F488918

General Info

Members Datasets Scaffolds Average Seq Length
1044 456 1044 176

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_495535_c1|nmdc:mga0n895_495535_c1_410_1033
Length 201
Sequence LIEIAATRRGGAFFARLTVLHHDVEAGTREDAMTDTEALEQDKLRFPTIDAGVRIGHVHLKVADLQRALDFYCGVLGFELTTSRPGAAFISAGGYHHHIGLNTWESRGGSTGLYHTAILYPTRRLLADALRRLIVAKIPLEGASDHGVSEALYLRDPDDNGVELYWDRPKELWPQRPDGGLQMFTNPLDLRDLLAELDKPA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
142 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
143 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
144 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
145 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
165 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
246 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
252 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
253 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
254 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
255 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
264 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
265 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
266 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
267 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
268 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
269 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
276 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
277 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
278 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
280 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
282 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
283 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
284 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
285 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
286 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
287 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
288 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
289 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
290 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
291 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
292 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
293 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
294 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
295 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
299 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
300 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
303 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
309 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
310 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
311 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
312 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
313 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
314 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
315 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
316 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
340 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
341 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
345 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
346 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
347 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
353 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
354 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
355 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
358 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
359 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
360 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
363 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
364 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
365 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
369 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
370 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
371 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
372 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
373 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
374 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
375 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
376 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
377 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
380 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
381 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
382 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
383 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
384 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
385 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
418 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
419 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
420 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
421 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
422 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
423 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
424 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
425 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
426 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
436 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
437 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
438 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
439 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
440 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
443 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
444 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
445 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
446 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
447 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
448 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
449 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
452 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
453 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
454 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
455 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
456 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 5.84
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544913 2209111006 Bacteria 25171
2 ARcpr5oldR_c000030 3300000041 Bacteria 28909
3 ARSoilYngRDRAFT_c00022 3300000042 Bacteria 23602
4 ARcpr5yngRDRAFT_c000011 3300000043 Bacteria 35549
5 ARSoilOldRDRAFT_c000040 3300000044 Bacteria 28954
6 ARCol0oldRDRAFT_c01878 3300000045 Bacteria 1134
7 ARCol0yngRDRAFT_1000028 3300000652 Bacteria 25625
8 JGI24032J14994_100177 3300001430 Bacteria 3239
9 JGI24752J21851_1011523 3300001976 Bacteria 1156
10 JGI24747J21853_1001659 3300001978 Bacteria 1705
11 JGI24739J22299_10000164 3300001989 Bacteria 21825
12 JGI24737J22298_10002054 3300001990 Bacteria 7202
13 JGI24737J22298_10004205 3300001990 Bacteria 5033
14 JGI24750J21931_1000178 3300002070 Bacteria 10641
15 JGI24745J21846_1000640 3300002073 Bacteria 3142
16 JGI24748J21848_1000266 3300002074 Bacteria 6220
17 JGI24738J21930_10000112 3300002075 Bacteria 19038
18 JGI24749J21850_1002285 3300002076 Bacteria 2697
19 JGI24744J21845_10004212 3300002077 Bacteria 2966
20 JGI24035J26624_1000424 3300002126 Bacteria 3991
21 JGI24033J26618_1001840 3300002155 Bacteria 2123
22 JGI24034J26672_10002682 3300002239 Bacteria 2451
23 JGI24742J22300_10000334 3300002244 Bacteria 6993
24 JGI24751J29686_10004003 3300002459 Bacteria 2981
25 JGI25404J52841_10018490 3300003659 Bacteria 1510
26 JGI25405J52794_10008628 3300003911 Bacteria 1908
27 JGI25405J52794_10010557 3300003911 Bacteria 1758
28 Ga0065717_1000386 3300005276 Bacteria 1461
29 Ga0065716_1001616 3300005277 Bacteria 5181
30 Ga0065712_10070488 3300005290 Bacteria 5965
31 Ga0065715_10001682 3300005293 Bacteria 8090
32 Ga0065715_10018746 3300005293 Bacteria 2166
33 Ga0065707_10125256 3300005295 Bacteria 1999
34 Ga0070658_10030706 3300005327 Bacteria 4316
35 Ga0070658_10321270 3300005327 Bacteria 1322
36 Ga0070658_10713122 3300005327 Bacteria 871
37 Ga0070676_10003775 3300005328 Bacteria 7942
38 Ga0070676_10085140 3300005328 Bacteria 1926
39 Ga0070676_10127179 3300005328 Bacteria 1607
40 Ga0070683_100000376 3300005329 Bacteria 31004
41 Ga0070683_100064147 3300005329 Bacteria 3419
42 Ga0070690_100002745 3300005330 Bacteria 9502
43 Ga0070690_100006745 3300005330 Bacteria 6525
44 Ga0070690_100008317 3300005330 Bacteria 5970
45 Ga0070670_100004417 3300005331 Bacteria 11775
46 Ga0070677_10000049 3300005333 Bacteria 37210
47 Ga0068869_100000523 3300005334 Bacteria 21387
48 Ga0068869_100451400 3300005334 Bacteria 1066
49 Ga0070666_10001839 3300005335 Bacteria 12930
50 Ga0070666_10002781 3300005335 Bacteria 10564
51 Ga0070680_100005313 3300005336 Bacteria 9748
52 Ga0070680_100016319 3300005336 Bacteria 5844
53 Ga0070680_100045410 3300005336 Bacteria 3571
54 Ga0070680_100123658 3300005336 Bacteria 2161
55 Ga0070680_100433128 3300005336 Bacteria 1122
56 Ga0070682_100000141 3300005337 Bacteria 57251
57 Ga0070682_100010927 3300005337 Bacteria 5173
58 Ga0070682_100165525 3300005337 Bacteria 1532
59 Ga0070682_100168686 3300005337 Bacteria 1519
60 Ga0068868_100009105 3300005338 Bacteria 7128
61 Ga0070660_100001073 3300005339 Bacteria 18364
62 Ga0070660_100038319 3300005339 Bacteria 3639
63 Ga0070660_100130758 3300005339 Bacteria 2009
64 Ga0070689_100028024 3300005340 Bacteria 4253
65 Ga0070689_100100586 3300005340 Bacteria 2287
66 Ga0070689_100236418 3300005340 Bacteria 1504
67 Ga0070691_10004687 3300005341 Bacteria 6220
68 Ga0070691_10020023 3300005341 Bacteria 3088
69 Ga0070687_100000212 3300005343 Bacteria 20234
70 Ga0070661_100000242 3300005344 Bacteria 44945
71 Ga0070661_100115710 3300005344 Bacteria 2005
72 Ga0070692_10010557 3300005345 Bacteria 4209
73 Ga0070668_100003395 3300005347 Bacteria 11753
74 Ga0070668_100414921 3300005347 Bacteria 1152
75 Ga0070669_100006805 3300005353 Bacteria 8223
76 Ga0070669_100147979 3300005353 Bacteria 1816
77 Ga0070675_100000165 3300005354 Bacteria 40656
78 Ga0070675_100011029 3300005354 Bacteria 7076
79 Ga0070671_100001907 3300005355 Bacteria 15957
80 Ga0070671_100165578 3300005355 Bacteria 1869
81 Ga0070674_100000450 3300005356 Bacteria 20737
82 Ga0070673_100001190 3300005364 Bacteria 14967
83 Ga0070673_100047352 3300005364 Bacteria 3345
84 Ga0070688_100004815 3300005365 Bacteria 7056
85 Ga0070688_100016577 3300005365 Bacteria 4215
86 Ga0070688_100035808 3300005365 Bacteria 3016
87 Ga0070659_100000988 3300005366 Bacteria 20880
88 Ga0070659_100031422 3300005366 Bacteria 4112
89 Ga0070659_100070846 3300005366 Bacteria 2770
90 Ga0070667_100019884 3300005367 Bacteria 5572
91 Ga0070667_100128897 3300005367 Bacteria 2207
92 Ga0070667_100448787 3300005367 Bacteria 1178
93 Ga0070703_10001274 3300005406 Bacteria 7647
94 Ga0070709_10088128 3300005434 Bacteria 2041
95 Ga0070709_10092920 3300005434 Bacteria 1993
96 Ga0070709_10150580 3300005434 Bacteria 1607
97 Ga0070714_100091747 3300005435 Bacteria 2662
98 Ga0070714_100096255 3300005435 Bacteria 2601
99 Ga0070714_100135536 3300005435 Bacteria 2204
100 Ga0070714_100168697 3300005435 Bacteria 1985
101 Ga0070714_100329391 3300005435 Bacteria 1430
102 Ga0070714_100339459 3300005435 Bacteria 1409
103 Ga0070713_100092317 3300005436 Bacteria 2606
104 Ga0070713_100148235 3300005436 Bacteria 2085
105 Ga0070713_100206637 3300005436 Bacteria 1776
106 Ga0070710_10004737 3300005437 Bacteria 6431
107 Ga0070710_10108572 3300005437 Bacteria 1664
108 Ga0070701_10006218 3300005438 Bacteria 5008
109 Ga0070701_10292204 3300005438 Bacteria 999
110 Ga0070701_10603384 3300005438 Bacteria 727
111 Ga0070711_100016051 3300005439 Bacteria 4748
112 Ga0070705_100003041 3300005440 Bacteria 8274
113 Ga0070705_100015515 3300005440 Bacteria 3942
114 Ga0070705_100209827 3300005440 Bacteria 1342
115 Ga0070700_100000364 3300005441 Bacteria 23195
116 Ga0070700_100012444 3300005441 Bacteria 4750
117 Ga0070694_100001077 3300005444 Bacteria 15614
118 Ga0070708_100259032 3300005445 Bacteria 1635
119 Ga0070663_100000417 3300005455 Bacteria 22399
120 Ga0070663_100015967 3300005455 Bacteria 4861
121 Ga0070678_100001012 3300005456 Bacteria 14620
122 Ga0070678_100162149 3300005456 Bacteria 1812
123 Ga0070662_100000796 3300005457 Bacteria 19367
124 Ga0070662_100838111 3300005457 Bacteria 783
125 Ga0070681_10002475 3300005458 Bacteria 16918
126 Ga0070681_10016363 3300005458 Bacteria 7402
127 Ga0070681_10037631 3300005458 Bacteria 4854
128 Ga0070681_10049230 3300005458 Bacteria 4209
129 Ga0070681_10090121 3300005458 Bacteria 3017
130 Ga0070681_10488888 3300005458 Bacteria 1144
131 Ga0070681_10893010 3300005458 Unclassified 807
132 Ga0068867_100006779 3300005459 Bacteria 8095
133 Ga0070685_10000547 3300005466 Bacteria 21062
134 Ga0070685_10060757 3300005466 Bacteria 2211
135 Ga0070706_100195631 3300005467 Bacteria 1889
136 Ga0070679_100002268 3300005530 Bacteria 17373
137 Ga0070679_100037005 3300005530 Bacteria 4845
138 Ga0070679_100071754 3300005530 Bacteria 3454
139 Ga0070679_100283271 3300005530 Bacteria 1609
140 Ga0070684_100000755 3300005535 Bacteria 22399
141 Ga0070684_100052457 3300005535 Bacteria 3547
142 Ga0070684_100079617 3300005535 Bacteria 2897
143 Ga0070697_100273711 3300005536 Bacteria 1448
144 Ga0068853_100000483 3300005539 Bacteria 27159
145 Ga0068853_100240073 3300005539 Bacteria 1661
146 Ga0068853_100316453 3300005539 Bacteria 1446
147 Ga0068853_100430251 3300005539 Bacteria 1239
148 Ga0070672_100000527 3300005543 Bacteria 22399
149 Ga0070672_100598142 3300005543 Bacteria 960
150 Ga0070686_100004541 3300005544 Bacteria 7655
151 Ga0070686_100028407 3300005544 Bacteria 3392
152 Ga0070686_100216175 3300005544 Bacteria 1383
153 Ga0070695_100007154 3300005545 Bacteria 6616
154 Ga0070695_100016829 3300005545 Bacteria 4431
155 Ga0070696_100004211 3300005546 Bacteria 9581
156 Ga0070696_100040575 3300005546 Bacteria 3214
157 Ga0070696_100126980 3300005546 Bacteria 1852
158 Ga0070696_100711268 3300005546 Bacteria 820
159 Ga0070693_100000199 3300005547 Bacteria 28265
160 Ga0070693_100042452 3300005547 Bacteria 2562
161 Ga0070693_100067261 3300005547 Bacteria 2100
162 Ga0070693_100152582 3300005547 Bacteria 1465
163 Ga0070693_100157117 3300005547 Bacteria 1445
164 Ga0070665_100123527 3300005548 Bacteria 2591
165 Ga0070665_100409391 3300005548 Bacteria 1364
166 Ga0070704_100000987 3300005549 Bacteria 14504
167 Ga0070704_100128703 3300005549 Bacteria 1958
168 Ga0070704_100844621 3300005549 Bacteria 821
169 Ga0068855_100004444 3300005563 Bacteria 17127
170 Ga0068855_100015363 3300005563 Bacteria 9217
171 Ga0068855_100339131 3300005563 Bacteria 1658
172 Ga0068855_101061464 3300005563 Bacteria 848
173 Ga0070664_100000895 3300005564 Bacteria 23168
174 Ga0068857_100001816 3300005577 Bacteria 17161
175 Ga0068857_100084708 3300005577 Bacteria 2833
176 Ga0068857_100528032 3300005577 Bacteria 1110
177 Ga0068854_100001812 3300005578 Bacteria 13001
178 Ga0068854_100199360 3300005578 Bacteria 1573
179 Ga0068854_100472263 3300005578 Bacteria 1052
180 Ga0068856_100002507 3300005614 Bacteria 18898
181 Ga0068856_100140935 3300005614 Bacteria 2418
182 Ga0068856_100250036 3300005614 Bacteria 1788
183 Ga0068856_100392362 3300005614 Bacteria 1408
184 Ga0070702_100005184 3300005615 Bacteria 6036
185 Ga0070702_100682654 3300005615 Bacteria 781
186 Ga0068852_100003253 3300005616 Bacteria 11339
187 Ga0068852_100137119 3300005616 Bacteria 2260
188 Ga0068859_100001353 3300005617 Bacteria 25014
189 Ga0068859_100072433 3300005617 Bacteria 3482
190 Ga0068859_100221537 3300005617 Bacteria 1979
191 Ga0068864_100000227 3300005618 Bacteria 50765
192 Ga0068864_100214765 3300005618 Bacteria 1773
193 Ga0068866_10003902 3300005718 Bacteria 6120
194 Ga0068866_10115621 3300005718 Bacteria 1504
195 Ga0068866_10194597 3300005718 Bacteria 1207
196 Ga0068861_100003517 3300005719 Bacteria 10409
197 Ga0068851_10037270 3300005834 Bacteria 2437
198 Ga0068851_10350412 3300005834 Bacteria 859
199 Ga0068870_10000062 3300005840 Bacteria 33752
200 Ga0068863_100000495 3300005841 Bacteria 39957
201 Ga0068858_100000783 3300005842 Bacteria 33229
202 Ga0068858_100112690 3300005842 Bacteria 2540
203 Ga0068858_100453708 3300005842 Bacteria 1236
204 Ga0068860_100022350 3300005843 Bacteria 6119
205 Ga0068860_100240532 3300005843 Bacteria 1761
206 Ga0068862_100003647 3300005844 Bacteria 13173
207 Ga0068862_100235513 3300005844 Bacteria 1662
208 Ga0081455_10000204 3300005937 Bacteria 75793
209 Ga0081455_10037283 3300005937 Bacteria 4320
210 Ga0081540_1012611 3300005983 Bacteria 5547
211 Ga0070717_10011080 3300006028 Bacteria 6833
212 Ga0070717_11043714 3300006028 Bacteria 744
213 Ga0070717_11080886 3300006028 Bacteria 731
214 Ga0075363_100102489 3300006048 Bacteria 1585
215 Ga0075432_10000464 3300006058 Bacteria 12026
216 Ga0070715_10004439 3300006163 Bacteria 4605
217 Ga0070716_100001496 3300006173 Bacteria 10442
218 Ga0070716_100195611 3300006173 Bacteria 1340
219 Ga0070712_100091539 3300006175 Bacteria 2229
220 Ga0070712_100100728 3300006175 Bacteria 2135
221 Ga0070712_100148881 3300006175 Bacteria 1795
222 Ga0070712_100354247 3300006175 Bacteria 1202
223 Ga0075362_10026979 3300006177 Bacteria 2457
224 Ga0075367_10584065 3300006178 Bacteria 710
225 Ga0097621_100000010 3300006237 Bacteria 112867
226 Ga0097621_100023529 3300006237 Bacteria 4798
227 Ga0075370_10463558 3300006353 Bacteria 763
228 Ga0068871_100000034 3300006358 Bacteria 71462
229 Ga0068871_100024903 3300006358 Bacteria 4647
230 Ga0075428_100031223 3300006844 Bacteria 5891
231 Ga0075430_100005373 3300006846 Bacteria 10813
232 Ga0075431_100142954 3300006847 Bacteria 2466
233 Ga0075433_10000774 3300006852 Bacteria 21997
234 Ga0075433_10005737 3300006852 Bacteria 9763
235 Ga0075433_10027741 3300006852 Bacteria 4806
236 Ga0075433_10097733 3300006852 Bacteria 2599
237 Ga0075433_10101236 3300006852 Bacteria 2551
238 Ga0075434_100001700 3300006871 Bacteria 18837
239 Ga0075434_100003565 3300006871 Bacteria 13904
240 Ga0075434_100261194 3300006871 Bacteria 1750
241 Ga0075434_100489468 3300006871 Bacteria 1251
242 Ga0075429_100027666 3300006880 Bacteria 4922
243 Ga0075429_100801880 3300006880 Unclassified 825
244 Ga0068865_100000230 3300006881 Bacteria 31147
245 Ga0068865_100056340 3300006881 Bacteria 2738
246 Ga0068865_100102449 3300006881 Bacteria 2098
247 Ga0075436_100061927 3300006914 Bacteria 2586
248 Ga0075436_100156448 3300006914 Bacteria 1606
249 Ga0075436_100552188 3300006914 Bacteria 845
250 Ga0097620_100001353 3300006931 Bacteria 25014
251 Ga0097620_100072439 3300006931 Bacteria 3482
252 Ga0097620_100221535 3300006931 Bacteria 1979
253 Ga0075435_100001109 3300007076 Bacteria 17153
254 Ga0075435_100017628 3300007076 Bacteria 5410
255 Ga0075435_100116938 3300007076 Bacteria 2222
256 Ga0075435_100192974 3300007076 Bacteria 1724
257 Ga0075435_100305843 3300007076 Bacteria 1360
258 Ga0105251_10038761 3300009011 Bacteria 2332
259 Ga0105250_10040716 3300009092 Bacteria 1863
260 Ga0105240_10020100 3300009093 Bacteria 8914
261 Ga0105240_10067652 3300009093 Bacteria 4427
262 Ga0105240_10966071 3300009093 Bacteria 913
263 Ga0111539_10000932 3300009094 Bacteria 38323
264 Ga0111539_10002162 3300009094 Bacteria 26296
265 Ga0111539_10059566 3300009094 Bacteria 4527
266 Ga0105245_10000258 3300009098 Bacteria 50464
267 Ga0105245_10012413 3300009098 Bacteria 7414
268 Ga0105245_10103418 3300009098 Bacteria 2639
269 Ga0105247_10015208 3300009101 Bacteria 4614
270 Ga0105247_10242887 3300009101 Bacteria 1228
271 Ga0105247_10445797 3300009101 Bacteria 932
272 Ga0105243_10000846 3300009148 Bacteria 29054
273 Ga0105243_10014969 3300009148 Bacteria 5872
274 Ga0105243_10023951 3300009148 Bacteria 4651
275 Ga0105243_10043258 3300009148 Bacteria 3530
276 Ga0105241_10141570 3300009174 Bacteria 1959
277 Ga0105242_10000037 3300009176 Bacteria 91293
278 Ga0105242_10033883 3300009176 Bacteria 4093
279 Ga0105242_10057874 3300009176 Bacteria 3176
280 Ga0105248_10000744 3300009177 Bacteria 36599
281 Ga0105248_10536829 3300009177 Bacteria 1319
282 Ga0105237_10020951 3300009545 Bacteria 6730
283 Ga0105237_10112148 3300009545 Bacteria 2719
284 Ga0105238_10066539 3300009551 Bacteria 3605
285 Ga0105238_10183495 3300009551 Bacteria 2069
286 Ga0105249_10000209 3300009553 Bacteria 67037
287 Ga0105249_10026930 3300009553 Bacteria 5184
288 Ga0105239_10001464 3300010375 Bacteria 31391
289 Ga0105239_10096125 3300010375 Bacteria 3273
290 Ga0105246_10026773 3300011119 Bacteria 3772
291 Ga0105246_10648283 3300011119 Bacteria 919
292 Ga0157328_1001425 3300012478 Bacteria 1025
293 Ga0157314_1002672 3300012500 Bacteria 1237
294 Ga0157314_1013035 3300012500 Bacteria 756
295 Ga0157342_1003689 3300012507 Bacteria 1327
296 Ga0157315_1002711 3300012508 Bacteria 1131
297 Ga0157316_1000114 3300012510 Bacteria 3720
298 Ga0157373_10344110 3300013100 Bacteria 1063
299 Ga0157373_10412442 3300013100 Bacteria 969
300 Ga0157373_10595511 3300013100 Bacteria 805
301 Ga0157371_10151573 3300013102 Bacteria 1654
302 Ga0157371_10421423 3300013102 Bacteria 979
303 Ga0157371_10582158 3300013102 Bacteria 831
304 Ga0157370_10146848 3300013104 Bacteria 2196
305 Ga0157369_10182747 3300013105 Bacteria 2206
306 Ga0157369_10955537 3300013105 Bacteria 878
307 Ga0157378_10001580 3300013297 Bacteria 20573
308 Ga0157378_10711400 3300013297 Bacteria 1025
309 Ga0157378_10819210 3300013297 Bacteria 958
310 Ga0163162_10001677 3300013306 Bacteria 20764
311 Ga0163162_10470559 3300013306 Bacteria 1388
312 Ga0163162_11510553 3300013306 Bacteria 765
313 Ga0157372_10109839 3300013307 Bacteria 3158
314 Ga0157372_10158955 3300013307 Bacteria 2611
315 Ga0157372_10416720 3300013307 Bacteria 1565
316 Ga0157372_10469552 3300013307 Bacteria 1467
317 Ga0157372_10807596 3300013307 Bacteria 1090
318 Ga0157372_10866812 3300013307 Bacteria 1048
319 Ga0157375_10000263 3300013308 Bacteria 47730
320 Ga0157375_10428144 3300013308 Bacteria 1489
321 Ga0163163_10019201 3300014325 Bacteria 6416
322 Ga0163163_11352258 3300014325 Bacteria 774
323 Ga0157380_10000294 3300014326 Bacteria 30013
324 Ga0157380_10077167 3300014326 Bacteria 2714
325 Ga0157377_10001222 3300014745 Bacteria 10959
326 Ga0157379_10002453 3300014968 Bacteria 15540
327 Ga0157379_10027532 3300014968 Bacteria 5061
328 Ga0157379_10696930 3300014968 Bacteria 953
329 Ga0157379_10776966 3300014968 Bacteria 903
330 Ga0157376_10000342 3300014969 Bacteria 31043
331 Ga0157376_10461782 3300014969 Bacteria 1241
332 Ga0157376_11216849 3300014969 Bacteria 782
333 Ga0163161_10000523 3300017792 Bacteria 31363
334 Ga0197907_10014073 3300020069 Bacteria 1087
335 Ga0206356_10130135 3300020070 Bacteria 1443
336 Ga0206354_10382701 3300020081 Bacteria 2413
337 Ga0206353_12062905 3300020082 Bacteria 958
338 Ga0213876_10236414 3300021384 Bacteria 971
339 Ga0207666_1000010 3300025271 Bacteria 46973
340 Ga0207666_1001035 3300025271 Bacteria 3299
341 Ga0207673_1000164 3300025290 Bacteria 6537
342 Ga0207697_10000186 3300025315 Bacteria 32405
343 Ga0207682_10000123 3300025893 Bacteria 34953
344 Ga0207692_10004961 3300025898 Bacteria 5296
345 Ga0207692_10087164 3300025898 Bacteria 1684
346 Ga0207692_10094665 3300025898 Bacteria 1627
347 Ga0207642_10000263 3300025899 Bacteria 15779
348 Ga0207710_10004419 3300025900 Bacteria 6141
349 Ga0207710_10304335 3300025900 Bacteria 806
350 Ga0207688_10000889 3300025901 Bacteria 15094
351 Ga0207688_10056265 3300025901 Bacteria 2209
352 Ga0207680_10001117 3300025903 Bacteria 12657
353 Ga0207680_10077237 3300025903 Bacteria 2082
354 Ga0207647_10005506 3300025904 Bacteria 9270
355 Ga0207647_10046296 3300025904 Bacteria 2711
356 Ga0207685_10001241 3300025905 Bacteria 5199
357 Ga0207699_10023071 3300025906 Bacteria 3382
358 Ga0207699_10026530 3300025906 Bacteria 3195
359 Ga0207645_10000023 3300025907 Bacteria 98724
360 Ga0207645_10020930 3300025907 Bacteria 4272
361 Ga0207645_10051083 3300025907 Bacteria 2641
362 Ga0207645_10132679 3300025907 Bacteria 1621
363 Ga0207643_10000007 3300025908 Bacteria 171706
364 Ga0207705_10025609 3300025909 Bacteria 4209
365 Ga0207705_10216574 3300025909 Bacteria 1453
366 Ga0207684_10339377 3300025910 Bacteria 1294
367 Ga0207654_10374275 3300025911 Bacteria 985
368 Ga0207707_10002015 3300025912 Bacteria 18441
369 Ga0207707_10094416 3300025912 Bacteria 2613
370 Ga0207707_10112364 3300025912 Bacteria 2382
371 Ga0207707_10217291 3300025912 Bacteria 1664
372 Ga0207707_10430416 3300025912 Bacteria 1130
373 Ga0207707_10565521 3300025912 Bacteria 965
374 Ga0207695_10092228 3300025913 Bacteria 3040
375 Ga0207695_10338560 3300025913 Bacteria 1392
376 Ga0207671_10008841 3300025914 Bacteria 8482
377 Ga0207693_10012859 3300025915 Bacteria 6754
378 Ga0207693_10099654 3300025915 Bacteria 2278
379 Ga0207693_10117664 3300025915 Bacteria 2087
380 Ga0207693_10132335 3300025915 Bacteria 1961
381 Ga0207693_10233177 3300025915 Bacteria 1445
382 Ga0207693_10291617 3300025915 Bacteria 1279
383 Ga0207693_10576547 3300025915 Bacteria 877
384 Ga0207663_10004450 3300025916 Bacteria 6968
385 Ga0207663_10040066 3300025916 Bacteria 2844
386 Ga0207663_10060441 3300025916 Bacteria 2401
387 Ga0207660_10000393 3300025917 Bacteria 28822
388 Ga0207660_10005747 3300025917 Bacteria 8044
389 Ga0207660_10110494 3300025917 Bacteria 2068
390 Ga0207660_10128860 3300025917 Bacteria 1924
391 Ga0207660_10189395 3300025917 Bacteria 1601
392 Ga0207662_10000136 3300025918 Bacteria 35258
393 Ga0207662_10011289 3300025918 Bacteria 4947
394 Ga0207662_10252685 3300025918 Bacteria 1158
395 Ga0207657_10005004 3300025919 Bacteria 13924
396 Ga0207657_10055737 3300025919 Bacteria 3413
397 Ga0207649_10000434 3300025920 Bacteria 30314
398 Ga0207652_10001720 3300025921 Bacteria 19098
399 Ga0207652_10016915 3300025921 Bacteria 5964
400 Ga0207652_10425908 3300025921 Bacteria 1197
401 Ga0207681_10000273 3300025923 Bacteria 38704
402 Ga0207681_10173194 3300025923 Bacteria 1637
403 Ga0207681_10859255 3300025923 Bacteria 759
404 Ga0207694_10052606 3300025924 Bacteria 3156
405 Ga0207694_10596276 3300025924 Bacteria 929
406 Ga0207650_10001932 3300025925 Bacteria 14593
407 Ga0207650_10597000 3300025925 Bacteria 928
408 Ga0207659_10000097 3300025926 Bacteria 51545
409 Ga0207659_10059029 3300025926 Bacteria 2756
410 Ga0207687_10001031 3300025927 Bacteria 18938
411 Ga0207687_10020925 3300025927 Bacteria 4343
412 Ga0207700_10000167 3300025928 Bacteria 39027
413 Ga0207700_10108029 3300025928 Bacteria 2233
414 Ga0207700_10207267 3300025928 Bacteria 1655
415 Ga0207700_10307066 3300025928 Bacteria 1371
416 Ga0207700_11001076 3300025928 Bacteria 748
417 Ga0207664_10038266 3300025929 Bacteria 3718
418 Ga0207664_10135349 3300025929 Bacteria 2079
419 Ga0207664_10243891 3300025929 Bacteria 1566
420 Ga0207664_10271211 3300025929 Bacteria 1486
421 Ga0207644_10001738 3300025931 Bacteria 14101
422 Ga0207644_10036997 3300025931 Bacteria 3430
423 Ga0207690_10000962 3300025932 Bacteria 18398
424 Ga0207690_10151161 3300025932 Bacteria 1721
425 Ga0207690_10289535 3300025932 Bacteria 1278
426 Ga0207690_10340419 3300025932 Bacteria 1184
427 Ga0207690_10824478 3300025932 Bacteria 767
428 Ga0207706_10000867 3300025933 Bacteria 31142
429 Ga0207706_10017224 3300025933 Bacteria 6513
430 Ga0207706_10021114 3300025933 Bacteria 5849
431 Ga0207706_10036344 3300025933 Bacteria 4375
432 Ga0207686_10000329 3300025934 Bacteria 34169
433 Ga0207686_10107854 3300025934 Bacteria 1872
434 Ga0207709_10000419 3300025935 Bacteria 41401
435 Ga0207709_10045024 3300025935 Bacteria 2670
436 Ga0207709_10101156 3300025935 Bacteria 1906
437 Ga0207709_10245035 3300025935 Bacteria 1306
438 Ga0207670_10000536 3300025936 Bacteria 20898
439 Ga0207670_10792165 3300025936 Bacteria 789
440 Ga0207669_10002798 3300025937 Bacteria 7473
441 Ga0207704_10000119 3300025938 Bacteria 43208
442 Ga0207704_10074797 3300025938 Bacteria 2163
443 Ga0207704_10282642 3300025938 Bacteria 1262
444 Ga0207704_11061300 3300025938 Bacteria 687
445 Ga0207665_10000417 3300025939 Bacteria 29333
446 Ga0207691_10000544 3300025940 Bacteria 37754
447 Ga0207691_10023702 3300025940 Bacteria 5777
448 Ga0207691_10170474 3300025940 Bacteria 1906
449 Ga0207691_10395597 3300025940 Bacteria 1179
450 Ga0207711_10002468 3300025941 Bacteria 16502
451 Ga0207711_10105904 3300025941 Bacteria 2494
452 Ga0207711_10319609 3300025941 Bacteria 1434
453 Ga0207689_10001743 3300025942 Bacteria 20521
454 Ga0207689_10381710 3300025942 Bacteria 1173
455 Ga0207689_10461869 3300025942 Bacteria 1062
456 Ga0207661_10000428 3300025944 Bacteria 27215
457 Ga0207661_10492543 3300025944 Bacteria 1120
458 Ga0207661_11466608 3300025944 Bacteria 626
459 Ga0207679_10000029 3300025945 Bacteria 183002
460 Ga0207679_10129224 3300025945 Bacteria 2024
461 Ga0207679_10278209 3300025945 Bacteria 1434
462 Ga0207667_10017999 3300025949 Bacteria 7935
463 Ga0207667_10056714 3300025949 Bacteria 4114
464 Ga0207667_10120758 3300025949 Bacteria 2700
465 Ga0207667_10407367 3300025949 Bacteria 1384
466 Ga0207667_11133467 3300025949 Bacteria 764
467 Ga0207651_10000083 3300025960 Bacteria 42310
468 Ga0207712_10000471 3300025961 Bacteria 33929
469 Ga0207712_10019998 3300025961 Bacteria 4380
470 Ga0207668_10000862 3300025972 Bacteria 18292
471 Ga0207640_10000637 3300025981 Bacteria 20610
472 Ga0207640_10494373 3300025981 Bacteria 1017
473 Ga0207640_10800633 3300025981 Bacteria 816
474 Ga0207658_10002203 3300025986 Bacteria 14473
475 Ga0207658_10041282 3300025986 Bacteria 3340
476 Ga0207658_10041634 3300025986 Bacteria 3328
477 Ga0207658_10342647 3300025986 Bacteria 1299
478 Ga0207658_11021815 3300025986 Bacteria 754
479 Ga0207658_11657912 3300025986 Bacteria 584
480 Ga0207677_10000992 3300026023 Bacteria 15647
481 Ga0207677_10368905 3300026023 Bacteria 1208
482 Ga0207677_10791571 3300026023 Bacteria 848
483 Ga0207703_10005165 3300026035 Bacteria 10555
484 Ga0207703_10008054 3300026035 Bacteria 8328
485 Ga0207703_10592055 3300026035 Bacteria 1048
486 Ga0207639_10005126 3300026041 Bacteria 8828
487 Ga0207639_10117256 3300026041 Bacteria 2181
488 Ga0207639_10221184 3300026041 Bacteria 1635
489 Ga0207678_10001568 3300026067 Bacteria 21015
490 Ga0207678_10021304 3300026067 Bacteria 5683
491 Ga0207678_10029617 3300026067 Bacteria 4780
492 Ga0207678_10055746 3300026067 Bacteria 3404
493 Ga0207678_10666137 3300026067 Bacteria 915
494 Ga0207708_10002060 3300026075 Bacteria 14813
495 Ga0207708_10005462 3300026075 Bacteria 9377
496 Ga0207708_10017276 3300026075 Bacteria 5431
497 Ga0207702_10001921 3300026078 Bacteria 20316
498 Ga0207702_10369941 3300026078 Bacteria 1376
499 Ga0207702_11433417 3300026078 Bacteria 684
500 Ga0207641_10000510 3300026088 Bacteria 43699
501 Ga0207648_10003487 3300026089 Bacteria 16487
502 Ga0207648_10212920 3300026089 Bacteria 1716
503 Ga0207648_10462116 3300026089 Bacteria 1157
504 Ga0207676_10003788 3300026095 Bacteria 10694
505 Ga0207676_10028269 3300026095 Bacteria 4186
506 Ga0207676_10102196 3300026095 Bacteria 2379
507 Ga0207674_10000608 3300026116 Bacteria 46971
508 Ga0207674_10141868 3300026116 Bacteria 2362
509 Ga0207674_10495818 3300026116 Bacteria 1180
510 Ga0207675_100000805 3300026118 Bacteria 31142
511 Ga0207675_100026921 3300026118 Bacteria 5353
512 Ga0207675_100714409 3300026118 Bacteria 1012
513 Ga0207683_10000082 3300026121 Bacteria 74842
514 Ga0207683_10006710 3300026121 Bacteria 9849
515 Ga0207683_10056132 3300026121 Bacteria 3454
516 Ga0207698_10000377 3300026142 Bacteria 25983
517 Ga0207698_10091738 3300026142 Bacteria 2488
518 Ga0207698_10313595 3300026142 Bacteria 1466
519 Ga0209967_1037373 3300027364 Bacteria 735
520 Ga0209984_1003002 3300027424 Bacteria 1907
521 Ga0209995_1018973 3300027471 Bacteria 1135
522 Ga0210002_1003792 3300027617 Bacteria 2243
523 Ga0209983_1006337 3300027665 Bacteria 2434
524 Ga0209971_1003286 3300027682 Bacteria 3842
525 Ga0209966_1001565 3300027695 Bacteria 3962
526 Ga0209966_1016036 3300027695 Bacteria 1413
527 Ga0209998_10000947 3300027717 Bacteria 7360
528 Ga0209998_10007515 3300027717 Bacteria 2261
529 Ga0209998_10009536 3300027717 Bacteria 2016
530 Ga0209974_10029116 3300027876 Bacteria 1830
531 Ga0209974_10047466 3300027876 Bacteria 1438
532 Ga0209974_10118998 3300027876 Bacteria 935
533 Ga0207428_10000124 3300027907 Bacteria 105795
534 Ga0207428_10000420 3300027907 Bacteria 52679
535 Ga0207428_10000703 3300027907 Bacteria 38851
536 Ga0268266_10101549 3300028379 Bacteria 2536
537 Ga0268265_10001170 3300028380 Bacteria 22993
538 Ga0268265_10017735 3300028380 Bacteria 4920
539 Ga0268264_10001878 3300028381 Bacteria 19073
540 Ga0268264_10047711 3300028381 Bacteria 3560
541 Ga0265337_1006137 3300028556 Bacteria 4674
542 Ga0265334_10054444 3300028573 Bacteria 1526
543 Ga0265338_10061561 3300028800 Bacteria 3289
544 Ga0265763_1002495 3300030763 Bacteria 1414
545 Ga0265773_1005860 3300031018 Bacteria 908
546 Ga0265760_10017485 3300031090 Bacteria 2060
547 Ga0265330_10058291 3300031235 Bacteria 1683
548 Ga0265325_10000105 3300031241 Bacteria 59642
549 Ga0265325_10007951 3300031241 Bacteria 6300
550 Ga0265325_10231447 3300031241 Bacteria 842
551 Ga0265325_10259934 3300031241 Bacteria 784
552 Ga0265340_10108658 3300031247 Bacteria 1284
553 Ga0265339_10005247 3300031249 Bacteria 8648
554 Ga0265339_10010020 3300031249 Bacteria 5910
555 Ga0265339_10106798 3300031249 Bacteria 1452
556 Ga0265316_10054466 3300031344 Bacteria 3132
557 Ga0265316_10215591 3300031344 Bacteria 1418
558 Ga0265313_10000041 3300031595 Bacteria 119119
559 Ga0265313_10035872 3300031595 Bacteria 2493
560 Ga0265313_10041344 3300031595 Bacteria 2272
561 Ga0265313_10106271 3300031595 Bacteria 1239
562 Ga0265313_10110491 3300031595 Bacteria 1209
563 Ga0316579_10042737 3300031691 Bacteria 2106
564 Ga0265314_10000279 3300031711 Bacteria 74300
565 Ga0265314_10017694 3300031711 Bacteria 5585
566 Ga0265342_10001077 3300031712 Bacteria 26505
567 Ga0265342_10054402 3300031712 Bacteria 2378
568 Ga0307413_10143610 3300031824 Bacteria 1653
569 Ga0307411_10191027 3300032005 Bacteria 1564
570 Ga0307415_100621291 3300032126 Bacteria 965
571 Ga0316583_10003152 3300032133 Bacteria 5794
572 Ga0373930_0000680 3300034816 Bacteria 4768
573 Ga0373930_0008825 3300034816 Bacteria 1771
574 Ga0373948_0000196 3300034817 Bacteria 6999
575 Ga0373950_0001373 3300034818 Bacteria 3163
576 Ga0373950_0005433 3300034818 Bacteria 1904
577 Ga0373958_0001277 3300034819 Bacteria 3363
578 Ga0373958_0002069 3300034819 Bacteria 2771
579 Ga0373958_0020804 3300034819 Bacteria 1212
580 Ga0373959_0043135 3300034820 Bacteria 953
581 Ga0373959_0150486 3300034820 Bacteria 588
582 Ga0373938_0000092 3300034957 Bacteria 12211
583 Ga0373938_0003487 3300034957 Bacteria 2580
584 Ga0373938_0020764 3300034957 Bacteria 1326
585 Ga0373926_0041110 3300035083 Bacteria 1651
586 Ga0373926_0205655 3300035083 Bacteria 758
587 Ga0373928_0003337 3300035084 Bacteria 3068
588 Ga0373928_0005526 3300035084 Bacteria 2417
589 Ga0373929_0000128 3300035085 Bacteria 12674
590 Ga0373940_0005195 3300035088 Bacteria 2804
591 Ga0373940_0035562 3300035088 Unclassified 1349
592 Ga0373940_0049925 3300035088 Bacteria 1172
593 Ga0373944_0045330 3300035089 Bacteria 1372
594 Ga0373949_0000715 3300035090 Bacteria 10774
595 Ga0373949_0011216 3300035090 Bacteria 1971
596 Ga0373949_0035614 3300035090 Bacteria 1204
597 Ga0373951_0000531 3300035091 Bacteria 10760
598 Ga0373951_0003670 3300035091 Bacteria 3703
599 Ga0373952_0006526 3300035092 Bacteria 2158
600 Ga0373952_0008456 3300035092 Bacteria 1954
601 Ga0373923_0002485 3300035111 Bacteria 5690
602 Ga0373923_0090402 3300035111 Bacteria 1339
603 Ga0373932_0000510 3300035112 Bacteria 11939
604 Ga0373932_0000597 3300035112 Bacteria 11032
605 Ga0373932_0002240 3300035112 Bacteria 4953
606 Ga0373936_0007526 3300035113 Bacteria 4096
607 Ga0373939_0000361 3300035114 Bacteria 11487
608 Ga0373939_0000377 3300035114 Bacteria 11260
609 Ga0373939_0013576 3300035114 Bacteria 2099
610 Ga0373939_0016420 3300035114 Bacteria 1952
611 Ga0373941_0020117 3300035115 Bacteria 1867
612 Ga0373941_0118879 3300035115 Bacteria 940
613 Ga0373945_0001243 3300035116 Bacteria 7756
614 Ga0373953_0003611 3300035117 Bacteria 4843
615 Ga0373953_0427848 3300035117 Bacteria 584
616 Ga0373954_0015537 3300035118 Bacteria 3403
617 Ga0373954_0096413 3300035118 Bacteria 1424
618 Ga0373954_0252495 3300035118 Bacteria 868
619 Ga0373956_0018425 3300035119 Bacteria 2957
620 Ga0373956_0077711 3300035119 Bacteria 1520
621 Ga0373956_0343485 3300035119 Bacteria 711
622 Ga0373957_0013805 3300035120 Bacteria 2749
623 Ga0373957_0079690 3300035120 Bacteria 1291
624 Ga0373960_0000204 3300035121 Bacteria 10830
625 Ga0373960_0001684 3300035121 Bacteria 4947
626 Ga0373943_0003538 3300035170 Bacteria 7112
627 Ga0373943_0105507 3300035170 Bacteria 1479
628 Ga0373943_0474672 3300035170 Bacteria 729
629 Ga0373946_0003985 3300035171 Bacteria 5252
630 Ga0373946_0172606 3300035171 Bacteria 1021
631 Ga0373955_0018458 3300035172 Bacteria 3469
632 Ga0373955_0248942 3300035172 Bacteria 1065
633 Ga0373942_0000813 3300035207 Bacteria 8599
634 Ga0373942_0002869 3300035207 Bacteria 4095
635 Ga0373961_0001755 3300035241 Bacteria 6010
636 Ga0373961_0001827 3300035241 Bacteria 5833
637 Ga0373961_0106872 3300035241 Bacteria 912
638 Ga0373962_0066553 3300035242 Bacteria 1068
639 Ga0373962_0113069 3300035242 Bacteria 858
640 Ga0373924_0016721 3300035410 Bacteria 2805
641 Ga0373924_0026473 3300035410 Bacteria 2301
642 Ga0373924_0065453 3300035410 Bacteria 1526
643 Ga0373931_0000186 3300035691 Bacteria 26950
644 Ga0373931_0002333 3300035691 Bacteria 8383
645 Ga0373931_0003707 3300035691 Bacteria 6911
646 Ga0373935_0016872 3300035692 Bacteria 4422
647 Ga0373935_0107931 3300035692 Bacteria 1844
648 Ga0373935_0692866 3300035692 Bacteria 749
649 Ga0373927_0063603 3300035695 Bacteria 2386
650 Ga0373927_0182286 3300035695 Unclassified 1377
651 Ga0373933_0016462 3300035724 Bacteria 4135
652 Ga0373933_0072189 3300035724 Bacteria 2102
653 Ga0373947_0004569 3300035725 Bacteria 8119
654 Ga0373937_0009657 3300036401 Bacteria 8402
655 Ga0373937_0016585 3300036401 Bacteria 6544
656 Ga0373937_0023701 3300036401 Bacteria 5532
657 Ga0373937_0025502 3300036401 Bacteria 5336
658 Ga0373937_0199890 3300036401 Bacteria 1879
659 Ga0373937_0494850 3300036401 Bacteria 1161
660 Ga0316582_0678080 3300036647 Bacteria 708
661 Ga0373925_0005307 3300037068 Bacteria 9621
662 Ga0373925_0010134 3300037068 Bacteria 6842
663 Ga0373925_0042928 3300037068 Bacteria 3355
664 Ga0373925_0058062 3300037068 Bacteria 2900
665 Ga0373925_0473795 3300037068 Bacteria 1027
666 Ga0395899_0001670 3300037312 Bacteria 18498
667 Ga0395900_0003491 3300037418 Bacteria 16965
668 Ga0395900_0030502 3300037418 Bacteria 5536
669 Ga0395900_0125555 3300037418 Bacteria 2632
670 Ga0395898_0002609 3300037466 Bacteria 21035
671 Ga0395898_0014973 3300037466 Bacteria 7963
672 Ga0395898_0322637 3300037466 Bacteria 1473
673 Ga0395901_0005021 3300038443 Bacteria 13359
674 Ga0395901_0205014 3300038443 Bacteria 2066
675 Ga0242420_019213 3300038996 Bacteria 1209
676 Ga0436365_0823677 3300039437 Bacteria 2841
677 Ga0436365_1587891 3300039437 Bacteria 1261
678 Ga0451839_1211329 3300041496 Bacteria 720
679 Ga0451853_1133953 3300041512 Bacteria 2211
680 Ga0439448_0090643 3300042005 Bacteria 1033
681 Ga0439450_031306 3300042008 Bacteria 1197
682 Ga0439455_0003575 3300042012 Bacteria 2988
683 Ga0439459_0067897 3300042438 Bacteria 819
684 Ga0451577_0600374 3300042876 Bacteria 999
685 Ga0466966_0112578 3300044684 Bacteria 1677
686 Ga0466961_0088464 3300044693 Bacteria 1957
687 Ga0466963_0230872 3300044694 Bacteria 1296
688 Ga0453684_0066809 3300044712 Bacteria 4577
689 Ga0466957_0272693 3300044842 Bacteria 1130
690 Ga0451576_0039893 3300045051 Bacteria 4970
691 Ga0466958_0388769 3300045836 Bacteria 900
692 Ga0466958_0411635 3300045836 Bacteria 874
693 Ga0466967_0005780 3300045976 Bacteria 8647
694 Ga0466967_0539386 3300045976 Bacteria 1147
695 Ga0495592_0001116 3300046454 Bacteria 18677
696 Ga0495592_0009742 3300046454 Bacteria 7231
697 Ga0495592_0057294 3300046454 Bacteria 2876
698 Ga0495592_0096795 3300046454 Bacteria 2109
699 Ga0495592_0470310 3300046454 Bacteria 785
700 Ga0495603_0012962 3300046455 Bacteria 5041
701 Ga0495629_0006281 3300046459 Bacteria 8819
702 Ga0495629_0016112 3300046459 Bacteria 5367
703 Ga0495629_0024439 3300046459 Bacteria 4302
704 Ga0495641_0023574 3300046461 Bacteria 3053
705 Ga0495641_0031793 3300046461 Bacteria 2518
706 Ga0495641_0188442 3300046461 Bacteria 924
707 Ga0495641_0285807 3300046461 Bacteria 743
708 Ga0495651_0000493 3300046462 Bacteria 30523
709 Ga0495651_0016283 3300046462 Bacteria 5757
710 Ga0495651_0283940 3300046462 Bacteria 1117
711 Ga0495653_0004657 3300046463 Bacteria 11097
712 Ga0495653_0012444 3300046463 Bacteria 6947
713 Ga0495653_0041839 3300046463 Bacteria 3574
714 Ga0495580_0483081 3300046472 Bacteria 828
715 Ga0495582_0001705 3300046473 Bacteria 12400
716 Ga0495582_0015446 3300046473 Bacteria 4193
717 Ga0495639_0019431 3300046475 Bacteria 2965
718 Ga0495639_0046937 3300046475 Bacteria 1956
719 Ga0495662_0009777 3300046476 Bacteria 4711
720 Ga0495662_0023030 3300046476 Bacteria 3007
721 Ga0495664_0001609 3300046477 Bacteria 12011
722 Ga0495664_0523671 3300046477 Bacteria 707
723 Ga0495584_0014705 3300046491 Bacteria 3988
724 Ga0495585_0009128 3300046492 Bacteria 5970
725 Ga0495594_0047336 3300046499 Bacteria 2361
726 Ga0495594_0101905 3300046499 Unclassified 1615
727 Ga0495607_0004288 3300046501 Bacteria 10532
728 Ga0495608_0010562 3300046511 Bacteria 6442
729 Ga0495608_0013937 3300046511 Bacteria 5580
730 Ga0495608_0110542 3300046511 Bacteria 1767
731 Ga0495608_0151432 3300046511 Bacteria 1478
732 Ga0495618_0007452 3300046514 Bacteria 6617
733 Ga0495618_0014982 3300046514 Bacteria 4728
734 Ga0495628_0002046 3300046516 Bacteria 18273
735 Ga0495628_0009974 3300046516 Bacteria 8082
736 Ga0495628_0014402 3300046516 Bacteria 6630
737 Ga0495630_0023584 3300046517 Bacteria 4548
738 Ga0495630_0157643 3300046517 Bacteria 1728
739 Ga0495630_0542717 3300046517 Bacteria 891
740 Ga0495630_0725421 3300046517 Bacteria 760
741 Ga0495637_0101288 3300046520 Bacteria 1125
742 Ga0495644_0000514 3300046523 Bacteria 16546
743 Ga0495666_0001847 3300046526 Bacteria 10463
744 Ga0495652_0020653 3300046529 Bacteria 5854
745 Ga0495652_0234879 3300046529 Bacteria 1368
746 Ga0495665_0006322 3300046531 Bacteria 6389
747 Ga0495665_0052492 3300046531 Bacteria 2158
748 Ga0495640_0020957 3300046533 Bacteria 4805
749 Ga0495640_0081965 3300046533 Bacteria 2144
750 Ga0495586_0060389 3300046535 Bacteria 2061
751 Ga0495587_0000335 3300046536 Bacteria 33563
752 Ga0495587_0027769 3300046536 Bacteria 3445
753 Ga0495598_0195351 3300046537 Bacteria 728
754 Ga0495609_0023913 3300046538 Bacteria 2805
755 Ga0495645_0001781 3300046543 Bacteria 14625
756 Ga0495645_0123648 3300046543 Bacteria 1819
757 Ga0495645_0154375 3300046543 Bacteria 1592
758 Ga0495645_0674978 3300046543 Bacteria 629
759 Ga0495622_0018802 3300046557 Bacteria 3218
760 Ga0495622_0093569 3300046557 Bacteria 1380
761 Ga0495667_0004928 3300046559 Bacteria 9026
762 Ga0495667_0019211 3300046559 Bacteria 4611
763 Ga0495667_0021834 3300046559 Bacteria 4317
764 Ga0495667_0042835 3300046559 Bacteria 3001
765 Ga0495667_0358182 3300046559 Bacteria 921
766 Ga0495656_0019735 3300046615 Bacteria 2605
767 Ga0495634_0007696 3300046642 Bacteria 8061
768 Ga0495634_0017766 3300046642 Bacteria 5071
769 Ga0495635_0000736 3300046663 Bacteria 21173
770 Ga0495635_0004379 3300046663 Bacteria 9778
771 Ga0495635_0031122 3300046663 Bacteria 3707
772 Ga0495635_0045113 3300046663 Bacteria 3041
773 Ga0495635_0061837 3300046663 Bacteria 2571
774 Ga0495635_0201286 3300046663 Bacteria 1351
775 Ga0495659_0008156 3300046664 Bacteria 3329
776 Ga0495588_0013623 3300046674 Bacteria 3876
777 Ga0495657_0000836 3300046675 Bacteria 27235
778 Ga0495657_0082765 3300046675 Bacteria 2073
779 Ga0495657_0110571 3300046675 Bacteria 1741
780 Ga0495657_0249728 3300046675 Bacteria 1068
781 Ga0495657_0393244 3300046675 Bacteria 817
782 Ga0495599_0003364 3300046678 Bacteria 9345
783 Ga0495599_0134578 3300046678 Bacteria 1534
784 Ga0495623_0027709 3300046679 Bacteria 3647
785 Ga0495646_0000229 3300046680 Bacteria 27971
786 Ga0495646_0006372 3300046680 Bacteria 7484
787 Ga0495647_0008999 3300046681 Bacteria 3368
788 Ga0495658_0000591 3300046683 Bacteria 19855
789 Ga0495658_0002748 3300046683 Bacteria 8846
790 Ga0495669_0119181 3300046684 Bacteria 1236
791 Ga0495669_0182857 3300046684 Bacteria 999
792 Ga0495613_0047264 3300046689 Bacteria 3179
793 Ga0495613_0115614 3300046689 Unclassified 1930
794 Ga0495624_0009422 3300046690 Bacteria 6764
795 Ga0495670_0008959 3300046691 Bacteria 4922
796 Ga0495671_0085443 3300046692 Bacteria 1546
797 Ga0495600_0004219 3300046809 Bacteria 8582
798 Ga0495600_0009757 3300046809 Bacteria 5935
799 Ga0495600_0135366 3300046809 Bacteria 1601
800 Ga0495600_0261780 3300046809 Bacteria 1098
801 Ga0495581_0017156 3300047315 Bacteria 4207
802 Ga0495581_0035361 3300047315 Bacteria 2891
803 Ga0495604_0021677 3300047317 Bacteria 5129
804 Ga0495604_0028471 3300047317 Bacteria 4444
805 Ga0495604_0043834 3300047317 Bacteria 3499
806 Ga0495636_0477254 3300047318 Bacteria 601
807 Ga0495674_0034790 3300047319 Bacteria 4551
808 Ga0495674_0040549 3300047319 Bacteria 4164
809 Ga0495674_0050397 3300047319 Bacteria 3673
810 Ga0495674_1288000 3300047319 Bacteria 549
811 Ga0495676_0017949 3300047321 Bacteria 6244
812 Ga0495680_0005567 3300047322 Bacteria 11823
813 Ga0495680_0008046 3300047322 Bacteria 9614
814 Ga0495680_0015939 3300047322 Bacteria 6468
815 Ga0495680_0036864 3300047322 Bacteria 3921
816 Ga0495680_0075306 3300047322 Bacteria 2561
817 Ga0495675_0000139 3300047444 Bacteria 50643
818 Ga0495675_0177155 3300047444 Bacteria 1307
819 Ga0495677_0019658 3300047445 Bacteria 2449
820 Ga0495684_0006324 3300047471 Bacteria 9204
821 Ga0495684_0016053 3300047471 Bacteria 5765
822 Ga0495684_0255654 3300047471 Bacteria 1273
823 Ga0495593_0064941 3300047673 Unclassified 1904
824 Ga0495593_0116979 3300047673 Bacteria 1358
825 Ga0495602_0004714 3300048088 Bacteria 14255
826 Ga0495602_0006950 3300048088 Bacteria 11884
827 Ga0495602_0112730 3300048088 Bacteria 2206
828 Ga0495602_0630110 3300048088 Bacteria 734
829 Ga0495614_0263582 3300048089 Bacteria 790
830 Ga0496100_0000057 3300048903 Bacteria 67216
831 Ga0496100_0088881 3300048903 Bacteria 2103
832 Ga0496100_0126792 3300048903 Bacteria 1792
833 Ga0496100_1162460 3300048903 Bacteria 608
834 Ga0496101_0001297 3300048904 Bacteria 14944
835 Ga0496101_0021335 3300048904 Bacteria 4450
836 Ga0496101_0697545 3300048904 Bacteria 801
837 Ga0496102_0001628 3300048905 Bacteria 19791
838 Ga0496102_0031718 3300048905 Bacteria 4742
839 Ga0496102_0146655 3300048905 Bacteria 2215
840 Ga0496102_0447252 3300048905 Bacteria 1212
841 Ga0496102_0450410 3300048905 Bacteria 1208
842 Ga0496102_0465246 3300048905 Bacteria 1185
843 Ga0496103_0003313 3300048906 Bacteria 9851
844 Ga0496103_0016110 3300048906 Bacteria 4460
845 Ga0496104_0000658 3300048907 Bacteria 29624
846 Ga0496104_0063613 3300048907 Bacteria 3499
847 Ga0496104_0143016 3300048907 Bacteria 2298
848 Ga0496104_0242057 3300048907 Bacteria 1716
849 Ga0496104_0330861 3300048907 Bacteria 1436
850 Ga0496104_0349874 3300048907 Bacteria 1390
851 Ga0496104_0378776 3300048907 Bacteria 1328
852 Ga0496105_0003619 3300048908 Bacteria 11480
853 Ga0496105_0007433 3300048908 Bacteria 8478
854 Ga0496105_0051118 3300048908 Bacteria 3415
855 Ga0496105_0128809 3300048908 Bacteria 2087
856 Ga0496105_0713944 3300048908 Bacteria 768
857 Ga0496106_0000518 3300048909 Bacteria 27401
858 Ga0496106_0013856 3300048909 Bacteria 5957
859 Ga0496106_0016140 3300048909 Bacteria 5524
860 Ga0496106_0036474 3300048909 Bacteria 3678
861 Ga0496106_0211603 3300048909 Bacteria 1544
862 Ga0496107_0001129 3300048910 Bacteria 16115
863 Ga0496107_0008616 3300048910 Bacteria 7063
864 Ga0496107_0023162 3300048910 Bacteria 4389
865 Ga0496107_0061873 3300048910 Bacteria 2711
866 Ga0496107_0275409 3300048910 Bacteria 1252
867 Ga0496107_0981283 3300048910 Bacteria 613
868 Ga0496108_0004254 3300048911 Bacteria 11528
869 Ga0496108_0044088 3300048911 Bacteria 3724
870 Ga0496109_0000390 3300048912 Bacteria 39843
871 Ga0496109_0002432 3300048912 Bacteria 15587
872 Ga0496109_0023523 3300048912 Bacteria 5470
873 Ga0496109_0038068 3300048912 Bacteria 4348
874 Ga0496110_0005641 3300048913 Bacteria 9824
875 Ga0496110_0014086 3300048913 Bacteria 6630
876 Ga0496110_0186510 3300048913 Bacteria 1883
877 Ga0496111_0020628 3300048914 Bacteria 4590
878 Ga0496111_0027669 3300048914 Bacteria 4014
879 Ga0496111_0092363 3300048914 Bacteria 2218
880 Ga0496112_0025896 3300048915 Bacteria 5636
881 Ga0496113_0019170 3300048916 Bacteria 4780
882 Ga0496113_0120372 3300048916 Bacteria 2051
883 Ga0496114_0002944 3300048917 Bacteria 13059
884 Ga0496114_0046938 3300048917 Bacteria 3590
885 Ga0496114_0266690 3300048917 Bacteria 1508
886 Ga0496114_0704363 3300048917 Bacteria 885
887 Ga0496115_0014682 3300048918 Bacteria 5932
888 Ga0496115_0073108 3300048918 Bacteria 2782
889 Ga0496115_0179507 3300048918 Bacteria 1750
890 Ga0496115_0586416 3300048918 Bacteria 887
891 Ga0496125_0300386 3300048928 Bacteria 984
892 Ga0501031_0086545 3300049568 Bacteria 2043
893 Ga0501031_0212867 3300049568 Bacteria 1259
894 Ga0501032_0012835 3300049569 Bacteria 5974
895 Ga0501032_0021838 3300049569 Bacteria 4444
896 Ga0501032_0052659 3300049569 Bacteria 2742
897 Ga0501032_0100027 3300049569 Bacteria 1921
898 Ga0501033_0139839 3300049570 Bacteria 1750
899 Ga0501034_0002292 3300049571 Bacteria 23472
900 Ga0501034_0020882 3300049571 Bacteria 6685
901 Ga0501034_0024137 3300049571 Bacteria 6185
902 Ga0501034_0076586 3300049571 Bacteria 3352
903 Ga0501034_0305190 3300049571 Bacteria 1527
904 Ga0501034_1229354 3300049571 Bacteria 627
905 Ga0501036_0000609 3300049572 Bacteria 25966
906 Ga0501036_0054800 3300049572 Bacteria 3378
907 Ga0501036_0205765 3300049572 Bacteria 1654
908 Ga0501036_0364435 3300049572 Bacteria 1206
909 Ga0501037_0007571 3300049573 Bacteria 7951
910 Ga0501037_0036674 3300049573 Bacteria 3612
911 Ga0501037_0517999 3300049573 Bacteria 807
912 Ga0501038_0016827 3300049574 Bacteria 6618
913 Ga0501038_0049627 3300049574 Bacteria 3628
914 Ga0501038_0051768 3300049574 Bacteria 3541
915 Ga0501038_0485019 3300049574 Bacteria 947
916 Ga0501039_0029717 3300049575 Bacteria 4210
917 Ga0501039_0038774 3300049575 Bacteria 3679
918 Ga0501039_0163405 3300049575 Bacteria 1750
919 Ga0501040_0089076 3300049576 Bacteria 2144
920 Ga0501040_0321027 3300049576 Bacteria 1108
921 Ga0501042_0495404 3300049578 Bacteria 887
922 Ga0501043_0002387 3300049579 Bacteria 15915
923 Ga0501043_0016255 3300049579 Bacteria 5836
924 Ga0501043_0062852 3300049579 Bacteria 2915
925 Ga0501043_0275321 3300049579 Bacteria 1291
926 Ga0501043_0870879 3300049579 Bacteria 648
927 Ga0501046_0026268 3300049580 Bacteria 4755
928 Ga0501046_0371783 3300049580 Bacteria 1035
929 Ga0501047_0000228 3300049581 Bacteria 66588
930 Ga0501047_0027357 3300049581 Bacteria 5493
931 Ga0501047_0425427 3300049581 Bacteria 1159
932 Ga0501047_0673064 3300049581 Bacteria 853
933 Ga0501047_1093626 3300049581 Bacteria 610
934 Ga0501048_0000467 3300049582 Bacteria 28373
935 Ga0501048_0123613 3300049582 Bacteria 1829
936 Ga0501067_0057885 3300049583 Bacteria 2146
937 Ga0501067_0167596 3300049583 Bacteria 1223
938 Ga0501067_0283274 3300049583 Bacteria 923
939 Ga0501068_0048365 3300049584 Bacteria 2567
940 Ga0501068_0051063 3300049584 Bacteria 2501
941 Ga0501068_0065914 3300049584 Bacteria 2205
942 Ga0501069_0054877 3300049585 Bacteria 2219
943 Ga0501069_0074349 3300049585 Bacteria 1906
944 Ga0501070_0008780 3300049586 Bacteria 8545
945 Ga0501070_0014043 3300049586 Bacteria 6741
946 Ga0501070_0029296 3300049586 Bacteria 4617
947 Ga0501070_0038930 3300049586 Bacteria 3967
948 Ga0501070_0046289 3300049586 Bacteria 3617
949 Ga0501070_0059350 3300049586 Bacteria 3171
950 Ga0501070_0196672 3300049586 Bacteria 1656
951 Ga0501070_0218106 3300049586 Bacteria 1565
952 Ga0501071_0174267 3300049587 Bacteria 1611
953 Ga0501072_0162152 3300049588 Bacteria 1784
954 Ga0501073_0005395 3300049589 Bacteria 9578
955 Ga0501073_0016516 3300049589 Bacteria 5351
956 Ga0501073_0059193 3300049589 Bacteria 2676
957 Ga0501073_0395835 3300049589 Bacteria 954
958 Ga0501074_0003305 3300049590 Bacteria 11407
959 Ga0501074_0004721 3300049590 Bacteria 9764
960 Ga0501074_0095235 3300049590 Bacteria 2132
961 Ga0501074_0134940 3300049590 Bacteria 1765
962 Ga0501074_0329981 3300049590 Bacteria 1083
963 Ga0501076_0127841 3300049592 Bacteria 2060
964 Ga0501077_0358400 3300049593 Bacteria 931
965 Ga0501079_0224929 3300049741 Bacteria 1466
966 Ga0501079_0289625 3300049741 Bacteria 1280
967 Ga0501080_0000112 3300049742 Bacteria 56408
968 Ga0501080_0013759 3300049742 Bacteria 7450
969 Ga0501080_0046008 3300049742 Bacteria 4064
970 Ga0501080_0053206 3300049742 Bacteria 3768
971 Ga0501080_0178247 3300049742 Bacteria 1957
972 Ga0501081_0389603 3300049743 Bacteria 1030
973 Ga0501083_0001098 3300049744 Bacteria 18074
974 Ga0501083_0071101 3300049744 Bacteria 2314
975 Ga0501083_0078218 3300049744 Bacteria 2194
976 Ga0501035_0012556 3300049822 Bacteria 7826
977 Ga0501035_0125846 3300049822 Bacteria 2237
978 Ga0501035_0214336 3300049822 Bacteria 1646
979 Ga0501035_0323928 3300049822 Bacteria 1294
980 Ga0501044_0017602 3300049823 Bacteria 7664
981 Ga0501044_0059118 3300049823 Bacteria 3928
982 Ga0501044_0068643 3300049823 Bacteria 3611
983 Ga0501044_0157923 3300049823 Bacteria 2246
984 Ga0501044_0173219 3300049823 Bacteria 2128
985 Ga0501044_0221775 3300049823 Bacteria 1841
986 Ga0501044_1119400 3300049823 Bacteria 656
987 Ga0501045_0259239 3300049824 Bacteria 1294
988 nmdc:mga00v17_258615_c1 3300050491 Bacteria 1129
989 nmdc:mga05p37_45_c1 3300050507 Bacteria 81140
990 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
991 nmdc:mga0qj67_701_c1 3300050509 Bacteria 22836
992 nmdc:mga06r32_227_c1 3300050510 Bacteria 45651
993 nmdc:mga08y16_1666_c1 3300050511 Bacteria 22506
994 nmdc:mga08y16_26694_c1 3300050511 Bacteria 6087
995 nmdc:mga0n895_379872_c1 3300050512 Bacteria 1430
996 nmdc:mga0n895_4930_c1 3300050512 Bacteria 11073
997 nmdc:mga0n895_495535_c1 3300050512 Bacteria 1231
998 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
999 nmdc:mga0n895_684569_c1 3300050512 Bacteria 1022
1000 nmdc:mga0rr50_17122_c1 3300050513 Bacteria 4829
1001 nmdc:mga0rr50_19371_c1 3300050513 Bacteria 4592
1002 nmdc:mga0rr50_253512_c1 3300050513 Bacteria 1462
1003 nmdc:mga0rr50_485637_c1 3300050513 Bacteria 1049
1004 nmdc:mga0rr50_67221_c1 3300050513 Bacteria 2722
1005 nmdc:mga0rr50_77127_c1 3300050513 Bacteria 2560
1006 nmdc:mga08x19_20074_c1 3300050514 Bacteria 4112
1007 nmdc:mga08x19_639141_c1 3300050514 Bacteria 755
1008 nmdc:mga0a205_21352_c1 3300050515 Bacteria 6125
1009 nmdc:mga0a205_2228_c1 3300050515 Bacteria 17060
1010 nmdc:mga0a205_322414_c1 3300050515 Bacteria 1416
1011 nmdc:mga0a205_34065_c1 3300050515 Bacteria 4886
1012 nmdc:mga0a205_4901_c1 3300050515 Bacteria 12033
1013 Ga0495601_0000204 3300053077 Bacteria 31605
1014 Ga0495601_0002295 3300053077 Bacteria 10791
1015 Ga0495601_0002402 3300053077 Bacteria 10631
1016 Ga0495601_0009449 3300053077 Bacteria 5768
1017 Ga0495601_0388326 3300053077 Bacteria 905
1018 Ga0495612_0000384 3300053078 Bacteria 17659
1019 Ga0495612_0011006 3300053078 Bacteria 3652
1020 Ga0495612_0012068 3300053078 Bacteria 3480
1021 Ga0495595_0000577 3300053084 Bacteria 14028
1022 Ga0495595_0000686 3300053084 Bacteria 12928
1023 Ga0495595_0001081 3300053084 Bacteria 10545
1024 Ga0495595_0002024 3300053084 Bacteria 7872
1025 Ga0495595_0012257 3300053084 Bacteria 3599
1026 Ga0495619_0000260 3300053085 Bacteria 38574
1027 Ga0495619_0000655 3300053085 Bacteria 22730
1028 Ga0495619_0017989 3300053085 Bacteria 4481
1029 Ga0495619_0024139 3300053085 Bacteria 3899
1030 Ga0495619_0128221 3300053085 Unclassified 1742
1031 Ga0500650_0164994 3300053098 Bacteria 1020
1032 Ga0500559_0334343 3300053136 Bacteria 709
1033 Ga0500616_0000006 3300053153 Bacteria 944738
1034 Ga0500616_0000046 3300053153 Bacteria 333409
1035 Ga0500616_0223222 3300053153 Bacteria 820
1036 Ga0500627_0320648 3300053158 Bacteria 673
1037 Ga0500596_000518 3300053735 Bacteria 7283
1038 Ga0501084_0053053 3300054114 Bacteria 3391
1039 Ga0501082_0021751 3300060353 Bacteria 5530
1040 Ga0501082_0025906 3300060353 Bacteria 5054
1041 Ga0501082_0601343 3300060353 Bacteria 962
1042 Ga0501082_1077582 3300060353 Bacteria 702
1043 Ga0466962_0373138 3300061719 Bacteria 712
1044 Ga0530510_0435141 3300061734 Bacteria 991

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10108658 Ga0265340_101086581 149
2 3300031249 Ga0265339_10005247 Ga0265339_100052476 149
3 3300046477 Ga0495664_0523671 Ga0495664_0523671_57_563 157
4 3300047319 Ga0495674_1288000 Ga0495674_1288000_30_536 157
5 3300049574 Ga0501038_0485019 Ga0501038_0485019_153_686 157
6 3300049583 Ga0501067_0057885 Ga0501067_0057885_1193_1726 157
7 3300049584 Ga0501068_0065914 Ga0501068_0065914_752_1285 157
8 3300049586 Ga0501070_0014043 Ga0501070_0014043_5302_5835 157
9 3300049587 Ga0501071_0174267 Ga0501071_0174267_782_1315 157
10 3300049588 Ga0501072_0162152 Ga0501072_0162152_295_828 157
11 3300049590 Ga0501074_0004721 Ga0501074_0004721_4414_4947 157
12 3300049741 Ga0501079_0224929 Ga0501079_0224929_407_940 157
13 3300049742 Ga0501080_0013759 Ga0501080_0013759_15_548 157
14 3300049822 Ga0501035_0323928 Ga0501035_0323928_98_631 157
15 3300049823 Ga0501044_0157923 Ga0501044_0157923_1361_1894 157
16 3300053136 Ga0500559_0334343 Ga0500559_0334343_33_539 157
17 3300053735 Ga0500596_000518 Ga0500596_000518_6754_7260 157
18 3300025915 Ga0207693_10576547 Ga0207693_105765472 158
19 3300053153 Ga0500616_0223222 Ga0500616_0223222_266_769 159
20 3300027364 Ga0209967_1037373 Ga0209967_10373732 160
21 3300049575 Ga0501039_0029717 Ga0501039_0029717_244_759 162
22 3300049589 Ga0501073_0395835 Ga0501073_0395835_446_934 162
23 3300061734 Ga0530510_0435141 Ga0530510_0435141_31_546 162
24 3300006048 Ga0075363_100102489 Ga0075363_1001024892 163
25 3300006175 Ga0070712_100354247 Ga0070712_1003542473 163
26 3300006177 Ga0075362_10026979 Ga0075362_100269793 163
27 3300006852 Ga0075433_10101236 Ga0075433_101012363 163
28 3300035088 Ga0373940_0035562 Ga0373940_0035562_824_1315 163
29 3300035171 Ga0373946_0172606 Ga0373946_0172606_519_1010 163
30 3300046517 Ga0495630_0157643 Ga0495630_0157643_15_506 163
31 3300048905 Ga0496102_0450410 Ga0496102_0450410_702_1193 163
32 3300050515 nmdc:mga0a205_322414_c1 nmdc:mga0a205_322414_c1_910_1401 163
33 3300050515 nmdc:mga0a205_34065_c1 nmdc:mga0a205_34065_c1_519_1010 163
34 3300053153 Ga0500616_0000046 Ga0500616_0000046_88668_89180 163
35 3300014968 Ga0157379_10776966 Ga0157379_107769662 164
36 3300020082 Ga0206353_12062905 Ga0206353_120629052 165
37 3300041512 Ga0451853_1133953 Ga0451853_1133953_1559_2092 166
38 3300046692 Ga0495671_0085443 Ga0495671_0085443_110_640 167
39 3300007076 Ga0075435_100305843 Ga0075435_1003058432 168
40 3300032126 Ga0307415_100621291 Ga0307415_1006212912 168
41 3300053158 Ga0500627_0320648 Ga0500627_0320648_129_635 168
42 3300006028 Ga0070717_11080886 Ga0070717_110808861 169
43 3300025912 Ga0207707_10430416 Ga0207707_104304162 169
44 3300046454 Ga0495592_0470310 Ga0495592_0470310_35_562 169
45 3300046462 Ga0495651_0283940 Ga0495651_0283940_544_1071 169
46 3300046517 Ga0495630_0725421 Ga0495630_0725421_132_659 169
47 3300048088 Ga0495602_0112730 Ga0495602_0112730_1650_2177 169
48 3300050512 nmdc:mga0n895_495535_c1 nmdc:mga0n895_495535_c1_410_1033 169
49 3300050513 nmdc:mga0rr50_253512_c1 nmdc:mga0rr50_253512_c1_711_1334 169
50 3300003911 JGI25405J52794_10010557 JGI25405J52794_100105572 170
51 3300005295 Ga0065707_10125256 Ga0065707_101252562 170
52 3300005937 Ga0081455_10037283 Ga0081455_100372834 170
53 3300031344 Ga0265316_10054466 Ga0265316_100544663 170
54 3300031595 Ga0265313_10000041 Ga0265313_1000004158 170
55 3300031691 Ga0316579_10042737 Ga0316579_100427372 170
56 3300032133 Ga0316583_10003152 Ga0316583_100031522 170
57 3300036647 Ga0316582_0678080 Ga0316582_0678080_109_639 170
58 3300049571 Ga0501034_0020882 Ga0501034_0020882_1410_1946 170
59 3300049579 Ga0501043_0870879 Ga0501043_0870879_71_601 170
60 3300049585 Ga0501069_0054877 Ga0501069_0054877_1662_2198 170
61 3300049586 Ga0501070_0059350 Ga0501070_0059350_437_973 170
62 3300049823 Ga0501044_0068643 Ga0501044_0068643_1033_1569 170
63 3300035083 Ga0373926_0205655 Ga0373926_0205655_22_552 171
64 3300035113 Ga0373936_0007526 Ga0373936_0007526_1601_2131 171
65 3300035116 Ga0373945_0001243 Ga0373945_0001243_3306_3836 171
66 3300035170 Ga0373943_0003538 Ga0373943_0003538_2336_2866 171
67 3300035695 Ga0373927_0182286 Ga0373927_0182286_814_1344 171
68 3300035725 Ga0373947_0004569 Ga0373947_0004569_51_581 171
69 3300037068 Ga0373925_0010134 Ga0373925_0010134_2336_2866 171
70 3300046455 Ga0495603_0012962 Ga0495603_0012962_238_768 171
71 3300046459 Ga0495629_0006281 Ga0495629_0006281_513_1043 171
72 3300046459 Ga0495629_0024439 Ga0495629_0024439_3096_3626 171
73 3300046461 Ga0495641_0031793 Ga0495641_0031793_957_1487 171
74 3300046473 Ga0495582_0001705 Ga0495582_0001705_2408_2938 171
75 3300046473 Ga0495582_0015446 Ga0495582_0015446_1984_2514 171
76 3300046475 Ga0495639_0019431 Ga0495639_0019431_2379_2909 171
77 3300046476 Ga0495662_0009777 Ga0495662_0009777_1846_2376 171
78 3300046492 Ga0495585_0009128 Ga0495585_0009128_5274_5804 171
79 3300046499 Ga0495594_0101905 Ga0495594_0101905_83_613 171
80 3300046501 Ga0495607_0004288 Ga0495607_0004288_3957_4487 171
81 3300046511 Ga0495608_0110542 Ga0495608_0110542_1031_1561 171
82 3300046514 Ga0495618_0014982 Ga0495618_0014982_3374_3904 171
83 3300046517 Ga0495630_0023584 Ga0495630_0023584_168_698 171
84 3300046523 Ga0495644_0000514 Ga0495644_0000514_7057_7587 171
85 3300046526 Ga0495666_0001847 Ga0495666_0001847_5885_6415 171
86 3300046529 Ga0495652_0020653 Ga0495652_0020653_2124_2654 171
87 3300046531 Ga0495665_0006322 Ga0495665_0006322_5803_6333 171
88 3300046535 Ga0495586_0060389 Ga0495586_0060389_22_552 171
89 3300046536 Ga0495587_0027769 Ga0495587_0027769_2828_3358 171
90 3300046537 Ga0495598_0195351 Ga0495598_0195351_27_557 171
91 3300046538 Ga0495609_0023913 Ga0495609_0023913_229_759 171
92 3300046543 Ga0495645_0154375 Ga0495645_0154375_840_1370 171
93 3300046557 Ga0495622_0093569 Ga0495622_0093569_480_1010 171
94 3300046559 Ga0495667_0019211 Ga0495667_0019211_3832_4362 171
95 3300046615 Ga0495656_0019735 Ga0495656_0019735_1910_2440 171
96 3300046663 Ga0495635_0004379 Ga0495635_0004379_3375_3905 171
97 3300046663 Ga0495635_0201286 Ga0495635_0201286_516_1046 171
98 3300046664 Ga0495659_0008156 Ga0495659_0008156_2767_3297 171
99 3300046674 Ga0495588_0013623 Ga0495588_0013623_1947_2477 171
100 3300046678 Ga0495599_0003364 Ga0495599_0003364_11_541 171
101 3300046681 Ga0495647_0008999 Ga0495647_0008999_631_1161 171
102 3300046683 Ga0495658_0000591 Ga0495658_0000591_693_1223 171
103 3300046689 Ga0495613_0047264 Ga0495613_0047264_1289_1819 171
104 3300046689 Ga0495613_0115614 Ga0495613_0115614_442_972 171
105 3300046690 Ga0495624_0009422 Ga0495624_0009422_6179_6709 171
106 3300046691 Ga0495670_0008959 Ga0495670_0008959_2451_2981 171
107 3300047315 Ga0495581_0017156 Ga0495581_0017156_56_586 171
108 3300047315 Ga0495581_0035361 Ga0495581_0035361_2002_2532 171
109 3300047318 Ga0495636_0477254 Ga0495636_0477254_61_591 171
110 3300047319 Ga0495674_0040549 Ga0495674_0040549_953_1483 171
111 3300047321 Ga0495676_0017949 Ga0495676_0017949_667_1197 171
112 3300047322 Ga0495680_0008046 Ga0495680_0008046_57_587 171
113 3300047471 Ga0495684_0006324 Ga0495684_0006324_2379_2909 171
114 3300048089 Ga0495614_0263582 Ga0495614_0263582_124_654 171
115 3300053077 Ga0495601_0388326 Ga0495601_0388326_168_698 171
116 3300053084 Ga0495595_0002024 Ga0495595_0002024_4165_4695 171
117 3300053085 Ga0495619_0024139 Ga0495619_0024139_3162_3692 171
118 3300053085 Ga0495619_0128221 Ga0495619_0128221_699_1229 171
119 3300005435 Ga0070714_100091747 Ga0070714_1000917472 172
120 3300005563 Ga0068855_100015363 Ga0068855_1000153633 172
121 3300013105 Ga0157369_10182747 Ga0157369_101827472 172
122 3300025921 Ga0207652_10425908 Ga0207652_104259081 172
123 3300025929 Ga0207664_10243891 Ga0207664_102438912 172
124 3300025932 Ga0207690_10340419 Ga0207690_103404192 172
125 3300025949 Ga0207667_11133467 Ga0207667_111334671 172
126 3300028573 Ga0265334_10054444 Ga0265334_100544442 172
127 3300031235 Ga0265330_10058291 Ga0265330_100582912 172
128 3300031241 Ga0265325_10231447 Ga0265325_102314471 172
129 3300031249 Ga0265339_10010020 Ga0265339_100100205 172
130 3300031712 Ga0265342_10054402 Ga0265342_100544022 172
131 3300035115 Ga0373941_0118879 Ga0373941_0118879_60_578 172
132 3300035172 Ga0373955_0248942 Ga0373955_0248942_320_838 172
133 3300046543 Ga0495645_0674978 Ga0495645_0674978_76_594 172
134 3300049823 Ga0501044_1119400 Ga0501044_1119400_83_601 172
135 3300005327 Ga0070658_10321270 Ga0070658_103212701 173
136 3300005530 Ga0070679_100283271 Ga0070679_1002832712 173
137 3300005539 Ga0068853_100430251 Ga0068853_1004302512 173
138 3300005563 Ga0068855_101061464 Ga0068855_1010614642 173
139 3300006175 Ga0070712_100148881 Ga0070712_1001488812 173
140 3300009093 Ga0105240_10966071 Ga0105240_109660712 173
141 3300013104 Ga0157370_10146848 Ga0157370_101468483 173
142 3300025915 Ga0207693_10099654 Ga0207693_100996542 173
143 3300025917 Ga0207660_10189395 Ga0207660_101893952 173
144 3300025944 Ga0207661_11466608 Ga0207661_114666081 173
145 3300025949 Ga0207667_10407367 Ga0207667_104073672 173
146 3300025981 Ga0207640_10494373 Ga0207640_104943732 173
147 3300031018 Ga0265773_1005860 Ga0265773_10058602 173
148 3300031595 Ga0265313_10106271 Ga0265313_101062712 173
149 3300049568 Ga0501031_0086545 Ga0501031_0086545_465_989 173
150 3300049568 Ga0501031_0212867 Ga0501031_0212867_483_1007 173
151 3300049569 Ga0501032_0012835 Ga0501032_0012835_1597_2121 173
152 3300049569 Ga0501032_0021838 Ga0501032_0021838_1299_1823 173
153 3300049569 Ga0501032_0052659 Ga0501032_0052659_1145_1669 173
154 3300049569 Ga0501032_0100027 Ga0501032_0100027_1218_1742 173
155 3300049570 Ga0501033_0139839 Ga0501033_0139839_1033_1557 173
156 3300049571 Ga0501034_0002292 Ga0501034_0002292_8102_8626 173
157 3300049571 Ga0501034_0024137 Ga0501034_0024137_4912_5436 173
158 3300049571 Ga0501034_0076586 Ga0501034_0076586_1170_1694 173
159 3300049571 Ga0501034_0305190 Ga0501034_0305190_108_632 173
160 3300049572 Ga0501036_0000609 Ga0501036_0000609_1483_2007 173
161 3300049572 Ga0501036_0054800 Ga0501036_0054800_766_1290 173
162 3300049572 Ga0501036_0205765 Ga0501036_0205765_901_1425 173
163 3300049572 Ga0501036_0364435 Ga0501036_0364435_201_725 173
164 3300049573 Ga0501037_0007571 Ga0501037_0007571_3688_4212 173
165 3300049573 Ga0501037_0036674 Ga0501037_0036674_1550_2074 173
166 3300049573 Ga0501037_0517999 Ga0501037_0517999_197_721 173
167 3300049574 Ga0501038_0016827 Ga0501038_0016827_1126_1650 173
168 3300049574 Ga0501038_0049627 Ga0501038_0049627_2786_3310 173
169 3300049574 Ga0501038_0051768 Ga0501038_0051768_2788_3312 173
170 3300049575 Ga0501039_0038774 Ga0501039_0038774_1513_2037 173
171 3300049575 Ga0501039_0163405 Ga0501039_0163405_230_754 173
172 3300049576 Ga0501040_0089076 Ga0501040_0089076_1326_1850 173
173 3300049576 Ga0501040_0321027 Ga0501040_0321027_396_920 173
174 3300049578 Ga0501042_0495404 Ga0501042_0495404_55_579 173
175 3300049579 Ga0501043_0002387 Ga0501043_0002387_13628_14152 173
176 3300049579 Ga0501043_0016255 Ga0501043_0016255_1623_2147 173
177 3300049579 Ga0501043_0062852 Ga0501043_0062852_468_992 173
178 3300049579 Ga0501043_0275321 Ga0501043_0275321_188_712 173
179 3300049580 Ga0501046_0026268 Ga0501046_0026268_379_903 173
180 3300049580 Ga0501046_0371783 Ga0501046_0371783_435_959 173
181 3300049581 Ga0501047_0000228 Ga0501047_0000228_14095_14619 173
182 3300049581 Ga0501047_0027357 Ga0501047_0027357_1483_2007 173
183 3300049581 Ga0501047_1093626 Ga0501047_1093626_39_563 173
184 3300049582 Ga0501048_0000467 Ga0501048_0000467_14095_14619 173
185 3300049582 Ga0501048_0123613 Ga0501048_0123613_229_753 173
186 3300049583 Ga0501067_0167596 Ga0501067_0167596_547_1071 173
187 3300049583 Ga0501067_0283274 Ga0501067_0283274_97_621 173
188 3300049584 Ga0501068_0048365 Ga0501068_0048365_230_754 173
189 3300049584 Ga0501068_0051063 Ga0501068_0051063_1690_2214 173
190 3300049585 Ga0501069_0074349 Ga0501069_0074349_468_992 173
191 3300049586 Ga0501070_0008780 Ga0501070_0008780_1707_2231 173
192 3300049586 Ga0501070_0029296 Ga0501070_0029296_3625_4149 173
193 3300049586 Ga0501070_0038930 Ga0501070_0038930_1768_2292 173
194 3300049586 Ga0501070_0046289 Ga0501070_0046289_1932_2456 173
195 3300049586 Ga0501070_0218106 Ga0501070_0218106_263_796 173
196 3300049589 Ga0501073_0005395 Ga0501073_0005395_8574_9098 173
197 3300049589 Ga0501073_0016516 Ga0501073_0016516_1287_1811 173
198 3300049589 Ga0501073_0059193 Ga0501073_0059193_998_1522 173
199 3300049590 Ga0501074_0003305 Ga0501074_0003305_2104_2628 173
200 3300049590 Ga0501074_0134940 Ga0501074_0134940_247_771 173
201 3300049741 Ga0501079_0289625 Ga0501079_0289625_594_1118 173
202 3300049742 Ga0501080_0000112 Ga0501080_0000112_42655_43179 173
203 3300049742 Ga0501080_0046008 Ga0501080_0046008_181_705 173
204 3300049742 Ga0501080_0053206 Ga0501080_0053206_2461_2985 173
205 3300049744 Ga0501083_0001098 Ga0501083_0001098_3567_4091 173
206 3300049744 Ga0501083_0071101 Ga0501083_0071101_865_1398 173
207 3300049744 Ga0501083_0078218 Ga0501083_0078218_516_1040 173
208 3300049822 Ga0501035_0012556 Ga0501035_0012556_3757_4281 173
209 3300049822 Ga0501035_0125846 Ga0501035_0125846_581_1105 173
210 3300049822 Ga0501035_0214336 Ga0501035_0214336_1014_1538 173
211 3300049823 Ga0501044_0017602 Ga0501044_0017602_2277_2801 173
212 3300049823 Ga0501044_0059118 Ga0501044_0059118_1208_1732 173
213 3300049823 Ga0501044_0173219 Ga0501044_0173219_1234_1758 173
214 3300050491 nmdc:mga00v17_258615_c1 nmdc:mga00v17_258615_c1_436_960 173
215 3300053153 Ga0500616_0000006 Ga0500616_0000006_416798_417319 173
216 3300054114 Ga0501084_0053053 Ga0501084_0053053_2686_3210 173
217 3300060353 Ga0501082_0021751 Ga0501082_0021751_2060_2584 173
218 3300060353 Ga0501082_0025906 Ga0501082_0025906_1170_1694 173
219 3300060353 Ga0501082_1077582 Ga0501082_1077582_166_690 173
220 3300005327 Ga0070658_10030706 Ga0070658_100307061 174
221 3300005327 Ga0070658_10713122 Ga0070658_107131222 174
222 3300005336 Ga0070680_100005313 Ga0070680_1000053136 174
223 3300005336 Ga0070680_100433128 Ga0070680_1004331282 174
224 3300005339 Ga0070660_100038319 Ga0070660_1000383192 174
225 3300005436 Ga0070713_100148235 Ga0070713_1001482351 174
226 3300005458 Ga0070681_10016363 Ga0070681_100163636 174
227 3300005458 Ga0070681_10090121 Ga0070681_100901212 174
228 3300005530 Ga0070679_100037005 Ga0070679_1000370052 174
229 3300005530 Ga0070679_100071754 Ga0070679_1000717543 174
230 3300005563 Ga0068855_100339131 Ga0068855_1003391312 174
231 3300005578 Ga0068854_100472263 Ga0068854_1004722632 174
232 3300009093 Ga0105240_10020100 Ga0105240_100201007 174
233 3300013102 Ga0157371_10151573 Ga0157371_101515732 174
234 3300013307 Ga0157372_10416720 Ga0157372_104167202 174
235 3300013307 Ga0157372_10807596 Ga0157372_108075962 174
236 3300020070 Ga0206356_10130135 Ga0206356_101301352 174
237 3300020081 Ga0206354_10382701 Ga0206354_103827012 174
238 3300025909 Ga0207705_10025609 Ga0207705_100256093 174
239 3300025909 Ga0207705_10216574 Ga0207705_102165742 174
240 3300025912 Ga0207707_10217291 Ga0207707_102172911 174
241 3300025913 Ga0207695_10092228 Ga0207695_100922282 174
242 3300025915 Ga0207693_10117664 Ga0207693_101176642 174
243 3300025917 Ga0207660_10005747 Ga0207660_100057474 174
244 3300025917 Ga0207660_10110494 Ga0207660_101104942 174
245 3300025921 Ga0207652_10016915 Ga0207652_100169153 174
246 3300025928 Ga0207700_10207267 Ga0207700_102072672 174
247 3300025944 Ga0207661_10492543 Ga0207661_104925432 174
248 3300025949 Ga0207667_10056714 Ga0207667_100567143 174
249 3300025949 Ga0207667_10120758 Ga0207667_101207582 174
250 3300026041 Ga0207639_10221184 Ga0207639_102211842 174
251 3300026078 Ga0207702_11433417 Ga0207702_114334171 174
252 3300026142 Ga0207698_10091738 Ga0207698_100917383 174
253 3300030763 Ga0265763_1002495 Ga0265763_10024952 174
254 3300031241 Ga0265325_10000105 Ga0265325_1000010555 174
255 3300031241 Ga0265325_10259934 Ga0265325_102599342 174
256 3300031249 Ga0265339_10106798 Ga0265339_101067982 174
257 3300031595 Ga0265313_10035872 Ga0265313_100358722 174
258 3300031711 Ga0265314_10000279 Ga0265314_1000027948 174
259 3300031712 Ga0265342_10001077 Ga0265342_1000107726 174
260 3300031824 Ga0307413_10143610 Ga0307413_101436102 174
261 3300032005 Ga0307411_10191027 Ga0307411_101910272 174
262 3300035118 Ga0373954_0015537 Ga0373954_0015537_2437_2961 174
263 3300035119 Ga0373956_0018425 Ga0373956_0018425_1218_1742 174
264 3300035120 Ga0373957_0013805 Ga0373957_0013805_1672_2196 174
265 3300035410 Ga0373924_0026473 Ga0373924_0026473_1629_2153 174
266 3300035692 Ga0373935_0692866 Ga0373935_0692866_184_708 174
267 3300035724 Ga0373933_0016462 Ga0373933_0016462_73_597 174
268 3300036401 Ga0373937_0016585 Ga0373937_0016585_220_744 174
269 3300037312 Ga0395899_0001670 Ga0395899_0001670_838_1374 174
270 3300037418 Ga0395900_0003491 Ga0395900_0003491_2671_3207 174
271 3300037418 Ga0395900_0030502 Ga0395900_0030502_2398_2934 174
272 3300037418 Ga0395900_0125555 Ga0395900_0125555_358_894 174
273 3300037466 Ga0395898_0002609 Ga0395898_0002609_4221_4757 174
274 3300037466 Ga0395898_0014973 Ga0395898_0014973_1736_2272 174
275 3300037466 Ga0395898_0322637 Ga0395898_0322637_697_1233 174
276 3300038443 Ga0395901_0005021 Ga0395901_0005021_9036_9572 174
277 3300038443 Ga0395901_0205014 Ga0395901_0205014_531_1067 174
278 3300042005 Ga0439448_0090643 Ga0439448_0090643_227_751 174
279 3300044684 Ga0466966_0112578 Ga0466966_0112578_1082_1609 174
280 3300044693 Ga0466961_0088464 Ga0466961_0088464_1263_1790 174
281 3300044694 Ga0466963_0230872 Ga0466963_0230872_369_893 174
282 3300044842 Ga0466957_0272693 Ga0466957_0272693_560_1084 174
283 3300045836 Ga0466958_0388769 Ga0466958_0388769_313_837 174
284 3300045836 Ga0466958_0411635 Ga0466958_0411635_90_620 174
285 3300045976 Ga0466967_0005780 Ga0466967_0005780_1149_1679 174
286 3300045976 Ga0466967_0539386 Ga0466967_0539386_522_1052 174
287 3300046511 Ga0495608_0151432 Ga0495608_0151432_702_1226 174
288 3300046559 Ga0495667_0021834 Ga0495667_0021834_3481_4005 174
289 3300046663 Ga0495635_0031122 Ga0495635_0031122_3009_3533 174
290 3300046675 Ga0495657_0249728 Ga0495657_0249728_243_767 174
291 3300047322 Ga0495680_0075306 Ga0495680_0075306_1199_1723 174
292 3300047444 Ga0495675_0177155 Ga0495675_0177155_62_586 174
293 3300049581 Ga0501047_0673064 Ga0501047_0673064_92_616 174
294 3300049590 Ga0501074_0329981 Ga0501074_0329981_461_985 174
295 3300049823 Ga0501044_0221775 Ga0501044_0221775_730_1254 174
296 3300053077 Ga0495601_0009449 Ga0495601_0009449_3553_4077 174
297 3300053084 Ga0495595_0012257 Ga0495595_0012257_77_601 174
298 3300061719 Ga0466962_0373138 Ga0466962_0373138_123_650 174
299 3300005435 Ga0070714_100135536 Ga0070714_1001355363 175
300 3300005435 Ga0070714_100329391 Ga0070714_1003293912 175
301 3300005436 Ga0070713_100206637 Ga0070713_1002066372 175
302 3300005439 Ga0070711_100016051 Ga0070711_1000160514 175
303 3300006028 Ga0070717_11043714 Ga0070717_110437142 175
304 3300021384 Ga0213876_10236414 Ga0213876_102364141 175
305 3300025916 Ga0207663_10004450 Ga0207663_100044502 175
306 3300025928 Ga0207700_10108029 Ga0207700_101080292 175
307 3300025929 Ga0207664_10135349 Ga0207664_101353492 175
308 3300031241 Ga0265325_10007951 Ga0265325_100079514 175
309 3300031595 Ga0265313_10041344 Ga0265313_100413443 175
310 3300031711 Ga0265314_10017694 Ga0265314_100176946 175
311 3300035692 Ga0373935_0107931 Ga0373935_0107931_58_585 175
312 3300037068 Ga0373925_0042928 Ga0373925_0042928_2601_3227 175
313 3300039437 Ga0436365_1587891 Ga0436365_1587891_135_704 175
314 3300041496 Ga0451839_1211329 Ga0451839_1211329_56_589 175
315 3300049571 Ga0501034_1229354 Ga0501034_1229354_75_602 175
316 3300049586 Ga0501070_0196672 Ga0501070_0196672_242_769 175
317 2209111006 2214544913 2213593223 176
318 3300000041 ARcpr5oldR_c000030 ARcpr5oldR_0000306 176
319 3300000042 ARSoilYngRDRAFT_c00022 ARSoilYngRDRAFT_0002224 176
320 3300000043 ARcpr5yngRDRAFT_c000011 ARcpr5yngRDRAFT_00001139 176
321 3300000044 ARSoilOldRDRAFT_c000040 ARSoilOldRDRAFT_00004030 176
322 3300000045 ARCol0oldRDRAFT_c01878 ARCol0oldRDRAFT_018782 176
323 3300000652 ARCol0yngRDRAFT_1000028 ARCol0yngRDRAFT_10000286 176
324 3300001430 JGI24032J14994_100177 JGI24032J14994_1001772 176
325 3300001976 JGI24752J21851_1011523 JGI24752J21851_10115232 176
326 3300001978 JGI24747J21853_1001659 JGI24747J21853_10016592 176
327 3300001989 JGI24739J22299_10000164 JGI24739J22299_1000016410 176
328 3300001990 JGI24737J22298_10002054 JGI24737J22298_100020546 176
329 3300001990 JGI24737J22298_10004205 JGI24737J22298_100042054 176
330 3300002070 JGI24750J21931_1000178 JGI24750J21931_10001788 176
331 3300002073 JGI24745J21846_1000640 JGI24745J21846_10006404 176
332 3300002074 JGI24748J21848_1000266 JGI24748J21848_10002668 176
333 3300002075 JGI24738J21930_10000112 JGI24738J21930_100001126 176
334 3300002076 JGI24749J21850_1002285 JGI24749J21850_10022853 176
335 3300002077 JGI24744J21845_10004212 JGI24744J21845_100042122 176
336 3300002126 JGI24035J26624_1000424 JGI24035J26624_10004243 176
337 3300002155 JGI24033J26618_1001840 JGI24033J26618_10018403 176
338 3300002239 JGI24034J26672_10002682 JGI24034J26672_100026822 176
339 3300002244 JGI24742J22300_10000334 JGI24742J22300_100003348 176
340 3300002459 JGI24751J29686_10004003 JGI24751J29686_100040031 176
341 3300003659 JGI25404J52841_10018490 JGI25404J52841_100184901 176
342 3300003911 JGI25405J52794_10008628 JGI25405J52794_100086282 176
343 3300005276 Ga0065717_1000386 Ga0065717_10003863 176
344 3300005277 Ga0065716_1001616 Ga0065716_10016163 176
345 3300005290 Ga0065712_10070488 Ga0065712_100704886 176
346 3300005293 Ga0065715_10001682 Ga0065715_100016829 176
347 3300005293 Ga0065715_10018746 Ga0065715_100187462 176
348 3300005328 Ga0070676_10003775 Ga0070676_100037752 176
349 3300005328 Ga0070676_10085140 Ga0070676_100851402 176
350 3300005328 Ga0070676_10127179 Ga0070676_101271792 176
351 3300005329 Ga0070683_100000376 Ga0070683_10000037618 176
352 3300005329 Ga0070683_100064147 Ga0070683_1000641472 176
353 3300005330 Ga0070690_100002745 Ga0070690_1000027458 176
354 3300005330 Ga0070690_100006745 Ga0070690_1000067453 176
355 3300005330 Ga0070690_100008317 Ga0070690_1000083175 176
356 3300005331 Ga0070670_100004417 Ga0070670_10000441711 176
357 3300005333 Ga0070677_10000049 Ga0070677_100000498 176
358 3300005334 Ga0068869_100000523 Ga0068869_1000005237 176
359 3300005334 Ga0068869_100451400 Ga0068869_1004514001 176
360 3300005335 Ga0070666_10001839 Ga0070666_100018392 176
361 3300005335 Ga0070666_10002781 Ga0070666_1000278110 176
362 3300005336 Ga0070680_100016319 Ga0070680_1000163198 176
363 3300005336 Ga0070680_100045410 Ga0070680_1000454104 176
364 3300005336 Ga0070680_100123658 Ga0070680_1001236582 176
365 3300005337 Ga0070682_100000141 Ga0070682_10000014112 176
366 3300005337 Ga0070682_100010927 Ga0070682_1000109275 176
367 3300005337 Ga0070682_100165525 Ga0070682_1001655252 176
368 3300005337 Ga0070682_100168686 Ga0070682_1001686862 176
369 3300005338 Ga0068868_100009105 Ga0068868_1000091053 176
370 3300005339 Ga0070660_100001073 Ga0070660_10000107319 176
371 3300005339 Ga0070660_100130758 Ga0070660_1001307583 176
372 3300005340 Ga0070689_100028024 Ga0070689_1000280244 176
373 3300005340 Ga0070689_100100586 Ga0070689_1001005862 176
374 3300005340 Ga0070689_100236418 Ga0070689_1002364182 176
375 3300005341 Ga0070691_10004687 Ga0070691_100046876 176
376 3300005341 Ga0070691_10020023 Ga0070691_100200232 176
377 3300005343 Ga0070687_100000212 Ga0070687_10000021220 176
378 3300005344 Ga0070661_100000242 Ga0070661_10000024239 176
379 3300005344 Ga0070661_100115710 Ga0070661_1001157102 176
380 3300005345 Ga0070692_10010557 Ga0070692_100105573 176
381 3300005347 Ga0070668_100003395 Ga0070668_1000033958 176
382 3300005347 Ga0070668_100414921 Ga0070668_1004149211 176
383 3300005353 Ga0070669_100006805 Ga0070669_1000068053 176
384 3300005353 Ga0070669_100147979 Ga0070669_1001479793 176
385 3300005354 Ga0070675_100000165 Ga0070675_10000016528 176
386 3300005354 Ga0070675_100011029 Ga0070675_1000110294 176
387 3300005355 Ga0070671_100001907 Ga0070671_10000190711 176
388 3300005355 Ga0070671_100165578 Ga0070671_1001655781 176
389 3300005356 Ga0070674_100000450 Ga0070674_1000004507 176
390 3300005364 Ga0070673_100001190 Ga0070673_1000011904 176
391 3300005364 Ga0070673_100047352 Ga0070673_1000473522 176
392 3300005365 Ga0070688_100004815 Ga0070688_1000048155 176
393 3300005365 Ga0070688_100016577 Ga0070688_1000165773 176
394 3300005365 Ga0070688_100035808 Ga0070688_1000358082 176
395 3300005366 Ga0070659_100000988 Ga0070659_10000098818 176
396 3300005366 Ga0070659_100031422 Ga0070659_1000314224 176
397 3300005366 Ga0070659_100070846 Ga0070659_1000708462 176
398 3300005367 Ga0070667_100019884 Ga0070667_1000198843 176
399 3300005367 Ga0070667_100128897 Ga0070667_1001288972 176
400 3300005367 Ga0070667_100448787 Ga0070667_1004487872 176
401 3300005406 Ga0070703_10001274 Ga0070703_100012746 176
402 3300005434 Ga0070709_10088128 Ga0070709_100881282 176
403 3300005434 Ga0070709_10092920 Ga0070709_100929203 176
404 3300005434 Ga0070709_10150580 Ga0070709_101505803 176
405 3300005435 Ga0070714_100096255 Ga0070714_1000962552 176
406 3300005435 Ga0070714_100168697 Ga0070714_1001686973 176
407 3300005435 Ga0070714_100339459 Ga0070714_1003394592 176
408 3300005436 Ga0070713_100092317 Ga0070713_1000923172 176
409 3300005437 Ga0070710_10004737 Ga0070710_100047373 176
410 3300005437 Ga0070710_10108572 Ga0070710_101085722 176
411 3300005438 Ga0070701_10006218 Ga0070701_100062183 176
412 3300005438 Ga0070701_10292204 Ga0070701_102922042 176
413 3300005438 Ga0070701_10603384 Ga0070701_106033841 176
414 3300005440 Ga0070705_100003041 Ga0070705_1000030418 176
415 3300005440 Ga0070705_100015515 Ga0070705_1000155153 176
416 3300005440 Ga0070705_100209827 Ga0070705_1002098273 176
417 3300005441 Ga0070700_100000364 Ga0070700_10000036420 176
418 3300005441 Ga0070700_100012444 Ga0070700_1000124442 176
419 3300005444 Ga0070694_100001077 Ga0070694_1000010777 176
420 3300005445 Ga0070708_100259032 Ga0070708_1002590322 176
421 3300005455 Ga0070663_100000417 Ga0070663_1000004177 176
422 3300005455 Ga0070663_100015967 Ga0070663_1000159674 176
423 3300005456 Ga0070678_100001012 Ga0070678_10000101215 176
424 3300005456 Ga0070678_100162149 Ga0070678_1001621492 176
425 3300005457 Ga0070662_100000796 Ga0070662_10000079616 176
426 3300005457 Ga0070662_100838111 Ga0070662_1008381111 176
427 3300005458 Ga0070681_10002475 Ga0070681_1000247515 176
428 3300005458 Ga0070681_10037631 Ga0070681_100376313 176
429 3300005458 Ga0070681_10049230 Ga0070681_100492304 176
430 3300005458 Ga0070681_10488888 Ga0070681_104888881 176
431 3300005458 Ga0070681_10893010 Ga0070681_108930101 176
432 3300005459 Ga0068867_100006779 Ga0068867_1000067793 176
433 3300005466 Ga0070685_10000547 Ga0070685_1000054722 176
434 3300005466 Ga0070685_10060757 Ga0070685_100607572 176
435 3300005467 Ga0070706_100195631 Ga0070706_1001956314 176
436 3300005530 Ga0070679_100002268 Ga0070679_1000022688 176
437 3300005535 Ga0070684_100000755 Ga0070684_1000007557 176
438 3300005535 Ga0070684_100052457 Ga0070684_1000524571 176
439 3300005535 Ga0070684_100079617 Ga0070684_1000796172 176
440 3300005536 Ga0070697_100273711 Ga0070697_1002737112 176
441 3300005539 Ga0068853_100000483 Ga0068853_1000004833 176
442 3300005539 Ga0068853_100240073 Ga0068853_1002400732 176
443 3300005539 Ga0068853_100316453 Ga0068853_1003164531 176
444 3300005543 Ga0070672_100000527 Ga0070672_1000005277 176
445 3300005543 Ga0070672_100598142 Ga0070672_1005981421 176
446 3300005544 Ga0070686_100004541 Ga0070686_1000045416 176
447 3300005544 Ga0070686_100028407 Ga0070686_1000284072 176
448 3300005544 Ga0070686_100216175 Ga0070686_1002161751 176
449 3300005545 Ga0070695_100007154 Ga0070695_1000071548 176
450 3300005545 Ga0070695_100016829 Ga0070695_1000168293 176
451 3300005546 Ga0070696_100004211 Ga0070696_1000042113 176
452 3300005546 Ga0070696_100040575 Ga0070696_1000405753 176
453 3300005546 Ga0070696_100126980 Ga0070696_1001269802 176
454 3300005546 Ga0070696_100711268 Ga0070696_1007112681 176
455 3300005547 Ga0070693_100000199 Ga0070693_10000019920 176
456 3300005547 Ga0070693_100042452 Ga0070693_1000424522 176
457 3300005547 Ga0070693_100067261 Ga0070693_1000672612 176
458 3300005547 Ga0070693_100152582 Ga0070693_1001525822 176
459 3300005547 Ga0070693_100157117 Ga0070693_1001571172 176
460 3300005548 Ga0070665_100123527 Ga0070665_1001235272 176
461 3300005548 Ga0070665_100409391 Ga0070665_1004093912 176
462 3300005549 Ga0070704_100000987 Ga0070704_10000098711 176
463 3300005549 Ga0070704_100128703 Ga0070704_1001287033 176
464 3300005549 Ga0070704_100844621 Ga0070704_1008446211 176
465 3300005563 Ga0068855_100004444 Ga0068855_10000444416 176
466 3300005564 Ga0070664_100000895 Ga0070664_10000089518 176
467 3300005577 Ga0068857_100001816 Ga0068857_1000018163 176
468 3300005577 Ga0068857_100084708 Ga0068857_1000847082 176
469 3300005577 Ga0068857_100528032 Ga0068857_1005280323 176
470 3300005578 Ga0068854_100001812 Ga0068854_1000018126 176
471 3300005578 Ga0068854_100199360 Ga0068854_1001993603 176
472 3300005614 Ga0068856_100002507 Ga0068856_1000025075 176
473 3300005614 Ga0068856_100140935 Ga0068856_1001409353 176
474 3300005614 Ga0068856_100250036 Ga0068856_1002500363 176
475 3300005614 Ga0068856_100392362 Ga0068856_1003923622 176
476 3300005615 Ga0070702_100005184 Ga0070702_1000051843 176
477 3300005615 Ga0070702_100682654 Ga0070702_1006826541 176
478 3300005616 Ga0068852_100003253 Ga0068852_1000032537 176
479 3300005616 Ga0068852_100137119 Ga0068852_1001371192 176
480 3300005617 Ga0068859_100001353 Ga0068859_1000013538 176
481 3300005617 Ga0068859_100072433 Ga0068859_1000724333 176
482 3300005617 Ga0068859_100221537 Ga0068859_1002215372 176
483 3300005618 Ga0068864_100000227 Ga0068864_10000022747 176
484 3300005618 Ga0068864_100214765 Ga0068864_1002147652 176
485 3300005718 Ga0068866_10003902 Ga0068866_100039021 176
486 3300005718 Ga0068866_10115621 Ga0068866_101156212 176
487 3300005718 Ga0068866_10194597 Ga0068866_101945972 176
488 3300005719 Ga0068861_100003517 Ga0068861_1000035178 176
489 3300005834 Ga0068851_10037270 Ga0068851_100372702 176
490 3300005834 Ga0068851_10350412 Ga0068851_103504122 176
491 3300005840 Ga0068870_10000062 Ga0068870_1000006240 176
492 3300005841 Ga0068863_100000495 Ga0068863_10000049539 176
493 3300005842 Ga0068858_100000783 Ga0068858_10000078336 176
494 3300005842 Ga0068858_100112690 Ga0068858_1001126902 176
495 3300005842 Ga0068858_100453708 Ga0068858_1004537083 176
496 3300005843 Ga0068860_100022350 Ga0068860_1000223505 176
497 3300005843 Ga0068860_100240532 Ga0068860_1002405322 176
498 3300005844 Ga0068862_100003647 Ga0068862_1000036479 176
499 3300005844 Ga0068862_100235513 Ga0068862_1002355133 176
500 3300005937 Ga0081455_10000204 Ga0081455_1000020475 176
501 3300005983 Ga0081540_1012611 Ga0081540_10126113 176
502 3300006028 Ga0070717_10011080 Ga0070717_100110803 176
503 3300006058 Ga0075432_10000464 Ga0075432_1000046414 176
504 3300006163 Ga0070715_10004439 Ga0070715_100044392 176
505 3300006173 Ga0070716_100001496 Ga0070716_1000014966 176
506 3300006173 Ga0070716_100195611 Ga0070716_1001956111 176
507 3300006175 Ga0070712_100091539 Ga0070712_1000915393 176
508 3300006175 Ga0070712_100100728 Ga0070712_1001007282 176
509 3300006178 Ga0075367_10584065 Ga0075367_105840651 176
510 3300006237 Ga0097621_100000010 Ga0097621_10000001042 176
511 3300006237 Ga0097621_100023529 Ga0097621_1000235293 176
512 3300006353 Ga0075370_10463558 Ga0075370_104635581 176
513 3300006358 Ga0068871_100000034 Ga0068871_10000003429 176
514 3300006358 Ga0068871_100024903 Ga0068871_1000249033 176
515 3300006844 Ga0075428_100031223 Ga0075428_1000312231 176
516 3300006846 Ga0075430_100005373 Ga0075430_1000053734 176
517 3300006847 Ga0075431_100142954 Ga0075431_1001429542 176
518 3300006852 Ga0075433_10000774 Ga0075433_100007749 176
519 3300006852 Ga0075433_10005737 Ga0075433_100057376 176
520 3300006852 Ga0075433_10027741 Ga0075433_100277414 176
521 3300006852 Ga0075433_10097733 Ga0075433_100977332 176
522 3300006871 Ga0075434_100001700 Ga0075434_10000170017 176
523 3300006871 Ga0075434_100003565 Ga0075434_10000356513 176
524 3300006871 Ga0075434_100261194 Ga0075434_1002611942 176
525 3300006871 Ga0075434_100489468 Ga0075434_1004894683 176
526 3300006880 Ga0075429_100027666 Ga0075429_1000276663 176
527 3300006880 Ga0075429_100801880 Ga0075429_1008018801 176
528 3300006881 Ga0068865_100000230 Ga0068865_10000023029 176
529 3300006881 Ga0068865_100056340 Ga0068865_1000563402 176
530 3300006881 Ga0068865_100102449 Ga0068865_1001024493 176
531 3300006914 Ga0075436_100061927 Ga0075436_1000619273 176
532 3300006914 Ga0075436_100156448 Ga0075436_1001564482 176
533 3300006914 Ga0075436_100552188 Ga0075436_1005521882 176
534 3300006931 Ga0097620_100001353 Ga0097620_1000013538 176
535 3300006931 Ga0097620_100072439 Ga0097620_1000724393 176
536 3300006931 Ga0097620_100221535 Ga0097620_1002215352 176
537 3300007076 Ga0075435_100001109 Ga0075435_1000011098 176
538 3300007076 Ga0075435_100017628 Ga0075435_1000176286 176
539 3300007076 Ga0075435_100116938 Ga0075435_1001169382 176
540 3300007076 Ga0075435_100192974 Ga0075435_1001929742 176
541 3300009011 Ga0105251_10038761 Ga0105251_100387611 176
542 3300009092 Ga0105250_10040716 Ga0105250_100407162 176
543 3300009093 Ga0105240_10067652 Ga0105240_100676524 176
544 3300009094 Ga0111539_10000932 Ga0111539_1000093216 176
545 3300009094 Ga0111539_10002162 Ga0111539_1000216220 176
546 3300009094 Ga0111539_10059566 Ga0111539_100595666 176
547 3300009098 Ga0105245_10000258 Ga0105245_1000025831 176
548 3300009098 Ga0105245_10012413 Ga0105245_100124132 176
549 3300009098 Ga0105245_10103418 Ga0105245_101034183 176
550 3300009101 Ga0105247_10015208 Ga0105247_100152084 176
551 3300009101 Ga0105247_10242887 Ga0105247_102428872 176
552 3300009101 Ga0105247_10445797 Ga0105247_104457971 176
553 3300009148 Ga0105243_10000846 Ga0105243_1000084616 176
554 3300009148 Ga0105243_10014969 Ga0105243_100149692 176
555 3300009148 Ga0105243_10023951 Ga0105243_100239515 176
556 3300009148 Ga0105243_10043258 Ga0105243_100432582 176
557 3300009174 Ga0105241_10141570 Ga0105241_101415701 176
558 3300009176 Ga0105242_10000037 Ga0105242_1000003760 176
559 3300009176 Ga0105242_10033883 Ga0105242_100338833 176
560 3300009176 Ga0105242_10057874 Ga0105242_100578742 176
561 3300009177 Ga0105248_10000744 Ga0105248_1000074415 176
562 3300009177 Ga0105248_10536829 Ga0105248_105368292 176
563 3300009545 Ga0105237_10020951 Ga0105237_100209515 176
564 3300009545 Ga0105237_10112148 Ga0105237_101121482 176
565 3300009551 Ga0105238_10066539 Ga0105238_100665393 176
566 3300009551 Ga0105238_10183495 Ga0105238_101834953 176
567 3300009553 Ga0105249_10000209 Ga0105249_1000020951 176
568 3300009553 Ga0105249_10026930 Ga0105249_100269306 176
569 3300010375 Ga0105239_10001464 Ga0105239_1000146417 176
570 3300010375 Ga0105239_10096125 Ga0105239_100961252 176
571 3300011119 Ga0105246_10026773 Ga0105246_100267733 176
572 3300011119 Ga0105246_10648283 Ga0105246_106482831 176
573 3300012478 Ga0157328_1001425 Ga0157328_10014252 176
574 3300012500 Ga0157314_1002672 Ga0157314_10026723 176
575 3300012500 Ga0157314_1013035 Ga0157314_10130352 176
576 3300012507 Ga0157342_1003689 Ga0157342_10036892 176
577 3300012508 Ga0157315_1002711 Ga0157315_10027113 176
578 3300012510 Ga0157316_1000114 Ga0157316_10001144 176
579 3300013100 Ga0157373_10344110 Ga0157373_103441102 176
580 3300013100 Ga0157373_10412442 Ga0157373_104124421 176
581 3300013100 Ga0157373_10595511 Ga0157373_105955112 176
582 3300013102 Ga0157371_10421423 Ga0157371_104214232 176
583 3300013102 Ga0157371_10582158 Ga0157371_105821581 176
584 3300013105 Ga0157369_10955537 Ga0157369_109555372 176
585 3300013297 Ga0157378_10001580 Ga0157378_1000158013 176
586 3300013297 Ga0157378_10711400 Ga0157378_107114002 176
587 3300013297 Ga0157378_10819210 Ga0157378_108192101 176
588 3300013306 Ga0163162_10001677 Ga0163162_100016777 176
589 3300013306 Ga0163162_10470559 Ga0163162_104705591 176
590 3300013306 Ga0163162_11510553 Ga0163162_115105532 176
591 3300013307 Ga0157372_10109839 Ga0157372_101098393 176
592 3300013307 Ga0157372_10158955 Ga0157372_101589552 176
593 3300013307 Ga0157372_10469552 Ga0157372_104695522 176
594 3300013307 Ga0157372_10866812 Ga0157372_108668122 176
595 3300013308 Ga0157375_10000263 Ga0157375_1000026355 176
596 3300013308 Ga0157375_10428144 Ga0157375_104281441 176
597 3300014325 Ga0163163_10019201 Ga0163163_100192013 176
598 3300014325 Ga0163163_11352258 Ga0163163_113522582 176
599 3300014326 Ga0157380_10000294 Ga0157380_1000029420 176
600 3300014326 Ga0157380_10077167 Ga0157380_100771673 176
601 3300014745 Ga0157377_10001222 Ga0157377_1000122211 176
602 3300014968 Ga0157379_10002453 Ga0157379_1000245316 176
603 3300014968 Ga0157379_10027532 Ga0157379_100275323 176
604 3300014968 Ga0157379_10696930 Ga0157379_106969302 176
605 3300014969 Ga0157376_10000342 Ga0157376_1000034219 176
606 3300014969 Ga0157376_10461782 Ga0157376_104617822 176
607 3300014969 Ga0157376_11216849 Ga0157376_112168492 176
608 3300017792 Ga0163161_10000523 Ga0163161_1000052323 176
609 3300020069 Ga0197907_10014073 Ga0197907_100140732 176
610 3300025271 Ga0207666_1000010 Ga0207666_10000107 176
611 3300025271 Ga0207666_1001035 Ga0207666_10010354 176
612 3300025290 Ga0207673_1000164 Ga0207673_10001646 176
613 3300025315 Ga0207697_10000186 Ga0207697_1000018631 176
614 3300025893 Ga0207682_10000123 Ga0207682_1000012325 176
615 3300025898 Ga0207692_10004961 Ga0207692_100049616 176
616 3300025898 Ga0207692_10087164 Ga0207692_100871643 176
617 3300025898 Ga0207692_10094665 Ga0207692_100946653 176
618 3300025899 Ga0207642_10000263 Ga0207642_1000026312 176
619 3300025900 Ga0207710_10004419 Ga0207710_100044192 176
620 3300025900 Ga0207710_10304335 Ga0207710_103043351 176
621 3300025901 Ga0207688_10000889 Ga0207688_100008893 176
622 3300025901 Ga0207688_10056265 Ga0207688_100562651 176
623 3300025903 Ga0207680_10001117 Ga0207680_1000111714 176
624 3300025903 Ga0207680_10077237 Ga0207680_100772372 176
625 3300025904 Ga0207647_10005506 Ga0207647_1000550610 176
626 3300025904 Ga0207647_10046296 Ga0207647_100462964 176
627 3300025905 Ga0207685_10001241 Ga0207685_100012413 176
628 3300025906 Ga0207699_10023071 Ga0207699_100230711 176
629 3300025906 Ga0207699_10026530 Ga0207699_100265302 176
630 3300025907 Ga0207645_10000023 Ga0207645_1000002329 176
631 3300025907 Ga0207645_10020930 Ga0207645_100209305 176
632 3300025907 Ga0207645_10051083 Ga0207645_100510832 176
633 3300025907 Ga0207645_10132679 Ga0207645_101326792 176
634 3300025908 Ga0207643_10000007 Ga0207643_1000000720 176
635 3300025910 Ga0207684_10339377 Ga0207684_103393773 176
636 3300025911 Ga0207654_10374275 Ga0207654_103742751 176
637 3300025912 Ga0207707_10002015 Ga0207707_1000201514 176
638 3300025912 Ga0207707_10094416 Ga0207707_100944162 176
639 3300025912 Ga0207707_10112364 Ga0207707_101123643 176
640 3300025912 Ga0207707_10565521 Ga0207707_105655212 176
641 3300025913 Ga0207695_10338560 Ga0207695_103385602 176
642 3300025914 Ga0207671_10008841 Ga0207671_100088415 176
643 3300025915 Ga0207693_10012859 Ga0207693_100128597 176
644 3300025915 Ga0207693_10132335 Ga0207693_101323352 176
645 3300025915 Ga0207693_10233177 Ga0207693_102331772 176
646 3300025915 Ga0207693_10291617 Ga0207693_102916172 176
647 3300025916 Ga0207663_10040066 Ga0207663_100400663 176
648 3300025916 Ga0207663_10060441 Ga0207663_100604412 176
649 3300025917 Ga0207660_10000393 Ga0207660_1000039313 176
650 3300025917 Ga0207660_10128860 Ga0207660_101288602 176
651 3300025918 Ga0207662_10000136 Ga0207662_1000013636 176
652 3300025918 Ga0207662_10011289 Ga0207662_100112894 176
653 3300025918 Ga0207662_10252685 Ga0207662_102526852 176
654 3300025919 Ga0207657_10005004 Ga0207657_100050043 176
655 3300025919 Ga0207657_10055737 Ga0207657_100557373 176
656 3300025920 Ga0207649_10000434 Ga0207649_1000043417 176
657 3300025921 Ga0207652_10001720 Ga0207652_1000172017 176
658 3300025923 Ga0207681_10000273 Ga0207681_1000027325 176
659 3300025923 Ga0207681_10173194 Ga0207681_101731941 176
660 3300025923 Ga0207681_10859255 Ga0207681_108592551 176
661 3300025924 Ga0207694_10052606 Ga0207694_100526063 176
662 3300025924 Ga0207694_10596276 Ga0207694_105962762 176
663 3300025925 Ga0207650_10001932 Ga0207650_1000193214 176
664 3300025925 Ga0207650_10597000 Ga0207650_105970001 176
665 3300025926 Ga0207659_10000097 Ga0207659_1000009731 176
666 3300025926 Ga0207659_10059029 Ga0207659_100590293 176
667 3300025927 Ga0207687_10001031 Ga0207687_1000103114 176
668 3300025927 Ga0207687_10020925 Ga0207687_100209255 176
669 3300025928 Ga0207700_10000167 Ga0207700_100001679 176
670 3300025928 Ga0207700_10307066 Ga0207700_103070662 176
671 3300025928 Ga0207700_11001076 Ga0207700_110010761 176
672 3300025929 Ga0207664_10038266 Ga0207664_100382665 176
673 3300025929 Ga0207664_10271211 Ga0207664_102712112 176
674 3300025931 Ga0207644_10001738 Ga0207644_1000173811 176
675 3300025931 Ga0207644_10036997 Ga0207644_100369972 176
676 3300025932 Ga0207690_10000962 Ga0207690_100009623 176
677 3300025932 Ga0207690_10151161 Ga0207690_101511613 176
678 3300025932 Ga0207690_10289535 Ga0207690_102895352 176
679 3300025932 Ga0207690_10824478 Ga0207690_108244781 176
680 3300025933 Ga0207706_10000867 Ga0207706_1000086729 176
681 3300025933 Ga0207706_10017224 Ga0207706_100172246 176
682 3300025933 Ga0207706_10021114 Ga0207706_100211146 176
683 3300025933 Ga0207706_10036344 Ga0207706_100363441 176
684 3300025934 Ga0207686_10000329 Ga0207686_1000032936 176
685 3300025934 Ga0207686_10107854 Ga0207686_101078542 176
686 3300025935 Ga0207709_10000419 Ga0207709_100004197 176
687 3300025935 Ga0207709_10045024 Ga0207709_100450244 176
688 3300025935 Ga0207709_10101156 Ga0207709_101011563 176
689 3300025935 Ga0207709_10245035 Ga0207709_102450352 176
690 3300025936 Ga0207670_10000536 Ga0207670_1000053620 176
691 3300025936 Ga0207670_10792165 Ga0207670_107921651 176
692 3300025937 Ga0207669_10002798 Ga0207669_100027983 176
693 3300025938 Ga0207704_10000119 Ga0207704_1000011952 176
694 3300025938 Ga0207704_10074797 Ga0207704_100747973 176
695 3300025938 Ga0207704_10282642 Ga0207704_102826421 176
696 3300025938 Ga0207704_11061300 Ga0207704_110613001 176
697 3300025939 Ga0207665_10000417 Ga0207665_1000041722 176
698 3300025940 Ga0207691_10000544 Ga0207691_100005447 176
699 3300025940 Ga0207691_10023702 Ga0207691_100237023 176
700 3300025940 Ga0207691_10170474 Ga0207691_101704743 176
701 3300025940 Ga0207691_10395597 Ga0207691_103955971 176
702 3300025941 Ga0207711_10002468 Ga0207711_1000246817 176
703 3300025941 Ga0207711_10105904 Ga0207711_101059043 176
704 3300025941 Ga0207711_10319609 Ga0207711_103196092 176
705 3300025942 Ga0207689_10001743 Ga0207689_1000174317 176
706 3300025942 Ga0207689_10381710 Ga0207689_103817102 176
707 3300025942 Ga0207689_10461869 Ga0207689_104618692 176
708 3300025944 Ga0207661_10000428 Ga0207661_1000042825 176
709 3300025945 Ga0207679_10000029 Ga0207679_10000029178 176
710 3300025945 Ga0207679_10129224 Ga0207679_101292241 176
711 3300025945 Ga0207679_10278209 Ga0207679_102782092 176
712 3300025949 Ga0207667_10017999 Ga0207667_100179996 176
713 3300025960 Ga0207651_10000083 Ga0207651_1000008321 176
714 3300025961 Ga0207712_10000471 Ga0207712_1000047117 176
715 3300025961 Ga0207712_10019998 Ga0207712_100199983 176
716 3300025972 Ga0207668_10000862 Ga0207668_1000086220 176
717 3300025981 Ga0207640_10000637 Ga0207640_1000063717 176
718 3300025981 Ga0207640_10800633 Ga0207640_108006332 176
719 3300025986 Ga0207658_10002203 Ga0207658_100022033 176
720 3300025986 Ga0207658_10041282 Ga0207658_100412824 176
721 3300025986 Ga0207658_10041634 Ga0207658_100416343 176
722 3300025986 Ga0207658_10342647 Ga0207658_103426472 176
723 3300025986 Ga0207658_11021815 Ga0207658_110218151 176
724 3300025986 Ga0207658_11657912 Ga0207658_116579121 176
725 3300026023 Ga0207677_10000992 Ga0207677_1000099216 176
726 3300026023 Ga0207677_10368905 Ga0207677_103689052 176
727 3300026023 Ga0207677_10791571 Ga0207677_107915711 176
728 3300026035 Ga0207703_10005165 Ga0207703_100051656 176
729 3300026035 Ga0207703_10008054 Ga0207703_1000805410 176
730 3300026035 Ga0207703_10592055 Ga0207703_105920551 176
731 3300026041 Ga0207639_10005126 Ga0207639_100051267 176
732 3300026041 Ga0207639_10117256 Ga0207639_101172562 176
733 3300026067 Ga0207678_10001568 Ga0207678_1000156820 176
734 3300026067 Ga0207678_10021304 Ga0207678_100213045 176
735 3300026067 Ga0207678_10029617 Ga0207678_100296174 176
736 3300026067 Ga0207678_10055746 Ga0207678_100557463 176
737 3300026067 Ga0207678_10666137 Ga0207678_106661372 176
738 3300026075 Ga0207708_10002060 Ga0207708_100020607 176
739 3300026075 Ga0207708_10005462 Ga0207708_100054628 176
740 3300026075 Ga0207708_10017276 Ga0207708_100172765 176
741 3300026078 Ga0207702_10001921 Ga0207702_1000192117 176
742 3300026078 Ga0207702_10369941 Ga0207702_103699413 176
743 3300026088 Ga0207641_10000510 Ga0207641_1000051020 176
744 3300026089 Ga0207648_10003487 Ga0207648_100034876 176
745 3300026089 Ga0207648_10212920 Ga0207648_102129201 176
746 3300026089 Ga0207648_10462116 Ga0207648_104621162 176
747 3300026095 Ga0207676_10003788 Ga0207676_1000378811 176
748 3300026095 Ga0207676_10028269 Ga0207676_100282693 176
749 3300026095 Ga0207676_10102196 Ga0207676_101021963 176
750 3300026116 Ga0207674_10000608 Ga0207674_100006087 176
751 3300026116 Ga0207674_10141868 Ga0207674_101418683 176
752 3300026116 Ga0207674_10495818 Ga0207674_104958182 176
753 3300026118 Ga0207675_100000805 Ga0207675_1000008057 176
754 3300026118 Ga0207675_100026921 Ga0207675_1000269214 176
755 3300026118 Ga0207675_100714409 Ga0207675_1007144091 176
756 3300026121 Ga0207683_10000082 Ga0207683_1000008245 176
757 3300026121 Ga0207683_10006710 Ga0207683_100067103 176
758 3300026121 Ga0207683_10056132 Ga0207683_100561322 176
759 3300026142 Ga0207698_10000377 Ga0207698_1000037714 176
760 3300026142 Ga0207698_10313595 Ga0207698_103135952 176
761 3300027424 Ga0209984_1003002 Ga0209984_10030022 176
762 3300027471 Ga0209995_1018973 Ga0209995_10189732 176
763 3300027617 Ga0210002_1003792 Ga0210002_10037922 176
764 3300027665 Ga0209983_1006337 Ga0209983_10063373 176
765 3300027682 Ga0209971_1003286 Ga0209971_10032865 176
766 3300027695 Ga0209966_1001565 Ga0209966_10015653 176
767 3300027695 Ga0209966_1016036 Ga0209966_10160362 176
768 3300027717 Ga0209998_10000947 Ga0209998_100009476 176
769 3300027717 Ga0209998_10007515 Ga0209998_100075154 176
770 3300027717 Ga0209998_10009536 Ga0209998_100095364 176
771 3300027876 Ga0209974_10029116 Ga0209974_100291162 176
772 3300027876 Ga0209974_10047466 Ga0209974_100474662 176
773 3300027876 Ga0209974_10118998 Ga0209974_101189982 176
774 3300027907 Ga0207428_10000124 Ga0207428_1000012483 176
775 3300027907 Ga0207428_10000420 Ga0207428_1000042031 176
776 3300027907 Ga0207428_10000703 Ga0207428_1000070328 176
777 3300028379 Ga0268266_10101549 Ga0268266_101015493 176
778 3300028380 Ga0268265_10001170 Ga0268265_100011709 176
779 3300028380 Ga0268265_10017735 Ga0268265_100177355 176
780 3300028381 Ga0268264_10001878 Ga0268264_100018787 176
781 3300028381 Ga0268264_10047711 Ga0268264_100477112 176
782 3300028556 Ga0265337_1006137 Ga0265337_10061372 176
783 3300028800 Ga0265338_10061561 Ga0265338_100615612 176
784 3300031090 Ga0265760_10017485 Ga0265760_100174852 176
785 3300031344 Ga0265316_10215591 Ga0265316_102155913 176
786 3300031595 Ga0265313_10110491 Ga0265313_101104912 176
787 3300034816 Ga0373930_0000680 Ga0373930_0000680_4168_4698 176
788 3300034816 Ga0373930_0008825 Ga0373930_0008825_845_1375 176
789 3300034817 Ga0373948_0000196 Ga0373948_0000196_4196_4726 176
790 3300034818 Ga0373950_0001373 Ga0373950_0001373_894_1424 176
791 3300034818 Ga0373950_0005433 Ga0373950_0005433_1293_1823 176
792 3300034819 Ga0373958_0001277 Ga0373958_0001277_2270_2800 176
793 3300034819 Ga0373958_0002069 Ga0373958_0002069_75_605 176
794 3300034819 Ga0373958_0020804 Ga0373958_0020804_92_622 176
795 3300034820 Ga0373959_0043135 Ga0373959_0043135_191_721 176
796 3300034820 Ga0373959_0150486 Ga0373959_0150486_26_556 176
797 3300034957 Ga0373938_0000092 Ga0373938_0000092_1759_2289 176
798 3300034957 Ga0373938_0003487 Ga0373938_0003487_1279_1809 176
799 3300034957 Ga0373938_0020764 Ga0373938_0020764_607_1137 176
800 3300035083 Ga0373926_0041110 Ga0373926_0041110_54_584 176
801 3300035084 Ga0373928_0003337 Ga0373928_0003337_285_815 176
802 3300035084 Ga0373928_0005526 Ga0373928_0005526_1108_1638 176
803 3300035085 Ga0373929_0000128 Ga0373929_0000128_5062_5592 176
804 3300035088 Ga0373940_0005195 Ga0373940_0005195_134_664 176
805 3300035088 Ga0373940_0049925 Ga0373940_0049925_611_1141 176
806 3300035089 Ga0373944_0045330 Ga0373944_0045330_668_1198 176
807 3300035090 Ga0373949_0000715 Ga0373949_0000715_5704_6234 176
808 3300035090 Ga0373949_0011216 Ga0373949_0011216_193_723 176
809 3300035090 Ga0373949_0035614 Ga0373949_0035614_214_744 176
810 3300035091 Ga0373951_0000531 Ga0373951_0000531_9369_9899 176
811 3300035091 Ga0373951_0003670 Ga0373951_0003670_2752_3282 176
812 3300035092 Ga0373952_0006526 Ga0373952_0006526_1381_1911 176
813 3300035092 Ga0373952_0008456 Ga0373952_0008456_786_1316 176
814 3300035111 Ga0373923_0002485 Ga0373923_0002485_3773_4303 176
815 3300035111 Ga0373923_0090402 Ga0373923_0090402_65_595 176
816 3300035112 Ga0373932_0000510 Ga0373932_0000510_11217_11747 176
817 3300035112 Ga0373932_0000597 Ga0373932_0000597_5586_6116 176
818 3300035112 Ga0373932_0002240 Ga0373932_0002240_743_1273 176
819 3300035114 Ga0373939_0000361 Ga0373939_0000361_5779_6309 176
820 3300035114 Ga0373939_0000377 Ga0373939_0000377_6149_6679 176
821 3300035114 Ga0373939_0013576 Ga0373939_0013576_1212_1742 176
822 3300035114 Ga0373939_0016420 Ga0373939_0016420_978_1508 176
823 3300035115 Ga0373941_0020117 Ga0373941_0020117_1327_1857 176
824 3300035117 Ga0373953_0003611 Ga0373953_0003611_3031_3597 176
825 3300035117 Ga0373953_0427848 Ga0373953_0427848_22_552 176
826 3300035118 Ga0373954_0096413 Ga0373954_0096413_341_871 176
827 3300035118 Ga0373954_0252495 Ga0373954_0252495_304_834 176
828 3300035119 Ga0373956_0077711 Ga0373956_0077711_621_1151 176
829 3300035119 Ga0373956_0343485 Ga0373956_0343485_69_599 176
830 3300035120 Ga0373957_0079690 Ga0373957_0079690_570_1136 176
831 3300035121 Ga0373960_0000204 Ga0373960_0000204_5931_6461 176
832 3300035121 Ga0373960_0001684 Ga0373960_0001684_1881_2411 176
833 3300035170 Ga0373943_0105507 Ga0373943_0105507_120_650 176
834 3300035170 Ga0373943_0474672 Ga0373943_0474672_68_598 176
835 3300035171 Ga0373946_0003985 Ga0373946_0003985_3487_4017 176
836 3300035172 Ga0373955_0018458 Ga0373955_0018458_1589_2155 176
837 3300035207 Ga0373942_0000813 Ga0373942_0000813_2321_2851 176
838 3300035207 Ga0373942_0002869 Ga0373942_0002869_53_583 176
839 3300035241 Ga0373961_0001755 Ga0373961_0001755_4531_5061 176
840 3300035241 Ga0373961_0001827 Ga0373961_0001827_3358_3888 176
841 3300035241 Ga0373961_0106872 Ga0373961_0106872_369_899 176
842 3300035242 Ga0373962_0066553 Ga0373962_0066553_411_941 176
843 3300035242 Ga0373962_0113069 Ga0373962_0113069_127_657 176
844 3300035410 Ga0373924_0016721 Ga0373924_0016721_697_1263 176
845 3300035410 Ga0373924_0065453 Ga0373924_0065453_902_1498 176
846 3300035691 Ga0373931_0000186 Ga0373931_0000186_11160_11690 176
847 3300035691 Ga0373931_0002333 Ga0373931_0002333_6724_7254 176
848 3300035691 Ga0373931_0003707 Ga0373931_0003707_368_898 176
849 3300035692 Ga0373935_0016872 Ga0373935_0016872_2678_3208 176
850 3300035695 Ga0373927_0063603 Ga0373927_0063603_1711_2241 176
851 3300035724 Ga0373933_0072189 Ga0373933_0072189_1484_2014 176
852 3300036401 Ga0373937_0009657 Ga0373937_0009657_3981_4547 176
853 3300036401 Ga0373937_0023701 Ga0373937_0023701_1514_2086 176
854 3300036401 Ga0373937_0025502 Ga0373937_0025502_3178_3708 176
855 3300036401 Ga0373937_0199890 Ga0373937_0199890_666_1196 176
856 3300036401 Ga0373937_0494850 Ga0373937_0494850_357_887 176
857 3300037068 Ga0373925_0005307 Ga0373925_0005307_272_802 176
858 3300037068 Ga0373925_0058062 Ga0373925_0058062_2216_2746 176
859 3300037068 Ga0373925_0473795 Ga0373925_0473795_60_590 176
860 3300038996 Ga0242420_019213 Ga0242420_019213_22_615 176
861 3300039437 Ga0436365_0823677 Ga0436365_0823677_461_994 176
862 3300042008 Ga0439450_031306 Ga0439450_031306_115_645 176
863 3300042012 Ga0439455_0003575 Ga0439455_0003575_1610_2140 176
864 3300042438 Ga0439459_0067897 Ga0439459_0067897_176_706 176
865 3300042876 Ga0451577_0600374 Ga0451577_0600374_71_613 176
866 3300044712 Ga0453684_0066809 Ga0453684_0066809_691_1221 176
867 3300045051 Ga0451576_0039893 Ga0451576_0039893_3410_3940 176
868 3300046454 Ga0495592_0001116 Ga0495592_0001116_11493_12023 176
869 3300046454 Ga0495592_0009742 Ga0495592_0009742_882_1448 176
870 3300046454 Ga0495592_0057294 Ga0495592_0057294_1851_2381 176
871 3300046454 Ga0495592_0096795 Ga0495592_0096795_1231_1761 176
872 3300046459 Ga0495629_0016112 Ga0495629_0016112_1109_1639 176
873 3300046461 Ga0495641_0023574 Ga0495641_0023574_631_1161 176
874 3300046461 Ga0495641_0188442 Ga0495641_0188442_86_616 176
875 3300046461 Ga0495641_0285807 Ga0495641_0285807_137_667 176
876 3300046462 Ga0495651_0000493 Ga0495651_0000493_22873_23439 176
877 3300046462 Ga0495651_0016283 Ga0495651_0016283_5016_5546 176
878 3300046463 Ga0495653_0004657 Ga0495653_0004657_3631_4197 176
879 3300046463 Ga0495653_0012444 Ga0495653_0012444_4698_5228 176
880 3300046463 Ga0495653_0041839 Ga0495653_0041839_1740_2270 176
881 3300046472 Ga0495580_0483081 Ga0495580_0483081_259_816 176
882 3300046475 Ga0495639_0046937 Ga0495639_0046937_1223_1753 176
883 3300046476 Ga0495662_0023030 Ga0495662_0023030_304_834 176
884 3300046477 Ga0495664_0001609 Ga0495664_0001609_9508_10038 176
885 3300046491 Ga0495584_0014705 Ga0495584_0014705_726_1256 176
886 3300046499 Ga0495594_0047336 Ga0495594_0047336_188_718 176
887 3300046511 Ga0495608_0010562 Ga0495608_0010562_2578_3144 176
888 3300046511 Ga0495608_0013937 Ga0495608_0013937_2161_2691 176
889 3300046514 Ga0495618_0007452 Ga0495618_0007452_3962_4528 176
890 3300046516 Ga0495628_0002046 Ga0495628_0002046_3631_4197 176
891 3300046516 Ga0495628_0009974 Ga0495628_0009974_3049_3579 176
892 3300046516 Ga0495628_0014402 Ga0495628_0014402_6057_6587 176
893 3300046517 Ga0495630_0542717 Ga0495630_0542717_96_662 176
894 3300046520 Ga0495637_0101288 Ga0495637_0101288_567_1097 176
895 3300046529 Ga0495652_0234879 Ga0495652_0234879_547_1113 176
896 3300046531 Ga0495665_0052492 Ga0495665_0052492_18_548 176
897 3300046533 Ga0495640_0020957 Ga0495640_0020957_3908_4474 176
898 3300046533 Ga0495640_0081965 Ga0495640_0081965_28_558 176
899 3300046536 Ga0495587_0000335 Ga0495587_0000335_30420_30986 176
900 3300046543 Ga0495645_0001781 Ga0495645_0001781_5108_5638 176
901 3300046543 Ga0495645_0123648 Ga0495645_0123648_555_1085 176
902 3300046557 Ga0495622_0018802 Ga0495622_0018802_1409_1939 176
903 3300046559 Ga0495667_0004928 Ga0495667_0004928_973_1539 176
904 3300046559 Ga0495667_0042835 Ga0495667_0042835_1297_1827 176
905 3300046559 Ga0495667_0358182 Ga0495667_0358182_305_835 176
906 3300046642 Ga0495634_0007696 Ga0495634_0007696_1716_2246 176
907 3300046642 Ga0495634_0017766 Ga0495634_0017766_452_1018 176
908 3300046663 Ga0495635_0000736 Ga0495635_0000736_4706_5272 176
909 3300046663 Ga0495635_0045113 Ga0495635_0045113_2413_2982 176
910 3300046663 Ga0495635_0061837 Ga0495635_0061837_414_944 176
911 3300046675 Ga0495657_0000836 Ga0495657_0000836_1657_2223 176
912 3300046675 Ga0495657_0082765 Ga0495657_0082765_158_688 176
913 3300046675 Ga0495657_0110571 Ga0495657_0110571_1092_1622 176
914 3300046675 Ga0495657_0393244 Ga0495657_0393244_67_597 176
915 3300046678 Ga0495599_0134578 Ga0495599_0134578_125_691 176
916 3300046679 Ga0495623_0027709 Ga0495623_0027709_2646_3212 176
917 3300046680 Ga0495646_0000229 Ga0495646_0000229_8948_9514 176
918 3300046680 Ga0495646_0006372 Ga0495646_0006372_6702_7232 176
919 3300046683 Ga0495658_0002748 Ga0495658_0002748_1401_1931 176
920 3300046684 Ga0495669_0119181 Ga0495669_0119181_220_777 176
921 3300046684 Ga0495669_0182857 Ga0495669_0182857_37_567 176
922 3300046809 Ga0495600_0004219 Ga0495600_0004219_1578_2144 176
923 3300046809 Ga0495600_0009757 Ga0495600_0009757_4132_4662 176
924 3300046809 Ga0495600_0135366 Ga0495600_0135366_152_682 176
925 3300046809 Ga0495600_0261780 Ga0495600_0261780_350_880 176
926 3300047317 Ga0495604_0021677 Ga0495604_0021677_1274_1804 176
927 3300047317 Ga0495604_0028471 Ga0495604_0028471_120_686 176
928 3300047317 Ga0495604_0043834 Ga0495604_0043834_1319_1849 176
929 3300047319 Ga0495674_0034790 Ga0495674_0034790_1260_1790 176
930 3300047319 Ga0495674_0050397 Ga0495674_0050397_419_985 176
931 3300047322 Ga0495680_0005567 Ga0495680_0005567_9817_10383 176
932 3300047322 Ga0495680_0015939 Ga0495680_0015939_1095_1625 176
933 3300047322 Ga0495680_0036864 Ga0495680_0036864_2109_2639 176
934 3300047444 Ga0495675_0000139 Ga0495675_0000139_973_1539 176
935 3300047445 Ga0495677_0019658 Ga0495677_0019658_1373_1903 176
936 3300047471 Ga0495684_0016053 Ga0495684_0016053_3680_4246 176
937 3300047471 Ga0495684_0255654 Ga0495684_0255654_430_960 176
938 3300047673 Ga0495593_0064941 Ga0495593_0064941_1341_1871 176
939 3300047673 Ga0495593_0116979 Ga0495593_0116979_414_980 176
940 3300048088 Ga0495602_0004714 Ga0495602_0004714_3366_3896 176
941 3300048088 Ga0495602_0006950 Ga0495602_0006950_2894_3460 176
942 3300048088 Ga0495602_0630110 Ga0495602_0630110_159_689 176
943 3300048903 Ga0496100_0000057 Ga0496100_0000057_14021_14551 176
944 3300048903 Ga0496100_0088881 Ga0496100_0088881_488_1018 176
945 3300048903 Ga0496100_0126792 Ga0496100_0126792_861_1427 176
946 3300048903 Ga0496100_1162460 Ga0496100_1162460_21_551 176
947 3300048904 Ga0496101_0001297 Ga0496101_0001297_3255_3785 176
948 3300048904 Ga0496101_0021335 Ga0496101_0021335_1111_1641 176
949 3300048904 Ga0496101_0697545 Ga0496101_0697545_143_673 176
950 3300048905 Ga0496102_0001628 Ga0496102_0001628_7059_7589 176
951 3300048905 Ga0496102_0031718 Ga0496102_0031718_117_647 176
952 3300048905 Ga0496102_0146655 Ga0496102_0146655_611_1141 176
953 3300048905 Ga0496102_0447252 Ga0496102_0447252_145_675 176
954 3300048905 Ga0496102_0465246 Ga0496102_0465246_108_689 176
955 3300048906 Ga0496103_0003313 Ga0496103_0003313_9142_9672 176
956 3300048906 Ga0496103_0016110 Ga0496103_0016110_834_1364 176
957 3300048907 Ga0496104_0000658 Ga0496104_0000658_26585_27154 176
958 3300048907 Ga0496104_0063613 Ga0496104_0063613_2250_2780 176
959 3300048907 Ga0496104_0143016 Ga0496104_0143016_614_1144 176
960 3300048907 Ga0496104_0242057 Ga0496104_0242057_333_899 176
961 3300048907 Ga0496104_0330861 Ga0496104_0330861_491_1021 176
962 3300048907 Ga0496104_0349874 Ga0496104_0349874_720_1250 176
963 3300048907 Ga0496104_0378776 Ga0496104_0378776_128_658 176
964 3300048908 Ga0496105_0003619 Ga0496105_0003619_3769_4299 176
965 3300048908 Ga0496105_0007433 Ga0496105_0007433_3642_4211 176
966 3300048908 Ga0496105_0051118 Ga0496105_0051118_2796_3326 176
967 3300048908 Ga0496105_0128809 Ga0496105_0128809_1226_1756 176
968 3300048908 Ga0496105_0713944 Ga0496105_0713944_177_707 176
969 3300048909 Ga0496106_0000518 Ga0496106_0000518_11160_11690 176
970 3300048909 Ga0496106_0013856 Ga0496106_0013856_4376_4906 176
971 3300048909 Ga0496106_0016140 Ga0496106_0016140_3121_3702 176
972 3300048909 Ga0496106_0036474 Ga0496106_0036474_15_545 176
973 3300048909 Ga0496106_0211603 Ga0496106_0211603_651_1181 176
974 3300048910 Ga0496107_0001129 Ga0496107_0001129_3255_3785 176
975 3300048910 Ga0496107_0008616 Ga0496107_0008616_4842_5402 176
976 3300048910 Ga0496107_0023162 Ga0496107_0023162_3369_3899 176
977 3300048910 Ga0496107_0061873 Ga0496107_0061873_1688_2218 176
978 3300048910 Ga0496107_0275409 Ga0496107_0275409_384_950 176
979 3300048910 Ga0496107_0981283 Ga0496107_0981283_22_552 176
980 3300048911 Ga0496108_0004254 Ga0496108_0004254_8476_9006 176
981 3300048911 Ga0496108_0044088 Ga0496108_0044088_2035_2565 176
982 3300048912 Ga0496109_0000390 Ga0496109_0000390_26081_26611 176
983 3300048912 Ga0496109_0002432 Ga0496109_0002432_504_1034 176
984 3300048912 Ga0496109_0023523 Ga0496109_0023523_1670_2236 176
985 3300048912 Ga0496109_0038068 Ga0496109_0038068_584_1114 176
986 3300048913 Ga0496110_0005641 Ga0496110_0005641_4353_4883 176
987 3300048913 Ga0496110_0014086 Ga0496110_0014086_4631_5161 176
988 3300048913 Ga0496110_0186510 Ga0496110_0186510_167_697 176
989 3300048914 Ga0496111_0020628 Ga0496111_0020628_3967_4497 176
990 3300048914 Ga0496111_0027669 Ga0496111_0027669_2393_2923 176
991 3300048914 Ga0496111_0092363 Ga0496111_0092363_969_1499 176
992 3300048915 Ga0496112_0025896 Ga0496112_0025896_2291_2821 176
993 3300048916 Ga0496113_0019170 Ga0496113_0019170_277_807 176
994 3300048916 Ga0496113_0120372 Ga0496113_0120372_290_820 176
995 3300048917 Ga0496114_0002944 Ga0496114_0002944_612_1142 176
996 3300048917 Ga0496114_0046938 Ga0496114_0046938_1813_2343 176
997 3300048917 Ga0496114_0266690 Ga0496114_0266690_702_1232 176
998 3300048917 Ga0496114_0704363 Ga0496114_0704363_35_604 176
999 3300048918 Ga0496115_0014682 Ga0496115_0014682_4840_5409 176
1000 3300048918 Ga0496115_0073108 Ga0496115_0073108_1905_2435 176
1001 3300048918 Ga0496115_0179507 Ga0496115_0179507_835_1365 176
1002 3300048918 Ga0496115_0586416 Ga0496115_0586416_81_611 176
1003 3300048928 Ga0496125_0300386 Ga0496125_0300386_141_671 176
1004 3300049581 Ga0501047_0425427 Ga0501047_0425427_441_983 176
1005 3300049590 Ga0501074_0095235 Ga0501074_0095235_495_1031 176
1006 3300049592 Ga0501076_0127841 Ga0501076_0127841_603_1133 176
1007 3300049593 Ga0501077_0358400 Ga0501077_0358400_139_672 176
1008 3300049742 Ga0501080_0178247 Ga0501080_0178247_1264_1794 176
1009 3300049743 Ga0501081_0389603 Ga0501081_0389603_479_1009 176
1010 3300049824 Ga0501045_0259239 Ga0501045_0259239_625_1155 176
1011 3300050507 nmdc:mga05p37_45_c1 nmdc:mga05p37_45_c1_77887_78453 176
1012 3300050508 nmdc:mga09592_1055_c1 nmdc:mga09592_1055_c1_6991_7557 176
1013 3300050509 nmdc:mga0qj67_701_c1 nmdc:mga0qj67_701_c1_13590_14156 176
1014 3300050510 nmdc:mga06r32_227_c1 nmdc:mga06r32_227_c1_10651_11217 176
1015 3300050511 nmdc:mga08y16_1666_c1 nmdc:mga08y16_1666_c1_1523_2089 176
1016 3300050511 nmdc:mga08y16_26694_c1 nmdc:mga08y16_26694_c1_5182_5712 176
1017 3300050512 nmdc:mga0n895_379872_c1 nmdc:mga0n895_379872_c1_377_907 176
1018 3300050512 nmdc:mga0n895_4930_c1 nmdc:mga0n895_4930_c1_9121_9651 176
1019 3300050512 nmdc:mga0n895_50_c1 nmdc:mga0n895_50_c1_56571_57137 176
1020 3300050512 nmdc:mga0n895_684569_c1 nmdc:mga0n895_684569_c1_257_787 176
1021 3300050513 nmdc:mga0rr50_17122_c1 nmdc:mga0rr50_17122_c1_2976_3506 176
1022 3300050513 nmdc:mga0rr50_19371_c1 nmdc:mga0rr50_19371_c1_90_620 176
1023 3300050513 nmdc:mga0rr50_485637_c1 nmdc:mga0rr50_485637_c1_115_645 176
1024 3300050513 nmdc:mga0rr50_67221_c1 nmdc:mga0rr50_67221_c1_365_931 176
1025 3300050513 nmdc:mga0rr50_77127_c1 nmdc:mga0rr50_77127_c1_284_814 176
1026 3300050514 nmdc:mga08x19_20074_c1 nmdc:mga08x19_20074_c1_2665_3195 176
1027 3300050514 nmdc:mga08x19_639141_c1 nmdc:mga08x19_639141_c1_121_651 176
1028 3300050515 nmdc:mga0a205_21352_c1 nmdc:mga0a205_21352_c1_3441_3971 176
1029 3300050515 nmdc:mga0a205_2228_c1 nmdc:mga0a205_2228_c1_12512_13042 176
1030 3300050515 nmdc:mga0a205_4901_c1 nmdc:mga0a205_4901_c1_10073_10639 176
1031 3300053077 Ga0495601_0000204 Ga0495601_0000204_2302_2832 176
1032 3300053077 Ga0495601_0002295 Ga0495601_0002295_6522_7052 176
1033 3300053077 Ga0495601_0002402 Ga0495601_0002402_7488_8054 176
1034 3300053078 Ga0495612_0000384 Ga0495612_0000384_14900_15430 176
1035 3300053078 Ga0495612_0011006 Ga0495612_0011006_1280_1810 176
1036 3300053078 Ga0495612_0012068 Ga0495612_0012068_698_1264 176
1037 3300053084 Ga0495595_0000577 Ga0495595_0000577_2212_2742 176
1038 3300053084 Ga0495595_0000686 Ga0495595_0000686_825_1391 176
1039 3300053084 Ga0495595_0001081 Ga0495595_0001081_5413_5943 176
1040 3300053085 Ga0495619_0000260 Ga0495619_0000260_22849_23379 176
1041 3300053085 Ga0495619_0000655 Ga0495619_0000655_9984_10514 176
1042 3300053085 Ga0495619_0017989 Ga0495619_0017989_1659_2225 176
1043 3300053098 Ga0500650_0164994 Ga0500650_0164994_129_662 176
1044 3300060353 Ga0501082_0601343 Ga0501082_0601343_74_604 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

54

164

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7985 23 140
1ecs-assembly1.cif.gz_B the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 0.7927 24 143
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7903 23 140
4nb2-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7887 23 145
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.7833 22 142
ID Description Score Start End Superfamily
af_O57457_206_298_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8451 114 141 2.30.29.30
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8366 22 148 3.10.180.10
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8341 24 70 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8214 24 158 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8183 22 148 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A431P746-F1-model_v4 deleted 0.9878 94 173
AF-A0A7Z9I5U6-F1-model_v4 Glyoxalase 0.9819 106 172
AF-A0A838GBZ9-F1-model_v4 VOC family protein 0.9811 86 169
AF-A0A4Q3WBU0-F1-model_v4 Glyoxalase 0.9675 86 168
AF-A0A431P746-F1-model_v4 deleted 0.964 94 173

Feature Viewer

pLDDT pTM Quality
87.39 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map