga0307406_10005253 | 3300031901 | Bacteria | 7079 |
| 629 | Ga0307406_10186025 | 3300031901 | Bacteria | 1517 |
| 630 | Ga0307407_10043860 | 3300031903 | Bacteria | 2517 |
| 631 | Ga0307412_10093954 | 3300031911 | Bacteria | 2105 |
| 632 | Ga0307412_10217952 | 3300031911 | Bacteria | 1461 |
| 633 | Ga0307409_100049477 | 3300031995 | Bacteria | 3205 |
| 634 | Ga0307409_100063613 | 3300031995 | Bacteria | 2894 |
| 635 | Ga0307416_100110189 | 3300032002 | Bacteria | 2423 |
| 636 | Ga0307414_10000303 | 3300032004 | Bacteria | 28561 |
| 637 | Ga0307414_10002908 | 3300032004 | Bacteria | 9058 |
| 638 | Ga0307414_10380382 | 3300032004 | Bacteria | 1220 |
| 639 | Ga0307411_10076113 | 3300032005 | Bacteria | 2293 |
| 640 | Ga0307411_10076436 | 3300032005 | Bacteria | 2289 |
| 641 | Ga0307411_10084639 | 3300032005 | Bacteria | 2194 |
| 642 | Ga0307415_100140021 | 3300032126 | Bacteria | 1846 |
| 643 | Ga0307415_100354786 | 3300032126 | Bacteria | 1236 |
| 644 | Ga0307507_10093349 | 3300033179 | Bacteria | 2564 |
| 645 | Ga0373926_0027212 | 3300035083 | Bacteria | 2002 |
| 646 | Ga0373952_0035064 | 3300035092 | Bacteria | 1134 |
| 647 | Ga0373945_0006636 | 3300035116 | Bacteria | 3739 |
| 648 | Ga0373956_0063225 | 3300035119 | Bacteria | 1678 |
| 649 | Ga0373943_0002619 | 3300035170 | Bacteria | 8184 |
| 650 | Ga0373935_0014070 | 3300035692 | Bacteria | 4832 |
| 651 | Ga0373927_0031176 | 3300035695 | Bacteria | 3477 |
| 652 | Ga0373933_0018862 | 3300035724 | Bacteria | 3886 |
| 653 | Ga0373933_0093035 | 3300035724 | Bacteria | 1863 |
| 654 | Ga0373947_0004896 | 3300035725 | Bacteria | 7838 |
| 655 | Ga0373947_0036575 | 3300035725 | Bacteria | 2912 |
| 656 | Ga0373937_0049907 | 3300036401 | Bacteria | 3832 |
| 657 | Ga0373937_0366843 | 3300036401 | Bacteria | 1365 |
| 658 | Ga0373925_0000649 | 3300037068 | Bacteria | 32703 |
| 659 | Ga0395899_0036394 | 3300037312 | Bacteria | 3692 |
| 660 | Ga0395900_0000033 | 3300037418 | Bacteria | 260271 |
| 661 | Ga0395900_0000888 | 3300037418 | Bacteria | 39271 |
| 662 | Ga0395900_0009693 | 3300037418 | Bacteria | 9869 |
| 663 | Ga0395900_0010009 | 3300037418 | Bacteria | 9702 |
| 664 | Ga0395900_0054926 | 3300037418 | Bacteria | 4100 |
| 665 | Ga0395898_0000355 | 3300037466 | Bacteria | 101003 |
| 666 | Ga0395898_0040116 | 3300037466 | Bacteria | 4632 |
| 667 | Ga0395898_0425028 | 3300037466 | Bacteria | 1266 |
| 668 | Ga0395905_0006600 | 3300037471 | Bacteria | 11643 |
| 669 | Ga0395905_0041832 | 3300037471 | Bacteria | 4300 |
| 670 | Ga0395905_0109833 | 3300037471 | Bacteria | 2589 |
| 671 | Ga0395905_0111481 | 3300037471 | Bacteria | 2569 |
| 672 | Ga0395905_0116462 | 3300037471 | Bacteria | 2512 |
| 673 | Ga0436364_0570527 | 3300037853 | Bacteria | 21688 |
| 674 | Ga0436364_0714734 | 3300037853 | Bacteria | 2049 |
| 675 | Ga0436364_1332114 | 3300037853 | Bacteria | 1998 |
| 676 | Ga0395901_0008861 | 3300038443 | Bacteria | 10186 |
| 677 | Ga0395901_0015001 | 3300038443 | Bacteria | 7876 |
| 678 | Ga0237819_00212 | 3300038705 | Bacteria | 21141 |
| 679 | Ga0237819_06260 | 3300038705 | Bacteria | 1798 |
| 680 | Ga0436365_0457258 | 3300039437 | Bacteria | 12071 |
| 681 | Ga0436365_1712708 | 3300039437 | Bacteria | 68148 |
| 682 | Ga0439436_0012161 | 3300041404 | Bacteria | 2612 |
| 683 | Ga0439441_007876 | 3300042001 | Bacteria | 1729 |
| 684 | Ga0439449_0079876 | 3300042007 | Bacteria | 1206 |
| 685 | Ga0466972_0014295 | 3300044658 | Bacteria | 3977 |
| 686 | Ga0466972_0020438 | 3300044658 | Bacteria | 3308 |
| 687 | Ga0466965_0055600 | 3300044683 | Bacteria | 1969 |
| 688 | Ga0466961_0097013 | 3300044693 | Bacteria | 1859 |
| 689 | Ga0466961_0099769 | 3300044693 | Bacteria | 1830 |
| 690 | Ga0453684_0121349 | 3300044712 | Bacteria | 3155 |
| 691 | Ga0453684_0671748 | 3300044712 | Bacteria | 1128 |
| 692 | Ga0466970_0021001 | 3300044765 | Bacteria | 3399 |
| 693 | Ga0466970_0086454 | 3300044765 | Bacteria | 1699 |
| 694 | Ga0466960_0007515 | 3300044901 | Bacteria | 4430 |
| 695 | Ga0466959_0049070 | 3300045049 | Bacteria | 3101 |
| 696 | Ga0466959_0201346 | 3300045049 | Bacteria | 1386 |
| 697 | Ga0466959_0267173 | 3300045049 | Bacteria | 1177 |
| 698 | Ga0451576_0049273 | 3300045051 | Bacteria | 4420 |
| 699 | Ga0451576_0386162 | 3300045051 | Bacteria | 1468 |
| 700 | Ga0466967_0520577 | 3300045976 | Bacteria | 1169 |
| 701 | Ga0495627_003294 | 3300046453 | Bacteria | 7220 |
| 702 | Ga0495627_010445 | 3300046453 | Bacteria | 3374 |
| 703 | Ga0495592_0001829 | 3300046454 | Bacteria | 14953 |
| 704 | Ga0495591_013499 | 3300046458 | Bacteria | 2983 |
| 705 | Ga0495638_0000087 | 3300046460 | Bacteria | 152531 |
| 706 | Ga0495638_0000095 | 3300046460 | Bacteria | 141825 |
| 707 | Ga0495638_0000526 | 3300046460 | Bacteria | 44654 |
| 708 | Ga0495651_0000112 | 3300046462 | Bacteria | 59789 |
| 709 | Ga0495651_0004909 | 3300046462 | Bacteria | 10229 |
| 710 | Ga0495651_0037275 | 3300046462 | Bacteria | 3785 |
| 711 | Ga0495653_0008702 | 3300046463 | Bacteria | 8315 |
| 712 | Ga0495653_0057144 | 3300046463 | Bacteria | 2972 |
| 713 | Ga0495650_0000122 | 3300046471 | Bacteria | 182888 |
| 714 | Ga0495580_0004583 | 3300046472 | Bacteria | 11600 |
| 715 | Ga0495582_0000213 | 3300046473 | Bacteria | 32186 |
| 716 | Ga0495639_0003220 | 3300046475 | Bacteria | 7093 |
| 717 | Ga0495662_0021763 | 3300046476 | Bacteria | 3098 |
| 718 | Ga0495664_0027212 | 3300046477 | Bacteria | 3333 |
| 719 | Ga0495664_0029489 | 3300046477 | Bacteria | 3209 |
| 720 | Ga0495664_0103014 | 3300046477 | Bacteria | 1720 |
| 721 | Ga0495606_0000154 | 3300046507 | Bacteria | 119458 |
| 722 | Ga0495608_0005013 | 3300046511 | Bacteria | 9472 |
| 723 | Ga0495608_0015212 | 3300046511 | Bacteria | 5339 |
| 724 | Ga0495628_0010075 | 3300046516 | Bacteria | 8042 |
| 725 | Ga0495630_0046901 | 3300046517 | Bacteria | 3230 |
| 726 | Ga0495630_0111043 | 3300046517 | Bacteria | 2077 |
| 727 | Ga0495630_0172293 | 3300046517 | Bacteria | 1649 |
| 728 | Ga0495632_0035825 | 3300046519 | Bacteria | 2528 |
| 729 | Ga0495643_0001815 | 3300046522 | Bacteria | 18211 |
| 730 | Ga0495663_0003358 | 3300046525 | Bacteria | 4627 |
| 731 | Ga0495663_0004265 | 3300046525 | Bacteria | 4031 |
| 732 | Ga0495642_0008250 | 3300046528 | Bacteria | 3984 |
| 733 | Ga0495652_0001460 | 3300046529 | Bacteria | 26134 |
| 734 | Ga0495652_0039539 | 3300046529 | Bacteria | 4078 |
| 735 | Ga0495665_0000168 | 3300046531 | Bacteria | 33008 |
| 736 | Ga0495665_0002975 | 3300046531 | Bacteria | 9159 |
| 737 | Ga0495640_0089957 | 3300046533 | Unclassified | 2027 |
| 738 | Ga0495640_0137767 | 3300046533 | Bacteria | 1575 |
| 739 | Ga0495586_0007098 | 3300046535 | Bacteria | 5970 |
| 740 | Ga0495586_0044609 | 3300046535 | Bacteria | 2389 |
| 741 | Ga0495586_0127954 | 3300046535 | Bacteria | 1421 |
| 742 | Ga0495587_0008194 | 3300046536 | Bacteria | 6734 |
| 743 | Ga0495645_0018582 | 3300046543 | Bacteria | 4995 |
| 744 | Ga0495622_0069635 | 3300046557 | Bacteria | 1624 |
| 745 | Ga0495633_0005215 | 3300046558 | Bacteria | 8016 |
| 746 | Ga0495633_0006398 | 3300046558 | Bacteria | 6986 |
| 747 | Ga0495667_0002346 | 3300046559 | Bacteria | 12657 |
| 748 | Ga0495667_0021853 | 3300046559 | Bacteria | 4314 |
| 749 | Ga0495656_0001607 | 3300046615 | Bacteria | 7396 |
| 750 | Ga0495668_0000364 | 3300046616 | Bacteria | 59836 |
| 751 | Ga0495625_0010997 | 3300046660 | Bacteria | 7425 |
| 752 | Ga0495625_0025870 | 3300046660 | Bacteria | 4442 |
| 753 | Ga0495625_0078789 | 3300046660 | Bacteria | 2299 |
| 754 | Ga0495635_0005328 | 3300046663 | Bacteria | 8955 |
| 755 | Ga0495635_0181855 | 3300046663 | Unclassified | 1429 |
| 756 | Ga0495657_0004093 | 3300046675 | Bacteria | 11695 |
| 757 | Ga0495657_0155154 | 3300046675 | Bacteria | 1419 |
| 758 | Ga0495623_0199603 | 3300046679 | Unclassified | 1151 |
| 759 | Ga0495646_0004052 | 3300046680 | Bacteria | 9190 |
| 760 | Ga0495647_0000124 | 3300046681 | Bacteria | 19840 |
| 761 | Ga0495647_0087280 | 3300046681 | Bacteria | 1274 |
| 762 | Ga0495658_0001608 | 3300046683 | Bacteria | 11762 |
| 763 | Ga0495613_0002933 | 3300046689 | Bacteria | 12776 |
| 764 | Ga0495613_0068659 | 3300046689 | Bacteria | 2585 |
| 765 | Ga0495624_0023365 | 3300046690 | Bacteria | 4077 |
| 766 | Ga0495670_0025528 | 3300046691 | Bacteria | 2923 |
| 767 | Ga0495671_0033896 | 3300046692 | Bacteria | 2599 |
| 768 | Ga0495649_0010401 | 3300046694 | Bacteria | 5489 |
| 769 | Ga0495600_0001620 | 3300046809 | Bacteria | 12555 |
| 770 | Ga0495600_0003112 | 3300046809 | Bacteria | 9714 |
| 771 | Ga0495581_0000059 | 3300047315 | Bacteria | 42676 |
| 772 | Ga0495581_0153730 | 3300047315 | Bacteria | 1344 |
| 773 | Ga0495604_0004415 | 3300047317 | Bacteria | 11133 |
| 774 | Ga0495674_0008146 | 3300047319 | Bacteria | 9996 |
| 775 | Ga0495674_0142410 | 3300047319 | Bacteria | 2015 |
| 776 | Ga0495672_0000087 | 3300047320 | Bacteria | 154275 |
| 777 | Ga0495680_0001270 | 3300047322 | Bacteria | 27523 |
| 778 | Ga0495680_0004117 | 3300047322 | Bacteria | 13982 |
| 779 | Ga0495680_0014929 | 3300047322 | Bacteria | 6713 |
| 780 | Ga0495675_0000121 | 3300047444 | Bacteria | 56852 |
| 781 | Ga0495675_0010587 | 3300047444 | Bacteria | 5764 |
| 782 | Ga0495675_0068687 | 3300047444 | Bacteria | 2238 |
| 783 | Ga0495684_0002904 | 3300047471 | Bacteria | 13490 |
| 784 | Ga0495684_0004922 | 3300047471 | Bacteria | 10428 |
| 785 | Ga0495684_0005046 | 3300047471 | Bacteria | 10306 |
| 786 | Ga0495684_0007540 | 3300047471 | Bacteria | 8420 |
| 787 | Ga0495684_0036199 | 3300047471 | Bacteria | 3785 |
| 788 | Ga0495686_0004003 | 3300047472 | Bacteria | 12335 |
| 789 | Ga0495686_0021929 | 3300047472 | Bacteria | 4231 |
| 790 | Ga0495593_0020029 | 3300047673 | Bacteria | 3746 |
| 791 | Ga0495602_0002431 | 3300048088 | Bacteria | 18968 |
| 792 | Ga0496100_0034593 | 3300048903 | Bacteria | 3172 |
| 793 | Ga0496101_0022322 | 3300048904 | Bacteria | 4355 |
| 794 | Ga0496101_0061834 | 3300048904 | Bacteria | 2721 |
| 795 | Ga0496104_0013018 | 3300048907 | Bacteria | 7491 |
| 796 | Ga0496104_0013159 | 3300048907 | Bacteria | 7459 |
| 797 | Ga0496105_0058392 | 3300048908 | Bacteria | 3185 |
| 798 | Ga0496106_0265147 | 3300048909 | Bacteria | 1375 |
| 799 | Ga0496107_0196288 | 3300048910 | Bacteria | 1500 |
| 800 | Ga0496108_0119623 | 3300048911 | Bacteria | 2258 |
| 801 | Ga0496108_0703611 | 3300048911 | Bacteria | 876 |
| 802 | Ga0496109_0083637 | 3300048912 | Bacteria | 2943 |
| 803 | Ga0496109_0193734 | 3300048912 | Bacteria | 1910 |
| 804 | Ga0496110_0144262 | 3300048913 | Bacteria | 2153 |
| 805 | Ga0496112_0046779 | 3300048915 | Bacteria | 4245 |
| 806 | Ga0496112_0204691 | 3300048915 | Bacteria | 1932 |
| 807 | Ga0496112_0224091 | 3300048915 | Bacteria | 1836 |
| 808 | Ga0496113_0013073 | 3300048916 | Bacteria | 5605 |
| 809 | Ga0496113_0046259 | 3300048916 | Bacteria | 3230 |
| 810 | Ga0496114_0011751 | 3300048917 | Bacteria | 7004 |
| 811 | Ga0496114_0075849 | 3300048917 | Bacteria | 2832 |
| 812 | Ga0496114_0132116 | 3300048917 | Bacteria | 2156 |
| 813 | Ga0496114_0203032 | 3300048917 | Bacteria | 1736 |
| 814 | Ga0496115_0000116 | 3300048918 | Bacteria | 73024 |
| 815 | Ga0496115_0000233 | 3300048918 | Bacteria | 50408 |
| 816 | Ga0496115_0000293 | 3300048918 | Bacteria | 43225 |
| 817 | Ga0496115_0007196 | 3300048918 | Bacteria | 8175 |
| 818 | Ga0496115_0231491 | 3300048918 | Bacteria | 1523 |
| 819 | Ga0496115_0351060 | 3300048918 | Bacteria | 1203 |
| 820 | Ga0496116_0002572 | 3300048919 | Bacteria | 18929 |
| 821 | Ga0496116_0013614 | 3300048919 | Bacteria | 6541 |
| 822 | Ga0496116_0014949 | 3300048919 | Bacteria | 6160 |
| 823 | Ga0496116_0041201 | 3300048919 | Bacteria | 3171 |
| 824 | Ga0496117_0003980 | 3300048920 | Bacteria | 16691 |
| 825 | Ga0496117_0008136 | 3300048920 | Bacteria | 10024 |
| 826 | Ga0496117_0013164 | 3300048920 | Bacteria | 7236 |
| 827 | Ga0496117_0069791 | 3300048920 | Bacteria | 2364 |
| 828 | Ga0496118_0000260 | 3300048921 | Bacteria | 92249 |
| 829 | Ga0496118_0000953 | 3300048921 | Bacteria | 45266 |
| 830 | Ga0496118_0006046 | 3300048921 | Bacteria | 13482 |
| 831 | Ga0496118_0007889 | 3300048921 | Bacteria | 11154 |
| 832 | Ga0496118_0008964 | 3300048921 | Bacteria | 10208 |
| 833 | Ga0496118_0015832 | 3300048921 | Bacteria | 6955 |
| 834 | Ga0496118_0023738 | 3300048921 | Bacteria | 5315 |
| 835 | Ga0496118_0058708 | 3300048921 | Bacteria | 2872 |
| 836 | Ga0496118_0088913 | 3300048921 | Bacteria | 2134 |
| 837 | Ga0496118_0110485 | 3300048921 | Bacteria | 1826 |
| 838 | Ga0496118_0239116 | 3300048921 | Bacteria | 1041 |
| 839 | Ga0496119_0000048 | 3300048922 | Bacteria | 185846 |
| 840 | Ga0496119_0000711 | 3300048922 | Bacteria | 44692 |
| 841 | Ga0496119_0004893 | 3300048922 | Bacteria | 13104 |
| 842 | Ga0496119_0023171 | 3300048922 | Bacteria | 4416 |
| 843 | Ga0496119_0034191 | 3300048922 | Bacteria | 3354 |
| 844 | Ga0496119_0046818 | 3300048922 | Bacteria | 2696 |
| 845 | Ga0496120_0000113 | 3300048923 | Bacteria | 136672 |
| 846 | Ga0496120_0000519 | 3300048923 | Bacteria | 59691 |
| 847 | Ga0496120_0000727 | 3300048923 | Bacteria | 48259 |
| 848 | Ga0496121_0000013 | 3300048924 | Bacteria | 614976 |
| 849 | Ga0496121_0004863 | 3300048924 | Bacteria | 17653 |
| 850 | Ga0496121_0005121 | 3300048924 | Bacteria | 17074 |
| 851 | Ga0496121_0042740 | 3300048924 | Bacteria | 3937 |
| 852 | Ga0496121_0043735 | 3300048924 | Bacteria | 3874 |
| 853 | Ga0496122_0001140 | 3300048925 | Bacteria | 45568 |
| 854 | Ga0496122_0014529 | 3300048925 | Bacteria | 7601 |
| 855 | Ga0496122_0126649 | 3300048925 | Bacteria | 1633 |
| 856 | Ga0496122_0192224 | 3300048925 | Bacteria | 1203 |
| 857 | Ga0496123_0000942 | 3300048926 | Bacteria | 45419 |
| 858 | Ga0496123_0056542 | 3300048926 | Bacteria | 2563 |
| 859 | Ga0496124_0001552 | 3300048927 | Bacteria | 33193 |
| 860 | Ga0496124_0003834 | 3300048927 | Bacteria | 18012 |
| 861 | Ga0496124_0027671 | 3300048927 | Bacteria | 5083 |
| 862 | Ga0496124_0089185 | 3300048927 | Bacteria | 2518 |
| 863 | Ga0496124_0106341 | 3300048927 | Bacteria | 2265 |
| 864 | Ga0496125_0000722 | 3300048928 | Bacteria | 54697 |
| 865 | Ga0496125_0013105 | 3300048928 | Bacteria | 8174 |
| 866 | Ga0496125_0018451 | 3300048928 | Bacteria | 6625 |
| 867 | Ga0496125_0035604 | 3300048928 | Bacteria | 4362 |
| 868 | Ga0496126_0000057 | 3300048929 | Bacteria | 276781 |
| 869 | Ga0496126_0000320 | 3300048929 | Bacteria | 102586 |
| 870 | Ga0496126_0003861 | 3300048929 | Bacteria | 18507 |
| 871 | Ga0496126_0015014 | 3300048929 | Bacteria | 7808 |
| 872 | Ga0496126_0016096 | 3300048929 | Bacteria | 7495 |
| 873 | Ga0496126_0023194 | 3300048929 | Bacteria | 6016 |
| 874 | Ga0496126_0023341 | 3300048929 | Bacteria | 5995 |
| 875 | Ga0501031_0001796 | 3300049568 | Bacteria | 13467 |
| 876 | Ga0501031_0014464 | 3300049568 | Bacteria | 5128 |
| 877 | Ga0501032_0007207 | 3300049569 | Bacteria | 8134 |
| 878 | Ga0501032_0010231 | 3300049569 | Bacteria | 6768 |
| 879 | Ga0501032_0044695 | 3300049569 | Bacteria | 2997 |
| 880 | Ga0501033_0000086 | 3300049570 | Bacteria | 88255 |
| 881 | Ga0501033_0006023 | 3300049570 | Bacteria | 9512 |
| 882 | Ga0501033_0024833 | 3300049570 | Bacteria | 4520 |
| 883 | Ga0501033_0030820 | 3300049570 | Bacteria | 4031 |
| 884 | Ga0501033_0036085 | 3300049570 | Bacteria | 3705 |
| 885 | Ga0501033_0060447 | 3300049570 | Bacteria | 2795 |
| 886 | Ga0501033_0063173 | 3300049570 | Bacteria | 2726 |
| 887 | Ga0501034_0093322 | 3300049571 | Bacteria | 3006 |
| 888 | Ga0501034_0200942 | 3300049571 | Bacteria | 1951 |
| 889 | Ga0501036_0003611 | 3300049572 | Bacteria | 12365 |
| 890 | Ga0501036_0011588 | 3300049572 | Bacteria | 7304 |
| 891 | Ga0501036_0018586 | 3300049572 | Bacteria | 5827 |
| 892 | Ga0501036_0025725 | 3300049572 | Bacteria | 4967 |
| 893 | Ga0501036_0152836 | 3300049572 | Bacteria | 1947 |
| 894 | Ga0501036_0350644 | 3300049572 | Bacteria | 1232 |
| 895 | Ga0501037_0041500 | 3300049573 | Bacteria | 3384 |
| 896 | Ga0501037_0086830 | 3300049573 | Bacteria | 2264 |
| 897 | Ga0501038_0011732 | 3300049574 | Bacteria | 7993 |
| 898 | Ga0501038_0016254 | 3300049574 | Bacteria | 6748 |
| 899 | Ga0501038_0022471 | 3300049574 | Bacteria | 5651 |
| 900 | Ga0501038_0061319 | 3300049574 | Bacteria | 3216 |
| 901 | Ga0501038_0109817 | 3300049574 | Bacteria | 2285 |
| 902 | Ga0501038_0172902 | 3300049574 | Bacteria | 1747 |
| 903 | Ga0501039_0007126 | 3300049575 | Bacteria | 8519 |
| 904 | Ga0501039_0010959 | 3300049575 | Bacteria | 6909 |
| 905 | Ga0501039_0013495 | 3300049575 | Bacteria | 6247 |
| 906 | Ga0501039_0045023 | 3300049575 | Bacteria | 3408 |
| 907 | Ga0501040_0004213 | 3300049576 | Bacteria | 9362 |
| 908 | Ga0501040_0017688 | 3300049576 | Bacteria | 4731 |
| 909 | Ga0501041_0003615 | 3300049577 | Bacteria | 8891 |
| 910 | Ga0501042_0001952 | 3300049578 | Bacteria | 12421 |
| 911 | Ga0501042_0002596 | 3300049578 | Bacteria | 11110 |
| 912 | Ga0501042_0364241 | 3300049578 | Bacteria | 1046 |
| 913 | Ga0501043_0005825 | 3300049579 | Bacteria | 9912 |
| 914 | Ga0501043_0045918 | 3300049579 | Bacteria | 3434 |
| 915 | Ga0501043_0111954 | 3300049579 | Bacteria | 2143 |
| 916 | Ga0501046_0001919 | 3300049580 | Bacteria | 19740 |
| 917 | Ga0501046_0007819 | 3300049580 | Bacteria | 9381 |
| 918 | Ga0501047_0011238 | 3300049581 | Bacteria | 8473 |
| 919 | Ga0501047_0011692 | 3300049581 | Bacteria | 8299 |
| 920 | Ga0501047_0466423 | 3300049581 | Bacteria | 1091 |
| 921 | Ga0501048_0137342 | 3300049582 | Bacteria | 1728 |
| 922 | Ga0501048_0209232 | 3300049582 | Bacteria | 1383 |
| 923 | Ga0501068_0001687 | 3300049584 | Bacteria | 11780 |
| 924 | Ga0501068_0019942 | 3300049584 | Bacteria | 3901 |
| 925 | Ga0501069_0004963 | 3300049585 | Bacteria | 6903 |
| 926 | Ga0501070_0000269 | 3300049586 | Bacteria | 49060 |
| 927 | Ga0501070_0170031 | 3300049586 | Bacteria | 1795 |
| 928 | Ga0501070_0267493 | 3300049586 | Bacteria | 1397 |
| 929 | Ga0501070_0397768 | 3300049586 | Bacteria | 1114 |
| 930 | Ga0501072_0019466 | 3300049588 | Bacteria | 5248 |
| 931 | Ga0501072_0223635 | 3300049588 | Bacteria | 1500 |
| 932 | Ga0501073_0000408 | 3300049589 | Bacteria | 29377 |
| 933 | Ga0501073_0080842 | 3300049589 | Bacteria | 2261 |
| 934 | Ga0501074_0011170 | 3300049590 | Bacteria | 6523 |
| 935 | Ga0501074_0056693 | 3300049590 | Bacteria | 2824 |
| 936 | Ga0501075_0158630 | 3300049591 | Bacteria | 1726 |
| 937 | Ga0501076_0001011 | 3300049592 | Bacteria | 18469 |
| 938 | Ga0501076_0007819 | 3300049592 | Bacteria | 7792 |
| 939 | Ga0501076_0122416 | 3300049592 | Bacteria | 2106 |
| 940 | Ga0501077_0004162 | 3300049593 | Bacteria | 8740 |
| 941 | Ga0501077_0011204 | 3300049593 | Bacteria | 5594 |
| 942 | Ga0501077_0020571 | 3300049593 | Bacteria | 4178 |
| 943 | Ga0501079_0012719 | 3300049741 | Bacteria | 6429 |
| 944 | Ga0501079_0234515 | 3300049741 | Bacteria | 1434 |
| 945 | Ga0501079_0251816 | 3300049741 | Bacteria | 1380 |
| 946 | Ga0501080_0030603 | 3300049742 | Bacteria | 5016 |
| 947 | Ga0501080_0533340 | 3300049742 | Bacteria | 1046 |
| 948 | Ga0501081_0002043 | 3300049743 | Bacteria | 12580 |
| 949 | Ga0501081_0128766 | 3300049743 | Bacteria | 1807 |
| 950 | Ga0501083_0000990 | 3300049744 | Bacteria | 18870 |
| 951 | Ga0501035_0008776 | 3300049822 | Bacteria | 9410 |
| 952 | Ga0501035_0020150 | 3300049822 | Bacteria | 6124 |
| 953 | Ga0501035_0029675 | 3300049822 | Bacteria | 4987 |
| 954 | Ga0501035_0072308 | 3300049822 | Bacteria | 3052 |
| 955 | Ga0501035_0277633 | 3300049822 | Bacteria | 1417 |
| 956 | Ga0501044_0000749 | 3300049823 | Bacteria | 39273 |
| 957 | Ga0501044_0002590 | 3300049823 | Bacteria | 20558 |
| 958 | Ga0501044_0013084 | 3300049823 | Bacteria | 8981 |
| 959 | Ga0501044_0039363 | 3300049823 | Bacteria | 4933 |
| 960 | Ga0501044_0358588 | 3300049823 | Bacteria | 1376 |
| 961 | Ga0501044_0432093 | 3300049823 | Bacteria | 1226 |
| 962 | Ga0501044_0481197 | 3300049823 | Bacteria | 1144 |
| 963 | Ga0501044_0622771 | 3300049823 | Bacteria | 970 |
| 964 | Ga0501045_0005098 | 3300049824 | Bacteria | 9093 |
| 965 | Ga0501045_0010906 | 3300049824 | Bacteria | 6364 |
| 966 | nmdc:mga05p37_22411_c1 | 3300050507 | Bacteria | 7662 |
| 967 | nmdc:mga05p37_470558_c1 | 3300050507 | Bacteria | 1450 |
| 968 | nmdc:mga09592_1422_c1 | 3300050508 | Bacteria | 19206 |
| 969 | nmdc:mga09592_170495_c1 | 3300050508 | Bacteria | 1882 |
| 970 | nmdc:mga0qj67_25287_c1 | 3300050509 | Bacteria | 4586 |
| 971 | nmdc:mga0qj67_338480_c1 | 3300050509 | Bacteria | 1217 |
| 972 | nmdc:mga06r32_20879_c1 | 3300050510 | Bacteria | 6037 |
| 973 | nmdc:mga06r32_247156_c1 | 3300050510 | Bacteria | 1771 |
| 974 | nmdc:mga08y16_123927_c1 | 3300050511 | Bacteria | 2689 |
| 975 | nmdc:mga08y16_1627_c1 | 3300050511 | Bacteria | 22743 |
| 976 | nmdc:mga0n895_30080_c1 | 3300050512 | Bacteria | 5186 |
| 977 | nmdc:mga0a205_113774_c1 | 3300050515 | Bacteria | 2605 |
| 978 | Ga0495619_0040301 | 3300053085 | Bacteria | 3053 |
| 979 | Ga0500651_0047289 | 3300053093 | Bacteria | 2705 |
| 980 | Ga0500595_000162 | 3300053119 | Bacteria | 44030 |
| 981 | Ga0500568_0000316 | 3300053139 | Bacteria | 38483 |
| 982 | Ga0500573_0000049 | 3300053140 | Bacteria | 96218 |
| 983 | Ga0500590_000735 | 3300053148 | Bacteria | 11952 |
| 984 | Ga0500634_0000377 | 3300053161 | Bacteria | 14223 |
| 985 | Ga0501084_0020970 | 3300054114 | Bacteria | 5449 |
| 986 | Ga0501082_0027265 | 3300060353 | Bacteria | 4919 |
| 987 | Ga0501082_0334484 | 3300060353 | Bacteria | 1319 |
| 988 | Ga0530510_0002588 | 3300061734 | Bacteria | 12423 |
| 989 | Ga0530510_0004408 | 3300061734 | Bacteria | 9747 |
| 990 | 2538835230 | 2537561836 | Bacteria | 3910579 |
| 991 | 2547503584 | 2547132130 | Bacteria | 4660562 |
| 992 | 2578456972 | 2576861471 | Bacteria | 4648976 |
| 993 | 2643828613 | 2643221562 | Bacteria | 4048635 |
| 994 | 2643896244 | 2643221577 | Bacteria | 3710843 |
| 995 | 2643909325 | 2643221579 | Bacteria | 4443405 |
| 996 | 2643914826 | 2643221581 | Bacteria | 3893603 |
| 997 | 2643973271 | 2643221593 | Bacteria | 6296053 |
| 998 | 2644181827 | 2643221632 | Bacteria | 3406696 |
| 999 | 2644478458 | 2643221685 | Bacteria | 3673288 |
| 1000 | 2687582201 | 2687453130 | Bacteria | 4227172 |
| 1001 | 2747949938 | 2747842428 | Bacteria | 4689383 |
| 1002 | 2748019670 | 2747842501 | Bacteria | 5293829 |
| 1003 | 2765580534 | 2765235840 | Bacteria | 4663337 |
| 1004 | 2816518442 | 2816332141 | Bacteria | 4436036 |
| 1005 | 2842394449 | 2842391507 | Bacteria | 4486072 |
| 1006 | 2844844335 | 2844841374 | Bacteria | 3917147 |
| 1007 | 2844853635 | 2844852863 | Bacteria | 3849151 |
| 1008 | 2852652124 | 2852649853 | Bacteria | 4036942 |
| 1009 | 2852687184 | 2852684882 | Bacteria | 5463342 |
| 1010 | 2857446854 | 2857442823 | Bacteria | 4562550 |
| 1011 | 2874223197 | 2874220319 | Bacteria | 4594709 |
| 1012 | 2884414161 | 2884411467 | Bacteria | 5246714 |
| 1013 | 2895397974 | 2895395659 | Bacteria | 3983269 |
| 1014 | 2919056285 | 2919055335 | Bacteria | 3875751 |
| 1015 | 2919093232 | 2919089067 | Bacteria | 4560942 |
| 1016 | 2919131059 | 2919130084 | Bacteria | 5301837 |
| 1017 | 2919138747 | 2919134579 | Bacteria | 4480386 |
| 1018 | 2919526287 | 2919523602 | Bacteria | 3788128 |
| 1019 | 2923517265 | 2923516293 | Bacteria | 3716336 |
| 1020 | 2928154418 | 2928153084 | Bacteria | 4020257 |
| 1021 | 2928499863 | 2928496128 | Bacteria | 4631123 |
| 1022 | 2928963689 | 2928963466 | Bacteria | 5165703 |
| 1023 | 2929196299 | 2929195423 | Bacteria | 5325372 |
| 1024 | 2931383366 | 2931380184 | Bacteria | 4455911 |
| 1025 | 2937614339 | 2937610967 | Bacteria | 4618818 |
| 1026 | 2939589835 | 2939589442 | Bacteria | 4214238 |
| 1027 | 2939613570 | 2939611941 | Bacteria | 3892017 |
| 1028 | 2939630929 | 2939626828 | Bacteria | 4695272 |
| 1029 | 2941478747 | 2941475908 | Bacteria | 4145589 |
| 1030 | 2941492614 | 2941489479 | Bacteria | 6313767 |
| 1031 | 2952255999 | 2952252522 | Bacteria | 4171745 |
| 1032 | 2961049961 | 2961047084 | Bacteria | 4594415 |
| 1033 | 2961064876 | 2961064222 | Bacteria | 4749990 |
| 1034 | 2974307620 | 2974307012 | Bacteria | 4172388 |
| 1035 | 2977248331 | 2977247770 | Bacteria | 4160543 |
| 1036 | 2984517176 | 2984514374 | Bacteria | 4172479 |
| 1037 | 2987608822 | 2987605356 | Bacteria | 4187822 |
| 1038 | 2995949724 | 2995948881 | Bacteria | 6358104 |
| 1039 | 3003003577 | 3002998708 | Bacteria | 11715108 |
| 1040 | 8021625567 | 8021622325 | Bacteria | 4844743 |
| 1041 | 8021630554 | 8021626552 | Bacteria | 4665214 |
| 1042 | 8021649736 | 8021648035 | Bacteria | 4772378 |
| 1043 | 8053951975 | 8053945823 | Bacteria | 8962862 |
| 1044 | 8056040431 | 8056037122 | Bacteria | 3854319 |
| 1045 | Ga0501080_0012126 | |||
| 1046 | JGI24740J21852_10000230 | |||
| 1047 | JGI24739J22299_10055207 | |||
| 1048 | JGI24737J22298_10002869 | |||
| 1049 | JGI24737J22298_10016551 | |||
| 1050 | JGI24735J21928_10000213 | |||
| 1051 | JGI25156J39149_1006824 | |||
| 1052 | JGI25162J39368_1000653 | |||
| 1053 | JGI25162J39368_1001259 | |||
| 1054 | JGI25162J39368_1001943 | |||
| 1055 | JGI25162J39368_1005494 | |||
| 1056 | JGI25157J39369_1002739 | |||
| 1057 | JGI25157J39369_1003624 | |||
| 1058 | JGI25164J39214_1000473 | |||
| 1059 | JGI25164J39214_1000490 | |||
| 1060 | JGI25152J39213_1000103 | |||
| 1061 | JGI25150J39212_1000183 | |||
| 1062 | JGI25151J46595_10000187 | |||
| 1063 | JGI25151J46595_10000271 | |||
| 1064 | JGI25406J46586_10015012 | |||
| 1065 | JGI25165J46597_1000625 | |||
| 1066 | JGI25153J46596_10000190 | |||
| 1067 | Ga0006562J51391_1007922 | |||
| 1068 | Ga0006562J51391_1007923 | |||
| 1069 | Ga0055539_1000014 | |||
| 1070 | Ga0055533_1000002 | |||
| 1071 | Ga0055533_1000962 | |||
| 1072 | Ga0055525_1005588 | |||
| 1073 | Ga0055542_1000010 | |||
| 1074 | Ga0055529_1001798 | |||
| 1075 | Ga0055526_1000005 | |||
| 1076 | Ga0055537_1000042 | |||
| 1077 | Ga0055537_1001615 | |||
| 1078 | Ga0055524_1000005 | |||
| 1079 | Ga0055536_1000773 | |||
| 1080 | Ga0055534_1000002 | |||
| 1081 | Ga0055528_1000002 | |||
| 1082 | Ga0055530_10002647 | |||
| 1083 | Ga0055541_1000497 | |||
| 1084 | Ga0058692_1000053 | |||
| 1085 | Ga0058692_1000065 | |||
| 1086 | Ga0058862_12823758 | |||
| 1087 | Ga0065714_10088992 | |||
| 1088 | Ga0065715_10005079 | |||
| 1089 | Ga0065707_10092011 | |||
| 1090 | Ga0070658_10000065 | |||
| 1091 | Ga0070658_10016063 | |||
| 1092 | Ga0070658_10122941 | |||
| 1093 | Ga0070658_10136650 | |||
| 1094 | Ga0070676_10002175 | |||
| 1095 | Ga0070676_10004260 | |||
| 1096 | Ga0070683_100058119 | |||
| 1097 | Ga0070683_100102372 | |||
| 1098 | Ga0070670_100086016 | |||
| 1099 | Ga0070670_100120801 | |||
| 1100 | Ga0070670_100295628 | |||
| 1101 | Ga0068869_100000848 | |||
| 1102 | Ga0068869_100005518 | |||
| 1103 | Ga0068869_100178597 | |||
| 1104 | Ga0070680_100000138 | |||
| 1105 | Ga0070680_100019130 | |||
| 1106 | Ga0070680_100026845 | |||
| 1107 | Ga0070680_100065060 | |||
| 1108 | Ga0070680_100249030 | |||
| 1109 | Ga0070682_100004912 | |||
| 1110 | Ga0070682_100013413 | |||
| 1111 | Ga0070682_100183929 | |||
| 1112 | Ga0068868_100000154 | |||
| 1113 | Ga0068868_100169688 | |||
| 1114 | Ga0070660_100355517 | |||
| 1115 | Ga0070689_100006130 | |||
| 1116 | Ga0070691_10000204 | |||
| 1117 | Ga0070691_10047295 | |||
| 1118 | Ga0070687_100001734 | |||
| 1119 | Ga0070687_100100108 | |||
| 1120 | Ga0070661_100014313 | |||
| 1121 | Ga0070661_100019362 | |||
| 1122 | Ga0070661_100022768 | |||
| 1123 | Ga0070661_100137945 | |||
| 1124 | Ga0070661_100221607 | |||
| 1125 | Ga0070661_100505846 | |||
| 1126 | Ga0070692_10000826 | |||
| 1127 | Ga0070692_10001376 | |||
| 1128 | Ga0070692_10024606 | |||
| 1129 | Ga0070668_100002627 | |||
| 1130 | Ga0070668_100005675 | |||
| 1131 | Ga0070668_100297144 | |||
| 1132 | Ga0070669_100016734 | |||
| 1133 | Ga0070669_100021816 | |||
| 1134 | Ga0070675_100025078 | |||
| 1135 | Ga0070675_100051402 | |||
| 1136 | Ga0070671_100020254 | |||
| 1137 | Ga0070673_100000023 | |||
| 1138 | Ga0070688_100015057 | |||
| 1139 | Ga0070688_100213269 | |||
| 1140 | Ga0070659_100004369 | |||
| 1141 | Ga0070659_100005005 | |||
| 1142 | Ga0070659_100014512 | |||
| 1143 | Ga0070667_100023098 | |||
| 1144 | Ga0070667_100059611 | |||
| 1145 | Ga0070667_100273171 | |||
| 1146 | Ga0070714_100000007 | |||
| 1147 | Ga0070714_100000025 | |||
| 1148 | Ga0070714_100002188 | |||
| 1149 | Ga0070714_100179606 | |||
| 1150 | Ga0070714_100234025 | |||
| 1151 | Ga0070713_100003658 | |||
| 1152 | Ga0070711_100203553 | |||
| 1153 | Ga0070705_100176800 | |||
| 1154 | Ga0070700_100000015 | |||
| 1155 | Ga0070700_100022316 | |||
| 1156 | Ga0070708_100005216 | |||
| 1157 | Ga0070708_100382634 | |||
| 1158 | Ga0070663_100001998 | |||
| 1159 | Ga0070663_100003552 | |||
| 1160 | Ga0070663_100011137 | |||
| 1161 | Ga0070663_100030594 | |||
| 1162 | Ga0070663_100174476 | |||
| 1163 | Ga0070663_100181951 | |||
| 1164 | Ga0070678_100015225 | |||
| 1165 | Ga0070678_100040799 | |||
| 1166 | Ga0070662_100007688 | |||
| 1167 | Ga0070662_100055165 | |||
| 1168 | Ga0070662_100095797 | |||
| 1169 | Ga0070662_100105335 | |||
| 1170 | Ga0070662_100356393 | |||
| 1171 | Ga0070681_10000076 | |||
| 1172 | Ga0070681_10001058 | |||
| 1173 | Ga0070681_10005260 | |||
| 1174 | Ga0070681_10012818 | |||
| 1175 | Ga0070681_10051976 | |||
| 1176 | Ga0070681_10097017 | |||
| 1177 | Ga0070681_10231243 | |||
| 1178 | Ga0068867_100000007 | |||
| 1179 | Ga0068867_100299750 | |||
| 1180 | Ga0070685_10053205 | |||
| 1181 | Ga0070706_100017183 | |||
| 1182 | Ga0070706_100075262 | |||
| 1183 | Ga0070698_100025964 | |||
| 1184 | Ga0070679_100000504 | |||
| 1185 | Ga0070679_100005669 | |||
| 1186 | Ga0070679_100094827 | |||
| 1187 | Ga0070679_100229808 | |||
| 1188 | Ga0070679_100245203 | |||
| 1189 | Ga0070684_100142709 | |||
| 1190 | Ga0070684_100431134 | |||
| 1191 | Ga0070684_100608218 | |||
| 1192 | Ga0070697_100053485 | |||
| 1193 | Ga0070697_100147487 | |||
| 1194 | Ga0068853_100025947 | |||
| 1195 | Ga0068853_100026580 | |||
| 1196 | Ga0068853_100087550 | |||
| 1197 | Ga0068853_100195851 | |||
| 1198 | Ga0068853_100241865 | |||
| 1199 | Ga0068853_100295727 | |||
| 1200 | Ga0070672_100003161 | |||
| 1201 | Ga0070672_100021437 | |||
| 1202 | Ga0070686_100193262 | |||
| 1203 | Ga0070696_100003079 | |||
| 1204 | Ga0070696_100015403 | |||
| 1205 | Ga0070696_100027962 | |||
| 1206 | Ga0070693_100014051 | |||
| 1207 | Ga0070665_100000465 | |||
| 1208 | Ga0070665_100237824 | |||
| 1209 | Ga0070665_100503266 | |||
| 1210 | Ga0070704_100071046 | |||
| 1211 | Ga0068855_100000897 | |||
| 1212 | Ga0068855_100034494 | |||
| 1213 | Ga0068855_100059757 | |||
| 1214 | Ga0068855_100167742 | |||
| 1215 | Ga0068855_100192031 | |||
| 1216 | Ga0068855_100593199 | |||
| 1217 | Ga0068857_100014249 | |||
| 1218 | Ga0068857_100019539 | |||
| 1219 | Ga0068857_100082251 | |||
| 1220 | Ga0068857_100120614 | |||
| 1221 | Ga0068857_100150476 | |||
| 1222 | Ga0068854_100000027 | |||
| 1223 | Ga0068854_100000142 | |||
| 1224 | Ga0068854_100063019 | |||
| 1225 | Ga0068854_100368849 | |||
| 1226 | Ga0068856_100000462 | |||
| 1227 | Ga0068856_100004819 | |||
| 1228 | Ga0068856_100025070 | |||
| 1229 | Ga0068856_100336574 | |||
| 1230 | Ga0068852_100112354 | |||
| 1231 | Ga0068866_10036810 | |||
| 1232 | Ga0068861_100004360 | |||
| 1233 | Ga0068851_10026102 | |||
| 1234 | Ga0068863_100038707 | |||
| 1235 | Ga0068858_100013390 | |||
| 1236 | Ga0068858_100098118 | |||
| 1237 | Ga0068858_100128673 | |||
| 1238 | Ga0068860_100041224 | |||
| 1239 | Ga0068860_100061738 | |||
| 1240 | Ga0068860_100101230 | |||
| 1241 | Ga0068862_100070914 | |||
| 1242 | Ga0081539_10000105 | |||
| 1243 | Ga0081539_10083936 | |||
| 1244 | Ga0075364_10061999 | |||
| 1245 | Ga0070712_100056201 | |||
| 1246 | Ga0070712_100218002 | |||
| 1247 | Ga0097621_100002061 | |||
| 1248 | Ga0068871_100002074 | |||
| 1249 | Ga0068871_100137854 | |||
| 1250 | Ga0075428_100002309 | |||
| 1251 | Ga0075428_100008733 | |||
| 1252 | Ga0075428_100415922 | |||
| 1253 | Ga0075428_100713931 | |||
| 1254 | Ga0075430_100065318 | |||
| 1255 | Ga0075431_100013904 | |||
| 1256 | Ga0075433_10039496 | |||
| 1257 | Ga0075434_100007756 | |||
| 1258 | Ga0075434_100048328 | |||
| 1259 | Ga0075429_100055515 | |||
| 1260 | Ga0068865_100000010 | |||
| 1261 | Ga0068865_100007765 | |||
| 1262 | Ga0068865_100122851 | |||
| 1263 | Ga0099795_10004112 | |||
| 1264 | Ga0105240_10000049 | |||
| 1265 | Ga0105240_10000113 | |||
| 1266 | Ga0105240_10002816 | |||
| 1267 | Ga0105240_10069114 | |||
| 1268 | Ga0105240_10081693 | |||
| 1269 | Ga0105240_10228162 | |||
| 1270 | Ga0105240_10680974 | |||
| 1271 | Ga0111539_10043138 | |||
| 1272 | Ga0111539_10049401 | |||
| 1273 | Ga0111539_10063244 | |||
| 1274 | Ga0111539_10565172 | |||
| 1275 | Ga0105245_10001804 | |||
| 1276 | Ga0105245_10056362 | |||
| 1277 | Ga0105245_10062002 | |||
| 1278 | Ga0114129_10001539 | |||
| 1279 | Ga0114129_10014853 | |||
| 1280 | Ga0114129_10148798 | |||
| 1281 | Ga0105243_10000950 | |||
| 1282 | Ga0105243_10004757 | |||
| 1283 | Ga0105243_10008647 | |||
| 1284 | Ga0105243_10011470 | |||
| 1285 | Ga0105243_10014541 | |||
| 1286 | Ga0105241_10011546 | |||
| 1287 | Ga0105241_10012868 | |||
| 1288 | Ga0105241_10013711 | |||
| 1289 | Ga0105241_10282502 | |||
| 1290 | Ga0105242_10000210 | |||
| 1291 | Ga0105242_10007241 | |||
| 1292 | Ga0105248_10057736 | |||
| 1293 | Ga0105248_10262904 | |||
| 1294 | Ga0105237_10000230 | |||
| 1295 | Ga0105237_10284515 | |||
| 1296 | Ga0105237_10362694 | |||
| 1297 | Ga0105238_10002948 | |||
| 1298 | Ga0105238_10041071 | |||
| 1299 | Ga0105238_10073696 | |||
| 1300 | Ga0105238_10143947 | |||
| 1301 | Ga0105238_10543702 | |||
| 1302 | Ga0105249_10000195 | |||
| 1303 | Ga0105249_10007619 | |||
| 1304 | Ga0105249_10017303 | |||
| 1305 | Ga0105249_10030480 | |||
| 1306 | Ga0105249_10135624 | |||
| 1307 | Ga0105249_10294373 | |||
| 1308 | Ga0105032_101587 | |||
| 1309 | Ga0105028_101804 | |||
| 1310 | Ga0105239_10000034 | |||
| 1311 | Ga0105239_10004123 | |||
| 1312 | Ga0105239_10095696 | |||
| 1313 | Ga0105239_10299995 | |||
| 1314 | Ga0105239_10319165 | |||
| 1315 | Ga0105239_10485188 | |||
| 1316 | Ga0157373_10098054 | |||
| 1317 | Ga0157371_10000397 | |||
| 1318 | Ga0157371_10019340 | |||
| 1319 | Ga0157371_10070140 | |||
| 1320 | Ga0157371_10080697 | |||
| 1321 | Ga0157371_10182732 | |||
| 1322 | Ga0157371_10236816 | |||
| 1323 | Ga0157370_10010248 | |||
| 1324 | Ga0157370_10024020 | |||
| 1325 | Ga0157370_10025407 | |||
| 1326 | Ga0157370_10035718 | |||
| 1327 | Ga0157370_10065485 | |||
| 1328 | Ga0157370_10082723 | |||
| 1329 | Ga0157370_10189137 | |||
| 1330 | Ga0157369_10030897 | |||
| 1331 | Ga0157369_10045576 | |||
| 1332 | Ga0157369_10054676 | |||
| 1333 | Ga0157369_10196583 | |||
| 1334 | Ga0157369_10219655 | |||
| 1335 | Ga0157369_10248017 | |||
| 1336 | Ga0157369_10301602 | |||
| 1337 | Ga0157374_10000830 | |||
| 1338 | Ga0157374_10002660 | |||
| 1339 | Ga0157374_10079124 | |||
| 1340 | Ga0157374_10265052 | |||
| 1341 | Ga0157378_10001477 | |||
| 1342 | Ga0157378_10013933 | |||
| 1343 | Ga0157378_10144915 | |||
| 1344 | Ga0157378_10562746 | |||
| 1345 | Ga0163162_10000015 | |||
| 1346 | Ga0163162_10009246 | |||
| 1347 | Ga0163162_10033700 | |||
| 1348 | Ga0163162_10072625 | |||
| 1349 | Ga0163162_10670611 | |||
| 1350 | Ga0157372_10000004 | |||
| 1351 | Ga0157372_10008269 | |||
| 1352 | Ga0157372_10022871 | |||
| 1353 | Ga0157372_10047515 | |||
| 1354 | Ga0157372_10070446 | |||
| 1355 | Ga0157372_10118468 | |||
| 1356 | Ga0157372_10122484 | |||
| 1357 | Ga0157375_10002120 | |||
| 1358 | Ga0157375_10156411 | |||
| 1359 | Ga0157375_10234511 | |||
| 1360 | Ga0157375_10389508 | |||
| 1361 | Ga0157375_10663712 | |||
| 1362 | Ga0163163_10000205 | |||
| 1363 | Ga0163163_10091541 | |||
| 1364 | Ga0157380_10033964 | |||
| 1365 | Ga0157380_10299929 | |||
| 1366 | Ga0182008_10048966 | |||
| 1367 | Ga0182008_10069164 | |||
| 1368 | Ga0157377_10014848 | |||
| 1369 | Ga0157379_10367839 | |||
| 1370 | Ga0157376_10000047 | |||
| 1371 | Ga0157376_10112995 | |||
| 1372 | Ga0157376_10261459 | |||
| 1373 | Ga0182006_1012948 | |||
| 1374 | Ga0182006_1030792 | |||
| 1375 | Ga0182006_1032508 | |||
| 1376 | Ga0182006_1033197 | |||
| 1377 | Ga0182007_10000079 | |||
| 1378 | Ga0182007_10003052 | |||
| 1379 | Ga0182005_1000166 | |||
| 1380 | Ga0182005_1048792 | |||
| 1381 | Ga0183368_1004 | |||
| 1382 | Ga0183360_10002 | |||
| 1383 | Ga0163161_10018593 | |||
| 1384 | Ga0163161_10039512 | |||
| 1385 | Ga0163161_10184246 | |||
| 1386 | Ga0197907_10031041 | |||
| 1387 | Ga0206356_11162436 | |||
| 1388 | Ga0206351_10270042 | |||
| 1389 | Ga0206352_10784584 | |||
| 1390 | Ga0206350_10514329 | |||
| 1391 | Ga0206354_10512197 | |||
| 1392 | Ga0206353_11363697 | |||
| 1393 | Ga0154015_1208151 | |||
| 1394 | Ga0154015_1499885 | |||
| 1395 | Ga0213876_10001632 | |||
| 1396 | Ga0213875_10049732 | |||
| 1397 | Ga0224712_10020806 | |||
| 1398 | Ga0224712_10028061 | |||
| 1399 | Ga0228598_1013405 | |||
| 1400 | Ga0209566_100056 | |||
| 1401 | Ga0209674_100001 | |||
| 1402 | Ga0209674_100063 | |||
| 1403 | Ga0209674_100836 | |||
| 1404 | Ga0209672_100509 | |||
| 1405 | Ga0209563_100001 | |||
| 1406 | Ga0207427_100132 | |||
| 1407 | Ga0207427_100322 | |||
| 1408 | Ga0207427_103057 | |||
| 1409 | Ga0209437_100005 | |||
| 1410 | Ga0209437_100118 | |||
| 1411 | Ga0209437_100233 | |||
| 1412 | Ga0209258_100935 | |||
| 1413 | Ga0209258_101545 | |||
| 1414 | Ga0207425_1000148 | |||
| 1415 | Ga0207425_1001805 | |||
| 1416 | Ga0209646_1004787 | |||
| 1417 | Ga0209026_1000010 | |||
| 1418 | Ga0209026_1000061 | |||
| 1419 | Ga0209677_100001 | |||
| 1420 | Ga0209148_1000005 | |||
| 1421 | Ga0209759_1003743 | |||
| 1422 | Ga0209129_1000239 | |||
| 1423 | Ga0209233_1000011 | |||
| 1424 | Ga0209233_1000046 | |||
| 1425 | Ga0209233_1011210 | |||
| 1426 | Ga0209233_1015398 | |||
| 1427 | Ga0209565_1000001 | |||
| 1428 | Ga0209455_1000111 | |||
| 1429 | Ga0209673_1000001 | |||
| 1430 | Ga0209675_1000001 | |||
| 1431 | Ga0209676_1000411 | |||
| 1432 | Ga0209025_1000006 | |||
| 1433 | Ga0209025_1000048 | |||
| 1434 | Ga0209564_1000001 | |||
| 1435 | Ga0209758_1000056 | |||
| 1436 | Ga0209758_1008030 | |||
| 1437 | Ga0209050_1000146 | |||
| 1438 | Ga0209256_1000006 | |||
| 1439 | Ga0209256_1003699 | |||
| 1440 | Ga0207656_10008749 | |||
| 1441 | Ga0207642_10161387 | |||
| 1442 | Ga0207688_10112355 | |||
| 1443 | Ga0207680_10047257 | |||
| 1444 | Ga0207680_10061889 | |||
| 1445 | Ga0207647_10001386 | |||
| 1446 | Ga0207647_10002100 | |||
| 1447 | Ga0207647_10003612 | |||
| 1448 | Ga0207647_10010284 | |||
| 1449 | Ga0207647_10026222 | |||
| 1450 | Ga0207647_10051240 | |||
| 1451 | Ga0207647_10054217 | |||
| 1452 | Ga0207645_10000737 | |||
| 1453 | Ga0207645_10009242 | |||
| 1454 | Ga0207705_10000001 | |||
| 1455 | Ga0207705_10000146 | |||
| 1456 | Ga0207705_10000373 | |||
| 1457 | Ga0207705_10000788 | |||
| 1458 | Ga0207705_10009432 | |||
| 1459 | Ga0207705_10059428 | |||
| 1460 | Ga0207705_10081047 | |||
| 1461 | Ga0207705_10257657 | |||
| 1462 | Ga0207684_10076825 | |||
| 1463 | Ga0207684_10321899 | |||
| 1464 | Ga0207654_10024425 | |||
| 1465 | Ga0207707_10000018 | |||
| 1466 | Ga0207707_10000036 | |||
| 1467 | Ga0207707_10000868 | |||
| 1468 | Ga0207707_10000944 | |||
| 1469 | Ga0207707_10009741 | |||
| 1470 | Ga0207707_10015309 | |||
| 1471 | Ga0207707_10017108 | |||
| 1472 | Ga0207707_10023133 | |||
| 1473 | Ga0207707_10027620 | |||
| 1474 | Ga0207707_10050186 | |||
| 1475 | Ga0207707_10127412 | |||
| 1476 | Ga0207695_10000007 | |||
| 1477 | Ga0207695_10000114 | |||
| 1478 | Ga0207695_10000816 | |||
| 1479 | Ga0207695_10001086 | |||
| 1480 | Ga0207695_10002626 | |||
| 1481 | Ga0207695_10027868 | |||
| 1482 | Ga0207695_10050538 | |||
| 1483 | Ga0207695_10053798 | |||
| 1484 | Ga0207695_10073182 | |||
| 1485 | Ga0207695_10115114 | |||
| 1486 | Ga0207695_10182106 | |||
| 1487 | Ga0207671_10000639 | |||
| 1488 | Ga0207671_10082200 | |||
| 1489 | Ga0207671_10321677 | |||
| 1490 | Ga0207660_10000389 | |||
| 1491 | Ga0207660_10009240 | |||
| 1492 | Ga0207660_10009433 | |||
| 1493 | Ga0207660_10009884 | |||
| 1494 | Ga0207660_10010720 | |||
| 1495 | Ga0207660_10015984 | |||
| 1496 | Ga0207660_10028000 | |||
| 1497 | Ga0207660_10048875 | |||
| 1498 | Ga0207660_10145550 | |||
| 1499 | Ga0207660_10237378 | |||
| 1500 | Ga0207662_10001726 | |||
| 1501 | Ga0207657_10022248 | |||
| 1502 | Ga0207649_10001271 | |||
| 1503 | Ga0207649_10019583 | |||
| 1504 | Ga0207649_10065234 | |||
| 1505 | Ga0207649_10150937 | |||
| 1506 | Ga0207652_10000409 | |||
| 1507 | Ga0207652_10004945 | |||
| 1508 | Ga0207652_10007521 | |||
| 1509 | Ga0207652_10038403 | |||
| 1510 | Ga0207652_10076977 | |||
| 1511 | Ga0207652_10212731 | |||
| 1512 | Ga0207646_10192292 | |||
| 1513 | Ga0207681_10027150 | |||
| 1514 | Ga0207694_10000930 | |||
| 1515 | Ga0207694_10002010 | |||
| 1516 | Ga0207694_10013293 | |||
| 1517 | Ga0207694_10085369 | |||
| 1518 | Ga0207694_10132693 | |||
| 1519 | Ga0207650_10059382 | |||
| 1520 | Ga0207650_10165686 | |||
| 1521 | Ga0207650_10244319 | |||
| 1522 | Ga0207659_10042135 | |||
| 1523 | Ga0207659_10136197 | |||
| 1524 | Ga0207687_10008258 | |||
| 1525 | Ga0207687_10062794 | |||
| 1526 | Ga0207700_10001535 | |||
| 1527 | Ga0207700_10296846 | |||
| 1528 | Ga0207664_10000014 | |||
| 1529 | Ga0207664_10000071 | |||
| 1530 | Ga0207664_10000601 | |||
| 1531 | Ga0207644_10042775 | |||
| 1532 | Ga0207690_10000532 | |||
| 1533 | Ga0207690_10001860 | |||
| 1534 | Ga0207690_10108815 | |||
| 1535 | Ga0207690_10109772 | |||
| 1536 | Ga0207690_10137975 | |||
| 1537 | Ga0207706_10008698 | |||
| 1538 | Ga0207706_10011915 | |||
| 1539 | Ga0207706_10013100 | |||
| 1540 | Ga0207706_10042110 | |||
| 1541 | Ga0207706_10049448 | |||
| 1542 | Ga0207706_10470496 | |||
| 1543 | Ga0207686_10000598 | |||
| 1544 | Ga0207709_10000050 | |||
| 1545 | Ga0207709_10000527 | |||
| 1546 | Ga0207709_10009913 | |||
| 1547 | Ga0207704_10000020 | |||
| 1548 | Ga0207704_10013639 | |||
| 1549 | Ga0207691_10003625 | |||
| 1550 | Ga0207691_10014108 | |||
| 1551 | Ga0207691_10046652 | |||
| 1552 | Ga0207711_10014427 | |||
| 1553 | Ga0207711_10023261 | |||
| 1554 | Ga0207689_10001541 | |||
| 1555 | Ga0207689_10001783 | |||
| 1556 | Ga0207661_10001897 | |||
| 1557 | Ga0207661_10045981 | |||
| 1558 | Ga0207661_10209699 | |||
| 1559 | Ga0207661_10248469 | |||
| 1560 | Ga0207679_10004674 | |||
| 1561 | Ga0207667_10000040 | |||
| 1562 | Ga0207667_10000947 | |||
| 1563 | Ga0207667_10007762 | |||
| 1564 | Ga0207667_10072474 | |||
| 1565 | Ga0207667_10103191 | |||
| 1566 | Ga0207667_10149101 | |||
| 1567 | Ga0207667_10205878 | |||
| 1568 | Ga0207667_10238588 | |||
| 1569 | Ga0207651_10000005 | |||
| 1570 | Ga0207712_10000277 | |||
| 1571 | Ga0207712_10001146 | |||
| 1572 | Ga0207712_10014077 | |||
| 1573 | Ga0207712_10021212 | |||
| 1574 | Ga0207668_10005154 | |||
| 1575 | Ga0207668_10018373 | |||
| 1576 | Ga0207640_10000009 | |||
| 1577 | Ga0207640_10000145 | |||
| 1578 | Ga0207640_10005290 | |||
| 1579 | Ga0207640_10014194 | |||
| 1580 | Ga0207640_10098268 | |||
| 1581 | Ga0207640_10133355 | |||
| 1582 | Ga0207658_10149525 | |||
| 1583 | Ga0207677_10000373 | |||
| 1584 | Ga0207677_10471654 | |||
| 1585 | Ga0207703_10004934 | |||
| 1586 | Ga0207639_10001840 | |||
| 1587 | Ga0207639_10004652 | |||
| 1588 | Ga0207639_10007809 | |||
| 1589 | Ga0207639_10014224 | |||
| 1590 | Ga0207639_10020933 | |||
| 1591 | Ga0207639_10293628 | |||
| 1592 | Ga0207639_10693695 | |||
| 1593 | Ga0207678_10004979 | |||
| 1594 | Ga0207678_10005889 | |||
| 1595 | Ga0207678_10006369 | |||
| 1596 | Ga0207678_10020914 | |||
| 1597 | Ga0207678_10043979 | |||
| 1598 | Ga0207708_10000004 | |||
| 1599 | Ga0207708_10009224 | |||
| 1600 | Ga0207702_10000172 | |||
| 1601 | Ga0207702_10008380 | |||
| 1602 | Ga0207702_10015708 | |||
| 1603 | Ga0207702_10036014 | |||
| 1604 | Ga0207641_10025775 | |||
| 1605 | Ga0207641_10043596 | |||
| 1606 | Ga0207648_10000017 | |||
| 1607 | Ga0207648_10027096 | |||
| 1608 | Ga0207648_10030744 | |||
| 1609 | Ga0207648_10136587 | |||
| 1610 | Ga0207674_10001921 | |||
| 1611 | Ga0207674_10004423 | |||
| 1612 | Ga0207674_10012476 | |||
| 1613 | Ga0207674_10021680 | |||
| 1614 | Ga0207674_10050289 | |||
| 1615 | Ga0207674_10227566 | |||
| 1616 | Ga0207674_10258908 | |||
| 1617 | Ga0207674_10341215 | |||
| 1618 | Ga0207675_100001976 | |||
| 1619 | Ga0207675_100031644 | |||
| 1620 | Ga0207683_10232436 | |||
| 1621 | Ga0207698_10000931 | |||
| 1622 | Ga0207698_10054723 | |||
| 1623 | Ga0207698_10083396 | |||
| 1624 | Ga0207698_10332722 | |||
| 1625 | Ga0209371_1000018 | |||
| 1626 | Ga0209371_1000025 | |||
| 1627 | Ga0209974_10004171 | |||
| 1628 | Ga0268266_10000006 | |||
| 1629 | Ga0268266_10026003 | |||
| 1630 | Ga0268266_10027010 | |||
| 1631 | Ga0268266_10031407 | |||
| 1632 | Ga0268266_10305737 | |||
| 1633 | Ga0268265_10061048 | |||
| 1634 | Ga0268265_10566371 | |||
| 1635 | Ga0268264_10148368 | |||
| 1636 | Ga0268264_10298648 | |||
| 1637 | Ga0265319_1000240 | |||
| 1638 | Ga0265318_10002424 | |||
| 1639 | Ga0265338_10212940 | |||
| 1640 | Ga0268256_1000016 | |||
| 1641 | Ga0268256_1000027 | |||
| 1642 | Ga0316181_1114053 | |||
| 1643 | Ga0316181_1268996 | |||
| 1644 | Ga0265332_10014777 | |||
| 1645 | Ga0265320_10000136 | |||
| 1646 | Ga0265325_10001525 | |||
| 1647 | Ga0265325_10042548 | |||
| 1648 | Ga0265329_10000171 | |||
| 1649 | Ga0265340_10003989 | |||
| 1650 | Ga0265339_10065646 | |||
| 1651 | Ga0265331_10000021 | |||
| 1652 | Ga0265331_10016315 | |||
| 1653 | Ga0265316_10001078 | |||
| 1654 | Ga0265316_10012682 | |||
| 1655 | Ga0307513_10158437 | |||
| 1656 | Ga0307408_100005909 | |||
| 1657 | Ga0307408_100073444 | |||
| 1658 | Ga0265313_10001348 | |||
| 1659 | Ga0307508_10065258 | |||
| 1660 | Ga0307508_10284242 | |||
| 1661 | Ga0265314_10007149 | |||
| 1662 | Ga0265342_10000555 | |||
| 1663 | Ga0265342_10104745 | |||
| 1664 | Ga0307413_10022756 | |||
| 1665 | Ga0307413_10085739 | |||
| 1666 | Ga0307413_10088902 | |||
| 1667 | Ga0307413_10126983 | |||
| 1668 | Ga0307410_10002430 | |||
| 1669 | Ga0307410_10029439 | |||
| 1670 | Ga0307410_10040470 | |||
| 1671 | Ga0307406_10002083 | |||
| 1672 | Ga0307406_10005253 | |||
| 1673 | Ga0307406_10186025 | |||
| 1674 | Ga0307407_10043860 | |||
| 1675 | Ga0307412_10093954 | |||
| 1676 | Ga0307412_10217952 | |||
| 1677 | Ga0307409_100049477 | |||
| 1678 | Ga0307409_100063613 | |||
| 1679 | Ga0307416_100110189 | |||
| 1680 | Ga0307414_10000303 | |||
| 1681 | Ga0307414_10002908 | |||
| 1682 | Ga0307414_10380382 | |||
| 1683 | Ga0307411_10076113 | |||
| 1684 | Ga0307411_10076436 | |||
| 1685 | Ga0307411_10084639 | |||
| 1686 | Ga0307415_100140021 | |||
| 1687 | Ga0307415_100354786 | |||
| 1688 | Ga0307507_10093349 | |||
| 1689 | Ga0373926_0027212 | |||
| 1690 | Ga0373952_0035064 | |||
| 1691 | Ga0373945_0006636 | |||
| 1692 | Ga0373956_0063225 | |||
| 1693 | Ga0373943_0002619 | |||
| 1694 | Ga0373935_0014070 | |||
| 1695 | Ga0373927_0031176 | |||
| 1696 | Ga0373933_0018862 | |||
| 1697 | Ga0373933_0093035 | |||
| 1698 | Ga0373947_0004896 | |||
| 1699 | Ga0373947_0036575 | |||
| 1700 | Ga0373937_0049907 | |||
| 1701 | Ga0373937_0366843 | |||
| 1702 | Ga0373925_0000649 | |||
| 1703 | Ga0395899_0036394 | |||
| 1704 | Ga0395900_0000033 | |||
| 1705 | Ga0395900_0000888 | |||
| 1706 | Ga0395900_0009693 | |||
| 1707 | Ga0395900_0010009 | |||
| 1708 | Ga0395900_0054926 | |||
| 1709 | Ga0395898_0000355 | |||
| 1710 | Ga0395898_0040116 | |||
| 1711 | Ga0395898_0425028 | |||
| 1712 | Ga0395905_0006600 | |||
| 1713 | Ga0395905_0041832 | |||
| 1714 | Ga0395905_0109833 | |||
| 1715 | Ga0395905_0111481 | |||
| 1716 | Ga0395905_0116462 | |||
| 1717 | Ga0436364_0570527 | |||
| 1718 | Ga0436364_0714734 | |||
| 1719 | Ga0436364_1332114 | |||
| 1720 | Ga0395901_0008861 | |||
| 1721 | Ga0395901_0015001 | |||
| 1722 | Ga0237819_00212 | |||
| 1723 | Ga0237819_06260 | |||
| 1724 | Ga0436365_0457258 | |||
| 1725 | Ga0436365_1712708 | |||
| 1726 | Ga0439436_0012161 | |||
| 1727 | Ga0439441_007876 | |||
| 1728 | Ga0439449_0079876 | |||
| 1729 | Ga0466972_0014295 | |||
| 1730 | Ga0466972_0020438 | |||
| 1731 | Ga0466965_0055600 | |||
| 1732 | Ga0466961_0097013 | |||
| 1733 | Ga0466961_0099769 | |||
| 1734 | Ga0453684_0121349 | |||
| 1735 | Ga0453684_0671748 | |||
| 1736 | Ga0466970_0021001 | |||
| 1737 | Ga0466970_0086454 | |||
| 1738 | Ga0466960_0007515 | |||
| 1739 | Ga0466959_0049070 | |||
| 1740 | Ga0466959_0201346 | |||
| 1741 | Ga0466959_0267173 | |||
| 1742 | Ga0451576_0049273 | |||
| 1743 | Ga0451576_0386162 | |||
| 1744 | Ga0466967_0520577 | |||
| 1745 | Ga0495627_003294 | |||
| 1746 | Ga0495627_010445 | |||
| 1747 | Ga0495592_0001829 | |||
| 1748 | Ga0495591_013499 | |||
| 1749 | Ga0495638_0000087 | |||
| 1750 | Ga0495638_0000095 | |||
| 1751 | Ga0495638_0000526 | |||
| 1752 | Ga0495651_0000112 | |||
| 1753 | Ga0495651_0004909 | |||
| 1754 | Ga0495651_0037275 | |||
| 1755 | Ga0495653_0008702 | |||
| 1756 | Ga0495653_0057144 | |||
| 1757 | Ga0495650_0000122 | |||
| 1758 | Ga0495580_0004583 | |||
| 1759 | Ga0495582_0000213 | |||
| 1760 | Ga0495639_0003220 | |||
| 1761 | Ga0495662_0021763 | |||
| 1762 | Ga0495664_0027212 | |||
| 1763 | Ga0495664_0029489 | |||
| 1764 | Ga0495664_0103014 | |||
| 1765 | Ga0495606_0000154 | |||
| 1766 | Ga0495608_0005013 | |||
| 1767 | Ga0495608_0015212 | |||
| 1768 | Ga0495628_0010075 | |||
| 1769 | Ga0495630_0046901 | |||
| 1770 | Ga0495630_0111043 | |||
| 1771 | Ga0495630_0172293 | |||
| 1772 | Ga0495632_0035825 | |||
| 1773 | Ga0495643_0001815 | |||
| 1774 | Ga0495663_0003358 | |||
| 1775 | Ga0495663_0004265 | |||
| 1776 | Ga0495642_0008250 | |||
| 1777 | Ga0495652_0001460 | |||
| 1778 | Ga0495652_0039539 | |||
| 1779 | Ga0495665_0000168 | |||
| 1780 | Ga0495665_0002975 | |||
| 1781 | Ga0495640_0089957 | |||
| 1782 | Ga0495640_0137767 | |||
| 1783 | Ga0495586_0007098 | |||
| 1784 | Ga0495586_0044609 | |||
| 1785 | Ga0495586_0127954 | |||
| 1786 | Ga0495587_0008194 | |||
| 1787 | Ga0495645_0018582 | |||
| 1788 | Ga0495622_0069635 | |||
| 1789 | Ga0495633_0005215 | |||
| 1790 | Ga0495633_0006398 | |||
| 1791 | Ga0495667_0002346 | |||
| 1792 | Ga0495667_0021853 | |||
| 1793 | Ga0495656_0001607 | |||
| 1794 | Ga0495668_0000364 | |||
| 1795 | Ga0495625_0010997 | |||
| 1796 | Ga0495625_0025870 | |||
| 1797 | Ga0495625_0078789 | |||
| 1798 | Ga0495635_0005328 | |||
| 1799 | Ga0495635_0181855 | |||
| 1800 | Ga0495657_0004093 | |||
| 1801 | Ga0495657_0155154 | |||
| 1802 | Ga0495623_0199603 | |||
| 1803 | Ga0495646_0004052 | |||
| 1804 | Ga0495647_0000124 | |||
| 1805 | Ga0495647_0087280 | |||
| 1806 | Ga0495658_0001608 | |||
| 1807 | Ga0495613_0002933 | |||
| 1808 | Ga0495613_0068659 | |||
| 1809 | Ga0495624_0023365 | |||
| 1810 | Ga0495670_0025528 | |||
| 1811 | Ga0495671_0033896 | |||
| 1812 | Ga0495649_0010401 | |||
| 1813 | Ga0495600_0001620 | |||
| 1814 | Ga0495600_0003112 | |||
| 1815 | Ga0495581_0000059 | |||
| 1816 | Ga0495581_0153730 | |||
| 1817 | Ga0495604_0004415 | |||
| 1818 | Ga0495674_0008146 | |||
| 1819 | Ga0495674_0142410 | |||
| 1820 | Ga0495672_0000087 | |||
| 1821 | Ga0495680_0001270 | |||
| 1822 | Ga0495680_0004117 | |||
| 1823 | Ga0495680_0014929 | |||
| 1824 | Ga0495675_0000121 | |||
| 1825 | Ga0495675_0010587 | |||
| 1826 | Ga0495675_0068687 | |||
| 1827 | Ga0495684_0002904 | |||
| 1828 | Ga0495684_0004922 | |||
| 1829 | Ga0495684_0005046 | |||
| 1830 | Ga0495684_0007540 | |||
| 1831 | Ga0495684_0036199 | |||
| 1832 | Ga0495686_0004003 | |||
| 1833 | Ga0495686_0021929 | |||
| 1834 | Ga0495593_0020029 | |||
| 1835 | Ga0495602_0002431 | |||
| 1836 | Ga0496100_0034593 | |||
| 1837 | Ga0496101_0022322 | |||
| 1838 | Ga0496101_0061834 | |||
| 1839 | Ga0496104_0013018 | |||
| 1840 | Ga0496104_0013159 | |||
| 1841 | Ga0496105_0058392 | |||
| 1842 | Ga0496106_0265147 | |||
| 1843 | Ga0496107_0196288 | |||
| 1844 | Ga0496108_0119623 | |||
| 1845 | Ga0496108_0703611 | |||
| 1846 | Ga0496109_0083637 | |||
| 1847 | Ga0496109_0193734 | |||
| 1848 | Ga0496110_0144262 | |||
| 1849 | Ga0496112_0046779 | |||
| 1850 | Ga0496112_0204691 | |||
| 1851 | Ga0496112_0224091 | |||
| 1852 | Ga0496113_0013073 | |||
| 1853 | Ga0496113_0046259 | |||
| 1854 | Ga0496114_0011751 | |||
| 1855 | Ga0496114_0075849 | |||
| 1856 | Ga0496114_0132116 | |||
| 1857 | Ga0496114_0203032 | |||
| 1858 | Ga0496115_0000116 | |||
| 1859 | Ga0496115_0000233 | |||
| 1860 | Ga0496115_0000293 | |||
| 1861 | Ga0496115_0007196 | |||
| 1862 | Ga0496115_0231491 | |||
| 1863 | Ga0496115_0351060 | |||
| 1864 | Ga0496116_0002572 | |||
| 1865 | Ga0496116_0013614 | |||
| 1866 | Ga0496116_0014949 | |||
| 1867 | Ga0496116_0041201 | |||
| 1868 | Ga0496117_0003980 | |||
| 1869 | Ga0496117_0008136 | |||
| 1870 | Ga0496117_0013164 | |||
| 1871 | Ga0496117_0069791 | |||
| 1872 | Ga0496118_0000260 | |||
| 1873 | Ga0496118_0000953 | |||
| 1874 | Ga0496118_0006046 | |||
| 1875 | Ga0496118_0007889 | |||
| 1876 | Ga0496118_0008964 | |||
| 1877 | Ga0496118_0015832 | |||
| 1878 | Ga0496118_0023738 | |||
| 1879 | Ga0496118_0058708 | |||
| 1880 | Ga0496118_0088913 | |||
| 1881 | Ga0496118_0110485 | |||
| 1882 | Ga0496118_0239116 | |||
| 1883 | Ga0496119_0000048 | |||
| 1884 | Ga0496119_0000711 | |||
| 1885 | Ga0496119_0004893 | |||
| 1886 | Ga0496119_0023171 | |||
| 1887 | Ga0496119_0034191 | |||
| 1888 | Ga0496119_0046818 | |||
| 1889 | Ga0496120_0000113 | |||
| 1890 | Ga0496120_0000519 | |||
| 1891 | Ga0496120_0000727 | |||
| 1892 | Ga0496121_0000013 | |||
| 1893 | Ga0496121_0004863 | |||
| 1894 | Ga0496121_0005121 | |||
| 1895 | Ga0496121_0042740 | |||
| 1896 | Ga0496121_0043735 | |||
| 1897 | Ga0496122_0001140 | |||
| 1898 | Ga0496122_0014529 | |||
| 1899 | Ga0496122_0126649 | |||
| 1900 | Ga0496122_0192224 | |||
| 1901 | Ga0496123_0000942 | |||
| 1902 | Ga0496123_0056542 | |||
| 1903 | Ga0496124_0001552 | |||
| 1904 | Ga0496124_0003834 | |||
| 1905 | Ga0496124_0027671 | |||
| 1906 | Ga0496124_0089185 | |||
| 1907 | Ga0496124_0106341 | |||
| 1908 | Ga0496125_0000722 | |||
| 1909 | Ga0496125_0013105 | |||
| 1910 | Ga0496125_0018451 | |||
| 1911 | Ga0496125_0035604 | |||
| 1912 | Ga0496126_0000057 | |||
| 1913 | Ga0496126_0000320 | |||
| 1914 | Ga0496126_0003861 | |||
| 1915 | Ga0496126_0015014 | |||
| 1916 | Ga0496126_0016096 | |||
| 1917 | Ga0496126_0023194 | |||
| 1918 | Ga0496126_0023341 | |||
| 1919 | Ga0501031_0001796 | |||
| 1920 | Ga0501031_0014464 | |||
| 1921 | Ga0501032_0007207 | |||
| 1922 | Ga0501032_0010231 | |||
| 1923 | Ga0501032_0044695 | |||
| 1924 | Ga0501033_0000086 | |||
| 1925 | Ga0501033_0006023 | |||
| 1926 | Ga0501033_0024833 | |||
| 1927 | Ga0501033_0030820 | |||
| 1928 | Ga0501033_0036085 | |||
| 1929 | Ga0501033_0060447 | |||
| 1930 | Ga0501033_0063173 | |||
| 1931 | Ga0501034_0093322 | |||
| 1932 | Ga0501034_0200942 | |||
| 1933 | Ga0501036_0003611 | |||
| 1934 | Ga0501036_0011588 | |||
| 1935 | Ga0501036_0018586 | |||
| 1936 | Ga0501036_0025725 | |||
| 1937 | Ga0501036_0152836 | |||
| 1938 | Ga0501036_0350644 | |||
| 1939 | Ga0501037_0041500 | |||
| 1940 | Ga0501037_0086830 | |||
| 1941 | Ga0501038_0011732 | |||
| 1942 | Ga0501038_0016254 | |||
| 1943 | Ga0501038_0022471 | |||
| 1944 | Ga0501038_0061319 | |||
| 1945 | Ga0501038_0109817 | |||
| 1946 | Ga0501038_0172902 | |||
| 1947 | Ga0501039_0007126 | |||
| 1948 | Ga0501039_0010959 | |||
| 1949 | Ga0501039_0013495 | |||
| 1950 | Ga0501039_0045023 | |||
| 1951 | Ga0501040_0004213 | |||
| 1952 | Ga0501040_0017688 | |||
| 1953 | Ga0501041_0003615 | |||
| 1954 | Ga0501042_0001952 | |||
| 1955 | Ga0501042_0002596 | |||
| 1956 | Ga0501042_0364241 | |||
| 1957 | Ga0501043_0005825 | |||
| 1958 | Ga0501043_0045918 | |||
| 1959 | Ga0501043_0111954 | |||
| 1960 | Ga0501046_0001919 | |||
| 1961 | Ga0501046_0007819 | |||
| 1962 | Ga0501047_0011238 | |||
| 1963 | Ga0501047_0011692 | |||
| 1964 | Ga0501047_0466423 | |||
| 1965 | Ga0501048_0137342 | |||
| 1966 | Ga0501048_0209232 | |||
| 1967 | Ga0501068_0001687 | |||
| 1968 | Ga0501068_0019942 | |||
| 1969 | Ga0501069_0004963 | |||
| 1970 | Ga0501070_0000269 | |||
| 1971 | Ga0501070_0170031 | |||
| 1972 | Ga0501070_0267493 | |||
| 1973 | Ga0501070_0397768 | |||
| 1974 | Ga0501072_0019466 | |||
| 1975 | Ga0501072_0223635 | |||
| 1976 | Ga0501073_0000408 | |||
| 1977 | Ga0501073_0080842 | |||
| 1978 | Ga0501074_0011170 | |||
| 1979 | Ga0501074_0056693 | |||
| 1980 | Ga0501075_0158630 | |||
| 1981 | Ga0501076_0001011 | |||
| 1982 | Ga0501076_0007819 | |||
| 1983 | Ga0501076_0122416 | |||
| 1984 | Ga0501077_0004162 | |||
| 1985 | Ga0501077_0011204 | |||
| 1986 | Ga0501077_0020571 | |||
| 1987 | Ga0501079_0012719 | |||
| 1988 | Ga0501079_0234515 | |||
| 1989 | Ga0501079_0251816 | |||
| 1990 | Ga0501080_0030603 | |||
| 1991 | Ga0501080_0533340 | |||
| 1992 | Ga0501081_0002043 | |||
| 1993 | Ga0501081_0128766 | |||
| 1994 | Ga0501083_0000990 | |||
| 1995 | Ga0501035_0008776 | |||
| 1996 | Ga0501035_0020150 | |||
| 1997 | Ga0501035_0029675 | |||
| 1998 | Ga0501035_0072308 | |||
| 1999 | Ga0501035_0277633 | |||
| 2000 | Ga0501044_0000749 | |||
| 2001 | Ga0501044_0002590 | |||
| 2002 | Ga0501044_0013084 | |||
| 2003 | Ga0501044_0039363 | |||
| 2004 | Ga0501044_0358588 | |||
| 2005 | Ga0501044_0432093 | |||
| 2006 | Ga0501044_0481197 | |||
| 2007 | Ga0501044_0622771 | |||
| 2008 | Ga0501045_0005098 | |||
| 2009 | Ga0501045_0010906 | |||
| 2010 | nmdc:mga05p37_22411_c1 | |||
| 2011 | nmdc:mga05p37_470558_c1 | |||
| 2012 | nmdc:mga09592_1422_c1 | |||
| 2013 | nmdc:mga09592_170495_c1 | |||
| 2014 | nmdc:mga0qj67_25287_c1 | |||
| 2015 | nmdc:mga0qj67_338480_c1 | |||
| 2016 | nmdc:mga06r32_20879_c1 | |||
| 2017 | nmdc:mga06r32_247156_c1 | |||
| 2018 | nmdc:mga08y16_123927_c1 | |||
| 2019 | nmdc:mga08y16_1627_c1 | |||
| 2020 | nmdc:mga0n895_30080_c1 | |||
| 2021 | nmdc:mga0a205_113774_c1 | |||
| 2022 | Ga0495619_0040301 | |||
| 2023 | Ga0500651_0047289 | |||
| 2024 | Ga0500595_000162 | |||
| 2025 | Ga0500568_0000316 | |||
| 2026 | Ga0500573_0000049 | |||
| 2027 | Ga0500590_000735 | |||
| 2028 | Ga0500634_0000377 | |||
| 2029 | Ga0501084_0020970 | |||
| 2030 | Ga0501082_0027265 | |||
| 2031 | Ga0501082_0334484 | |||
| 2032 | Ga0530510_0002588 | |||
| 2033 | Ga0530510_0004408 | |||
| 2034 | 2538835230 | |||
| 2035 | 2547503584 | |||
| 2036 | 2578456972 | |||
| 2037 | 2643828613 | |||
| 2038 | 2643896244 | |||
| 2039 | 2643909325 | |||
| 2040 | 2643914826 | |||
| 2041 | 2643973271 | |||
| 2042 | 2644181827 | |||
| 2043 | 2644478458 | |||
| 2044 | 2687582201 | |||
| 2045 | 2747949938 | |||
| 2046 | 2748019670 | |||
| 2047 | 2765580534 | |||
| 2048 | 2816518442 | |||
| 2049 | 2842394449 | |||
| 2050 | 2844844335 | |||
| 2051 | 2844853635 | |||
| 2052 | 2852652124 | |||
| 2053 | 2852687184 | |||
| 2054 | 2857446854 | |||
| 2055 | 2874223197 | |||
| 2056 | 2884414161 | |||
| 2057 | 2895397974 | |||
| 2058 | 2919056285 | |||
| 2059 | 2919093232 | |||
| 2060 | 2919131059 | |||
| 2061 | 2919138747 | |||
| 2062 | 2919526287 | |||
| 2063 | 2923517265 | |||
| 2064 | 2928154418 | |||
| 2065 | 2928499863 | |||
| 2066 | 2928963689 | |||
| 2067 | 2929196299 | |||
| 2068 | 2931383366 | |||
| 2069 | 2937614339 | |||
| 2070 | 2939589835 | |||
| 2071 | 2939613570 | |||
| 2072 | 2939630929 | |||
| 2073 | 2941478747 | |||
| 2074 | 2941492614 | |||
| 2075 | 2952255999 | |||
| 2076 | 2961049961 | |||
| 2077 | 2961064876 | |||
| 2078 | 2974307620 | |||
| 2079 | 2977248331 | |||
| 2080 | 2984517176 | |||
| 2081 | 2987608822 | |||
| 2082 | 2995949724 | |||
| 2083 | 3003003577 | |||
| 2084 | 8021625567 | |||
| 2085 | 8021630554 | |||
| 2086 | 8021649736 | |||
| 2087 | 8053951975 | |||
| 2088 | 8056040431 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j39-assembly1.cif.gz_A | crystal structure of cmis2 with inhibitor | 0.967 | 1 | 32 |
| 6vpb-assembly1.cif.gz_B-2 | a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) | 0.9533 | 1 | 293 |
| 5x6r-assembly2.cif.gz_B | crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 | 0.9514 | 1 | 33 |
| 4e21-assembly1.cif.gz_B-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9496 | 2 | 293 |
| 4e21-assembly1.cif.gz_A-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9485 | 2 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5VQP1_29_415_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9478 | 3 | 30 | 3.50.50.60 |
| 6fqxH01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9427 | 2 | 169 | 3.40.50.720 |
| af_A4HWA7_1_176_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9405 | 2 | 30 | 3.50.50.60 |
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9386 | 2 | 33 | 3.50.50.60 |
| 5y8iB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9356 | 2 | 164 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I5CPF4-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9949 | 47 | 154 |
GO:0004616
GO:0050661 |
| AF-T1B9E1-F1-model_v4 | 6-phosphogluconate dehydrogenase, NAD-binding domain protein (EC 1.1.-.-) | 0.9865 | 1 | 67 |
GO:0016491
GO:0050661 |
| AF-A0A328P4C0-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9862 | 1 | 301 |
GO:0004616
GO:0006098 GO:0016054 GO:0019521 GO:0050661 |
| AF-A0A2D6IMQ2-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9862 | 1 | 301 |
GO:0004616
GO:0006098 GO:0016054 GO:0019521 GO:0050661 |
| AF-A0A6A0JM29-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9857 | 1 | 75 |
GO:0016491
GO:0050661 |