F488918
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1044 | 456 | 1044 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_495535_c1|nmdc:mga0n895_495535_c1_410_1033 |
| Length | 201 |
| Sequence | LIEIAATRRGGAFFARLTVLHHDVEAGTREDAMTDTEALEQDKLRFPTIDAGVRIGHVHLKVADLQRALDFYCGVLGFELTTSRPGAAFISAGGYHHHIGLNTWESRGGSTGLYHTAILYPTRRLLADALRRLIVAKIPLEGASDHGVSEALYLRDPDDNGVELYWDRPKELWPQRPDGGLQMFTNPLDLRDLLAELDKPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 27 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 142 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 143 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 144 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 145 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 165 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 264 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 266 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 271 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 273 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 282 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 288 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 290 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 295 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 299 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 300 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 303 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 305 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 306 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 309 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 310 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 311 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 312 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 313 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 314 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 315 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 316 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 320 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 321 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 322 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 323 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 324 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 325 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 389 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 390 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 391 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 392 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 393 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 394 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 397 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 398 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 399 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 400 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 401 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 402 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 403 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 435 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 450 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 453 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 456 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 5.84 |
| Rhizosphere | 92.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544913 | 2209111006 | Bacteria | 25171 |
| 2 | ARcpr5oldR_c000030 | 3300000041 | Bacteria | 28909 |
| 3 | ARSoilYngRDRAFT_c00022 | 3300000042 | Bacteria | 23602 |
| 4 | ARcpr5yngRDRAFT_c000011 | 3300000043 | Bacteria | 35549 |
| 5 | ARSoilOldRDRAFT_c000040 | 3300000044 | Bacteria | 28954 |
| 6 | ARCol0oldRDRAFT_c01878 | 3300000045 | Bacteria | 1134 |
| 7 | ARCol0yngRDRAFT_1000028 | 3300000652 | Bacteria | 25625 |
| 8 | JGI24032J14994_100177 | 3300001430 | Bacteria | 3239 |
| 9 | JGI24752J21851_1011523 | 3300001976 | Bacteria | 1156 |
| 10 | JGI24747J21853_1001659 | 3300001978 | Bacteria | 1705 |
| 11 | JGI24739J22299_10000164 | 3300001989 | Bacteria | 21825 |
| 12 | JGI24737J22298_10002054 | 3300001990 | Bacteria | 7202 |
| 13 | JGI24737J22298_10004205 | 3300001990 | Bacteria | 5033 |
| 14 | JGI24750J21931_1000178 | 3300002070 | Bacteria | 10641 |
| 15 | JGI24745J21846_1000640 | 3300002073 | Bacteria | 3142 |
| 16 | JGI24748J21848_1000266 | 3300002074 | Bacteria | 6220 |
| 17 | JGI24738J21930_10000112 | 3300002075 | Bacteria | 19038 |
| 18 | JGI24749J21850_1002285 | 3300002076 | Bacteria | 2697 |
| 19 | JGI24744J21845_10004212 | 3300002077 | Bacteria | 2966 |
| 20 | JGI24035J26624_1000424 | 3300002126 | Bacteria | 3991 |
| 21 | JGI24033J26618_1001840 | 3300002155 | Bacteria | 2123 |
| 22 | JGI24034J26672_10002682 | 3300002239 | Bacteria | 2451 |
| 23 | JGI24742J22300_10000334 | 3300002244 | Bacteria | 6993 |
| 24 | JGI24751J29686_10004003 | 3300002459 | Bacteria | 2981 |
| 25 | JGI25404J52841_10018490 | 3300003659 | Bacteria | 1510 |
| 26 | JGI25405J52794_10008628 | 3300003911 | Bacteria | 1908 |
| 27 | JGI25405J52794_10010557 | 3300003911 | Bacteria | 1758 |
| 28 | Ga0065717_1000386 | 3300005276 | Bacteria | 1461 |
| 29 | Ga0065716_1001616 | 3300005277 | Bacteria | 5181 |
| 30 | Ga0065712_10070488 | 3300005290 | Bacteria | 5965 |
| 31 | Ga0065715_10001682 | 3300005293 | Bacteria | 8090 |
| 32 | Ga0065715_10018746 | 3300005293 | Bacteria | 2166 |
| 33 | Ga0065707_10125256 | 3300005295 | Bacteria | 1999 |
| 34 | Ga0070658_10030706 | 3300005327 | Bacteria | 4316 |
| 35 | Ga0070658_10321270 | 3300005327 | Bacteria | 1322 |
| 36 | Ga0070658_10713122 | 3300005327 | Bacteria | 871 |
| 37 | Ga0070676_10003775 | 3300005328 | Bacteria | 7942 |
| 38 | Ga0070676_10085140 | 3300005328 | Bacteria | 1926 |
| 39 | Ga0070676_10127179 | 3300005328 | Bacteria | 1607 |
| 40 | Ga0070683_100000376 | 3300005329 | Bacteria | 31004 |
| 41 | Ga0070683_100064147 | 3300005329 | Bacteria | 3419 |
| 42 | Ga0070690_100002745 | 3300005330 | Bacteria | 9502 |
| 43 | Ga0070690_100006745 | 3300005330 | Bacteria | 6525 |
| 44 | Ga0070690_100008317 | 3300005330 | Bacteria | 5970 |
| 45 | Ga0070670_100004417 | 3300005331 | Bacteria | 11775 |
| 46 | Ga0070677_10000049 | 3300005333 | Bacteria | 37210 |
| 47 | Ga0068869_100000523 | 3300005334 | Bacteria | 21387 |
| 48 | Ga0068869_100451400 | 3300005334 | Bacteria | 1066 |
| 49 | Ga0070666_10001839 | 3300005335 | Bacteria | 12930 |
| 50 | Ga0070666_10002781 | 3300005335 | Bacteria | 10564 |
| 51 | Ga0070680_100005313 | 3300005336 | Bacteria | 9748 |
| 52 | Ga0070680_100016319 | 3300005336 | Bacteria | 5844 |
| 53 | Ga0070680_100045410 | 3300005336 | Bacteria | 3571 |
| 54 | Ga0070680_100123658 | 3300005336 | Bacteria | 2161 |
| 55 | Ga0070680_100433128 | 3300005336 | Bacteria | 1122 |
| 56 | Ga0070682_100000141 | 3300005337 | Bacteria | 57251 |
| 57 | Ga0070682_100010927 | 3300005337 | Bacteria | 5173 |
| 58 | Ga0070682_100165525 | 3300005337 | Bacteria | 1532 |
| 59 | Ga0070682_100168686 | 3300005337 | Bacteria | 1519 |
| 60 | Ga0068868_100009105 | 3300005338 | Bacteria | 7128 |
| 61 | Ga0070660_100001073 | 3300005339 | Bacteria | 18364 |
| 62 | Ga0070660_100038319 | 3300005339 | Bacteria | 3639 |
| 63 | Ga0070660_100130758 | 3300005339 | Bacteria | 2009 |
| 64 | Ga0070689_100028024 | 3300005340 | Bacteria | 4253 |
| 65 | Ga0070689_100100586 | 3300005340 | Bacteria | 2287 |
| 66 | Ga0070689_100236418 | 3300005340 | Bacteria | 1504 |
| 67 | Ga0070691_10004687 | 3300005341 | Bacteria | 6220 |
| 68 | Ga0070691_10020023 | 3300005341 | Bacteria | 3088 |
| 69 | Ga0070687_100000212 | 3300005343 | Bacteria | 20234 |
| 70 | Ga0070661_100000242 | 3300005344 | Bacteria | 44945 |
| 71 | Ga0070661_100115710 | 3300005344 | Bacteria | 2005 |
| 72 | Ga0070692_10010557 | 3300005345 | Bacteria | 4209 |
| 73 | Ga0070668_100003395 | 3300005347 | Bacteria | 11753 |
| 74 | Ga0070668_100414921 | 3300005347 | Bacteria | 1152 |
| 75 | Ga0070669_100006805 | 3300005353 | Bacteria | 8223 |
| 76 | Ga0070669_100147979 | 3300005353 | Bacteria | 1816 |
| 77 | Ga0070675_100000165 | 3300005354 | Bacteria | 40656 |
| 78 | Ga0070675_100011029 | 3300005354 | Bacteria | 7076 |
| 79 | Ga0070671_100001907 | 3300005355 | Bacteria | 15957 |
| 80 | Ga0070671_100165578 | 3300005355 | Bacteria | 1869 |
| 81 | Ga0070674_100000450 | 3300005356 | Bacteria | 20737 |
| 82 | Ga0070673_100001190 | 3300005364 | Bacteria | 14967 |
| 83 | Ga0070673_100047352 | 3300005364 | Bacteria | 3345 |
| 84 | Ga0070688_100004815 | 3300005365 | Bacteria | 7056 |
| 85 | Ga0070688_100016577 | 3300005365 | Bacteria | 4215 |
| 86 | Ga0070688_100035808 | 3300005365 | Bacteria | 3016 |
| 87 | Ga0070659_100000988 | 3300005366 | Bacteria | 20880 |
| 88 | Ga0070659_100031422 | 3300005366 | Bacteria | 4112 |
| 89 | Ga0070659_100070846 | 3300005366 | Bacteria | 2770 |
| 90 | Ga0070667_100019884 | 3300005367 | Bacteria | 5572 |
| 91 | Ga0070667_100128897 | 3300005367 | Bacteria | 2207 |
| 92 | Ga0070667_100448787 | 3300005367 | Bacteria | 1178 |
| 93 | Ga0070703_10001274 | 3300005406 | Bacteria | 7647 |
| 94 | Ga0070709_10088128 | 3300005434 | Bacteria | 2041 |
| 95 | Ga0070709_10092920 | 3300005434 | Bacteria | 1993 |
| 96 | Ga0070709_10150580 | 3300005434 | Bacteria | 1607 |
| 97 | Ga0070714_100091747 | 3300005435 | Bacteria | 2662 |
| 98 | Ga0070714_100096255 | 3300005435 | Bacteria | 2601 |
| 99 | Ga0070714_100135536 | 3300005435 | Bacteria | 2204 |
| 100 | Ga0070714_100168697 | 3300005435 | Bacteria | 1985 |
| 101 | Ga0070714_100329391 | 3300005435 | Bacteria | 1430 |
| 102 | Ga0070714_100339459 | 3300005435 | Bacteria | 1409 |
| 103 | Ga0070713_100092317 | 3300005436 | Bacteria | 2606 |
| 104 | Ga0070713_100148235 | 3300005436 | Bacteria | 2085 |
| 105 | Ga0070713_100206637 | 3300005436 | Bacteria | 1776 |
| 106 | Ga0070710_10004737 | 3300005437 | Bacteria | 6431 |
| 107 | Ga0070710_10108572 | 3300005437 | Bacteria | 1664 |
| 108 | Ga0070701_10006218 | 3300005438 | Bacteria | 5008 |
| 109 | Ga0070701_10292204 | 3300005438 | Bacteria | 999 |
| 110 | Ga0070701_10603384 | 3300005438 | Bacteria | 727 |
| 111 | Ga0070711_100016051 | 3300005439 | Bacteria | 4748 |
| 112 | Ga0070705_100003041 | 3300005440 | Bacteria | 8274 |
| 113 | Ga0070705_100015515 | 3300005440 | Bacteria | 3942 |
| 114 | Ga0070705_100209827 | 3300005440 | Bacteria | 1342 |
| 115 | Ga0070700_100000364 | 3300005441 | Bacteria | 23195 |
| 116 | Ga0070700_100012444 | 3300005441 | Bacteria | 4750 |
| 117 | Ga0070694_100001077 | 3300005444 | Bacteria | 15614 |
| 118 | Ga0070708_100259032 | 3300005445 | Bacteria | 1635 |
| 119 | Ga0070663_100000417 | 3300005455 | Bacteria | 22399 |
| 120 | Ga0070663_100015967 | 3300005455 | Bacteria | 4861 |
| 121 | Ga0070678_100001012 | 3300005456 | Bacteria | 14620 |
| 122 | Ga0070678_100162149 | 3300005456 | Bacteria | 1812 |
| 123 | Ga0070662_100000796 | 3300005457 | Bacteria | 19367 |
| 124 | Ga0070662_100838111 | 3300005457 | Bacteria | 783 |
| 125 | Ga0070681_10002475 | 3300005458 | Bacteria | 16918 |
| 126 | Ga0070681_10016363 | 3300005458 | Bacteria | 7402 |
| 127 | Ga0070681_10037631 | 3300005458 | Bacteria | 4854 |
| 128 | Ga0070681_10049230 | 3300005458 | Bacteria | 4209 |
| 129 | Ga0070681_10090121 | 3300005458 | Bacteria | 3017 |
| 130 | Ga0070681_10488888 | 3300005458 | Bacteria | 1144 |
| 131 | Ga0070681_10893010 | 3300005458 | Unclassified | 807 |
| 132 | Ga0068867_100006779 | 3300005459 | Bacteria | 8095 |
| 133 | Ga0070685_10000547 | 3300005466 | Bacteria | 21062 |
| 134 | Ga0070685_10060757 | 3300005466 | Bacteria | 2211 |
| 135 | Ga0070706_100195631 | 3300005467 | Bacteria | 1889 |
| 136 | Ga0070679_100002268 | 3300005530 | Bacteria | 17373 |
| 137 | Ga0070679_100037005 | 3300005530 | Bacteria | 4845 |
| 138 | Ga0070679_100071754 | 3300005530 | Bacteria | 3454 |
| 139 | Ga0070679_100283271 | 3300005530 | Bacteria | 1609 |
| 140 | Ga0070684_100000755 | 3300005535 | Bacteria | 22399 |
| 141 | Ga0070684_100052457 | 3300005535 | Bacteria | 3547 |
| 142 | Ga0070684_100079617 | 3300005535 | Bacteria | 2897 |
| 143 | Ga0070697_100273711 | 3300005536 | Bacteria | 1448 |
| 144 | Ga0068853_100000483 | 3300005539 | Bacteria | 27159 |
| 145 | Ga0068853_100240073 | 3300005539 | Bacteria | 1661 |
| 146 | Ga0068853_100316453 | 3300005539 | Bacteria | 1446 |
| 147 | Ga0068853_100430251 | 3300005539 | Bacteria | 1239 |
| 148 | Ga0070672_100000527 | 3300005543 | Bacteria | 22399 |
| 149 | Ga0070672_100598142 | 3300005543 | Bacteria | 960 |
| 150 | Ga0070686_100004541 | 3300005544 | Bacteria | 7655 |
| 151 | Ga0070686_100028407 | 3300005544 | Bacteria | 3392 |
| 152 | Ga0070686_100216175 | 3300005544 | Bacteria | 1383 |
| 153 | Ga0070695_100007154 | 3300005545 | Bacteria | 6616 |
| 154 | Ga0070695_100016829 | 3300005545 | Bacteria | 4431 |
| 155 | Ga0070696_100004211 | 3300005546 | Bacteria | 9581 |
| 156 | Ga0070696_100040575 | 3300005546 | Bacteria | 3214 |
| 157 | Ga0070696_100126980 | 3300005546 | Bacteria | 1852 |
| 158 | Ga0070696_100711268 | 3300005546 | Bacteria | 820 |
| 159 | Ga0070693_100000199 | 3300005547 | Bacteria | 28265 |
| 160 | Ga0070693_100042452 | 3300005547 | Bacteria | 2562 |
| 161 | Ga0070693_100067261 | 3300005547 | Bacteria | 2100 |
| 162 | Ga0070693_100152582 | 3300005547 | Bacteria | 1465 |
| 163 | Ga0070693_100157117 | 3300005547 | Bacteria | 1445 |
| 164 | Ga0070665_100123527 | 3300005548 | Bacteria | 2591 |
| 165 | Ga0070665_100409391 | 3300005548 | Bacteria | 1364 |
| 166 | Ga0070704_100000987 | 3300005549 | Bacteria | 14504 |
| 167 | Ga0070704_100128703 | 3300005549 | Bacteria | 1958 |
| 168 | Ga0070704_100844621 | 3300005549 | Bacteria | 821 |
| 169 | Ga0068855_100004444 | 3300005563 | Bacteria | 17127 |
| 170 | Ga0068855_100015363 | 3300005563 | Bacteria | 9217 |
| 171 | Ga0068855_100339131 | 3300005563 | Bacteria | 1658 |
| 172 | Ga0068855_101061464 | 3300005563 | Bacteria | 848 |
| 173 | Ga0070664_100000895 | 3300005564 | Bacteria | 23168 |
| 174 | Ga0068857_100001816 | 3300005577 | Bacteria | 17161 |
| 175 | Ga0068857_100084708 | 3300005577 | Bacteria | 2833 |
| 176 | Ga0068857_100528032 | 3300005577 | Bacteria | 1110 |
| 177 | Ga0068854_100001812 | 3300005578 | Bacteria | 13001 |
| 178 | Ga0068854_100199360 | 3300005578 | Bacteria | 1573 |
| 179 | Ga0068854_100472263 | 3300005578 | Bacteria | 1052 |
| 180 | Ga0068856_100002507 | 3300005614 | Bacteria | 18898 |
| 181 | Ga0068856_100140935 | 3300005614 | Bacteria | 2418 |
| 182 | Ga0068856_100250036 | 3300005614 | Bacteria | 1788 |
| 183 | Ga0068856_100392362 | 3300005614 | Bacteria | 1408 |
| 184 | Ga0070702_100005184 | 3300005615 | Bacteria | 6036 |
| 185 | Ga0070702_100682654 | 3300005615 | Bacteria | 781 |
| 186 | Ga0068852_100003253 | 3300005616 | Bacteria | 11339 |
| 187 | Ga0068852_100137119 | 3300005616 | Bacteria | 2260 |
| 188 | Ga0068859_100001353 | 3300005617 | Bacteria | 25014 |
| 189 | Ga0068859_100072433 | 3300005617 | Bacteria | 3482 |
| 190 | Ga0068859_100221537 | 3300005617 | Bacteria | 1979 |
| 191 | Ga0068864_100000227 | 3300005618 | Bacteria | 50765 |
| 192 | Ga0068864_100214765 | 3300005618 | Bacteria | 1773 |
| 193 | Ga0068866_10003902 | 3300005718 | Bacteria | 6120 |
| 194 | Ga0068866_10115621 | 3300005718 | Bacteria | 1504 |
| 195 | Ga0068866_10194597 | 3300005718 | Bacteria | 1207 |
| 196 | Ga0068861_100003517 | 3300005719 | Bacteria | 10409 |
| 197 | Ga0068851_10037270 | 3300005834 | Bacteria | 2437 |
| 198 | Ga0068851_10350412 | 3300005834 | Bacteria | 859 |
| 199 | Ga0068870_10000062 | 3300005840 | Bacteria | 33752 |
| 200 | Ga0068863_100000495 | 3300005841 | Bacteria | 39957 |
| 201 | Ga0068858_100000783 | 3300005842 | Bacteria | 33229 |
| 202 | Ga0068858_100112690 | 3300005842 | Bacteria | 2540 |
| 203 | Ga0068858_100453708 | 3300005842 | Bacteria | 1236 |
| 204 | Ga0068860_100022350 | 3300005843 | Bacteria | 6119 |
| 205 | Ga0068860_100240532 | 3300005843 | Bacteria | 1761 |
| 206 | Ga0068862_100003647 | 3300005844 | Bacteria | 13173 |
| 207 | Ga0068862_100235513 | 3300005844 | Bacteria | 1662 |
| 208 | Ga0081455_10000204 | 3300005937 | Bacteria | 75793 |
| 209 | Ga0081455_10037283 | 3300005937 | Bacteria | 4320 |
| 210 | Ga0081540_1012611 | 3300005983 | Bacteria | 5547 |
| 211 | Ga0070717_10011080 | 3300006028 | Bacteria | 6833 |
| 212 | Ga0070717_11043714 | 3300006028 | Bacteria | 744 |
| 213 | Ga0070717_11080886 | 3300006028 | Bacteria | 731 |
| 214 | Ga0075363_100102489 | 3300006048 | Bacteria | 1585 |
| 215 | Ga0075432_10000464 | 3300006058 | Bacteria | 12026 |
| 216 | Ga0070715_10004439 | 3300006163 | Bacteria | 4605 |
| 217 | Ga0070716_100001496 | 3300006173 | Bacteria | 10442 |
| 218 | Ga0070716_100195611 | 3300006173 | Bacteria | 1340 |
| 219 | Ga0070712_100091539 | 3300006175 | Bacteria | 2229 |
| 220 | Ga0070712_100100728 | 3300006175 | Bacteria | 2135 |
| 221 | Ga0070712_100148881 | 3300006175 | Bacteria | 1795 |
| 222 | Ga0070712_100354247 | 3300006175 | Bacteria | 1202 |
| 223 | Ga0075362_10026979 | 3300006177 | Bacteria | 2457 |
| 224 | Ga0075367_10584065 | 3300006178 | Bacteria | 710 |
| 225 | Ga0097621_100000010 | 3300006237 | Bacteria | 112867 |
| 226 | Ga0097621_100023529 | 3300006237 | Bacteria | 4798 |
| 227 | Ga0075370_10463558 | 3300006353 | Bacteria | 763 |
| 228 | Ga0068871_100000034 | 3300006358 | Bacteria | 71462 |
| 229 | Ga0068871_100024903 | 3300006358 | Bacteria | 4647 |
| 230 | Ga0075428_100031223 | 3300006844 | Bacteria | 5891 |
| 231 | Ga0075430_100005373 | 3300006846 | Bacteria | 10813 |
| 232 | Ga0075431_100142954 | 3300006847 | Bacteria | 2466 |
| 233 | Ga0075433_10000774 | 3300006852 | Bacteria | 21997 |
| 234 | Ga0075433_10005737 | 3300006852 | Bacteria | 9763 |
| 235 | Ga0075433_10027741 | 3300006852 | Bacteria | 4806 |
| 236 | Ga0075433_10097733 | 3300006852 | Bacteria | 2599 |
| 237 | Ga0075433_10101236 | 3300006852 | Bacteria | 2551 |
| 238 | Ga0075434_100001700 | 3300006871 | Bacteria | 18837 |
| 239 | Ga0075434_100003565 | 3300006871 | Bacteria | 13904 |
| 240 | Ga0075434_100261194 | 3300006871 | Bacteria | 1750 |
| 241 | Ga0075434_100489468 | 3300006871 | Bacteria | 1251 |
| 242 | Ga0075429_100027666 | 3300006880 | Bacteria | 4922 |
| 243 | Ga0075429_100801880 | 3300006880 | Unclassified | 825 |
| 244 | Ga0068865_100000230 | 3300006881 | Bacteria | 31147 |
| 245 | Ga0068865_100056340 | 3300006881 | Bacteria | 2738 |
| 246 | Ga0068865_100102449 | 3300006881 | Bacteria | 2098 |
| 247 | Ga0075436_100061927 | 3300006914 | Bacteria | 2586 |
| 248 | Ga0075436_100156448 | 3300006914 | Bacteria | 1606 |
| 249 | Ga0075436_100552188 | 3300006914 | Bacteria | 845 |
| 250 | Ga0097620_100001353 | 3300006931 | Bacteria | 25014 |
| 251 | Ga0097620_100072439 | 3300006931 | Bacteria | 3482 |
| 252 | Ga0097620_100221535 | 3300006931 | Bacteria | 1979 |
| 253 | Ga0075435_100001109 | 3300007076 | Bacteria | 17153 |
| 254 | Ga0075435_100017628 | 3300007076 | Bacteria | 5410 |
| 255 | Ga0075435_100116938 | 3300007076 | Bacteria | 2222 |
| 256 | Ga0075435_100192974 | 3300007076 | Bacteria | 1724 |
| 257 | Ga0075435_100305843 | 3300007076 | Bacteria | 1360 |
| 258 | Ga0105251_10038761 | 3300009011 | Bacteria | 2332 |
| 259 | Ga0105250_10040716 | 3300009092 | Bacteria | 1863 |
| 260 | Ga0105240_10020100 | 3300009093 | Bacteria | 8914 |
| 261 | Ga0105240_10067652 | 3300009093 | Bacteria | 4427 |
| 262 | Ga0105240_10966071 | 3300009093 | Bacteria | 913 |
| 263 | Ga0111539_10000932 | 3300009094 | Bacteria | 38323 |
| 264 | Ga0111539_10002162 | 3300009094 | Bacteria | 26296 |
| 265 | Ga0111539_10059566 | 3300009094 | Bacteria | 4527 |
| 266 | Ga0105245_10000258 | 3300009098 | Bacteria | 50464 |
| 267 | Ga0105245_10012413 | 3300009098 | Bacteria | 7414 |
| 268 | Ga0105245_10103418 | 3300009098 | Bacteria | 2639 |
| 269 | Ga0105247_10015208 | 3300009101 | Bacteria | 4614 |
| 270 | Ga0105247_10242887 | 3300009101 | Bacteria | 1228 |
| 271 | Ga0105247_10445797 | 3300009101 | Bacteria | 932 |
| 272 | Ga0105243_10000846 | 3300009148 | Bacteria | 29054 |
| 273 | Ga0105243_10014969 | 3300009148 | Bacteria | 5872 |
| 274 | Ga0105243_10023951 | 3300009148 | Bacteria | 4651 |
| 275 | Ga0105243_10043258 | 3300009148 | Bacteria | 3530 |
| 276 | Ga0105241_10141570 | 3300009174 | Bacteria | 1959 |
| 277 | Ga0105242_10000037 | 3300009176 | Bacteria | 91293 |
| 278 | Ga0105242_10033883 | 3300009176 | Bacteria | 4093 |
| 279 | Ga0105242_10057874 | 3300009176 | Bacteria | 3176 |
| 280 | Ga0105248_10000744 | 3300009177 | Bacteria | 36599 |
| 281 | Ga0105248_10536829 | 3300009177 | Bacteria | 1319 |
| 282 | Ga0105237_10020951 | 3300009545 | Bacteria | 6730 |
| 283 | Ga0105237_10112148 | 3300009545 | Bacteria | 2719 |
| 284 | Ga0105238_10066539 | 3300009551 | Bacteria | 3605 |
| 285 | Ga0105238_10183495 | 3300009551 | Bacteria | 2069 |
| 286 | Ga0105249_10000209 | 3300009553 | Bacteria | 67037 |
| 287 | Ga0105249_10026930 | 3300009553 | Bacteria | 5184 |
| 288 | Ga0105239_10001464 | 3300010375 | Bacteria | 31391 |
| 289 | Ga0105239_10096125 | 3300010375 | Bacteria | 3273 |
| 290 | Ga0105246_10026773 | 3300011119 | Bacteria | 3772 |
| 291 | Ga0105246_10648283 | 3300011119 | Bacteria | 919 |
| 292 | Ga0157328_1001425 | 3300012478 | Bacteria | 1025 |
| 293 | Ga0157314_1002672 | 3300012500 | Bacteria | 1237 |
| 294 | Ga0157314_1013035 | 3300012500 | Bacteria | 756 |
| 295 | Ga0157342_1003689 | 3300012507 | Bacteria | 1327 |
| 296 | Ga0157315_1002711 | 3300012508 | Bacteria | 1131 |
| 297 | Ga0157316_1000114 | 3300012510 | Bacteria | 3720 |
| 298 | Ga0157373_10344110 | 3300013100 | Bacteria | 1063 |
| 299 | Ga0157373_10412442 | 3300013100 | Bacteria | 969 |
| 300 | Ga0157373_10595511 | 3300013100 | Bacteria | 805 |
| 301 | Ga0157371_10151573 | 3300013102 | Bacteria | 1654 |
| 302 | Ga0157371_10421423 | 3300013102 | Bacteria | 979 |
| 303 | Ga0157371_10582158 | 3300013102 | Bacteria | 831 |
| 304 | Ga0157370_10146848 | 3300013104 | Bacteria | 2196 |
| 305 | Ga0157369_10182747 | 3300013105 | Bacteria | 2206 |
| 306 | Ga0157369_10955537 | 3300013105 | Bacteria | 878 |
| 307 | Ga0157378_10001580 | 3300013297 | Bacteria | 20573 |
| 308 | Ga0157378_10711400 | 3300013297 | Bacteria | 1025 |
| 309 | Ga0157378_10819210 | 3300013297 | Bacteria | 958 |
| 310 | Ga0163162_10001677 | 3300013306 | Bacteria | 20764 |
| 311 | Ga0163162_10470559 | 3300013306 | Bacteria | 1388 |
| 312 | Ga0163162_11510553 | 3300013306 | Bacteria | 765 |
| 313 | Ga0157372_10109839 | 3300013307 | Bacteria | 3158 |
| 314 | Ga0157372_10158955 | 3300013307 | Bacteria | 2611 |
| 315 | Ga0157372_10416720 | 3300013307 | Bacteria | 1565 |
| 316 | Ga0157372_10469552 | 3300013307 | Bacteria | 1467 |
| 317 | Ga0157372_10807596 | 3300013307 | Bacteria | 1090 |
| 318 | Ga0157372_10866812 | 3300013307 | Bacteria | 1048 |
| 319 | Ga0157375_10000263 | 3300013308 | Bacteria | 47730 |
| 320 | Ga0157375_10428144 | 3300013308 | Bacteria | 1489 |
| 321 | Ga0163163_10019201 | 3300014325 | Bacteria | 6416 |
| 322 | Ga0163163_11352258 | 3300014325 | Bacteria | 774 |
| 323 | Ga0157380_10000294 | 3300014326 | Bacteria | 30013 |
| 324 | Ga0157380_10077167 | 3300014326 | Bacteria | 2714 |
| 325 | Ga0157377_10001222 | 3300014745 | Bacteria | 10959 |
| 326 | Ga0157379_10002453 | 3300014968 | Bacteria | 15540 |
| 327 | Ga0157379_10027532 | 3300014968 | Bacteria | 5061 |
| 328 | Ga0157379_10696930 | 3300014968 | Bacteria | 953 |
| 329 | Ga0157379_10776966 | 3300014968 | Bacteria | 903 |
| 330 | Ga0157376_10000342 | 3300014969 | Bacteria | 31043 |
| 331 | Ga0157376_10461782 | 3300014969 | Bacteria | 1241 |
| 332 | Ga0157376_11216849 | 3300014969 | Bacteria | 782 |
| 333 | Ga0163161_10000523 | 3300017792 | Bacteria | 31363 |
| 334 | Ga0197907_10014073 | 3300020069 | Bacteria | 1087 |
| 335 | Ga0206356_10130135 | 3300020070 | Bacteria | 1443 |
| 336 | Ga0206354_10382701 | 3300020081 | Bacteria | 2413 |
| 337 | Ga0206353_12062905 | 3300020082 | Bacteria | 958 |
| 338 | Ga0213876_10236414 | 3300021384 | Bacteria | 971 |
| 339 | Ga0207666_1000010 | 3300025271 | Bacteria | 46973 |
| 340 | Ga0207666_1001035 | 3300025271 | Bacteria | 3299 |
| 341 | Ga0207673_1000164 | 3300025290 | Bacteria | 6537 |
| 342 | Ga0207697_10000186 | 3300025315 | Bacteria | 32405 |
| 343 | Ga0207682_10000123 | 3300025893 | Bacteria | 34953 |
| 344 | Ga0207692_10004961 | 3300025898 | Bacteria | 5296 |
| 345 | Ga0207692_10087164 | 3300025898 | Bacteria | 1684 |
| 346 | Ga0207692_10094665 | 3300025898 | Bacteria | 1627 |
| 347 | Ga0207642_10000263 | 3300025899 | Bacteria | 15779 |
| 348 | Ga0207710_10004419 | 3300025900 | Bacteria | 6141 |
| 349 | Ga0207710_10304335 | 3300025900 | Bacteria | 806 |
| 350 | Ga0207688_10000889 | 3300025901 | Bacteria | 15094 |
| 351 | Ga0207688_10056265 | 3300025901 | Bacteria | 2209 |
| 352 | Ga0207680_10001117 | 3300025903 | Bacteria | 12657 |
| 353 | Ga0207680_10077237 | 3300025903 | Bacteria | 2082 |
| 354 | Ga0207647_10005506 | 3300025904 | Bacteria | 9270 |
| 355 | Ga0207647_10046296 | 3300025904 | Bacteria | 2711 |
| 356 | Ga0207685_10001241 | 3300025905 | Bacteria | 5199 |
| 357 | Ga0207699_10023071 | 3300025906 | Bacteria | 3382 |
| 358 | Ga0207699_10026530 | 3300025906 | Bacteria | 3195 |
| 359 | Ga0207645_10000023 | 3300025907 | Bacteria | 98724 |
| 360 | Ga0207645_10020930 | 3300025907 | Bacteria | 4272 |
| 361 | Ga0207645_10051083 | 3300025907 | Bacteria | 2641 |
| 362 | Ga0207645_10132679 | 3300025907 | Bacteria | 1621 |
| 363 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 364 | Ga0207705_10025609 | 3300025909 | Bacteria | 4209 |
| 365 | Ga0207705_10216574 | 3300025909 | Bacteria | 1453 |
| 366 | Ga0207684_10339377 | 3300025910 | Bacteria | 1294 |
| 367 | Ga0207654_10374275 | 3300025911 | Bacteria | 985 |
| 368 | Ga0207707_10002015 | 3300025912 | Bacteria | 18441 |
| 369 | Ga0207707_10094416 | 3300025912 | Bacteria | 2613 |
| 370 | Ga0207707_10112364 | 3300025912 | Bacteria | 2382 |
| 371 | Ga0207707_10217291 | 3300025912 | Bacteria | 1664 |
| 372 | Ga0207707_10430416 | 3300025912 | Bacteria | 1130 |
| 373 | Ga0207707_10565521 | 3300025912 | Bacteria | 965 |
| 374 | Ga0207695_10092228 | 3300025913 | Bacteria | 3040 |
| 375 | Ga0207695_10338560 | 3300025913 | Bacteria | 1392 |
| 376 | Ga0207671_10008841 | 3300025914 | Bacteria | 8482 |
| 377 | Ga0207693_10012859 | 3300025915 | Bacteria | 6754 |
| 378 | Ga0207693_10099654 | 3300025915 | Bacteria | 2278 |
| 379 | Ga0207693_10117664 | 3300025915 | Bacteria | 2087 |
| 380 | Ga0207693_10132335 | 3300025915 | Bacteria | 1961 |
| 381 | Ga0207693_10233177 | 3300025915 | Bacteria | 1445 |
| 382 | Ga0207693_10291617 | 3300025915 | Bacteria | 1279 |
| 383 | Ga0207693_10576547 | 3300025915 | Bacteria | 877 |
| 384 | Ga0207663_10004450 | 3300025916 | Bacteria | 6968 |
| 385 | Ga0207663_10040066 | 3300025916 | Bacteria | 2844 |
| 386 | Ga0207663_10060441 | 3300025916 | Bacteria | 2401 |
| 387 | Ga0207660_10000393 | 3300025917 | Bacteria | 28822 |
| 388 | Ga0207660_10005747 | 3300025917 | Bacteria | 8044 |
| 389 | Ga0207660_10110494 | 3300025917 | Bacteria | 2068 |
| 390 | Ga0207660_10128860 | 3300025917 | Bacteria | 1924 |
| 391 | Ga0207660_10189395 | 3300025917 | Bacteria | 1601 |
| 392 | Ga0207662_10000136 | 3300025918 | Bacteria | 35258 |
| 393 | Ga0207662_10011289 | 3300025918 | Bacteria | 4947 |
| 394 | Ga0207662_10252685 | 3300025918 | Bacteria | 1158 |
| 395 | Ga0207657_10005004 | 3300025919 | Bacteria | 13924 |
| 396 | Ga0207657_10055737 | 3300025919 | Bacteria | 3413 |
| 397 | Ga0207649_10000434 | 3300025920 | Bacteria | 30314 |
| 398 | Ga0207652_10001720 | 3300025921 | Bacteria | 19098 |
| 399 | Ga0207652_10016915 | 3300025921 | Bacteria | 5964 |
| 400 | Ga0207652_10425908 | 3300025921 | Bacteria | 1197 |
| 401 | Ga0207681_10000273 | 3300025923 | Bacteria | 38704 |
| 402 | Ga0207681_10173194 | 3300025923 | Bacteria | 1637 |
| 403 | Ga0207681_10859255 | 3300025923 | Bacteria | 759 |
| 404 | Ga0207694_10052606 | 3300025924 | Bacteria | 3156 |
| 405 | Ga0207694_10596276 | 3300025924 | Bacteria | 929 |
| 406 | Ga0207650_10001932 | 3300025925 | Bacteria | 14593 |
| 407 | Ga0207650_10597000 | 3300025925 | Bacteria | 928 |
| 408 | Ga0207659_10000097 | 3300025926 | Bacteria | 51545 |
| 409 | Ga0207659_10059029 | 3300025926 | Bacteria | 2756 |
| 410 | Ga0207687_10001031 | 3300025927 | Bacteria | 18938 |
| 411 | Ga0207687_10020925 | 3300025927 | Bacteria | 4343 |
| 412 | Ga0207700_10000167 | 3300025928 | Bacteria | 39027 |
| 413 | Ga0207700_10108029 | 3300025928 | Bacteria | 2233 |
| 414 | Ga0207700_10207267 | 3300025928 | Bacteria | 1655 |
| 415 | Ga0207700_10307066 | 3300025928 | Bacteria | 1371 |
| 416 | Ga0207700_11001076 | 3300025928 | Bacteria | 748 |
| 417 | Ga0207664_10038266 | 3300025929 | Bacteria | 3718 |
| 418 | Ga0207664_10135349 | 3300025929 | Bacteria | 2079 |
| 419 | Ga0207664_10243891 | 3300025929 | Bacteria | 1566 |
| 420 | Ga0207664_10271211 | 3300025929 | Bacteria | 1486 |
| 421 | Ga0207644_10001738 | 3300025931 | Bacteria | 14101 |
| 422 | Ga0207644_10036997 | 3300025931 | Bacteria | 3430 |
| 423 | Ga0207690_10000962 | 3300025932 | Bacteria | 18398 |
| 424 | Ga0207690_10151161 | 3300025932 | Bacteria | 1721 |
| 425 | Ga0207690_10289535 | 3300025932 | Bacteria | 1278 |
| 426 | Ga0207690_10340419 | 3300025932 | Bacteria | 1184 |
| 427 | Ga0207690_10824478 | 3300025932 | Bacteria | 767 |
| 428 | Ga0207706_10000867 | 3300025933 | Bacteria | 31142 |
| 429 | Ga0207706_10017224 | 3300025933 | Bacteria | 6513 |
| 430 | Ga0207706_10021114 | 3300025933 | Bacteria | 5849 |
| 431 | Ga0207706_10036344 | 3300025933 | Bacteria | 4375 |
| 432 | Ga0207686_10000329 | 3300025934 | Bacteria | 34169 |
| 433 | Ga0207686_10107854 | 3300025934 | Bacteria | 1872 |
| 434 | Ga0207709_10000419 | 3300025935 | Bacteria | 41401 |
| 435 | Ga0207709_10045024 | 3300025935 | Bacteria | 2670 |
| 436 | Ga0207709_10101156 | 3300025935 | Bacteria | 1906 |
| 437 | Ga0207709_10245035 | 3300025935 | Bacteria | 1306 |
| 438 | Ga0207670_10000536 | 3300025936 | Bacteria | 20898 |
| 439 | Ga0207670_10792165 | 3300025936 | Bacteria | 789 |
| 440 | Ga0207669_10002798 | 3300025937 | Bacteria | 7473 |
| 441 | Ga0207704_10000119 | 3300025938 | Bacteria | 43208 |
| 442 | Ga0207704_10074797 | 3300025938 | Bacteria | 2163 |
| 443 | Ga0207704_10282642 | 3300025938 | Bacteria | 1262 |
| 444 | Ga0207704_11061300 | 3300025938 | Bacteria | 687 |
| 445 | Ga0207665_10000417 | 3300025939 | Bacteria | 29333 |
| 446 | Ga0207691_10000544 | 3300025940 | Bacteria | 37754 |
| 447 | Ga0207691_10023702 | 3300025940 | Bacteria | 5777 |
| 448 | Ga0207691_10170474 | 3300025940 | Bacteria | 1906 |
| 449 | Ga0207691_10395597 | 3300025940 | Bacteria | 1179 |
| 450 | Ga0207711_10002468 | 3300025941 | Bacteria | 16502 |
| 451 | Ga0207711_10105904 | 3300025941 | Bacteria | 2494 |
| 452 | Ga0207711_10319609 | 3300025941 | Bacteria | 1434 |
| 453 | Ga0207689_10001743 | 3300025942 | Bacteria | 20521 |
| 454 | Ga0207689_10381710 | 3300025942 | Bacteria | 1173 |
| 455 | Ga0207689_10461869 | 3300025942 | Bacteria | 1062 |
| 456 | Ga0207661_10000428 | 3300025944 | Bacteria | 27215 |
| 457 | Ga0207661_10492543 | 3300025944 | Bacteria | 1120 |
| 458 | Ga0207661_11466608 | 3300025944 | Bacteria | 626 |
| 459 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 460 | Ga0207679_10129224 | 3300025945 | Bacteria | 2024 |
| 461 | Ga0207679_10278209 | 3300025945 | Bacteria | 1434 |
| 462 | Ga0207667_10017999 | 3300025949 | Bacteria | 7935 |
| 463 | Ga0207667_10056714 | 3300025949 | Bacteria | 4114 |
| 464 | Ga0207667_10120758 | 3300025949 | Bacteria | 2700 |
| 465 | Ga0207667_10407367 | 3300025949 | Bacteria | 1384 |
| 466 | Ga0207667_11133467 | 3300025949 | Bacteria | 764 |
| 467 | Ga0207651_10000083 | 3300025960 | Bacteria | 42310 |
| 468 | Ga0207712_10000471 | 3300025961 | Bacteria | 33929 |
| 469 | Ga0207712_10019998 | 3300025961 | Bacteria | 4380 |
| 470 | Ga0207668_10000862 | 3300025972 | Bacteria | 18292 |
| 471 | Ga0207640_10000637 | 3300025981 | Bacteria | 20610 |
| 472 | Ga0207640_10494373 | 3300025981 | Bacteria | 1017 |
| 473 | Ga0207640_10800633 | 3300025981 | Bacteria | 816 |
| 474 | Ga0207658_10002203 | 3300025986 | Bacteria | 14473 |
| 475 | Ga0207658_10041282 | 3300025986 | Bacteria | 3340 |
| 476 | Ga0207658_10041634 | 3300025986 | Bacteria | 3328 |
| 477 | Ga0207658_10342647 | 3300025986 | Bacteria | 1299 |
| 478 | Ga0207658_11021815 | 3300025986 | Bacteria | 754 |
| 479 | Ga0207658_11657912 | 3300025986 | Bacteria | 584 |
| 480 | Ga0207677_10000992 | 3300026023 | Bacteria | 15647 |
| 481 | Ga0207677_10368905 | 3300026023 | Bacteria | 1208 |
| 482 | Ga0207677_10791571 | 3300026023 | Bacteria | 848 |
| 483 | Ga0207703_10005165 | 3300026035 | Bacteria | 10555 |
| 484 | Ga0207703_10008054 | 3300026035 | Bacteria | 8328 |
| 485 | Ga0207703_10592055 | 3300026035 | Bacteria | 1048 |
| 486 | Ga0207639_10005126 | 3300026041 | Bacteria | 8828 |
| 487 | Ga0207639_10117256 | 3300026041 | Bacteria | 2181 |
| 488 | Ga0207639_10221184 | 3300026041 | Bacteria | 1635 |
| 489 | Ga0207678_10001568 | 3300026067 | Bacteria | 21015 |
| 490 | Ga0207678_10021304 | 3300026067 | Bacteria | 5683 |
| 491 | Ga0207678_10029617 | 3300026067 | Bacteria | 4780 |
| 492 | Ga0207678_10055746 | 3300026067 | Bacteria | 3404 |
| 493 | Ga0207678_10666137 | 3300026067 | Bacteria | 915 |
| 494 | Ga0207708_10002060 | 3300026075 | Bacteria | 14813 |
| 495 | Ga0207708_10005462 | 3300026075 | Bacteria | 9377 |
| 496 | Ga0207708_10017276 | 3300026075 | Bacteria | 5431 |
| 497 | Ga0207702_10001921 | 3300026078 | Bacteria | 20316 |
| 498 | Ga0207702_10369941 | 3300026078 | Bacteria | 1376 |
| 499 | Ga0207702_11433417 | 3300026078 | Bacteria | 684 |
| 500 | Ga0207641_10000510 | 3300026088 | Bacteria | 43699 |
| 501 | Ga0207648_10003487 | 3300026089 | Bacteria | 16487 |
| 502 | Ga0207648_10212920 | 3300026089 | Bacteria | 1716 |
| 503 | Ga0207648_10462116 | 3300026089 | Bacteria | 1157 |
| 504 | Ga0207676_10003788 | 3300026095 | Bacteria | 10694 |
| 505 | Ga0207676_10028269 | 3300026095 | Bacteria | 4186 |
| 506 | Ga0207676_10102196 | 3300026095 | Bacteria | 2379 |
| 507 | Ga0207674_10000608 | 3300026116 | Bacteria | 46971 |
| 508 | Ga0207674_10141868 | 3300026116 | Bacteria | 2362 |
| 509 | Ga0207674_10495818 | 3300026116 | Bacteria | 1180 |
| 510 | Ga0207675_100000805 | 3300026118 | Bacteria | 31142 |
| 511 | Ga0207675_100026921 | 3300026118 | Bacteria | 5353 |
| 512 | Ga0207675_100714409 | 3300026118 | Bacteria | 1012 |
| 513 | Ga0207683_10000082 | 3300026121 | Bacteria | 74842 |
| 514 | Ga0207683_10006710 | 3300026121 | Bacteria | 9849 |
| 515 | Ga0207683_10056132 | 3300026121 | Bacteria | 3454 |
| 516 | Ga0207698_10000377 | 3300026142 | Bacteria | 25983 |
| 517 | Ga0207698_10091738 | 3300026142 | Bacteria | 2488 |
| 518 | Ga0207698_10313595 | 3300026142 | Bacteria | 1466 |
| 519 | Ga0209967_1037373 | 3300027364 | Bacteria | 735 |
| 520 | Ga0209984_1003002 | 3300027424 | Bacteria | 1907 |
| 521 | Ga0209995_1018973 | 3300027471 | Bacteria | 1135 |
| 522 | Ga0210002_1003792 | 3300027617 | Bacteria | 2243 |
| 523 | Ga0209983_1006337 | 3300027665 | Bacteria | 2434 |
| 524 | Ga0209971_1003286 | 3300027682 | Bacteria | 3842 |
| 525 | Ga0209966_1001565 | 3300027695 | Bacteria | 3962 |
| 526 | Ga0209966_1016036 | 3300027695 | Bacteria | 1413 |
| 527 | Ga0209998_10000947 | 3300027717 | Bacteria | 7360 |
| 528 | Ga0209998_10007515 | 3300027717 | Bacteria | 2261 |
| 529 | Ga0209998_10009536 | 3300027717 | Bacteria | 2016 |
| 530 | Ga0209974_10029116 | 3300027876 | Bacteria | 1830 |
| 531 | Ga0209974_10047466 | 3300027876 | Bacteria | 1438 |
| 532 | Ga0209974_10118998 | 3300027876 | Bacteria | 935 |
| 533 | Ga0207428_10000124 | 3300027907 | Bacteria | 105795 |
| 534 | Ga0207428_10000420 | 3300027907 | Bacteria | 52679 |
| 535 | Ga0207428_10000703 | 3300027907 | Bacteria | 38851 |
| 536 | Ga0268266_10101549 | 3300028379 | Bacteria | 2536 |
| 537 | Ga0268265_10001170 | 3300028380 | Bacteria | 22993 |
| 538 | Ga0268265_10017735 | 3300028380 | Bacteria | 4920 |
| 539 | Ga0268264_10001878 | 3300028381 | Bacteria | 19073 |
| 540 | Ga0268264_10047711 | 3300028381 | Bacteria | 3560 |
| 541 | Ga0265337_1006137 | 3300028556 | Bacteria | 4674 |
| 542 | Ga0265334_10054444 | 3300028573 | Bacteria | 1526 |
| 543 | Ga0265338_10061561 | 3300028800 | Bacteria | 3289 |
| 544 | Ga0265763_1002495 | 3300030763 | Bacteria | 1414 |
| 545 | Ga0265773_1005860 | 3300031018 | Bacteria | 908 |
| 546 | Ga0265760_10017485 | 3300031090 | Bacteria | 2060 |
| 547 | Ga0265330_10058291 | 3300031235 | Bacteria | 1683 |
| 548 | Ga0265325_10000105 | 3300031241 | Bacteria | 59642 |
| 549 | Ga0265325_10007951 | 3300031241 | Bacteria | 6300 |
| 550 | Ga0265325_10231447 | 3300031241 | Bacteria | 842 |
| 551 | Ga0265325_10259934 | 3300031241 | Bacteria | 784 |
| 552 | Ga0265340_10108658 | 3300031247 | Bacteria | 1284 |
| 553 | Ga0265339_10005247 | 3300031249 | Bacteria | 8648 |
| 554 | Ga0265339_10010020 | 3300031249 | Bacteria | 5910 |
| 555 | Ga0265339_10106798 | 3300031249 | Bacteria | 1452 |
| 556 | Ga0265316_10054466 | 3300031344 | Bacteria | 3132 |
| 557 | Ga0265316_10215591 | 3300031344 | Bacteria | 1418 |
| 558 | Ga0265313_10000041 | 3300031595 | Bacteria | 119119 |
| 559 | Ga0265313_10035872 | 3300031595 | Bacteria | 2493 |
| 560 | Ga0265313_10041344 | 3300031595 | Bacteria | 2272 |
| 561 | Ga0265313_10106271 | 3300031595 | Bacteria | 1239 |
| 562 | Ga0265313_10110491 | 3300031595 | Bacteria | 1209 |
| 563 | Ga0316579_10042737 | 3300031691 | Bacteria | 2106 |
| 564 | Ga0265314_10000279 | 3300031711 | Bacteria | 74300 |
| 565 | Ga0265314_10017694 | 3300031711 | Bacteria | 5585 |
| 566 | Ga0265342_10001077 | 3300031712 | Bacteria | 26505 |
| 567 | Ga0265342_10054402 | 3300031712 | Bacteria | 2378 |
| 568 | Ga0307413_10143610 | 3300031824 | Bacteria | 1653 |
| 569 | Ga0307411_10191027 | 3300032005 | Bacteria | 1564 |
| 570 | Ga0307415_100621291 | 3300032126 | Bacteria | 965 |
| 571 | Ga0316583_10003152 | 3300032133 | Bacteria | 5794 |
| 572 | Ga0373930_0000680 | 3300034816 | Bacteria | 4768 |
| 573 | Ga0373930_0008825 | 3300034816 | Bacteria | 1771 |
| 574 | Ga0373948_0000196 | 3300034817 | Bacteria | 6999 |
| 575 | Ga0373950_0001373 | 3300034818 | Bacteria | 3163 |
| 576 | Ga0373950_0005433 | 3300034818 | Bacteria | 1904 |
| 577 | Ga0373958_0001277 | 3300034819 | Bacteria | 3363 |
| 578 | Ga0373958_0002069 | 3300034819 | Bacteria | 2771 |
| 579 | Ga0373958_0020804 | 3300034819 | Bacteria | 1212 |
| 580 | Ga0373959_0043135 | 3300034820 | Bacteria | 953 |
| 581 | Ga0373959_0150486 | 3300034820 | Bacteria | 588 |
| 582 | Ga0373938_0000092 | 3300034957 | Bacteria | 12211 |
| 583 | Ga0373938_0003487 | 3300034957 | Bacteria | 2580 |
| 584 | Ga0373938_0020764 | 3300034957 | Bacteria | 1326 |
| 585 | Ga0373926_0041110 | 3300035083 | Bacteria | 1651 |
| 586 | Ga0373926_0205655 | 3300035083 | Bacteria | 758 |
| 587 | Ga0373928_0003337 | 3300035084 | Bacteria | 3068 |
| 588 | Ga0373928_0005526 | 3300035084 | Bacteria | 2417 |
| 589 | Ga0373929_0000128 | 3300035085 | Bacteria | 12674 |
| 590 | Ga0373940_0005195 | 3300035088 | Bacteria | 2804 |
| 591 | Ga0373940_0035562 | 3300035088 | Unclassified | 1349 |
| 592 | Ga0373940_0049925 | 3300035088 | Bacteria | 1172 |
| 593 | Ga0373944_0045330 | 3300035089 | Bacteria | 1372 |
| 594 | Ga0373949_0000715 | 3300035090 | Bacteria | 10774 |
| 595 | Ga0373949_0011216 | 3300035090 | Bacteria | 1971 |
| 596 | Ga0373949_0035614 | 3300035090 | Bacteria | 1204 |
| 597 | Ga0373951_0000531 | 3300035091 | Bacteria | 10760 |
| 598 | Ga0373951_0003670 | 3300035091 | Bacteria | 3703 |
| 599 | Ga0373952_0006526 | 3300035092 | Bacteria | 2158 |
| 600 | Ga0373952_0008456 | 3300035092 | Bacteria | 1954 |
| 601 | Ga0373923_0002485 | 3300035111 | Bacteria | 5690 |
| 602 | Ga0373923_0090402 | 3300035111 | Bacteria | 1339 |
| 603 | Ga0373932_0000510 | 3300035112 | Bacteria | 11939 |
| 604 | Ga0373932_0000597 | 3300035112 | Bacteria | 11032 |
| 605 | Ga0373932_0002240 | 3300035112 | Bacteria | 4953 |
| 606 | Ga0373936_0007526 | 3300035113 | Bacteria | 4096 |
| 607 | Ga0373939_0000361 | 3300035114 | Bacteria | 11487 |
| 608 | Ga0373939_0000377 | 3300035114 | Bacteria | 11260 |
| 609 | Ga0373939_0013576 | 3300035114 | Bacteria | 2099 |
| 610 | Ga0373939_0016420 | 3300035114 | Bacteria | 1952 |
| 611 | Ga0373941_0020117 | 3300035115 | Bacteria | 1867 |
| 612 | Ga0373941_0118879 | 3300035115 | Bacteria | 940 |
| 613 | Ga0373945_0001243 | 3300035116 | Bacteria | 7756 |
| 614 | Ga0373953_0003611 | 3300035117 | Bacteria | 4843 |
| 615 | Ga0373953_0427848 | 3300035117 | Bacteria | 584 |
| 616 | Ga0373954_0015537 | 3300035118 | Bacteria | 3403 |
| 617 | Ga0373954_0096413 | 3300035118 | Bacteria | 1424 |
| 618 | Ga0373954_0252495 | 3300035118 | Bacteria | 868 |
| 619 | Ga0373956_0018425 | 3300035119 | Bacteria | 2957 |
| 620 | Ga0373956_0077711 | 3300035119 | Bacteria | 1520 |
| 621 | Ga0373956_0343485 | 3300035119 | Bacteria | 711 |
| 622 | Ga0373957_0013805 | 3300035120 | Bacteria | 2749 |
| 623 | Ga0373957_0079690 | 3300035120 | Bacteria | 1291 |
| 624 | Ga0373960_0000204 | 3300035121 | Bacteria | 10830 |
| 625 | Ga0373960_0001684 | 3300035121 | Bacteria | 4947 |
| 626 | Ga0373943_0003538 | 3300035170 | Bacteria | 7112 |
| 627 | Ga0373943_0105507 | 3300035170 | Bacteria | 1479 |
| 628 | Ga0373943_0474672 | 3300035170 | Bacteria | 729 |
| 629 | Ga0373946_0003985 | 3300035171 | Bacteria | 5252 |
| 630 | Ga0373946_0172606 | 3300035171 | Bacteria | 1021 |
| 631 | Ga0373955_0018458 | 3300035172 | Bacteria | 3469 |
| 632 | Ga0373955_0248942 | 3300035172 | Bacteria | 1065 |
| 633 | Ga0373942_0000813 | 3300035207 | Bacteria | 8599 |
| 634 | Ga0373942_0002869 | 3300035207 | Bacteria | 4095 |
| 635 | Ga0373961_0001755 | 3300035241 | Bacteria | 6010 |
| 636 | Ga0373961_0001827 | 3300035241 | Bacteria | 5833 |
| 637 | Ga0373961_0106872 | 3300035241 | Bacteria | 912 |
| 638 | Ga0373962_0066553 | 3300035242 | Bacteria | 1068 |
| 639 | Ga0373962_0113069 | 3300035242 | Bacteria | 858 |
| 640 | Ga0373924_0016721 | 3300035410 | Bacteria | 2805 |
| 641 | Ga0373924_0026473 | 3300035410 | Bacteria | 2301 |
| 642 | Ga0373924_0065453 | 3300035410 | Bacteria | 1526 |
| 643 | Ga0373931_0000186 | 3300035691 | Bacteria | 26950 |
| 644 | Ga0373931_0002333 | 3300035691 | Bacteria | 8383 |
| 645 | Ga0373931_0003707 | 3300035691 | Bacteria | 6911 |
| 646 | Ga0373935_0016872 | 3300035692 | Bacteria | 4422 |
| 647 | Ga0373935_0107931 | 3300035692 | Bacteria | 1844 |
| 648 | Ga0373935_0692866 | 3300035692 | Bacteria | 749 |
| 649 | Ga0373927_0063603 | 3300035695 | Bacteria | 2386 |
| 650 | Ga0373927_0182286 | 3300035695 | Unclassified | 1377 |
| 651 | Ga0373933_0016462 | 3300035724 | Bacteria | 4135 |
| 652 | Ga0373933_0072189 | 3300035724 | Bacteria | 2102 |
| 653 | Ga0373947_0004569 | 3300035725 | Bacteria | 8119 |
| 654 | Ga0373937_0009657 | 3300036401 | Bacteria | 8402 |
| 655 | Ga0373937_0016585 | 3300036401 | Bacteria | 6544 |
| 656 | Ga0373937_0023701 | 3300036401 | Bacteria | 5532 |
| 657 | Ga0373937_0025502 | 3300036401 | Bacteria | 5336 |
| 658 | Ga0373937_0199890 | 3300036401 | Bacteria | 1879 |
| 659 | Ga0373937_0494850 | 3300036401 | Bacteria | 1161 |
| 660 | Ga0316582_0678080 | 3300036647 | Bacteria | 708 |
| 661 | Ga0373925_0005307 | 3300037068 | Bacteria | 9621 |
| 662 | Ga0373925_0010134 | 3300037068 | Bacteria | 6842 |
| 663 | Ga0373925_0042928 | 3300037068 | Bacteria | 3355 |
| 664 | Ga0373925_0058062 | 3300037068 | Bacteria | 2900 |
| 665 | Ga0373925_0473795 | 3300037068 | Bacteria | 1027 |
| 666 | Ga0395899_0001670 | 3300037312 | Bacteria | 18498 |
| 667 | Ga0395900_0003491 | 3300037418 | Bacteria | 16965 |
| 668 | Ga0395900_0030502 | 3300037418 | Bacteria | 5536 |
| 669 | Ga0395900_0125555 | 3300037418 | Bacteria | 2632 |
| 670 | Ga0395898_0002609 | 3300037466 | Bacteria | 21035 |
| 671 | Ga0395898_0014973 | 3300037466 | Bacteria | 7963 |
| 672 | Ga0395898_0322637 | 3300037466 | Bacteria | 1473 |
| 673 | Ga0395901_0005021 | 3300038443 | Bacteria | 13359 |
| 674 | Ga0395901_0205014 | 3300038443 | Bacteria | 2066 |
| 675 | Ga0242420_019213 | 3300038996 | Bacteria | 1209 |
| 676 | Ga0436365_0823677 | 3300039437 | Bacteria | 2841 |
| 677 | Ga0436365_1587891 | 3300039437 | Bacteria | 1261 |
| 678 | Ga0451839_1211329 | 3300041496 | Bacteria | 720 |
| 679 | Ga0451853_1133953 | 3300041512 | Bacteria | 2211 |
| 680 | Ga0439448_0090643 | 3300042005 | Bacteria | 1033 |
| 681 | Ga0439450_031306 | 3300042008 | Bacteria | 1197 |
| 682 | Ga0439455_0003575 | 3300042012 | Bacteria | 2988 |
| 683 | Ga0439459_0067897 | 3300042438 | Bacteria | 819 |
| 684 | Ga0451577_0600374 | 3300042876 | Bacteria | 999 |
| 685 | Ga0466966_0112578 | 3300044684 | Bacteria | 1677 |
| 686 | Ga0466961_0088464 | 3300044693 | Bacteria | 1957 |
| 687 | Ga0466963_0230872 | 3300044694 | Bacteria | 1296 |
| 688 | Ga0453684_0066809 | 3300044712 | Bacteria | 4577 |
| 689 | Ga0466957_0272693 | 3300044842 | Bacteria | 1130 |
| 690 | Ga0451576_0039893 | 3300045051 | Bacteria | 4970 |
| 691 | Ga0466958_0388769 | 3300045836 | Bacteria | 900 |
| 692 | Ga0466958_0411635 | 3300045836 | Bacteria | 874 |
| 693 | Ga0466967_0005780 | 3300045976 | Bacteria | 8647 |
| 694 | Ga0466967_0539386 | 3300045976 | Bacteria | 1147 |
| 695 | Ga0495592_0001116 | 3300046454 | Bacteria | 18677 |
| 696 | Ga0495592_0009742 | 3300046454 | Bacteria | 7231 |
| 697 | Ga0495592_0057294 | 3300046454 | Bacteria | 2876 |
| 698 | Ga0495592_0096795 | 3300046454 | Bacteria | 2109 |
| 699 | Ga0495592_0470310 | 3300046454 | Bacteria | 785 |
| 700 | Ga0495603_0012962 | 3300046455 | Bacteria | 5041 |
| 701 | Ga0495629_0006281 | 3300046459 | Bacteria | 8819 |
| 702 | Ga0495629_0016112 | 3300046459 | Bacteria | 5367 |
| 703 | Ga0495629_0024439 | 3300046459 | Bacteria | 4302 |
| 704 | Ga0495641_0023574 | 3300046461 | Bacteria | 3053 |
| 705 | Ga0495641_0031793 | 3300046461 | Bacteria | 2518 |
| 706 | Ga0495641_0188442 | 3300046461 | Bacteria | 924 |
| 707 | Ga0495641_0285807 | 3300046461 | Bacteria | 743 |
| 708 | Ga0495651_0000493 | 3300046462 | Bacteria | 30523 |
| 709 | Ga0495651_0016283 | 3300046462 | Bacteria | 5757 |
| 710 | Ga0495651_0283940 | 3300046462 | Bacteria | 1117 |
| 711 | Ga0495653_0004657 | 3300046463 | Bacteria | 11097 |
| 712 | Ga0495653_0012444 | 3300046463 | Bacteria | 6947 |
| 713 | Ga0495653_0041839 | 3300046463 | Bacteria | 3574 |
| 714 | Ga0495580_0483081 | 3300046472 | Bacteria | 828 |
| 715 | Ga0495582_0001705 | 3300046473 | Bacteria | 12400 |
| 716 | Ga0495582_0015446 | 3300046473 | Bacteria | 4193 |
| 717 | Ga0495639_0019431 | 3300046475 | Bacteria | 2965 |
| 718 | Ga0495639_0046937 | 3300046475 | Bacteria | 1956 |
| 719 | Ga0495662_0009777 | 3300046476 | Bacteria | 4711 |
| 720 | Ga0495662_0023030 | 3300046476 | Bacteria | 3007 |
| 721 | Ga0495664_0001609 | 3300046477 | Bacteria | 12011 |
| 722 | Ga0495664_0523671 | 3300046477 | Bacteria | 707 |
| 723 | Ga0495584_0014705 | 3300046491 | Bacteria | 3988 |
| 724 | Ga0495585_0009128 | 3300046492 | Bacteria | 5970 |
| 725 | Ga0495594_0047336 | 3300046499 | Bacteria | 2361 |
| 726 | Ga0495594_0101905 | 3300046499 | Unclassified | 1615 |
| 727 | Ga0495607_0004288 | 3300046501 | Bacteria | 10532 |
| 728 | Ga0495608_0010562 | 3300046511 | Bacteria | 6442 |
| 729 | Ga0495608_0013937 | 3300046511 | Bacteria | 5580 |
| 730 | Ga0495608_0110542 | 3300046511 | Bacteria | 1767 |
| 731 | Ga0495608_0151432 | 3300046511 | Bacteria | 1478 |
| 732 | Ga0495618_0007452 | 3300046514 | Bacteria | 6617 |
| 733 | Ga0495618_0014982 | 3300046514 | Bacteria | 4728 |
| 734 | Ga0495628_0002046 | 3300046516 | Bacteria | 18273 |
| 735 | Ga0495628_0009974 | 3300046516 | Bacteria | 8082 |
| 736 | Ga0495628_0014402 | 3300046516 | Bacteria | 6630 |
| 737 | Ga0495630_0023584 | 3300046517 | Bacteria | 4548 |
| 738 | Ga0495630_0157643 | 3300046517 | Bacteria | 1728 |
| 739 | Ga0495630_0542717 | 3300046517 | Bacteria | 891 |
| 740 | Ga0495630_0725421 | 3300046517 | Bacteria | 760 |
| 741 | Ga0495637_0101288 | 3300046520 | Bacteria | 1125 |
| 742 | Ga0495644_0000514 | 3300046523 | Bacteria | 16546 |
| 743 | Ga0495666_0001847 | 3300046526 | Bacteria | 10463 |
| 744 | Ga0495652_0020653 | 3300046529 | Bacteria | 5854 |
| 745 | Ga0495652_0234879 | 3300046529 | Bacteria | 1368 |
| 746 | Ga0495665_0006322 | 3300046531 | Bacteria | 6389 |
| 747 | Ga0495665_0052492 | 3300046531 | Bacteria | 2158 |
| 748 | Ga0495640_0020957 | 3300046533 | Bacteria | 4805 |
| 749 | Ga0495640_0081965 | 3300046533 | Bacteria | 2144 |
| 750 | Ga0495586_0060389 | 3300046535 | Bacteria | 2061 |
| 751 | Ga0495587_0000335 | 3300046536 | Bacteria | 33563 |
| 752 | Ga0495587_0027769 | 3300046536 | Bacteria | 3445 |
| 753 | Ga0495598_0195351 | 3300046537 | Bacteria | 728 |
| 754 | Ga0495609_0023913 | 3300046538 | Bacteria | 2805 |
| 755 | Ga0495645_0001781 | 3300046543 | Bacteria | 14625 |
| 756 | Ga0495645_0123648 | 3300046543 | Bacteria | 1819 |
| 757 | Ga0495645_0154375 | 3300046543 | Bacteria | 1592 |
| 758 | Ga0495645_0674978 | 3300046543 | Bacteria | 629 |
| 759 | Ga0495622_0018802 | 3300046557 | Bacteria | 3218 |
| 760 | Ga0495622_0093569 | 3300046557 | Bacteria | 1380 |
| 761 | Ga0495667_0004928 | 3300046559 | Bacteria | 9026 |
| 762 | Ga0495667_0019211 | 3300046559 | Bacteria | 4611 |
| 763 | Ga0495667_0021834 | 3300046559 | Bacteria | 4317 |
| 764 | Ga0495667_0042835 | 3300046559 | Bacteria | 3001 |
| 765 | Ga0495667_0358182 | 3300046559 | Bacteria | 921 |
| 766 | Ga0495656_0019735 | 3300046615 | Bacteria | 2605 |
| 767 | Ga0495634_0007696 | 3300046642 | Bacteria | 8061 |
| 768 | Ga0495634_0017766 | 3300046642 | Bacteria | 5071 |
| 769 | Ga0495635_0000736 | 3300046663 | Bacteria | 21173 |
| 770 | Ga0495635_0004379 | 3300046663 | Bacteria | 9778 |
| 771 | Ga0495635_0031122 | 3300046663 | Bacteria | 3707 |
| 772 | Ga0495635_0045113 | 3300046663 | Bacteria | 3041 |
| 773 | Ga0495635_0061837 | 3300046663 | Bacteria | 2571 |
| 774 | Ga0495635_0201286 | 3300046663 | Bacteria | 1351 |
| 775 | Ga0495659_0008156 | 3300046664 | Bacteria | 3329 |
| 776 | Ga0495588_0013623 | 3300046674 | Bacteria | 3876 |
| 777 | Ga0495657_0000836 | 3300046675 | Bacteria | 27235 |
| 778 | Ga0495657_0082765 | 3300046675 | Bacteria | 2073 |
| 779 | Ga0495657_0110571 | 3300046675 | Bacteria | 1741 |
| 780 | Ga0495657_0249728 | 3300046675 | Bacteria | 1068 |
| 781 | Ga0495657_0393244 | 3300046675 | Bacteria | 817 |
| 782 | Ga0495599_0003364 | 3300046678 | Bacteria | 9345 |
| 783 | Ga0495599_0134578 | 3300046678 | Bacteria | 1534 |
| 784 | Ga0495623_0027709 | 3300046679 | Bacteria | 3647 |
| 785 | Ga0495646_0000229 | 3300046680 | Bacteria | 27971 |
| 786 | Ga0495646_0006372 | 3300046680 | Bacteria | 7484 |
| 787 | Ga0495647_0008999 | 3300046681 | Bacteria | 3368 |
| 788 | Ga0495658_0000591 | 3300046683 | Bacteria | 19855 |
| 789 | Ga0495658_0002748 | 3300046683 | Bacteria | 8846 |
| 790 | Ga0495669_0119181 | 3300046684 | Bacteria | 1236 |
| 791 | Ga0495669_0182857 | 3300046684 | Bacteria | 999 |
| 792 | Ga0495613_0047264 | 3300046689 | Bacteria | 3179 |
| 793 | Ga0495613_0115614 | 3300046689 | Unclassified | 1930 |
| 794 | Ga0495624_0009422 | 3300046690 | Bacteria | 6764 |
| 795 | Ga0495670_0008959 | 3300046691 | Bacteria | 4922 |
| 796 | Ga0495671_0085443 | 3300046692 | Bacteria | 1546 |
| 797 | Ga0495600_0004219 | 3300046809 | Bacteria | 8582 |
| 798 | Ga0495600_0009757 | 3300046809 | Bacteria | 5935 |
| 799 | Ga0495600_0135366 | 3300046809 | Bacteria | 1601 |
| 800 | Ga0495600_0261780 | 3300046809 | Bacteria | 1098 |
| 801 | Ga0495581_0017156 | 3300047315 | Bacteria | 4207 |
| 802 | Ga0495581_0035361 | 3300047315 | Bacteria | 2891 |
| 803 | Ga0495604_0021677 | 3300047317 | Bacteria | 5129 |
| 804 | Ga0495604_0028471 | 3300047317 | Bacteria | 4444 |
| 805 | Ga0495604_0043834 | 3300047317 | Bacteria | 3499 |
| 806 | Ga0495636_0477254 | 3300047318 | Bacteria | 601 |
| 807 | Ga0495674_0034790 | 3300047319 | Bacteria | 4551 |
| 808 | Ga0495674_0040549 | 3300047319 | Bacteria | 4164 |
| 809 | Ga0495674_0050397 | 3300047319 | Bacteria | 3673 |
| 810 | Ga0495674_1288000 | 3300047319 | Bacteria | 549 |
| 811 | Ga0495676_0017949 | 3300047321 | Bacteria | 6244 |
| 812 | Ga0495680_0005567 | 3300047322 | Bacteria | 11823 |
| 813 | Ga0495680_0008046 | 3300047322 | Bacteria | 9614 |
| 814 | Ga0495680_0015939 | 3300047322 | Bacteria | 6468 |
| 815 | Ga0495680_0036864 | 3300047322 | Bacteria | 3921 |
| 816 | Ga0495680_0075306 | 3300047322 | Bacteria | 2561 |
| 817 | Ga0495675_0000139 | 3300047444 | Bacteria | 50643 |
| 818 | Ga0495675_0177155 | 3300047444 | Bacteria | 1307 |
| 819 | Ga0495677_0019658 | 3300047445 | Bacteria | 2449 |
| 820 | Ga0495684_0006324 | 3300047471 | Bacteria | 9204 |
| 821 | Ga0495684_0016053 | 3300047471 | Bacteria | 5765 |
| 822 | Ga0495684_0255654 | 3300047471 | Bacteria | 1273 |
| 823 | Ga0495593_0064941 | 3300047673 | Unclassified | 1904 |
| 824 | Ga0495593_0116979 | 3300047673 | Bacteria | 1358 |
| 825 | Ga0495602_0004714 | 3300048088 | Bacteria | 14255 |
| 826 | Ga0495602_0006950 | 3300048088 | Bacteria | 11884 |
| 827 | Ga0495602_0112730 | 3300048088 | Bacteria | 2206 |
| 828 | Ga0495602_0630110 | 3300048088 | Bacteria | 734 |
| 829 | Ga0495614_0263582 | 3300048089 | Bacteria | 790 |
| 830 | Ga0496100_0000057 | 3300048903 | Bacteria | 67216 |
| 831 | Ga0496100_0088881 | 3300048903 | Bacteria | 2103 |
| 832 | Ga0496100_0126792 | 3300048903 | Bacteria | 1792 |
| 833 | Ga0496100_1162460 | 3300048903 | Bacteria | 608 |
| 834 | Ga0496101_0001297 | 3300048904 | Bacteria | 14944 |
| 835 | Ga0496101_0021335 | 3300048904 | Bacteria | 4450 |
| 836 | Ga0496101_0697545 | 3300048904 | Bacteria | 801 |
| 837 | Ga0496102_0001628 | 3300048905 | Bacteria | 19791 |
| 838 | Ga0496102_0031718 | 3300048905 | Bacteria | 4742 |
| 839 | Ga0496102_0146655 | 3300048905 | Bacteria | 2215 |
| 840 | Ga0496102_0447252 | 3300048905 | Bacteria | 1212 |
| 841 | Ga0496102_0450410 | 3300048905 | Bacteria | 1208 |
| 842 | Ga0496102_0465246 | 3300048905 | Bacteria | 1185 |
| 843 | Ga0496103_0003313 | 3300048906 | Bacteria | 9851 |
| 844 | Ga0496103_0016110 | 3300048906 | Bacteria | 4460 |
| 845 | Ga0496104_0000658 | 3300048907 | Bacteria | 29624 |
| 846 | Ga0496104_0063613 | 3300048907 | Bacteria | 3499 |
| 847 | Ga0496104_0143016 | 3300048907 | Bacteria | 2298 |
| 848 | Ga0496104_0242057 | 3300048907 | Bacteria | 1716 |
| 849 | Ga0496104_0330861 | 3300048907 | Bacteria | 1436 |
| 850 | Ga0496104_0349874 | 3300048907 | Bacteria | 1390 |
| 851 | Ga0496104_0378776 | 3300048907 | Bacteria | 1328 |
| 852 | Ga0496105_0003619 | 3300048908 | Bacteria | 11480 |
| 853 | Ga0496105_0007433 | 3300048908 | Bacteria | 8478 |
| 854 | Ga0496105_0051118 | 3300048908 | Bacteria | 3415 |
| 855 | Ga0496105_0128809 | 3300048908 | Bacteria | 2087 |
| 856 | Ga0496105_0713944 | 3300048908 | Bacteria | 768 |
| 857 | Ga0496106_0000518 | 3300048909 | Bacteria | 27401 |
| 858 | Ga0496106_0013856 | 3300048909 | Bacteria | 5957 |
| 859 | Ga0496106_0016140 | 3300048909 | Bacteria | 5524 |
| 860 | Ga0496106_0036474 | 3300048909 | Bacteria | 3678 |
| 861 | Ga0496106_0211603 | 3300048909 | Bacteria | 1544 |
| 862 | Ga0496107_0001129 | 3300048910 | Bacteria | 16115 |
| 863 | Ga0496107_0008616 | 3300048910 | Bacteria | 7063 |
| 864 | Ga0496107_0023162 | 3300048910 | Bacteria | 4389 |
| 865 | Ga0496107_0061873 | 3300048910 | Bacteria | 2711 |
| 866 | Ga0496107_0275409 | 3300048910 | Bacteria | 1252 |
| 867 | Ga0496107_0981283 | 3300048910 | Bacteria | 613 |
| 868 | Ga0496108_0004254 | 3300048911 | Bacteria | 11528 |
| 869 | Ga0496108_0044088 | 3300048911 | Bacteria | 3724 |
| 870 | Ga0496109_0000390 | 3300048912 | Bacteria | 39843 |
| 871 | Ga0496109_0002432 | 3300048912 | Bacteria | 15587 |
| 872 | Ga0496109_0023523 | 3300048912 | Bacteria | 5470 |
| 873 | Ga0496109_0038068 | 3300048912 | Bacteria | 4348 |
| 874 | Ga0496110_0005641 | 3300048913 | Bacteria | 9824 |
| 875 | Ga0496110_0014086 | 3300048913 | Bacteria | 6630 |
| 876 | Ga0496110_0186510 | 3300048913 | Bacteria | 1883 |
| 877 | Ga0496111_0020628 | 3300048914 | Bacteria | 4590 |
| 878 | Ga0496111_0027669 | 3300048914 | Bacteria | 4014 |
| 879 | Ga0496111_0092363 | 3300048914 | Bacteria | 2218 |
| 880 | Ga0496112_0025896 | 3300048915 | Bacteria | 5636 |
| 881 | Ga0496113_0019170 | 3300048916 | Bacteria | 4780 |
| 882 | Ga0496113_0120372 | 3300048916 | Bacteria | 2051 |
| 883 | Ga0496114_0002944 | 3300048917 | Bacteria | 13059 |
| 884 | Ga0496114_0046938 | 3300048917 | Bacteria | 3590 |
| 885 | Ga0496114_0266690 | 3300048917 | Bacteria | 1508 |
| 886 | Ga0496114_0704363 | 3300048917 | Bacteria | 885 |
| 887 | Ga0496115_0014682 | 3300048918 | Bacteria | 5932 |
| 888 | Ga0496115_0073108 | 3300048918 | Bacteria | 2782 |
| 889 | Ga0496115_0179507 | 3300048918 | Bacteria | 1750 |
| 890 | Ga0496115_0586416 | 3300048918 | Bacteria | 887 |
| 891 | Ga0496125_0300386 | 3300048928 | Bacteria | 984 |
| 892 | Ga0501031_0086545 | 3300049568 | Bacteria | 2043 |
| 893 | Ga0501031_0212867 | 3300049568 | Bacteria | 1259 |
| 894 | Ga0501032_0012835 | 3300049569 | Bacteria | 5974 |
| 895 | Ga0501032_0021838 | 3300049569 | Bacteria | 4444 |
| 896 | Ga0501032_0052659 | 3300049569 | Bacteria | 2742 |
| 897 | Ga0501032_0100027 | 3300049569 | Bacteria | 1921 |
| 898 | Ga0501033_0139839 | 3300049570 | Bacteria | 1750 |
| 899 | Ga0501034_0002292 | 3300049571 | Bacteria | 23472 |
| 900 | Ga0501034_0020882 | 3300049571 | Bacteria | 6685 |
| 901 | Ga0501034_0024137 | 3300049571 | Bacteria | 6185 |
| 902 | Ga0501034_0076586 | 3300049571 | Bacteria | 3352 |
| 903 | Ga0501034_0305190 | 3300049571 | Bacteria | 1527 |
| 904 | Ga0501034_1229354 | 3300049571 | Bacteria | 627 |
| 905 | Ga0501036_0000609 | 3300049572 | Bacteria | 25966 |
| 906 | Ga0501036_0054800 | 3300049572 | Bacteria | 3378 |
| 907 | Ga0501036_0205765 | 3300049572 | Bacteria | 1654 |
| 908 | Ga0501036_0364435 | 3300049572 | Bacteria | 1206 |
| 909 | Ga0501037_0007571 | 3300049573 | Bacteria | 7951 |
| 910 | Ga0501037_0036674 | 3300049573 | Bacteria | 3612 |
| 911 | Ga0501037_0517999 | 3300049573 | Bacteria | 807 |
| 912 | Ga0501038_0016827 | 3300049574 | Bacteria | 6618 |
| 913 | Ga0501038_0049627 | 3300049574 | Bacteria | 3628 |
| 914 | Ga0501038_0051768 | 3300049574 | Bacteria | 3541 |
| 915 | Ga0501038_0485019 | 3300049574 | Bacteria | 947 |
| 916 | Ga0501039_0029717 | 3300049575 | Bacteria | 4210 |
| 917 | Ga0501039_0038774 | 3300049575 | Bacteria | 3679 |
| 918 | Ga0501039_0163405 | 3300049575 | Bacteria | 1750 |
| 919 | Ga0501040_0089076 | 3300049576 | Bacteria | 2144 |
| 920 | Ga0501040_0321027 | 3300049576 | Bacteria | 1108 |
| 921 | Ga0501042_0495404 | 3300049578 | Bacteria | 887 |
| 922 | Ga0501043_0002387 | 3300049579 | Bacteria | 15915 |
| 923 | Ga0501043_0016255 | 3300049579 | Bacteria | 5836 |
| 924 | Ga0501043_0062852 | 3300049579 | Bacteria | 2915 |
| 925 | Ga0501043_0275321 | 3300049579 | Bacteria | 1291 |
| 926 | Ga0501043_0870879 | 3300049579 | Bacteria | 648 |
| 927 | Ga0501046_0026268 | 3300049580 | Bacteria | 4755 |
| 928 | Ga0501046_0371783 | 3300049580 | Bacteria | 1035 |
| 929 | Ga0501047_0000228 | 3300049581 | Bacteria | 66588 |
| 930 | Ga0501047_0027357 | 3300049581 | Bacteria | 5493 |
| 931 | Ga0501047_0425427 | 3300049581 | Bacteria | 1159 |
| 932 | Ga0501047_0673064 | 3300049581 | Bacteria | 853 |
| 933 | Ga0501047_1093626 | 3300049581 | Bacteria | 610 |
| 934 | Ga0501048_0000467 | 3300049582 | Bacteria | 28373 |
| 935 | Ga0501048_0123613 | 3300049582 | Bacteria | 1829 |
| 936 | Ga0501067_0057885 | 3300049583 | Bacteria | 2146 |
| 937 | Ga0501067_0167596 | 3300049583 | Bacteria | 1223 |
| 938 | Ga0501067_0283274 | 3300049583 | Bacteria | 923 |
| 939 | Ga0501068_0048365 | 3300049584 | Bacteria | 2567 |
| 940 | Ga0501068_0051063 | 3300049584 | Bacteria | 2501 |
| 941 | Ga0501068_0065914 | 3300049584 | Bacteria | 2205 |
| 942 | Ga0501069_0054877 | 3300049585 | Bacteria | 2219 |
| 943 | Ga0501069_0074349 | 3300049585 | Bacteria | 1906 |
| 944 | Ga0501070_0008780 | 3300049586 | Bacteria | 8545 |
| 945 | Ga0501070_0014043 | 3300049586 | Bacteria | 6741 |
| 946 | Ga0501070_0029296 | 3300049586 | Bacteria | 4617 |
| 947 | Ga0501070_0038930 | 3300049586 | Bacteria | 3967 |
| 948 | Ga0501070_0046289 | 3300049586 | Bacteria | 3617 |
| 949 | Ga0501070_0059350 | 3300049586 | Bacteria | 3171 |
| 950 | Ga0501070_0196672 | 3300049586 | Bacteria | 1656 |
| 951 | Ga0501070_0218106 | 3300049586 | Bacteria | 1565 |
| 952 | Ga0501071_0174267 | 3300049587 | Bacteria | 1611 |
| 953 | Ga0501072_0162152 | 3300049588 | Bacteria | 1784 |
| 954 | Ga0501073_0005395 | 3300049589 | Bacteria | 9578 |
| 955 | Ga0501073_0016516 | 3300049589 | Bacteria | 5351 |
| 956 | Ga0501073_0059193 | 3300049589 | Bacteria | 2676 |
| 957 | Ga0501073_0395835 | 3300049589 | Bacteria | 954 |
| 958 | Ga0501074_0003305 | 3300049590 | Bacteria | 11407 |
| 959 | Ga0501074_0004721 | 3300049590 | Bacteria | 9764 |
| 960 | Ga0501074_0095235 | 3300049590 | Bacteria | 2132 |
| 961 | Ga0501074_0134940 | 3300049590 | Bacteria | 1765 |
| 962 | Ga0501074_0329981 | 3300049590 | Bacteria | 1083 |
| 963 | Ga0501076_0127841 | 3300049592 | Bacteria | 2060 |
| 964 | Ga0501077_0358400 | 3300049593 | Bacteria | 931 |
| 965 | Ga0501079_0224929 | 3300049741 | Bacteria | 1466 |
| 966 | Ga0501079_0289625 | 3300049741 | Bacteria | 1280 |
| 967 | Ga0501080_0000112 | 3300049742 | Bacteria | 56408 |
| 968 | Ga0501080_0013759 | 3300049742 | Bacteria | 7450 |
| 969 | Ga0501080_0046008 | 3300049742 | Bacteria | 4064 |
| 970 | Ga0501080_0053206 | 3300049742 | Bacteria | 3768 |
| 971 | Ga0501080_0178247 | 3300049742 | Bacteria | 1957 |
| 972 | Ga0501081_0389603 | 3300049743 | Bacteria | 1030 |
| 973 | Ga0501083_0001098 | 3300049744 | Bacteria | 18074 |
| 974 | Ga0501083_0071101 | 3300049744 | Bacteria | 2314 |
| 975 | Ga0501083_0078218 | 3300049744 | Bacteria | 2194 |
| 976 | Ga0501035_0012556 | 3300049822 | Bacteria | 7826 |
| 977 | Ga0501035_0125846 | 3300049822 | Bacteria | 2237 |
| 978 | Ga0501035_0214336 | 3300049822 | Bacteria | 1646 |
| 979 | Ga0501035_0323928 | 3300049822 | Bacteria | 1294 |
| 980 | Ga0501044_0017602 | 3300049823 | Bacteria | 7664 |
| 981 | Ga0501044_0059118 | 3300049823 | Bacteria | 3928 |
| 982 | Ga0501044_0068643 | 3300049823 | Bacteria | 3611 |
| 983 | Ga0501044_0157923 | 3300049823 | Bacteria | 2246 |
| 984 | Ga0501044_0173219 | 3300049823 | Bacteria | 2128 |
| 985 | Ga0501044_0221775 | 3300049823 | Bacteria | 1841 |
| 986 | Ga0501044_1119400 | 3300049823 | Bacteria | 656 |
| 987 | Ga0501045_0259239 | 3300049824 | Bacteria | 1294 |
| 988 | nmdc:mga00v17_258615_c1 | 3300050491 | Bacteria | 1129 |
| 989 | nmdc:mga05p37_45_c1 | 3300050507 | Bacteria | 81140 |
| 990 | nmdc:mga09592_1055_c1 | 3300050508 | Bacteria | 21846 |
| 991 | nmdc:mga0qj67_701_c1 | 3300050509 | Bacteria | 22836 |
| 992 | nmdc:mga06r32_227_c1 | 3300050510 | Bacteria | 45651 |
| 993 | nmdc:mga08y16_1666_c1 | 3300050511 | Bacteria | 22506 |
| 994 | nmdc:mga08y16_26694_c1 | 3300050511 | Bacteria | 6087 |
| 995 | nmdc:mga0n895_379872_c1 | 3300050512 | Bacteria | 1430 |
| 996 | nmdc:mga0n895_4930_c1 | 3300050512 | Bacteria | 11073 |
| 997 | nmdc:mga0n895_495535_c1 | 3300050512 | Bacteria | 1231 |
| 998 | nmdc:mga0n895_50_c1 | 3300050512 | Bacteria | 71634 |
| 999 | nmdc:mga0n895_684569_c1 | 3300050512 | Bacteria | 1022 |
| 1000 | nmdc:mga0rr50_17122_c1 | 3300050513 | Bacteria | 4829 |
| 1001 | nmdc:mga0rr50_19371_c1 | 3300050513 | Bacteria | 4592 |
| 1002 | nmdc:mga0rr50_253512_c1 | 3300050513 | Bacteria | 1462 |
| 1003 | nmdc:mga0rr50_485637_c1 | 3300050513 | Bacteria | 1049 |
| 1004 | nmdc:mga0rr50_67221_c1 | 3300050513 | Bacteria | 2722 |
| 1005 | nmdc:mga0rr50_77127_c1 | 3300050513 | Bacteria | 2560 |
| 1006 | nmdc:mga08x19_20074_c1 | 3300050514 | Bacteria | 4112 |
| 1007 | nmdc:mga08x19_639141_c1 | 3300050514 | Bacteria | 755 |
| 1008 | nmdc:mga0a205_21352_c1 | 3300050515 | Bacteria | 6125 |
| 1009 | nmdc:mga0a205_2228_c1 | 3300050515 | Bacteria | 17060 |
| 1010 | nmdc:mga0a205_322414_c1 | 3300050515 | Bacteria | 1416 |
| 1011 | nmdc:mga0a205_34065_c1 | 3300050515 | Bacteria | 4886 |
| 1012 | nmdc:mga0a205_4901_c1 | 3300050515 | Bacteria | 12033 |
| 1013 | Ga0495601_0000204 | 3300053077 | Bacteria | 31605 |
| 1014 | Ga0495601_0002295 | 3300053077 | Bacteria | 10791 |
| 1015 | Ga0495601_0002402 | 3300053077 | Bacteria | 10631 |
| 1016 | Ga0495601_0009449 | 3300053077 | Bacteria | 5768 |
| 1017 | Ga0495601_0388326 | 3300053077 | Bacteria | 905 |
| 1018 | Ga0495612_0000384 | 3300053078 | Bacteria | 17659 |
| 1019 | Ga0495612_0011006 | 3300053078 | Bacteria | 3652 |
| 1020 | Ga0495612_0012068 | 3300053078 | Bacteria | 3480 |
| 1021 | Ga0495595_0000577 | 3300053084 | Bacteria | 14028 |
| 1022 | Ga0495595_0000686 | 3300053084 | Bacteria | 12928 |
| 1023 | Ga0495595_0001081 | 3300053084 | Bacteria | 10545 |
| 1024 | Ga0495595_0002024 | 3300053084 | Bacteria | 7872 |
| 1025 | Ga0495595_0012257 | 3300053084 | Bacteria | 3599 |
| 1026 | Ga0495619_0000260 | 3300053085 | Bacteria | 38574 |
| 1027 | Ga0495619_0000655 | 3300053085 | Bacteria | 22730 |
| 1028 | Ga0495619_0017989 | 3300053085 | Bacteria | 4481 |
| 1029 | Ga0495619_0024139 | 3300053085 | Bacteria | 3899 |
| 1030 | Ga0495619_0128221 | 3300053085 | Unclassified | 1742 |
| 1031 | Ga0500650_0164994 | 3300053098 | Bacteria | 1020 |
| 1032 | Ga0500559_0334343 | 3300053136 | Bacteria | 709 |
| 1033 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1034 | Ga0500616_0000046 | 3300053153 | Bacteria | 333409 |
| 1035 | Ga0500616_0223222 | 3300053153 | Bacteria | 820 |
| 1036 | Ga0500627_0320648 | 3300053158 | Bacteria | 673 |
| 1037 | Ga0500596_000518 | 3300053735 | Bacteria | 7283 |
| 1038 | Ga0501084_0053053 | 3300054114 | Bacteria | 3391 |
| 1039 | Ga0501082_0021751 | 3300060353 | Bacteria | 5530 |
| 1040 | Ga0501082_0025906 | 3300060353 | Bacteria | 5054 |
| 1041 | Ga0501082_0601343 | 3300060353 | Bacteria | 962 |
| 1042 | Ga0501082_1077582 | 3300060353 | Bacteria | 702 |
| 1043 | Ga0466962_0373138 | 3300061719 | Bacteria | 712 |
| 1044 | Ga0530510_0435141 | 3300061734 | Bacteria | 991 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031247 | Ga0265340_10108658 | Ga0265340_101086581 | 149 |
| 2 | 3300031249 | Ga0265339_10005247 | Ga0265339_100052476 | 149 |
| 3 | 3300046477 | Ga0495664_0523671 | Ga0495664_0523671_57_563 | 157 |
| 4 | 3300047319 | Ga0495674_1288000 | Ga0495674_1288000_30_536 | 157 |
| 5 | 3300049574 | Ga0501038_0485019 | Ga0501038_0485019_153_686 | 157 |
| 6 | 3300049583 | Ga0501067_0057885 | Ga0501067_0057885_1193_1726 | 157 |
| 7 | 3300049584 | Ga0501068_0065914 | Ga0501068_0065914_752_1285 | 157 |
| 8 | 3300049586 | Ga0501070_0014043 | Ga0501070_0014043_5302_5835 | 157 |
| 9 | 3300049587 | Ga0501071_0174267 | Ga0501071_0174267_782_1315 | 157 |
| 10 | 3300049588 | Ga0501072_0162152 | Ga0501072_0162152_295_828 | 157 |
| 11 | 3300049590 | Ga0501074_0004721 | Ga0501074_0004721_4414_4947 | 157 |
| 12 | 3300049741 | Ga0501079_0224929 | Ga0501079_0224929_407_940 | 157 |
| 13 | 3300049742 | Ga0501080_0013759 | Ga0501080_0013759_15_548 | 157 |
| 14 | 3300049822 | Ga0501035_0323928 | Ga0501035_0323928_98_631 | 157 |
| 15 | 3300049823 | Ga0501044_0157923 | Ga0501044_0157923_1361_1894 | 157 |
| 16 | 3300053136 | Ga0500559_0334343 | Ga0500559_0334343_33_539 | 157 |
| 17 | 3300053735 | Ga0500596_000518 | Ga0500596_000518_6754_7260 | 157 |
| 18 | 3300025915 | Ga0207693_10576547 | Ga0207693_105765472 | 158 |
| 19 | 3300053153 | Ga0500616_0223222 | Ga0500616_0223222_266_769 | 159 |
| 20 | 3300027364 | Ga0209967_1037373 | Ga0209967_10373732 | 160 |
| 21 | 3300049575 | Ga0501039_0029717 | Ga0501039_0029717_244_759 | 162 |
| 22 | 3300049589 | Ga0501073_0395835 | Ga0501073_0395835_446_934 | 162 |
| 23 | 3300061734 | Ga0530510_0435141 | Ga0530510_0435141_31_546 | 162 |
| 24 | 3300006048 | Ga0075363_100102489 | Ga0075363_1001024892 | 163 |
| 25 | 3300006175 | Ga0070712_100354247 | Ga0070712_1003542473 | 163 |
| 26 | 3300006177 | Ga0075362_10026979 | Ga0075362_100269793 | 163 |
| 27 | 3300006852 | Ga0075433_10101236 | Ga0075433_101012363 | 163 |
| 28 | 3300035088 | Ga0373940_0035562 | Ga0373940_0035562_824_1315 | 163 |
| 29 | 3300035171 | Ga0373946_0172606 | Ga0373946_0172606_519_1010 | 163 |
| 30 | 3300046517 | Ga0495630_0157643 | Ga0495630_0157643_15_506 | 163 |
| 31 | 3300048905 | Ga0496102_0450410 | Ga0496102_0450410_702_1193 | 163 |
| 32 | 3300050515 | nmdc:mga0a205_322414_c1 | nmdc:mga0a205_322414_c1_910_1401 | 163 |
| 33 | 3300050515 | nmdc:mga0a205_34065_c1 | nmdc:mga0a205_34065_c1_519_1010 | 163 |
| 34 | 3300053153 | Ga0500616_0000046 | Ga0500616_0000046_88668_89180 | 163 |
| 35 | 3300014968 | Ga0157379_10776966 | Ga0157379_107769662 | 164 |
| 36 | 3300020082 | Ga0206353_12062905 | Ga0206353_120629052 | 165 |
| 37 | 3300041512 | Ga0451853_1133953 | Ga0451853_1133953_1559_2092 | 166 |
| 38 | 3300046692 | Ga0495671_0085443 | Ga0495671_0085443_110_640 | 167 |
| 39 | 3300007076 | Ga0075435_100305843 | Ga0075435_1003058432 | 168 |
| 40 | 3300032126 | Ga0307415_100621291 | Ga0307415_1006212912 | 168 |
| 41 | 3300053158 | Ga0500627_0320648 | Ga0500627_0320648_129_635 | 168 |
| 42 | 3300006028 | Ga0070717_11080886 | Ga0070717_110808861 | 169 |
| 43 | 3300025912 | Ga0207707_10430416 | Ga0207707_104304162 | 169 |
| 44 | 3300046454 | Ga0495592_0470310 | Ga0495592_0470310_35_562 | 169 |
| 45 | 3300046462 | Ga0495651_0283940 | Ga0495651_0283940_544_1071 | 169 |
| 46 | 3300046517 | Ga0495630_0725421 | Ga0495630_0725421_132_659 | 169 |
| 47 | 3300048088 | Ga0495602_0112730 | Ga0495602_0112730_1650_2177 | 169 |
| 48 | 3300050512 | nmdc:mga0n895_495535_c1 | nmdc:mga0n895_495535_c1_410_1033 | 169 |
| 49 | 3300050513 | nmdc:mga0rr50_253512_c1 | nmdc:mga0rr50_253512_c1_711_1334 | 169 |
| 50 | 3300003911 | JGI25405J52794_10010557 | JGI25405J52794_100105572 | 170 |
| 51 | 3300005295 | Ga0065707_10125256 | Ga0065707_101252562 | 170 |
| 52 | 3300005937 | Ga0081455_10037283 | Ga0081455_100372834 | 170 |
| 53 | 3300031344 | Ga0265316_10054466 | Ga0265316_100544663 | 170 |
| 54 | 3300031595 | Ga0265313_10000041 | Ga0265313_1000004158 | 170 |
| 55 | 3300031691 | Ga0316579_10042737 | Ga0316579_100427372 | 170 |
| 56 | 3300032133 | Ga0316583_10003152 | Ga0316583_100031522 | 170 |
| 57 | 3300036647 | Ga0316582_0678080 | Ga0316582_0678080_109_639 | 170 |
| 58 | 3300049571 | Ga0501034_0020882 | Ga0501034_0020882_1410_1946 | 170 |
| 59 | 3300049579 | Ga0501043_0870879 | Ga0501043_0870879_71_601 | 170 |
| 60 | 3300049585 | Ga0501069_0054877 | Ga0501069_0054877_1662_2198 | 170 |
| 61 | 3300049586 | Ga0501070_0059350 | Ga0501070_0059350_437_973 | 170 |
| 62 | 3300049823 | Ga0501044_0068643 | Ga0501044_0068643_1033_1569 | 170 |
| 63 | 3300035083 | Ga0373926_0205655 | Ga0373926_0205655_22_552 | 171 |
| 64 | 3300035113 | Ga0373936_0007526 | Ga0373936_0007526_1601_2131 | 171 |
| 65 | 3300035116 | Ga0373945_0001243 | Ga0373945_0001243_3306_3836 | 171 |
| 66 | 3300035170 | Ga0373943_0003538 | Ga0373943_0003538_2336_2866 | 171 |
| 67 | 3300035695 | Ga0373927_0182286 | Ga0373927_0182286_814_1344 | 171 |
| 68 | 3300035725 | Ga0373947_0004569 | Ga0373947_0004569_51_581 | 171 |
| 69 | 3300037068 | Ga0373925_0010134 | Ga0373925_0010134_2336_2866 | 171 |
| 70 | 3300046455 | Ga0495603_0012962 | Ga0495603_0012962_238_768 | 171 |
| 71 | 3300046459 | Ga0495629_0006281 | Ga0495629_0006281_513_1043 | 171 |
| 72 | 3300046459 | Ga0495629_0024439 | Ga0495629_0024439_3096_3626 | 171 |
| 73 | 3300046461 | Ga0495641_0031793 | Ga0495641_0031793_957_1487 | 171 |
| 74 | 3300046473 | Ga0495582_0001705 | Ga0495582_0001705_2408_2938 | 171 |
| 75 | 3300046473 | Ga0495582_0015446 | Ga0495582_0015446_1984_2514 | 171 |
| 76 | 3300046475 | Ga0495639_0019431 | Ga0495639_0019431_2379_2909 | 171 |
| 77 | 3300046476 | Ga0495662_0009777 | Ga0495662_0009777_1846_2376 | 171 |
| 78 | 3300046492 | Ga0495585_0009128 | Ga0495585_0009128_5274_5804 | 171 |
| 79 | 3300046499 | Ga0495594_0101905 | Ga0495594_0101905_83_613 | 171 |
| 80 | 3300046501 | Ga0495607_0004288 | Ga0495607_0004288_3957_4487 | 171 |
| 81 | 3300046511 | Ga0495608_0110542 | Ga0495608_0110542_1031_1561 | 171 |
| 82 | 3300046514 | Ga0495618_0014982 | Ga0495618_0014982_3374_3904 | 171 |
| 83 | 3300046517 | Ga0495630_0023584 | Ga0495630_0023584_168_698 | 171 |
| 84 | 3300046523 | Ga0495644_0000514 | Ga0495644_0000514_7057_7587 | 171 |
| 85 | 3300046526 | Ga0495666_0001847 | Ga0495666_0001847_5885_6415 | 171 |
| 86 | 3300046529 | Ga0495652_0020653 | Ga0495652_0020653_2124_2654 | 171 |
| 87 | 3300046531 | Ga0495665_0006322 | Ga0495665_0006322_5803_6333 | 171 |
| 88 | 3300046535 | Ga0495586_0060389 | Ga0495586_0060389_22_552 | 171 |
| 89 | 3300046536 | Ga0495587_0027769 | Ga0495587_0027769_2828_3358 | 171 |
| 90 | 3300046537 | Ga0495598_0195351 | Ga0495598_0195351_27_557 | 171 |
| 91 | 3300046538 | Ga0495609_0023913 | Ga0495609_0023913_229_759 | 171 |
| 92 | 3300046543 | Ga0495645_0154375 | Ga0495645_0154375_840_1370 | 171 |
| 93 | 3300046557 | Ga0495622_0093569 | Ga0495622_0093569_480_1010 | 171 |
| 94 | 3300046559 | Ga0495667_0019211 | Ga0495667_0019211_3832_4362 | 171 |
| 95 | 3300046615 | Ga0495656_0019735 | Ga0495656_0019735_1910_2440 | 171 |
| 96 | 3300046663 | Ga0495635_0004379 | Ga0495635_0004379_3375_3905 | 171 |
| 97 | 3300046663 | Ga0495635_0201286 | Ga0495635_0201286_516_1046 | 171 |
| 98 | 3300046664 | Ga0495659_0008156 | Ga0495659_0008156_2767_3297 | 171 |
| 99 | 3300046674 | Ga0495588_0013623 | Ga0495588_0013623_1947_2477 | 171 |
| 100 | 3300046678 | Ga0495599_0003364 | Ga0495599_0003364_11_541 | 171 |
| 101 | 3300046681 | Ga0495647_0008999 | Ga0495647_0008999_631_1161 | 171 |
| 102 | 3300046683 | Ga0495658_0000591 | Ga0495658_0000591_693_1223 | 171 |
| 103 | 3300046689 | Ga0495613_0047264 | Ga0495613_0047264_1289_1819 | 171 |
| 104 | 3300046689 | Ga0495613_0115614 | Ga0495613_0115614_442_972 | 171 |
| 105 | 3300046690 | Ga0495624_0009422 | Ga0495624_0009422_6179_6709 | 171 |
| 106 | 3300046691 | Ga0495670_0008959 | Ga0495670_0008959_2451_2981 | 171 |
| 107 | 3300047315 | Ga0495581_0017156 | Ga0495581_0017156_56_586 | 171 |
| 108 | 3300047315 | Ga0495581_0035361 | Ga0495581_0035361_2002_2532 | 171 |
| 109 | 3300047318 | Ga0495636_0477254 | Ga0495636_0477254_61_591 | 171 |
| 110 | 3300047319 | Ga0495674_0040549 | Ga0495674_0040549_953_1483 | 171 |
| 111 | 3300047321 | Ga0495676_0017949 | Ga0495676_0017949_667_1197 | 171 |
| 112 | 3300047322 | Ga0495680_0008046 | Ga0495680_0008046_57_587 | 171 |
| 113 | 3300047471 | Ga0495684_0006324 | Ga0495684_0006324_2379_2909 | 171 |
| 114 | 3300048089 | Ga0495614_0263582 | Ga0495614_0263582_124_654 | 171 |
| 115 | 3300053077 | Ga0495601_0388326 | Ga0495601_0388326_168_698 | 171 |
| 116 | 3300053084 | Ga0495595_0002024 | Ga0495595_0002024_4165_4695 | 171 |
| 117 | 3300053085 | Ga0495619_0024139 | Ga0495619_0024139_3162_3692 | 171 |
| 118 | 3300053085 | Ga0495619_0128221 | Ga0495619_0128221_699_1229 | 171 |
| 119 | 3300005435 | Ga0070714_100091747 | Ga0070714_1000917472 | 172 |
| 120 | 3300005563 | Ga0068855_100015363 | Ga0068855_1000153633 | 172 |
| 121 | 3300013105 | Ga0157369_10182747 | Ga0157369_101827472 | 172 |
| 122 | 3300025921 | Ga0207652_10425908 | Ga0207652_104259081 | 172 |
| 123 | 3300025929 | Ga0207664_10243891 | Ga0207664_102438912 | 172 |
| 124 | 3300025932 | Ga0207690_10340419 | Ga0207690_103404192 | 172 |
| 125 | 3300025949 | Ga0207667_11133467 | Ga0207667_111334671 | 172 |
| 126 | 3300028573 | Ga0265334_10054444 | Ga0265334_100544442 | 172 |
| 127 | 3300031235 | Ga0265330_10058291 | Ga0265330_100582912 | 172 |
| 128 | 3300031241 | Ga0265325_10231447 | Ga0265325_102314471 | 172 |
| 129 | 3300031249 | Ga0265339_10010020 | Ga0265339_100100205 | 172 |
| 130 | 3300031712 | Ga0265342_10054402 | Ga0265342_100544022 | 172 |
| 131 | 3300035115 | Ga0373941_0118879 | Ga0373941_0118879_60_578 | 172 |
| 132 | 3300035172 | Ga0373955_0248942 | Ga0373955_0248942_320_838 | 172 |
| 133 | 3300046543 | Ga0495645_0674978 | Ga0495645_0674978_76_594 | 172 |
| 134 | 3300049823 | Ga0501044_1119400 | Ga0501044_1119400_83_601 | 172 |
| 135 | 3300005327 | Ga0070658_10321270 | Ga0070658_103212701 | 173 |
| 136 | 3300005530 | Ga0070679_100283271 | Ga0070679_1002832712 | 173 |
| 137 | 3300005539 | Ga0068853_100430251 | Ga0068853_1004302512 | 173 |
| 138 | 3300005563 | Ga0068855_101061464 | Ga0068855_1010614642 | 173 |
| 139 | 3300006175 | Ga0070712_100148881 | Ga0070712_1001488812 | 173 |
| 140 | 3300009093 | Ga0105240_10966071 | Ga0105240_109660712 | 173 |
| 141 | 3300013104 | Ga0157370_10146848 | Ga0157370_101468483 | 173 |
| 142 | 3300025915 | Ga0207693_10099654 | Ga0207693_100996542 | 173 |
| 143 | 3300025917 | Ga0207660_10189395 | Ga0207660_101893952 | 173 |
| 144 | 3300025944 | Ga0207661_11466608 | Ga0207661_114666081 | 173 |
| 145 | 3300025949 | Ga0207667_10407367 | Ga0207667_104073672 | 173 |
| 146 | 3300025981 | Ga0207640_10494373 | Ga0207640_104943732 | 173 |
| 147 | 3300031018 | Ga0265773_1005860 | Ga0265773_10058602 | 173 |
| 148 | 3300031595 | Ga0265313_10106271 | Ga0265313_101062712 | 173 |
| 149 | 3300049568 | Ga0501031_0086545 | Ga0501031_0086545_465_989 | 173 |
| 150 | 3300049568 | Ga0501031_0212867 | Ga0501031_0212867_483_1007 | 173 |
| 151 | 3300049569 | Ga0501032_0012835 | Ga0501032_0012835_1597_2121 | 173 |
| 152 | 3300049569 | Ga0501032_0021838 | Ga0501032_0021838_1299_1823 | 173 |
| 153 | 3300049569 | Ga0501032_0052659 | Ga0501032_0052659_1145_1669 | 173 |
| 154 | 3300049569 | Ga0501032_0100027 | Ga0501032_0100027_1218_1742 | 173 |
| 155 | 3300049570 | Ga0501033_0139839 | Ga0501033_0139839_1033_1557 | 173 |
| 156 | 3300049571 | Ga0501034_0002292 | Ga0501034_0002292_8102_8626 | 173 |
| 157 | 3300049571 | Ga0501034_0024137 | Ga0501034_0024137_4912_5436 | 173 |
| 158 | 3300049571 | Ga0501034_0076586 | Ga0501034_0076586_1170_1694 | 173 |
| 159 | 3300049571 | Ga0501034_0305190 | Ga0501034_0305190_108_632 | 173 |
| 160 | 3300049572 | Ga0501036_0000609 | Ga0501036_0000609_1483_2007 | 173 |
| 161 | 3300049572 | Ga0501036_0054800 | Ga0501036_0054800_766_1290 | 173 |
| 162 | 3300049572 | Ga0501036_0205765 | Ga0501036_0205765_901_1425 | 173 |
| 163 | 3300049572 | Ga0501036_0364435 | Ga0501036_0364435_201_725 | 173 |
| 164 | 3300049573 | Ga0501037_0007571 | Ga0501037_0007571_3688_4212 | 173 |
| 165 | 3300049573 | Ga0501037_0036674 | Ga0501037_0036674_1550_2074 | 173 |
| 166 | 3300049573 | Ga0501037_0517999 | Ga0501037_0517999_197_721 | 173 |
| 167 | 3300049574 | Ga0501038_0016827 | Ga0501038_0016827_1126_1650 | 173 |
| 168 | 3300049574 | Ga0501038_0049627 | Ga0501038_0049627_2786_3310 | 173 |
| 169 | 3300049574 | Ga0501038_0051768 | Ga0501038_0051768_2788_3312 | 173 |
| 170 | 3300049575 | Ga0501039_0038774 | Ga0501039_0038774_1513_2037 | 173 |
| 171 | 3300049575 | Ga0501039_0163405 | Ga0501039_0163405_230_754 | 173 |
| 172 | 3300049576 | Ga0501040_0089076 | Ga0501040_0089076_1326_1850 | 173 |
| 173 | 3300049576 | Ga0501040_0321027 | Ga0501040_0321027_396_920 | 173 |
| 174 | 3300049578 | Ga0501042_0495404 | Ga0501042_0495404_55_579 | 173 |
| 175 | 3300049579 | Ga0501043_0002387 | Ga0501043_0002387_13628_14152 | 173 |
| 176 | 3300049579 | Ga0501043_0016255 | Ga0501043_0016255_1623_2147 | 173 |
| 177 | 3300049579 | Ga0501043_0062852 | Ga0501043_0062852_468_992 | 173 |
| 178 | 3300049579 | Ga0501043_0275321 | Ga0501043_0275321_188_712 | 173 |
| 179 | 3300049580 | Ga0501046_0026268 | Ga0501046_0026268_379_903 | 173 |
| 180 | 3300049580 | Ga0501046_0371783 | Ga0501046_0371783_435_959 | 173 |
| 181 | 3300049581 | Ga0501047_0000228 | Ga0501047_0000228_14095_14619 | 173 |
| 182 | 3300049581 | Ga0501047_0027357 | Ga0501047_0027357_1483_2007 | 173 |
| 183 | 3300049581 | Ga0501047_1093626 | Ga0501047_1093626_39_563 | 173 |
| 184 | 3300049582 | Ga0501048_0000467 | Ga0501048_0000467_14095_14619 | 173 |
| 185 | 3300049582 | Ga0501048_0123613 | Ga0501048_0123613_229_753 | 173 |
| 186 | 3300049583 | Ga0501067_0167596 | Ga0501067_0167596_547_1071 | 173 |
| 187 | 3300049583 | Ga0501067_0283274 | Ga0501067_0283274_97_621 | 173 |
| 188 | 3300049584 | Ga0501068_0048365 | Ga0501068_0048365_230_754 | 173 |
| 189 | 3300049584 | Ga0501068_0051063 | Ga0501068_0051063_1690_2214 | 173 |
| 190 | 3300049585 | Ga0501069_0074349 | Ga0501069_0074349_468_992 | 173 |
| 191 | 3300049586 | Ga0501070_0008780 | Ga0501070_0008780_1707_2231 | 173 |
| 192 | 3300049586 | Ga0501070_0029296 | Ga0501070_0029296_3625_4149 | 173 |
| 193 | 3300049586 | Ga0501070_0038930 | Ga0501070_0038930_1768_2292 | 173 |
| 194 | 3300049586 | Ga0501070_0046289 | Ga0501070_0046289_1932_2456 | 173 |
| 195 | 3300049586 | Ga0501070_0218106 | Ga0501070_0218106_263_796 | 173 |
| 196 | 3300049589 | Ga0501073_0005395 | Ga0501073_0005395_8574_9098 | 173 |
| 197 | 3300049589 | Ga0501073_0016516 | Ga0501073_0016516_1287_1811 | 173 |
| 198 | 3300049589 | Ga0501073_0059193 | Ga0501073_0059193_998_1522 | 173 |
| 199 | 3300049590 | Ga0501074_0003305 | Ga0501074_0003305_2104_2628 | 173 |
| 200 | 3300049590 | Ga0501074_0134940 | Ga0501074_0134940_247_771 | 173 |
| 201 | 3300049741 | Ga0501079_0289625 | Ga0501079_0289625_594_1118 | 173 |
| 202 | 3300049742 | Ga0501080_0000112 | Ga0501080_0000112_42655_43179 | 173 |
| 203 | 3300049742 | Ga0501080_0046008 | Ga0501080_0046008_181_705 | 173 |
| 204 | 3300049742 | Ga0501080_0053206 | Ga0501080_0053206_2461_2985 | 173 |
| 205 | 3300049744 | Ga0501083_0001098 | Ga0501083_0001098_3567_4091 | 173 |
| 206 | 3300049744 | Ga0501083_0071101 | Ga0501083_0071101_865_1398 | 173 |
| 207 | 3300049744 | Ga0501083_0078218 | Ga0501083_0078218_516_1040 | 173 |
| 208 | 3300049822 | Ga0501035_0012556 | Ga0501035_0012556_3757_4281 | 173 |
| 209 | 3300049822 | Ga0501035_0125846 | Ga0501035_0125846_581_1105 | 173 |
| 210 | 3300049822 | Ga0501035_0214336 | Ga0501035_0214336_1014_1538 | 173 |
| 211 | 3300049823 | Ga0501044_0017602 | Ga0501044_0017602_2277_2801 | 173 |
| 212 | 3300049823 | Ga0501044_0059118 | Ga0501044_0059118_1208_1732 | 173 |
| 213 | 3300049823 | Ga0501044_0173219 | Ga0501044_0173219_1234_1758 | 173 |
| 214 | 3300050491 | nmdc:mga00v17_258615_c1 | nmdc:mga00v17_258615_c1_436_960 | 173 |
| 215 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_416798_417319 | 173 |
| 216 | 3300054114 | Ga0501084_0053053 | Ga0501084_0053053_2686_3210 | 173 |
| 217 | 3300060353 | Ga0501082_0021751 | Ga0501082_0021751_2060_2584 | 173 |
| 218 | 3300060353 | Ga0501082_0025906 | Ga0501082_0025906_1170_1694 | 173 |
| 219 | 3300060353 | Ga0501082_1077582 | Ga0501082_1077582_166_690 | 173 |
| 220 | 3300005327 | Ga0070658_10030706 | Ga0070658_100307061 | 174 |
| 221 | 3300005327 | Ga0070658_10713122 | Ga0070658_107131222 | 174 |
| 222 | 3300005336 | Ga0070680_100005313 | Ga0070680_1000053136 | 174 |
| 223 | 3300005336 | Ga0070680_100433128 | Ga0070680_1004331282 | 174 |
| 224 | 3300005339 | Ga0070660_100038319 | Ga0070660_1000383192 | 174 |
| 225 | 3300005436 | Ga0070713_100148235 | Ga0070713_1001482351 | 174 |
| 226 | 3300005458 | Ga0070681_10016363 | Ga0070681_100163636 | 174 |
| 227 | 3300005458 | Ga0070681_10090121 | Ga0070681_100901212 | 174 |
| 228 | 3300005530 | Ga0070679_100037005 | Ga0070679_1000370052 | 174 |
| 229 | 3300005530 | Ga0070679_100071754 | Ga0070679_1000717543 | 174 |
| 230 | 3300005563 | Ga0068855_100339131 | Ga0068855_1003391312 | 174 |
| 231 | 3300005578 | Ga0068854_100472263 | Ga0068854_1004722632 | 174 |
| 232 | 3300009093 | Ga0105240_10020100 | Ga0105240_100201007 | 174 |
| 233 | 3300013102 | Ga0157371_10151573 | Ga0157371_101515732 | 174 |
| 234 | 3300013307 | Ga0157372_10416720 | Ga0157372_104167202 | 174 |
| 235 | 3300013307 | Ga0157372_10807596 | Ga0157372_108075962 | 174 |
| 236 | 3300020070 | Ga0206356_10130135 | Ga0206356_101301352 | 174 |
| 237 | 3300020081 | Ga0206354_10382701 | Ga0206354_103827012 | 174 |
| 238 | 3300025909 | Ga0207705_10025609 | Ga0207705_100256093 | 174 |
| 239 | 3300025909 | Ga0207705_10216574 | Ga0207705_102165742 | 174 |
| 240 | 3300025912 | Ga0207707_10217291 | Ga0207707_102172911 | 174 |
| 241 | 3300025913 | Ga0207695_10092228 | Ga0207695_100922282 | 174 |
| 242 | 3300025915 | Ga0207693_10117664 | Ga0207693_101176642 | 174 |
| 243 | 3300025917 | Ga0207660_10005747 | Ga0207660_100057474 | 174 |
| 244 | 3300025917 | Ga0207660_10110494 | Ga0207660_101104942 | 174 |
| 245 | 3300025921 | Ga0207652_10016915 | Ga0207652_100169153 | 174 |
| 246 | 3300025928 | Ga0207700_10207267 | Ga0207700_102072672 | 174 |
| 247 | 3300025944 | Ga0207661_10492543 | Ga0207661_104925432 | 174 |
| 248 | 3300025949 | Ga0207667_10056714 | Ga0207667_100567143 | 174 |
| 249 | 3300025949 | Ga0207667_10120758 | Ga0207667_101207582 | 174 |
| 250 | 3300026041 | Ga0207639_10221184 | Ga0207639_102211842 | 174 |
| 251 | 3300026078 | Ga0207702_11433417 | Ga0207702_114334171 | 174 |
| 252 | 3300026142 | Ga0207698_10091738 | Ga0207698_100917383 | 174 |
| 253 | 3300030763 | Ga0265763_1002495 | Ga0265763_10024952 | 174 |
| 254 | 3300031241 | Ga0265325_10000105 | Ga0265325_1000010555 | 174 |
| 255 | 3300031241 | Ga0265325_10259934 | Ga0265325_102599342 | 174 |
| 256 | 3300031249 | Ga0265339_10106798 | Ga0265339_101067982 | 174 |
| 257 | 3300031595 | Ga0265313_10035872 | Ga0265313_100358722 | 174 |
| 258 | 3300031711 | Ga0265314_10000279 | Ga0265314_1000027948 | 174 |
| 259 | 3300031712 | Ga0265342_10001077 | Ga0265342_1000107726 | 174 |
| 260 | 3300031824 | Ga0307413_10143610 | Ga0307413_101436102 | 174 |
| 261 | 3300032005 | Ga0307411_10191027 | Ga0307411_101910272 | 174 |
| 262 | 3300035118 | Ga0373954_0015537 | Ga0373954_0015537_2437_2961 | 174 |
| 263 | 3300035119 | Ga0373956_0018425 | Ga0373956_0018425_1218_1742 | 174 |
| 264 | 3300035120 | Ga0373957_0013805 | Ga0373957_0013805_1672_2196 | 174 |
| 265 | 3300035410 | Ga0373924_0026473 | Ga0373924_0026473_1629_2153 | 174 |
| 266 | 3300035692 | Ga0373935_0692866 | Ga0373935_0692866_184_708 | 174 |
| 267 | 3300035724 | Ga0373933_0016462 | Ga0373933_0016462_73_597 | 174 |
| 268 | 3300036401 | Ga0373937_0016585 | Ga0373937_0016585_220_744 | 174 |
| 269 | 3300037312 | Ga0395899_0001670 | Ga0395899_0001670_838_1374 | 174 |
| 270 | 3300037418 | Ga0395900_0003491 | Ga0395900_0003491_2671_3207 | 174 |
| 271 | 3300037418 | Ga0395900_0030502 | Ga0395900_0030502_2398_2934 | 174 |
| 272 | 3300037418 | Ga0395900_0125555 | Ga0395900_0125555_358_894 | 174 |
| 273 | 3300037466 | Ga0395898_0002609 | Ga0395898_0002609_4221_4757 | 174 |
| 274 | 3300037466 | Ga0395898_0014973 | Ga0395898_0014973_1736_2272 | 174 |
| 275 | 3300037466 | Ga0395898_0322637 | Ga0395898_0322637_697_1233 | 174 |
| 276 | 3300038443 | Ga0395901_0005021 | Ga0395901_0005021_9036_9572 | 174 |
| 277 | 3300038443 | Ga0395901_0205014 | Ga0395901_0205014_531_1067 | 174 |
| 278 | 3300042005 | Ga0439448_0090643 | Ga0439448_0090643_227_751 | 174 |
| 279 | 3300044684 | Ga0466966_0112578 | Ga0466966_0112578_1082_1609 | 174 |
| 280 | 3300044693 | Ga0466961_0088464 | Ga0466961_0088464_1263_1790 | 174 |
| 281 | 3300044694 | Ga0466963_0230872 | Ga0466963_0230872_369_893 | 174 |
| 282 | 3300044842 | Ga0466957_0272693 | Ga0466957_0272693_560_1084 | 174 |
| 283 | 3300045836 | Ga0466958_0388769 | Ga0466958_0388769_313_837 | 174 |
| 284 | 3300045836 | Ga0466958_0411635 | Ga0466958_0411635_90_620 | 174 |
| 285 | 3300045976 | Ga0466967_0005780 | Ga0466967_0005780_1149_1679 | 174 |
| 286 | 3300045976 | Ga0466967_0539386 | Ga0466967_0539386_522_1052 | 174 |
| 287 | 3300046511 | Ga0495608_0151432 | Ga0495608_0151432_702_1226 | 174 |
| 288 | 3300046559 | Ga0495667_0021834 | Ga0495667_0021834_3481_4005 | 174 |
| 289 | 3300046663 | Ga0495635_0031122 | Ga0495635_0031122_3009_3533 | 174 |
| 290 | 3300046675 | Ga0495657_0249728 | Ga0495657_0249728_243_767 | 174 |
| 291 | 3300047322 | Ga0495680_0075306 | Ga0495680_0075306_1199_1723 | 174 |
| 292 | 3300047444 | Ga0495675_0177155 | Ga0495675_0177155_62_586 | 174 |
| 293 | 3300049581 | Ga0501047_0673064 | Ga0501047_0673064_92_616 | 174 |
| 294 | 3300049590 | Ga0501074_0329981 | Ga0501074_0329981_461_985 | 174 |
| 295 | 3300049823 | Ga0501044_0221775 | Ga0501044_0221775_730_1254 | 174 |
| 296 | 3300053077 | Ga0495601_0009449 | Ga0495601_0009449_3553_4077 | 174 |
| 297 | 3300053084 | Ga0495595_0012257 | Ga0495595_0012257_77_601 | 174 |
| 298 | 3300061719 | Ga0466962_0373138 | Ga0466962_0373138_123_650 | 174 |
| 299 | 3300005435 | Ga0070714_100135536 | Ga0070714_1001355363 | 175 |
| 300 | 3300005435 | Ga0070714_100329391 | Ga0070714_1003293912 | 175 |
| 301 | 3300005436 | Ga0070713_100206637 | Ga0070713_1002066372 | 175 |
| 302 | 3300005439 | Ga0070711_100016051 | Ga0070711_1000160514 | 175 |
| 303 | 3300006028 | Ga0070717_11043714 | Ga0070717_110437142 | 175 |
| 304 | 3300021384 | Ga0213876_10236414 | Ga0213876_102364141 | 175 |
| 305 | 3300025916 | Ga0207663_10004450 | Ga0207663_100044502 | 175 |
| 306 | 3300025928 | Ga0207700_10108029 | Ga0207700_101080292 | 175 |
| 307 | 3300025929 | Ga0207664_10135349 | Ga0207664_101353492 | 175 |
| 308 | 3300031241 | Ga0265325_10007951 | Ga0265325_100079514 | 175 |
| 309 | 3300031595 | Ga0265313_10041344 | Ga0265313_100413443 | 175 |
| 310 | 3300031711 | Ga0265314_10017694 | Ga0265314_100176946 | 175 |
| 311 | 3300035692 | Ga0373935_0107931 | Ga0373935_0107931_58_585 | 175 |
| 312 | 3300037068 | Ga0373925_0042928 | Ga0373925_0042928_2601_3227 | 175 |
| 313 | 3300039437 | Ga0436365_1587891 | Ga0436365_1587891_135_704 | 175 |
| 314 | 3300041496 | Ga0451839_1211329 | Ga0451839_1211329_56_589 | 175 |
| 315 | 3300049571 | Ga0501034_1229354 | Ga0501034_1229354_75_602 | 175 |
| 316 | 3300049586 | Ga0501070_0196672 | Ga0501070_0196672_242_769 | 175 |
| 317 | 2209111006 | 2214544913 | 2213593223 | 176 |
| 318 | 3300000041 | ARcpr5oldR_c000030 | ARcpr5oldR_0000306 | 176 |
| 319 | 3300000042 | ARSoilYngRDRAFT_c00022 | ARSoilYngRDRAFT_0002224 | 176 |
| 320 | 3300000043 | ARcpr5yngRDRAFT_c000011 | ARcpr5yngRDRAFT_00001139 | 176 |
| 321 | 3300000044 | ARSoilOldRDRAFT_c000040 | ARSoilOldRDRAFT_00004030 | 176 |
| 322 | 3300000045 | ARCol0oldRDRAFT_c01878 | ARCol0oldRDRAFT_018782 | 176 |
| 323 | 3300000652 | ARCol0yngRDRAFT_1000028 | ARCol0yngRDRAFT_10000286 | 176 |
| 324 | 3300001430 | JGI24032J14994_100177 | JGI24032J14994_1001772 | 176 |
| 325 | 3300001976 | JGI24752J21851_1011523 | JGI24752J21851_10115232 | 176 |
| 326 | 3300001978 | JGI24747J21853_1001659 | JGI24747J21853_10016592 | 176 |
| 327 | 3300001989 | JGI24739J22299_10000164 | JGI24739J22299_1000016410 | 176 |
| 328 | 3300001990 | JGI24737J22298_10002054 | JGI24737J22298_100020546 | 176 |
| 329 | 3300001990 | JGI24737J22298_10004205 | JGI24737J22298_100042054 | 176 |
| 330 | 3300002070 | JGI24750J21931_1000178 | JGI24750J21931_10001788 | 176 |
| 331 | 3300002073 | JGI24745J21846_1000640 | JGI24745J21846_10006404 | 176 |
| 332 | 3300002074 | JGI24748J21848_1000266 | JGI24748J21848_10002668 | 176 |
| 333 | 3300002075 | JGI24738J21930_10000112 | JGI24738J21930_100001126 | 176 |
| 334 | 3300002076 | JGI24749J21850_1002285 | JGI24749J21850_10022853 | 176 |
| 335 | 3300002077 | JGI24744J21845_10004212 | JGI24744J21845_100042122 | 176 |
| 336 | 3300002126 | JGI24035J26624_1000424 | JGI24035J26624_10004243 | 176 |
| 337 | 3300002155 | JGI24033J26618_1001840 | JGI24033J26618_10018403 | 176 |
| 338 | 3300002239 | JGI24034J26672_10002682 | JGI24034J26672_100026822 | 176 |
| 339 | 3300002244 | JGI24742J22300_10000334 | JGI24742J22300_100003348 | 176 |
| 340 | 3300002459 | JGI24751J29686_10004003 | JGI24751J29686_100040031 | 176 |
| 341 | 3300003659 | JGI25404J52841_10018490 | JGI25404J52841_100184901 | 176 |
| 342 | 3300003911 | JGI25405J52794_10008628 | JGI25405J52794_100086282 | 176 |
| 343 | 3300005276 | Ga0065717_1000386 | Ga0065717_10003863 | 176 |
| 344 | 3300005277 | Ga0065716_1001616 | Ga0065716_10016163 | 176 |
| 345 | 3300005290 | Ga0065712_10070488 | Ga0065712_100704886 | 176 |
| 346 | 3300005293 | Ga0065715_10001682 | Ga0065715_100016829 | 176 |
| 347 | 3300005293 | Ga0065715_10018746 | Ga0065715_100187462 | 176 |
| 348 | 3300005328 | Ga0070676_10003775 | Ga0070676_100037752 | 176 |
| 349 | 3300005328 | Ga0070676_10085140 | Ga0070676_100851402 | 176 |
| 350 | 3300005328 | Ga0070676_10127179 | Ga0070676_101271792 | 176 |
| 351 | 3300005329 | Ga0070683_100000376 | Ga0070683_10000037618 | 176 |
| 352 | 3300005329 | Ga0070683_100064147 | Ga0070683_1000641472 | 176 |
| 353 | 3300005330 | Ga0070690_100002745 | Ga0070690_1000027458 | 176 |
| 354 | 3300005330 | Ga0070690_100006745 | Ga0070690_1000067453 | 176 |
| 355 | 3300005330 | Ga0070690_100008317 | Ga0070690_1000083175 | 176 |
| 356 | 3300005331 | Ga0070670_100004417 | Ga0070670_10000441711 | 176 |
| 357 | 3300005333 | Ga0070677_10000049 | Ga0070677_100000498 | 176 |
| 358 | 3300005334 | Ga0068869_100000523 | Ga0068869_1000005237 | 176 |
| 359 | 3300005334 | Ga0068869_100451400 | Ga0068869_1004514001 | 176 |
| 360 | 3300005335 | Ga0070666_10001839 | Ga0070666_100018392 | 176 |
| 361 | 3300005335 | Ga0070666_10002781 | Ga0070666_1000278110 | 176 |
| 362 | 3300005336 | Ga0070680_100016319 | Ga0070680_1000163198 | 176 |
| 363 | 3300005336 | Ga0070680_100045410 | Ga0070680_1000454104 | 176 |
| 364 | 3300005336 | Ga0070680_100123658 | Ga0070680_1001236582 | 176 |
| 365 | 3300005337 | Ga0070682_100000141 | Ga0070682_10000014112 | 176 |
| 366 | 3300005337 | Ga0070682_100010927 | Ga0070682_1000109275 | 176 |
| 367 | 3300005337 | Ga0070682_100165525 | Ga0070682_1001655252 | 176 |
| 368 | 3300005337 | Ga0070682_100168686 | Ga0070682_1001686862 | 176 |
| 369 | 3300005338 | Ga0068868_100009105 | Ga0068868_1000091053 | 176 |
| 370 | 3300005339 | Ga0070660_100001073 | Ga0070660_10000107319 | 176 |
| 371 | 3300005339 | Ga0070660_100130758 | Ga0070660_1001307583 | 176 |
| 372 | 3300005340 | Ga0070689_100028024 | Ga0070689_1000280244 | 176 |
| 373 | 3300005340 | Ga0070689_100100586 | Ga0070689_1001005862 | 176 |
| 374 | 3300005340 | Ga0070689_100236418 | Ga0070689_1002364182 | 176 |
| 375 | 3300005341 | Ga0070691_10004687 | Ga0070691_100046876 | 176 |
| 376 | 3300005341 | Ga0070691_10020023 | Ga0070691_100200232 | 176 |
| 377 | 3300005343 | Ga0070687_100000212 | Ga0070687_10000021220 | 176 |
| 378 | 3300005344 | Ga0070661_100000242 | Ga0070661_10000024239 | 176 |
| 379 | 3300005344 | Ga0070661_100115710 | Ga0070661_1001157102 | 176 |
| 380 | 3300005345 | Ga0070692_10010557 | Ga0070692_100105573 | 176 |
| 381 | 3300005347 | Ga0070668_100003395 | Ga0070668_1000033958 | 176 |
| 382 | 3300005347 | Ga0070668_100414921 | Ga0070668_1004149211 | 176 |
| 383 | 3300005353 | Ga0070669_100006805 | Ga0070669_1000068053 | 176 |
| 384 | 3300005353 | Ga0070669_100147979 | Ga0070669_1001479793 | 176 |
| 385 | 3300005354 | Ga0070675_100000165 | Ga0070675_10000016528 | 176 |
| 386 | 3300005354 | Ga0070675_100011029 | Ga0070675_1000110294 | 176 |
| 387 | 3300005355 | Ga0070671_100001907 | Ga0070671_10000190711 | 176 |
| 388 | 3300005355 | Ga0070671_100165578 | Ga0070671_1001655781 | 176 |
| 389 | 3300005356 | Ga0070674_100000450 | Ga0070674_1000004507 | 176 |
| 390 | 3300005364 | Ga0070673_100001190 | Ga0070673_1000011904 | 176 |
| 391 | 3300005364 | Ga0070673_100047352 | Ga0070673_1000473522 | 176 |
| 392 | 3300005365 | Ga0070688_100004815 | Ga0070688_1000048155 | 176 |
| 393 | 3300005365 | Ga0070688_100016577 | Ga0070688_1000165773 | 176 |
| 394 | 3300005365 | Ga0070688_100035808 | Ga0070688_1000358082 | 176 |
| 395 | 3300005366 | Ga0070659_100000988 | Ga0070659_10000098818 | 176 |
| 396 | 3300005366 | Ga0070659_100031422 | Ga0070659_1000314224 | 176 |
| 397 | 3300005366 | Ga0070659_100070846 | Ga0070659_1000708462 | 176 |
| 398 | 3300005367 | Ga0070667_100019884 | Ga0070667_1000198843 | 176 |
| 399 | 3300005367 | Ga0070667_100128897 | Ga0070667_1001288972 | 176 |
| 400 | 3300005367 | Ga0070667_100448787 | Ga0070667_1004487872 | 176 |
| 401 | 3300005406 | Ga0070703_10001274 | Ga0070703_100012746 | 176 |
| 402 | 3300005434 | Ga0070709_10088128 | Ga0070709_100881282 | 176 |
| 403 | 3300005434 | Ga0070709_10092920 | Ga0070709_100929203 | 176 |
| 404 | 3300005434 | Ga0070709_10150580 | Ga0070709_101505803 | 176 |
| 405 | 3300005435 | Ga0070714_100096255 | Ga0070714_1000962552 | 176 |
| 406 | 3300005435 | Ga0070714_100168697 | Ga0070714_1001686973 | 176 |
| 407 | 3300005435 | Ga0070714_100339459 | Ga0070714_1003394592 | 176 |
| 408 | 3300005436 | Ga0070713_100092317 | Ga0070713_1000923172 | 176 |
| 409 | 3300005437 | Ga0070710_10004737 | Ga0070710_100047373 | 176 |
| 410 | 3300005437 | Ga0070710_10108572 | Ga0070710_101085722 | 176 |
| 411 | 3300005438 | Ga0070701_10006218 | Ga0070701_100062183 | 176 |
| 412 | 3300005438 | Ga0070701_10292204 | Ga0070701_102922042 | 176 |
| 413 | 3300005438 | Ga0070701_10603384 | Ga0070701_106033841 | 176 |
| 414 | 3300005440 | Ga0070705_100003041 | Ga0070705_1000030418 | 176 |
| 415 | 3300005440 | Ga0070705_100015515 | Ga0070705_1000155153 | 176 |
| 416 | 3300005440 | Ga0070705_100209827 | Ga0070705_1002098273 | 176 |
| 417 | 3300005441 | Ga0070700_100000364 | Ga0070700_10000036420 | 176 |
| 418 | 3300005441 | Ga0070700_100012444 | Ga0070700_1000124442 | 176 |
| 419 | 3300005444 | Ga0070694_100001077 | Ga0070694_1000010777 | 176 |
| 420 | 3300005445 | Ga0070708_100259032 | Ga0070708_1002590322 | 176 |
| 421 | 3300005455 | Ga0070663_100000417 | Ga0070663_1000004177 | 176 |
| 422 | 3300005455 | Ga0070663_100015967 | Ga0070663_1000159674 | 176 |
| 423 | 3300005456 | Ga0070678_100001012 | Ga0070678_10000101215 | 176 |
| 424 | 3300005456 | Ga0070678_100162149 | Ga0070678_1001621492 | 176 |
| 425 | 3300005457 | Ga0070662_100000796 | Ga0070662_10000079616 | 176 |
| 426 | 3300005457 | Ga0070662_100838111 | Ga0070662_1008381111 | 176 |
| 427 | 3300005458 | Ga0070681_10002475 | Ga0070681_1000247515 | 176 |
| 428 | 3300005458 | Ga0070681_10037631 | Ga0070681_100376313 | 176 |
| 429 | 3300005458 | Ga0070681_10049230 | Ga0070681_100492304 | 176 |
| 430 | 3300005458 | Ga0070681_10488888 | Ga0070681_104888881 | 176 |
| 431 | 3300005458 | Ga0070681_10893010 | Ga0070681_108930101 | 176 |
| 432 | 3300005459 | Ga0068867_100006779 | Ga0068867_1000067793 | 176 |
| 433 | 3300005466 | Ga0070685_10000547 | Ga0070685_1000054722 | 176 |
| 434 | 3300005466 | Ga0070685_10060757 | Ga0070685_100607572 | 176 |
| 435 | 3300005467 | Ga0070706_100195631 | Ga0070706_1001956314 | 176 |
| 436 | 3300005530 | Ga0070679_100002268 | Ga0070679_1000022688 | 176 |
| 437 | 3300005535 | Ga0070684_100000755 | Ga0070684_1000007557 | 176 |
| 438 | 3300005535 | Ga0070684_100052457 | Ga0070684_1000524571 | 176 |
| 439 | 3300005535 | Ga0070684_100079617 | Ga0070684_1000796172 | 176 |
| 440 | 3300005536 | Ga0070697_100273711 | Ga0070697_1002737112 | 176 |
| 441 | 3300005539 | Ga0068853_100000483 | Ga0068853_1000004833 | 176 |
| 442 | 3300005539 | Ga0068853_100240073 | Ga0068853_1002400732 | 176 |
| 443 | 3300005539 | Ga0068853_100316453 | Ga0068853_1003164531 | 176 |
| 444 | 3300005543 | Ga0070672_100000527 | Ga0070672_1000005277 | 176 |
| 445 | 3300005543 | Ga0070672_100598142 | Ga0070672_1005981421 | 176 |
| 446 | 3300005544 | Ga0070686_100004541 | Ga0070686_1000045416 | 176 |
| 447 | 3300005544 | Ga0070686_100028407 | Ga0070686_1000284072 | 176 |
| 448 | 3300005544 | Ga0070686_100216175 | Ga0070686_1002161751 | 176 |
| 449 | 3300005545 | Ga0070695_100007154 | Ga0070695_1000071548 | 176 |
| 450 | 3300005545 | Ga0070695_100016829 | Ga0070695_1000168293 | 176 |
| 451 | 3300005546 | Ga0070696_100004211 | Ga0070696_1000042113 | 176 |
| 452 | 3300005546 | Ga0070696_100040575 | Ga0070696_1000405753 | 176 |
| 453 | 3300005546 | Ga0070696_100126980 | Ga0070696_1001269802 | 176 |
| 454 | 3300005546 | Ga0070696_100711268 | Ga0070696_1007112681 | 176 |
| 455 | 3300005547 | Ga0070693_100000199 | Ga0070693_10000019920 | 176 |
| 456 | 3300005547 | Ga0070693_100042452 | Ga0070693_1000424522 | 176 |
| 457 | 3300005547 | Ga0070693_100067261 | Ga0070693_1000672612 | 176 |
| 458 | 3300005547 | Ga0070693_100152582 | Ga0070693_1001525822 | 176 |
| 459 | 3300005547 | Ga0070693_100157117 | Ga0070693_1001571172 | 176 |
| 460 | 3300005548 | Ga0070665_100123527 | Ga0070665_1001235272 | 176 |
| 461 | 3300005548 | Ga0070665_100409391 | Ga0070665_1004093912 | 176 |
| 462 | 3300005549 | Ga0070704_100000987 | Ga0070704_10000098711 | 176 |
| 463 | 3300005549 | Ga0070704_100128703 | Ga0070704_1001287033 | 176 |
| 464 | 3300005549 | Ga0070704_100844621 | Ga0070704_1008446211 | 176 |
| 465 | 3300005563 | Ga0068855_100004444 | Ga0068855_10000444416 | 176 |
| 466 | 3300005564 | Ga0070664_100000895 | Ga0070664_10000089518 | 176 |
| 467 | 3300005577 | Ga0068857_100001816 | Ga0068857_1000018163 | 176 |
| 468 | 3300005577 | Ga0068857_100084708 | Ga0068857_1000847082 | 176 |
| 469 | 3300005577 | Ga0068857_100528032 | Ga0068857_1005280323 | 176 |
| 470 | 3300005578 | Ga0068854_100001812 | Ga0068854_1000018126 | 176 |
| 471 | 3300005578 | Ga0068854_100199360 | Ga0068854_1001993603 | 176 |
| 472 | 3300005614 | Ga0068856_100002507 | Ga0068856_1000025075 | 176 |
| 473 | 3300005614 | Ga0068856_100140935 | Ga0068856_1001409353 | 176 |
| 474 | 3300005614 | Ga0068856_100250036 | Ga0068856_1002500363 | 176 |
| 475 | 3300005614 | Ga0068856_100392362 | Ga0068856_1003923622 | 176 |
| 476 | 3300005615 | Ga0070702_100005184 | Ga0070702_1000051843 | 176 |
| 477 | 3300005615 | Ga0070702_100682654 | Ga0070702_1006826541 | 176 |
| 478 | 3300005616 | Ga0068852_100003253 | Ga0068852_1000032537 | 176 |
| 479 | 3300005616 | Ga0068852_100137119 | Ga0068852_1001371192 | 176 |
| 480 | 3300005617 | Ga0068859_100001353 | Ga0068859_1000013538 | 176 |
| 481 | 3300005617 | Ga0068859_100072433 | Ga0068859_1000724333 | 176 |
| 482 | 3300005617 | Ga0068859_100221537 | Ga0068859_1002215372 | 176 |
| 483 | 3300005618 | Ga0068864_100000227 | Ga0068864_10000022747 | 176 |
| 484 | 3300005618 | Ga0068864_100214765 | Ga0068864_1002147652 | 176 |
| 485 | 3300005718 | Ga0068866_10003902 | Ga0068866_100039021 | 176 |
| 486 | 3300005718 | Ga0068866_10115621 | Ga0068866_101156212 | 176 |
| 487 | 3300005718 | Ga0068866_10194597 | Ga0068866_101945972 | 176 |
| 488 | 3300005719 | Ga0068861_100003517 | Ga0068861_1000035178 | 176 |
| 489 | 3300005834 | Ga0068851_10037270 | Ga0068851_100372702 | 176 |
| 490 | 3300005834 | Ga0068851_10350412 | Ga0068851_103504122 | 176 |
| 491 | 3300005840 | Ga0068870_10000062 | Ga0068870_1000006240 | 176 |
| 492 | 3300005841 | Ga0068863_100000495 | Ga0068863_10000049539 | 176 |
| 493 | 3300005842 | Ga0068858_100000783 | Ga0068858_10000078336 | 176 |
| 494 | 3300005842 | Ga0068858_100112690 | Ga0068858_1001126902 | 176 |
| 495 | 3300005842 | Ga0068858_100453708 | Ga0068858_1004537083 | 176 |
| 496 | 3300005843 | Ga0068860_100022350 | Ga0068860_1000223505 | 176 |
| 497 | 3300005843 | Ga0068860_100240532 | Ga0068860_1002405322 | 176 |
| 498 | 3300005844 | Ga0068862_100003647 | Ga0068862_1000036479 | 176 |
| 499 | 3300005844 | Ga0068862_100235513 | Ga0068862_1002355133 | 176 |
| 500 | 3300005937 | Ga0081455_10000204 | Ga0081455_1000020475 | 176 |
| 501 | 3300005983 | Ga0081540_1012611 | Ga0081540_10126113 | 176 |
| 502 | 3300006028 | Ga0070717_10011080 | Ga0070717_100110803 | 176 |
| 503 | 3300006058 | Ga0075432_10000464 | Ga0075432_1000046414 | 176 |
| 504 | 3300006163 | Ga0070715_10004439 | Ga0070715_100044392 | 176 |
| 505 | 3300006173 | Ga0070716_100001496 | Ga0070716_1000014966 | 176 |
| 506 | 3300006173 | Ga0070716_100195611 | Ga0070716_1001956111 | 176 |
| 507 | 3300006175 | Ga0070712_100091539 | Ga0070712_1000915393 | 176 |
| 508 | 3300006175 | Ga0070712_100100728 | Ga0070712_1001007282 | 176 |
| 509 | 3300006178 | Ga0075367_10584065 | Ga0075367_105840651 | 176 |
| 510 | 3300006237 | Ga0097621_100000010 | Ga0097621_10000001042 | 176 |
| 511 | 3300006237 | Ga0097621_100023529 | Ga0097621_1000235293 | 176 |
| 512 | 3300006353 | Ga0075370_10463558 | Ga0075370_104635581 | 176 |
| 513 | 3300006358 | Ga0068871_100000034 | Ga0068871_10000003429 | 176 |
| 514 | 3300006358 | Ga0068871_100024903 | Ga0068871_1000249033 | 176 |
| 515 | 3300006844 | Ga0075428_100031223 | Ga0075428_1000312231 | 176 |
| 516 | 3300006846 | Ga0075430_100005373 | Ga0075430_1000053734 | 176 |
| 517 | 3300006847 | Ga0075431_100142954 | Ga0075431_1001429542 | 176 |
| 518 | 3300006852 | Ga0075433_10000774 | Ga0075433_100007749 | 176 |
| 519 | 3300006852 | Ga0075433_10005737 | Ga0075433_100057376 | 176 |
| 520 | 3300006852 | Ga0075433_10027741 | Ga0075433_100277414 | 176 |
| 521 | 3300006852 | Ga0075433_10097733 | Ga0075433_100977332 | 176 |
| 522 | 3300006871 | Ga0075434_100001700 | Ga0075434_10000170017 | 176 |
| 523 | 3300006871 | Ga0075434_100003565 | Ga0075434_10000356513 | 176 |
| 524 | 3300006871 | Ga0075434_100261194 | Ga0075434_1002611942 | 176 |
| 525 | 3300006871 | Ga0075434_100489468 | Ga0075434_1004894683 | 176 |
| 526 | 3300006880 | Ga0075429_100027666 | Ga0075429_1000276663 | 176 |
| 527 | 3300006880 | Ga0075429_100801880 | Ga0075429_1008018801 | 176 |
| 528 | 3300006881 | Ga0068865_100000230 | Ga0068865_10000023029 | 176 |
| 529 | 3300006881 | Ga0068865_100056340 | Ga0068865_1000563402 | 176 |
| 530 | 3300006881 | Ga0068865_100102449 | Ga0068865_1001024493 | 176 |
| 531 | 3300006914 | Ga0075436_100061927 | Ga0075436_1000619273 | 176 |
| 532 | 3300006914 | Ga0075436_100156448 | Ga0075436_1001564482 | 176 |
| 533 | 3300006914 | Ga0075436_100552188 | Ga0075436_1005521882 | 176 |
| 534 | 3300006931 | Ga0097620_100001353 | Ga0097620_1000013538 | 176 |
| 535 | 3300006931 | Ga0097620_100072439 | Ga0097620_1000724393 | 176 |
| 536 | 3300006931 | Ga0097620_100221535 | Ga0097620_1002215352 | 176 |
| 537 | 3300007076 | Ga0075435_100001109 | Ga0075435_1000011098 | 176 |
| 538 | 3300007076 | Ga0075435_100017628 | Ga0075435_1000176286 | 176 |
| 539 | 3300007076 | Ga0075435_100116938 | Ga0075435_1001169382 | 176 |
| 540 | 3300007076 | Ga0075435_100192974 | Ga0075435_1001929742 | 176 |
| 541 | 3300009011 | Ga0105251_10038761 | Ga0105251_100387611 | 176 |
| 542 | 3300009092 | Ga0105250_10040716 | Ga0105250_100407162 | 176 |
| 543 | 3300009093 | Ga0105240_10067652 | Ga0105240_100676524 | 176 |
| 544 | 3300009094 | Ga0111539_10000932 | Ga0111539_1000093216 | 176 |
| 545 | 3300009094 | Ga0111539_10002162 | Ga0111539_1000216220 | 176 |
| 546 | 3300009094 | Ga0111539_10059566 | Ga0111539_100595666 | 176 |
| 547 | 3300009098 | Ga0105245_10000258 | Ga0105245_1000025831 | 176 |
| 548 | 3300009098 | Ga0105245_10012413 | Ga0105245_100124132 | 176 |
| 549 | 3300009098 | Ga0105245_10103418 | Ga0105245_101034183 | 176 |
| 550 | 3300009101 | Ga0105247_10015208 | Ga0105247_100152084 | 176 |
| 551 | 3300009101 | Ga0105247_10242887 | Ga0105247_102428872 | 176 |
| 552 | 3300009101 | Ga0105247_10445797 | Ga0105247_104457971 | 176 |
| 553 | 3300009148 | Ga0105243_10000846 | Ga0105243_1000084616 | 176 |
| 554 | 3300009148 | Ga0105243_10014969 | Ga0105243_100149692 | 176 |
| 555 | 3300009148 | Ga0105243_10023951 | Ga0105243_100239515 | 176 |
| 556 | 3300009148 | Ga0105243_10043258 | Ga0105243_100432582 | 176 |
| 557 | 3300009174 | Ga0105241_10141570 | Ga0105241_101415701 | 176 |
| 558 | 3300009176 | Ga0105242_10000037 | Ga0105242_1000003760 | 176 |
| 559 | 3300009176 | Ga0105242_10033883 | Ga0105242_100338833 | 176 |
| 560 | 3300009176 | Ga0105242_10057874 | Ga0105242_100578742 | 176 |
| 561 | 3300009177 | Ga0105248_10000744 | Ga0105248_1000074415 | 176 |
| 562 | 3300009177 | Ga0105248_10536829 | Ga0105248_105368292 | 176 |
| 563 | 3300009545 | Ga0105237_10020951 | Ga0105237_100209515 | 176 |
| 564 | 3300009545 | Ga0105237_10112148 | Ga0105237_101121482 | 176 |
| 565 | 3300009551 | Ga0105238_10066539 | Ga0105238_100665393 | 176 |
| 566 | 3300009551 | Ga0105238_10183495 | Ga0105238_101834953 | 176 |
| 567 | 3300009553 | Ga0105249_10000209 | Ga0105249_1000020951 | 176 |
| 568 | 3300009553 | Ga0105249_10026930 | Ga0105249_100269306 | 176 |
| 569 | 3300010375 | Ga0105239_10001464 | Ga0105239_1000146417 | 176 |
| 570 | 3300010375 | Ga0105239_10096125 | Ga0105239_100961252 | 176 |
| 571 | 3300011119 | Ga0105246_10026773 | Ga0105246_100267733 | 176 |
| 572 | 3300011119 | Ga0105246_10648283 | Ga0105246_106482831 | 176 |
| 573 | 3300012478 | Ga0157328_1001425 | Ga0157328_10014252 | 176 |
| 574 | 3300012500 | Ga0157314_1002672 | Ga0157314_10026723 | 176 |
| 575 | 3300012500 | Ga0157314_1013035 | Ga0157314_10130352 | 176 |
| 576 | 3300012507 | Ga0157342_1003689 | Ga0157342_10036892 | 176 |
| 577 | 3300012508 | Ga0157315_1002711 | Ga0157315_10027113 | 176 |
| 578 | 3300012510 | Ga0157316_1000114 | Ga0157316_10001144 | 176 |
| 579 | 3300013100 | Ga0157373_10344110 | Ga0157373_103441102 | 176 |
| 580 | 3300013100 | Ga0157373_10412442 | Ga0157373_104124421 | 176 |
| 581 | 3300013100 | Ga0157373_10595511 | Ga0157373_105955112 | 176 |
| 582 | 3300013102 | Ga0157371_10421423 | Ga0157371_104214232 | 176 |
| 583 | 3300013102 | Ga0157371_10582158 | Ga0157371_105821581 | 176 |
| 584 | 3300013105 | Ga0157369_10955537 | Ga0157369_109555372 | 176 |
| 585 | 3300013297 | Ga0157378_10001580 | Ga0157378_1000158013 | 176 |
| 586 | 3300013297 | Ga0157378_10711400 | Ga0157378_107114002 | 176 |
| 587 | 3300013297 | Ga0157378_10819210 | Ga0157378_108192101 | 176 |
| 588 | 3300013306 | Ga0163162_10001677 | Ga0163162_100016777 | 176 |
| 589 | 3300013306 | Ga0163162_10470559 | Ga0163162_104705591 | 176 |
| 590 | 3300013306 | Ga0163162_11510553 | Ga0163162_115105532 | 176 |
| 591 | 3300013307 | Ga0157372_10109839 | Ga0157372_101098393 | 176 |
| 592 | 3300013307 | Ga0157372_10158955 | Ga0157372_101589552 | 176 |
| 593 | 3300013307 | Ga0157372_10469552 | Ga0157372_104695522 | 176 |
| 594 | 3300013307 | Ga0157372_10866812 | Ga0157372_108668122 | 176 |
| 595 | 3300013308 | Ga0157375_10000263 | Ga0157375_1000026355 | 176 |
| 596 | 3300013308 | Ga0157375_10428144 | Ga0157375_104281441 | 176 |
| 597 | 3300014325 | Ga0163163_10019201 | Ga0163163_100192013 | 176 |
| 598 | 3300014325 | Ga0163163_11352258 | Ga0163163_113522582 | 176 |
| 599 | 3300014326 | Ga0157380_10000294 | Ga0157380_1000029420 | 176 |
| 600 | 3300014326 | Ga0157380_10077167 | Ga0157380_100771673 | 176 |
| 601 | 3300014745 | Ga0157377_10001222 | Ga0157377_1000122211 | 176 |
| 602 | 3300014968 | Ga0157379_10002453 | Ga0157379_1000245316 | 176 |
| 603 | 3300014968 | Ga0157379_10027532 | Ga0157379_100275323 | 176 |
| 604 | 3300014968 | Ga0157379_10696930 | Ga0157379_106969302 | 176 |
| 605 | 3300014969 | Ga0157376_10000342 | Ga0157376_1000034219 | 176 |
| 606 | 3300014969 | Ga0157376_10461782 | Ga0157376_104617822 | 176 |
| 607 | 3300014969 | Ga0157376_11216849 | Ga0157376_112168492 | 176 |
| 608 | 3300017792 | Ga0163161_10000523 | Ga0163161_1000052323 | 176 |
| 609 | 3300020069 | Ga0197907_10014073 | Ga0197907_100140732 | 176 |
| 610 | 3300025271 | Ga0207666_1000010 | Ga0207666_10000107 | 176 |
| 611 | 3300025271 | Ga0207666_1001035 | Ga0207666_10010354 | 176 |
| 612 | 3300025290 | Ga0207673_1000164 | Ga0207673_10001646 | 176 |
| 613 | 3300025315 | Ga0207697_10000186 | Ga0207697_1000018631 | 176 |
| 614 | 3300025893 | Ga0207682_10000123 | Ga0207682_1000012325 | 176 |
| 615 | 3300025898 | Ga0207692_10004961 | Ga0207692_100049616 | 176 |
| 616 | 3300025898 | Ga0207692_10087164 | Ga0207692_100871643 | 176 |
| 617 | 3300025898 | Ga0207692_10094665 | Ga0207692_100946653 | 176 |
| 618 | 3300025899 | Ga0207642_10000263 | Ga0207642_1000026312 | 176 |
| 619 | 3300025900 | Ga0207710_10004419 | Ga0207710_100044192 | 176 |
| 620 | 3300025900 | Ga0207710_10304335 | Ga0207710_103043351 | 176 |
| 621 | 3300025901 | Ga0207688_10000889 | Ga0207688_100008893 | 176 |
| 622 | 3300025901 | Ga0207688_10056265 | Ga0207688_100562651 | 176 |
| 623 | 3300025903 | Ga0207680_10001117 | Ga0207680_1000111714 | 176 |
| 624 | 3300025903 | Ga0207680_10077237 | Ga0207680_100772372 | 176 |
| 625 | 3300025904 | Ga0207647_10005506 | Ga0207647_1000550610 | 176 |
| 626 | 3300025904 | Ga0207647_10046296 | Ga0207647_100462964 | 176 |
| 627 | 3300025905 | Ga0207685_10001241 | Ga0207685_100012413 | 176 |
| 628 | 3300025906 | Ga0207699_10023071 | Ga0207699_100230711 | 176 |
| 629 | 3300025906 | Ga0207699_10026530 | Ga0207699_100265302 | 176 |
| 630 | 3300025907 | Ga0207645_10000023 | Ga0207645_1000002329 | 176 |
| 631 | 3300025907 | Ga0207645_10020930 | Ga0207645_100209305 | 176 |
| 632 | 3300025907 | Ga0207645_10051083 | Ga0207645_100510832 | 176 |
| 633 | 3300025907 | Ga0207645_10132679 | Ga0207645_101326792 | 176 |
| 634 | 3300025908 | Ga0207643_10000007 | Ga0207643_1000000720 | 176 |
| 635 | 3300025910 | Ga0207684_10339377 | Ga0207684_103393773 | 176 |
| 636 | 3300025911 | Ga0207654_10374275 | Ga0207654_103742751 | 176 |
| 637 | 3300025912 | Ga0207707_10002015 | Ga0207707_1000201514 | 176 |
| 638 | 3300025912 | Ga0207707_10094416 | Ga0207707_100944162 | 176 |
| 639 | 3300025912 | Ga0207707_10112364 | Ga0207707_101123643 | 176 |
| 640 | 3300025912 | Ga0207707_10565521 | Ga0207707_105655212 | 176 |
| 641 | 3300025913 | Ga0207695_10338560 | Ga0207695_103385602 | 176 |
| 642 | 3300025914 | Ga0207671_10008841 | Ga0207671_100088415 | 176 |
| 643 | 3300025915 | Ga0207693_10012859 | Ga0207693_100128597 | 176 |
| 644 | 3300025915 | Ga0207693_10132335 | Ga0207693_101323352 | 176 |
| 645 | 3300025915 | Ga0207693_10233177 | Ga0207693_102331772 | 176 |
| 646 | 3300025915 | Ga0207693_10291617 | Ga0207693_102916172 | 176 |
| 647 | 3300025916 | Ga0207663_10040066 | Ga0207663_100400663 | 176 |
| 648 | 3300025916 | Ga0207663_10060441 | Ga0207663_100604412 | 176 |
| 649 | 3300025917 | Ga0207660_10000393 | Ga0207660_1000039313 | 176 |
| 650 | 3300025917 | Ga0207660_10128860 | Ga0207660_101288602 | 176 |
| 651 | 3300025918 | Ga0207662_10000136 | Ga0207662_1000013636 | 176 |
| 652 | 3300025918 | Ga0207662_10011289 | Ga0207662_100112894 | 176 |
| 653 | 3300025918 | Ga0207662_10252685 | Ga0207662_102526852 | 176 |
| 654 | 3300025919 | Ga0207657_10005004 | Ga0207657_100050043 | 176 |
| 655 | 3300025919 | Ga0207657_10055737 | Ga0207657_100557373 | 176 |
| 656 | 3300025920 | Ga0207649_10000434 | Ga0207649_1000043417 | 176 |
| 657 | 3300025921 | Ga0207652_10001720 | Ga0207652_1000172017 | 176 |
| 658 | 3300025923 | Ga0207681_10000273 | Ga0207681_1000027325 | 176 |
| 659 | 3300025923 | Ga0207681_10173194 | Ga0207681_101731941 | 176 |
| 660 | 3300025923 | Ga0207681_10859255 | Ga0207681_108592551 | 176 |
| 661 | 3300025924 | Ga0207694_10052606 | Ga0207694_100526063 | 176 |
| 662 | 3300025924 | Ga0207694_10596276 | Ga0207694_105962762 | 176 |
| 663 | 3300025925 | Ga0207650_10001932 | Ga0207650_1000193214 | 176 |
| 664 | 3300025925 | Ga0207650_10597000 | Ga0207650_105970001 | 176 |
| 665 | 3300025926 | Ga0207659_10000097 | Ga0207659_1000009731 | 176 |
| 666 | 3300025926 | Ga0207659_10059029 | Ga0207659_100590293 | 176 |
| 667 | 3300025927 | Ga0207687_10001031 | Ga0207687_1000103114 | 176 |
| 668 | 3300025927 | Ga0207687_10020925 | Ga0207687_100209255 | 176 |
| 669 | 3300025928 | Ga0207700_10000167 | Ga0207700_100001679 | 176 |
| 670 | 3300025928 | Ga0207700_10307066 | Ga0207700_103070662 | 176 |
| 671 | 3300025928 | Ga0207700_11001076 | Ga0207700_110010761 | 176 |
| 672 | 3300025929 | Ga0207664_10038266 | Ga0207664_100382665 | 176 |
| 673 | 3300025929 | Ga0207664_10271211 | Ga0207664_102712112 | 176 |
| 674 | 3300025931 | Ga0207644_10001738 | Ga0207644_1000173811 | 176 |
| 675 | 3300025931 | Ga0207644_10036997 | Ga0207644_100369972 | 176 |
| 676 | 3300025932 | Ga0207690_10000962 | Ga0207690_100009623 | 176 |
| 677 | 3300025932 | Ga0207690_10151161 | Ga0207690_101511613 | 176 |
| 678 | 3300025932 | Ga0207690_10289535 | Ga0207690_102895352 | 176 |
| 679 | 3300025932 | Ga0207690_10824478 | Ga0207690_108244781 | 176 |
| 680 | 3300025933 | Ga0207706_10000867 | Ga0207706_1000086729 | 176 |
| 681 | 3300025933 | Ga0207706_10017224 | Ga0207706_100172246 | 176 |
| 682 | 3300025933 | Ga0207706_10021114 | Ga0207706_100211146 | 176 |
| 683 | 3300025933 | Ga0207706_10036344 | Ga0207706_100363441 | 176 |
| 684 | 3300025934 | Ga0207686_10000329 | Ga0207686_1000032936 | 176 |
| 685 | 3300025934 | Ga0207686_10107854 | Ga0207686_101078542 | 176 |
| 686 | 3300025935 | Ga0207709_10000419 | Ga0207709_100004197 | 176 |
| 687 | 3300025935 | Ga0207709_10045024 | Ga0207709_100450244 | 176 |
| 688 | 3300025935 | Ga0207709_10101156 | Ga0207709_101011563 | 176 |
| 689 | 3300025935 | Ga0207709_10245035 | Ga0207709_102450352 | 176 |
| 690 | 3300025936 | Ga0207670_10000536 | Ga0207670_1000053620 | 176 |
| 691 | 3300025936 | Ga0207670_10792165 | Ga0207670_107921651 | 176 |
| 692 | 3300025937 | Ga0207669_10002798 | Ga0207669_100027983 | 176 |
| 693 | 3300025938 | Ga0207704_10000119 | Ga0207704_1000011952 | 176 |
| 694 | 3300025938 | Ga0207704_10074797 | Ga0207704_100747973 | 176 |
| 695 | 3300025938 | Ga0207704_10282642 | Ga0207704_102826421 | 176 |
| 696 | 3300025938 | Ga0207704_11061300 | Ga0207704_110613001 | 176 |
| 697 | 3300025939 | Ga0207665_10000417 | Ga0207665_1000041722 | 176 |
| 698 | 3300025940 | Ga0207691_10000544 | Ga0207691_100005447 | 176 |
| 699 | 3300025940 | Ga0207691_10023702 | Ga0207691_100237023 | 176 |
| 700 | 3300025940 | Ga0207691_10170474 | Ga0207691_101704743 | 176 |
| 701 | 3300025940 | Ga0207691_10395597 | Ga0207691_103955971 | 176 |
| 702 | 3300025941 | Ga0207711_10002468 | Ga0207711_1000246817 | 176 |
| 703 | 3300025941 | Ga0207711_10105904 | Ga0207711_101059043 | 176 |
| 704 | 3300025941 | Ga0207711_10319609 | Ga0207711_103196092 | 176 |
| 705 | 3300025942 | Ga0207689_10001743 | Ga0207689_1000174317 | 176 |
| 706 | 3300025942 | Ga0207689_10381710 | Ga0207689_103817102 | 176 |
| 707 | 3300025942 | Ga0207689_10461869 | Ga0207689_104618692 | 176 |
| 708 | 3300025944 | Ga0207661_10000428 | Ga0207661_1000042825 | 176 |
| 709 | 3300025945 | Ga0207679_10000029 | Ga0207679_10000029178 | 176 |
| 710 | 3300025945 | Ga0207679_10129224 | Ga0207679_101292241 | 176 |
| 711 | 3300025945 | Ga0207679_10278209 | Ga0207679_102782092 | 176 |
| 712 | 3300025949 | Ga0207667_10017999 | Ga0207667_100179996 | 176 |
| 713 | 3300025960 | Ga0207651_10000083 | Ga0207651_1000008321 | 176 |
| 714 | 3300025961 | Ga0207712_10000471 | Ga0207712_1000047117 | 176 |
| 715 | 3300025961 | Ga0207712_10019998 | Ga0207712_100199983 | 176 |
| 716 | 3300025972 | Ga0207668_10000862 | Ga0207668_1000086220 | 176 |
| 717 | 3300025981 | Ga0207640_10000637 | Ga0207640_1000063717 | 176 |
| 718 | 3300025981 | Ga0207640_10800633 | Ga0207640_108006332 | 176 |
| 719 | 3300025986 | Ga0207658_10002203 | Ga0207658_100022033 | 176 |
| 720 | 3300025986 | Ga0207658_10041282 | Ga0207658_100412824 | 176 |
| 721 | 3300025986 | Ga0207658_10041634 | Ga0207658_100416343 | 176 |
| 722 | 3300025986 | Ga0207658_10342647 | Ga0207658_103426472 | 176 |
| 723 | 3300025986 | Ga0207658_11021815 | Ga0207658_110218151 | 176 |
| 724 | 3300025986 | Ga0207658_11657912 | Ga0207658_116579121 | 176 |
| 725 | 3300026023 | Ga0207677_10000992 | Ga0207677_1000099216 | 176 |
| 726 | 3300026023 | Ga0207677_10368905 | Ga0207677_103689052 | 176 |
| 727 | 3300026023 | Ga0207677_10791571 | Ga0207677_107915711 | 176 |
| 728 | 3300026035 | Ga0207703_10005165 | Ga0207703_100051656 | 176 |
| 729 | 3300026035 | Ga0207703_10008054 | Ga0207703_1000805410 | 176 |
| 730 | 3300026035 | Ga0207703_10592055 | Ga0207703_105920551 | 176 |
| 731 | 3300026041 | Ga0207639_10005126 | Ga0207639_100051267 | 176 |
| 732 | 3300026041 | Ga0207639_10117256 | Ga0207639_101172562 | 176 |
| 733 | 3300026067 | Ga0207678_10001568 | Ga0207678_1000156820 | 176 |
| 734 | 3300026067 | Ga0207678_10021304 | Ga0207678_100213045 | 176 |
| 735 | 3300026067 | Ga0207678_10029617 | Ga0207678_100296174 | 176 |
| 736 | 3300026067 | Ga0207678_10055746 | Ga0207678_100557463 | 176 |
| 737 | 3300026067 | Ga0207678_10666137 | Ga0207678_106661372 | 176 |
| 738 | 3300026075 | Ga0207708_10002060 | Ga0207708_100020607 | 176 |
| 739 | 3300026075 | Ga0207708_10005462 | Ga0207708_100054628 | 176 |
| 740 | 3300026075 | Ga0207708_10017276 | Ga0207708_100172765 | 176 |
| 741 | 3300026078 | Ga0207702_10001921 | Ga0207702_1000192117 | 176 |
| 742 | 3300026078 | Ga0207702_10369941 | Ga0207702_103699413 | 176 |
| 743 | 3300026088 | Ga0207641_10000510 | Ga0207641_1000051020 | 176 |
| 744 | 3300026089 | Ga0207648_10003487 | Ga0207648_100034876 | 176 |
| 745 | 3300026089 | Ga0207648_10212920 | Ga0207648_102129201 | 176 |
| 746 | 3300026089 | Ga0207648_10462116 | Ga0207648_104621162 | 176 |
| 747 | 3300026095 | Ga0207676_10003788 | Ga0207676_1000378811 | 176 |
| 748 | 3300026095 | Ga0207676_10028269 | Ga0207676_100282693 | 176 |
| 749 | 3300026095 | Ga0207676_10102196 | Ga0207676_101021963 | 176 |
| 750 | 3300026116 | Ga0207674_10000608 | Ga0207674_100006087 | 176 |
| 751 | 3300026116 | Ga0207674_10141868 | Ga0207674_101418683 | 176 |
| 752 | 3300026116 | Ga0207674_10495818 | Ga0207674_104958182 | 176 |
| 753 | 3300026118 | Ga0207675_100000805 | Ga0207675_1000008057 | 176 |
| 754 | 3300026118 | Ga0207675_100026921 | Ga0207675_1000269214 | 176 |
| 755 | 3300026118 | Ga0207675_100714409 | Ga0207675_1007144091 | 176 |
| 756 | 3300026121 | Ga0207683_10000082 | Ga0207683_1000008245 | 176 |
| 757 | 3300026121 | Ga0207683_10006710 | Ga0207683_100067103 | 176 |
| 758 | 3300026121 | Ga0207683_10056132 | Ga0207683_100561322 | 176 |
| 759 | 3300026142 | Ga0207698_10000377 | Ga0207698_1000037714 | 176 |
| 760 | 3300026142 | Ga0207698_10313595 | Ga0207698_103135952 | 176 |
| 761 | 3300027424 | Ga0209984_1003002 | Ga0209984_10030022 | 176 |
| 762 | 3300027471 | Ga0209995_1018973 | Ga0209995_10189732 | 176 |
| 763 | 3300027617 | Ga0210002_1003792 | Ga0210002_10037922 | 176 |
| 764 | 3300027665 | Ga0209983_1006337 | Ga0209983_10063373 | 176 |
| 765 | 3300027682 | Ga0209971_1003286 | Ga0209971_10032865 | 176 |
| 766 | 3300027695 | Ga0209966_1001565 | Ga0209966_10015653 | 176 |
| 767 | 3300027695 | Ga0209966_1016036 | Ga0209966_10160362 | 176 |
| 768 | 3300027717 | Ga0209998_10000947 | Ga0209998_100009476 | 176 |
| 769 | 3300027717 | Ga0209998_10007515 | Ga0209998_100075154 | 176 |
| 770 | 3300027717 | Ga0209998_10009536 | Ga0209998_100095364 | 176 |
| 771 | 3300027876 | Ga0209974_10029116 | Ga0209974_100291162 | 176 |
| 772 | 3300027876 | Ga0209974_10047466 | Ga0209974_100474662 | 176 |
| 773 | 3300027876 | Ga0209974_10118998 | Ga0209974_101189982 | 176 |
| 774 | 3300027907 | Ga0207428_10000124 | Ga0207428_1000012483 | 176 |
| 775 | 3300027907 | Ga0207428_10000420 | Ga0207428_1000042031 | 176 |
| 776 | 3300027907 | Ga0207428_10000703 | Ga0207428_1000070328 | 176 |
| 777 | 3300028379 | Ga0268266_10101549 | Ga0268266_101015493 | 176 |
| 778 | 3300028380 | Ga0268265_10001170 | Ga0268265_100011709 | 176 |
| 779 | 3300028380 | Ga0268265_10017735 | Ga0268265_100177355 | 176 |
| 780 | 3300028381 | Ga0268264_10001878 | Ga0268264_100018787 | 176 |
| 781 | 3300028381 | Ga0268264_10047711 | Ga0268264_100477112 | 176 |
| 782 | 3300028556 | Ga0265337_1006137 | Ga0265337_10061372 | 176 |
| 783 | 3300028800 | Ga0265338_10061561 | Ga0265338_100615612 | 176 |
| 784 | 3300031090 | Ga0265760_10017485 | Ga0265760_100174852 | 176 |
| 785 | 3300031344 | Ga0265316_10215591 | Ga0265316_102155913 | 176 |
| 786 | 3300031595 | Ga0265313_10110491 | Ga0265313_101104912 | 176 |
| 787 | 3300034816 | Ga0373930_0000680 | Ga0373930_0000680_4168_4698 | 176 |
| 788 | 3300034816 | Ga0373930_0008825 | Ga0373930_0008825_845_1375 | 176 |
| 789 | 3300034817 | Ga0373948_0000196 | Ga0373948_0000196_4196_4726 | 176 |
| 790 | 3300034818 | Ga0373950_0001373 | Ga0373950_0001373_894_1424 | 176 |
| 791 | 3300034818 | Ga0373950_0005433 | Ga0373950_0005433_1293_1823 | 176 |
| 792 | 3300034819 | Ga0373958_0001277 | Ga0373958_0001277_2270_2800 | 176 |
| 793 | 3300034819 | Ga0373958_0002069 | Ga0373958_0002069_75_605 | 176 |
| 794 | 3300034819 | Ga0373958_0020804 | Ga0373958_0020804_92_622 | 176 |
| 795 | 3300034820 | Ga0373959_0043135 | Ga0373959_0043135_191_721 | 176 |
| 796 | 3300034820 | Ga0373959_0150486 | Ga0373959_0150486_26_556 | 176 |
| 797 | 3300034957 | Ga0373938_0000092 | Ga0373938_0000092_1759_2289 | 176 |
| 798 | 3300034957 | Ga0373938_0003487 | Ga0373938_0003487_1279_1809 | 176 |
| 799 | 3300034957 | Ga0373938_0020764 | Ga0373938_0020764_607_1137 | 176 |
| 800 | 3300035083 | Ga0373926_0041110 | Ga0373926_0041110_54_584 | 176 |
| 801 | 3300035084 | Ga0373928_0003337 | Ga0373928_0003337_285_815 | 176 |
| 802 | 3300035084 | Ga0373928_0005526 | Ga0373928_0005526_1108_1638 | 176 |
| 803 | 3300035085 | Ga0373929_0000128 | Ga0373929_0000128_5062_5592 | 176 |
| 804 | 3300035088 | Ga0373940_0005195 | Ga0373940_0005195_134_664 | 176 |
| 805 | 3300035088 | Ga0373940_0049925 | Ga0373940_0049925_611_1141 | 176 |
| 806 | 3300035089 | Ga0373944_0045330 | Ga0373944_0045330_668_1198 | 176 |
| 807 | 3300035090 | Ga0373949_0000715 | Ga0373949_0000715_5704_6234 | 176 |
| 808 | 3300035090 | Ga0373949_0011216 | Ga0373949_0011216_193_723 | 176 |
| 809 | 3300035090 | Ga0373949_0035614 | Ga0373949_0035614_214_744 | 176 |
| 810 | 3300035091 | Ga0373951_0000531 | Ga0373951_0000531_9369_9899 | 176 |
| 811 | 3300035091 | Ga0373951_0003670 | Ga0373951_0003670_2752_3282 | 176 |
| 812 | 3300035092 | Ga0373952_0006526 | Ga0373952_0006526_1381_1911 | 176 |
| 813 | 3300035092 | Ga0373952_0008456 | Ga0373952_0008456_786_1316 | 176 |
| 814 | 3300035111 | Ga0373923_0002485 | Ga0373923_0002485_3773_4303 | 176 |
| 815 | 3300035111 | Ga0373923_0090402 | Ga0373923_0090402_65_595 | 176 |
| 816 | 3300035112 | Ga0373932_0000510 | Ga0373932_0000510_11217_11747 | 176 |
| 817 | 3300035112 | Ga0373932_0000597 | Ga0373932_0000597_5586_6116 | 176 |
| 818 | 3300035112 | Ga0373932_0002240 | Ga0373932_0002240_743_1273 | 176 |
| 819 | 3300035114 | Ga0373939_0000361 | Ga0373939_0000361_5779_6309 | 176 |
| 820 | 3300035114 | Ga0373939_0000377 | Ga0373939_0000377_6149_6679 | 176 |
| 821 | 3300035114 | Ga0373939_0013576 | Ga0373939_0013576_1212_1742 | 176 |
| 822 | 3300035114 | Ga0373939_0016420 | Ga0373939_0016420_978_1508 | 176 |
| 823 | 3300035115 | Ga0373941_0020117 | Ga0373941_0020117_1327_1857 | 176 |
| 824 | 3300035117 | Ga0373953_0003611 | Ga0373953_0003611_3031_3597 | 176 |
| 825 | 3300035117 | Ga0373953_0427848 | Ga0373953_0427848_22_552 | 176 |
| 826 | 3300035118 | Ga0373954_0096413 | Ga0373954_0096413_341_871 | 176 |
| 827 | 3300035118 | Ga0373954_0252495 | Ga0373954_0252495_304_834 | 176 |
| 828 | 3300035119 | Ga0373956_0077711 | Ga0373956_0077711_621_1151 | 176 |
| 829 | 3300035119 | Ga0373956_0343485 | Ga0373956_0343485_69_599 | 176 |
| 830 | 3300035120 | Ga0373957_0079690 | Ga0373957_0079690_570_1136 | 176 |
| 831 | 3300035121 | Ga0373960_0000204 | Ga0373960_0000204_5931_6461 | 176 |
| 832 | 3300035121 | Ga0373960_0001684 | Ga0373960_0001684_1881_2411 | 176 |
| 833 | 3300035170 | Ga0373943_0105507 | Ga0373943_0105507_120_650 | 176 |
| 834 | 3300035170 | Ga0373943_0474672 | Ga0373943_0474672_68_598 | 176 |
| 835 | 3300035171 | Ga0373946_0003985 | Ga0373946_0003985_3487_4017 | 176 |
| 836 | 3300035172 | Ga0373955_0018458 | Ga0373955_0018458_1589_2155 | 176 |
| 837 | 3300035207 | Ga0373942_0000813 | Ga0373942_0000813_2321_2851 | 176 |
| 838 | 3300035207 | Ga0373942_0002869 | Ga0373942_0002869_53_583 | 176 |
| 839 | 3300035241 | Ga0373961_0001755 | Ga0373961_0001755_4531_5061 | 176 |
| 840 | 3300035241 | Ga0373961_0001827 | Ga0373961_0001827_3358_3888 | 176 |
| 841 | 3300035241 | Ga0373961_0106872 | Ga0373961_0106872_369_899 | 176 |
| 842 | 3300035242 | Ga0373962_0066553 | Ga0373962_0066553_411_941 | 176 |
| 843 | 3300035242 | Ga0373962_0113069 | Ga0373962_0113069_127_657 | 176 |
| 844 | 3300035410 | Ga0373924_0016721 | Ga0373924_0016721_697_1263 | 176 |
| 845 | 3300035410 | Ga0373924_0065453 | Ga0373924_0065453_902_1498 | 176 |
| 846 | 3300035691 | Ga0373931_0000186 | Ga0373931_0000186_11160_11690 | 176 |
| 847 | 3300035691 | Ga0373931_0002333 | Ga0373931_0002333_6724_7254 | 176 |
| 848 | 3300035691 | Ga0373931_0003707 | Ga0373931_0003707_368_898 | 176 |
| 849 | 3300035692 | Ga0373935_0016872 | Ga0373935_0016872_2678_3208 | 176 |
| 850 | 3300035695 | Ga0373927_0063603 | Ga0373927_0063603_1711_2241 | 176 |
| 851 | 3300035724 | Ga0373933_0072189 | Ga0373933_0072189_1484_2014 | 176 |
| 852 | 3300036401 | Ga0373937_0009657 | Ga0373937_0009657_3981_4547 | 176 |
| 853 | 3300036401 | Ga0373937_0023701 | Ga0373937_0023701_1514_2086 | 176 |
| 854 | 3300036401 | Ga0373937_0025502 | Ga0373937_0025502_3178_3708 | 176 |
| 855 | 3300036401 | Ga0373937_0199890 | Ga0373937_0199890_666_1196 | 176 |
| 856 | 3300036401 | Ga0373937_0494850 | Ga0373937_0494850_357_887 | 176 |
| 857 | 3300037068 | Ga0373925_0005307 | Ga0373925_0005307_272_802 | 176 |
| 858 | 3300037068 | Ga0373925_0058062 | Ga0373925_0058062_2216_2746 | 176 |
| 859 | 3300037068 | Ga0373925_0473795 | Ga0373925_0473795_60_590 | 176 |
| 860 | 3300038996 | Ga0242420_019213 | Ga0242420_019213_22_615 | 176 |
| 861 | 3300039437 | Ga0436365_0823677 | Ga0436365_0823677_461_994 | 176 |
| 862 | 3300042008 | Ga0439450_031306 | Ga0439450_031306_115_645 | 176 |
| 863 | 3300042012 | Ga0439455_0003575 | Ga0439455_0003575_1610_2140 | 176 |
| 864 | 3300042438 | Ga0439459_0067897 | Ga0439459_0067897_176_706 | 176 |
| 865 | 3300042876 | Ga0451577_0600374 | Ga0451577_0600374_71_613 | 176 |
| 866 | 3300044712 | Ga0453684_0066809 | Ga0453684_0066809_691_1221 | 176 |
| 867 | 3300045051 | Ga0451576_0039893 | Ga0451576_0039893_3410_3940 | 176 |
| 868 | 3300046454 | Ga0495592_0001116 | Ga0495592_0001116_11493_12023 | 176 |
| 869 | 3300046454 | Ga0495592_0009742 | Ga0495592_0009742_882_1448 | 176 |
| 870 | 3300046454 | Ga0495592_0057294 | Ga0495592_0057294_1851_2381 | 176 |
| 871 | 3300046454 | Ga0495592_0096795 | Ga0495592_0096795_1231_1761 | 176 |
| 872 | 3300046459 | Ga0495629_0016112 | Ga0495629_0016112_1109_1639 | 176 |
| 873 | 3300046461 | Ga0495641_0023574 | Ga0495641_0023574_631_1161 | 176 |
| 874 | 3300046461 | Ga0495641_0188442 | Ga0495641_0188442_86_616 | 176 |
| 875 | 3300046461 | Ga0495641_0285807 | Ga0495641_0285807_137_667 | 176 |
| 876 | 3300046462 | Ga0495651_0000493 | Ga0495651_0000493_22873_23439 | 176 |
| 877 | 3300046462 | Ga0495651_0016283 | Ga0495651_0016283_5016_5546 | 176 |
| 878 | 3300046463 | Ga0495653_0004657 | Ga0495653_0004657_3631_4197 | 176 |
| 879 | 3300046463 | Ga0495653_0012444 | Ga0495653_0012444_4698_5228 | 176 |
| 880 | 3300046463 | Ga0495653_0041839 | Ga0495653_0041839_1740_2270 | 176 |
| 881 | 3300046472 | Ga0495580_0483081 | Ga0495580_0483081_259_816 | 176 |
| 882 | 3300046475 | Ga0495639_0046937 | Ga0495639_0046937_1223_1753 | 176 |
| 883 | 3300046476 | Ga0495662_0023030 | Ga0495662_0023030_304_834 | 176 |
| 884 | 3300046477 | Ga0495664_0001609 | Ga0495664_0001609_9508_10038 | 176 |
| 885 | 3300046491 | Ga0495584_0014705 | Ga0495584_0014705_726_1256 | 176 |
| 886 | 3300046499 | Ga0495594_0047336 | Ga0495594_0047336_188_718 | 176 |
| 887 | 3300046511 | Ga0495608_0010562 | Ga0495608_0010562_2578_3144 | 176 |
| 888 | 3300046511 | Ga0495608_0013937 | Ga0495608_0013937_2161_2691 | 176 |
| 889 | 3300046514 | Ga0495618_0007452 | Ga0495618_0007452_3962_4528 | 176 |
| 890 | 3300046516 | Ga0495628_0002046 | Ga0495628_0002046_3631_4197 | 176 |
| 891 | 3300046516 | Ga0495628_0009974 | Ga0495628_0009974_3049_3579 | 176 |
| 892 | 3300046516 | Ga0495628_0014402 | Ga0495628_0014402_6057_6587 | 176 |
| 893 | 3300046517 | Ga0495630_0542717 | Ga0495630_0542717_96_662 | 176 |
| 894 | 3300046520 | Ga0495637_0101288 | Ga0495637_0101288_567_1097 | 176 |
| 895 | 3300046529 | Ga0495652_0234879 | Ga0495652_0234879_547_1113 | 176 |
| 896 | 3300046531 | Ga0495665_0052492 | Ga0495665_0052492_18_548 | 176 |
| 897 | 3300046533 | Ga0495640_0020957 | Ga0495640_0020957_3908_4474 | 176 |
| 898 | 3300046533 | Ga0495640_0081965 | Ga0495640_0081965_28_558 | 176 |
| 899 | 3300046536 | Ga0495587_0000335 | Ga0495587_0000335_30420_30986 | 176 |
| 900 | 3300046543 | Ga0495645_0001781 | Ga0495645_0001781_5108_5638 | 176 |
| 901 | 3300046543 | Ga0495645_0123648 | Ga0495645_0123648_555_1085 | 176 |
| 902 | 3300046557 | Ga0495622_0018802 | Ga0495622_0018802_1409_1939 | 176 |
| 903 | 3300046559 | Ga0495667_0004928 | Ga0495667_0004928_973_1539 | 176 |
| 904 | 3300046559 | Ga0495667_0042835 | Ga0495667_0042835_1297_1827 | 176 |
| 905 | 3300046559 | Ga0495667_0358182 | Ga0495667_0358182_305_835 | 176 |
| 906 | 3300046642 | Ga0495634_0007696 | Ga0495634_0007696_1716_2246 | 176 |
| 907 | 3300046642 | Ga0495634_0017766 | Ga0495634_0017766_452_1018 | 176 |
| 908 | 3300046663 | Ga0495635_0000736 | Ga0495635_0000736_4706_5272 | 176 |
| 909 | 3300046663 | Ga0495635_0045113 | Ga0495635_0045113_2413_2982 | 176 |
| 910 | 3300046663 | Ga0495635_0061837 | Ga0495635_0061837_414_944 | 176 |
| 911 | 3300046675 | Ga0495657_0000836 | Ga0495657_0000836_1657_2223 | 176 |
| 912 | 3300046675 | Ga0495657_0082765 | Ga0495657_0082765_158_688 | 176 |
| 913 | 3300046675 | Ga0495657_0110571 | Ga0495657_0110571_1092_1622 | 176 |
| 914 | 3300046675 | Ga0495657_0393244 | Ga0495657_0393244_67_597 | 176 |
| 915 | 3300046678 | Ga0495599_0134578 | Ga0495599_0134578_125_691 | 176 |
| 916 | 3300046679 | Ga0495623_0027709 | Ga0495623_0027709_2646_3212 | 176 |
| 917 | 3300046680 | Ga0495646_0000229 | Ga0495646_0000229_8948_9514 | 176 |
| 918 | 3300046680 | Ga0495646_0006372 | Ga0495646_0006372_6702_7232 | 176 |
| 919 | 3300046683 | Ga0495658_0002748 | Ga0495658_0002748_1401_1931 | 176 |
| 920 | 3300046684 | Ga0495669_0119181 | Ga0495669_0119181_220_777 | 176 |
| 921 | 3300046684 | Ga0495669_0182857 | Ga0495669_0182857_37_567 | 176 |
| 922 | 3300046809 | Ga0495600_0004219 | Ga0495600_0004219_1578_2144 | 176 |
| 923 | 3300046809 | Ga0495600_0009757 | Ga0495600_0009757_4132_4662 | 176 |
| 924 | 3300046809 | Ga0495600_0135366 | Ga0495600_0135366_152_682 | 176 |
| 925 | 3300046809 | Ga0495600_0261780 | Ga0495600_0261780_350_880 | 176 |
| 926 | 3300047317 | Ga0495604_0021677 | Ga0495604_0021677_1274_1804 | 176 |
| 927 | 3300047317 | Ga0495604_0028471 | Ga0495604_0028471_120_686 | 176 |
| 928 | 3300047317 | Ga0495604_0043834 | Ga0495604_0043834_1319_1849 | 176 |
| 929 | 3300047319 | Ga0495674_0034790 | Ga0495674_0034790_1260_1790 | 176 |
| 930 | 3300047319 | Ga0495674_0050397 | Ga0495674_0050397_419_985 | 176 |
| 931 | 3300047322 | Ga0495680_0005567 | Ga0495680_0005567_9817_10383 | 176 |
| 932 | 3300047322 | Ga0495680_0015939 | Ga0495680_0015939_1095_1625 | 176 |
| 933 | 3300047322 | Ga0495680_0036864 | Ga0495680_0036864_2109_2639 | 176 |
| 934 | 3300047444 | Ga0495675_0000139 | Ga0495675_0000139_973_1539 | 176 |
| 935 | 3300047445 | Ga0495677_0019658 | Ga0495677_0019658_1373_1903 | 176 |
| 936 | 3300047471 | Ga0495684_0016053 | Ga0495684_0016053_3680_4246 | 176 |
| 937 | 3300047471 | Ga0495684_0255654 | Ga0495684_0255654_430_960 | 176 |
| 938 | 3300047673 | Ga0495593_0064941 | Ga0495593_0064941_1341_1871 | 176 |
| 939 | 3300047673 | Ga0495593_0116979 | Ga0495593_0116979_414_980 | 176 |
| 940 | 3300048088 | Ga0495602_0004714 | Ga0495602_0004714_3366_3896 | 176 |
| 941 | 3300048088 | Ga0495602_0006950 | Ga0495602_0006950_2894_3460 | 176 |
| 942 | 3300048088 | Ga0495602_0630110 | Ga0495602_0630110_159_689 | 176 |
| 943 | 3300048903 | Ga0496100_0000057 | Ga0496100_0000057_14021_14551 | 176 |
| 944 | 3300048903 | Ga0496100_0088881 | Ga0496100_0088881_488_1018 | 176 |
| 945 | 3300048903 | Ga0496100_0126792 | Ga0496100_0126792_861_1427 | 176 |
| 946 | 3300048903 | Ga0496100_1162460 | Ga0496100_1162460_21_551 | 176 |
| 947 | 3300048904 | Ga0496101_0001297 | Ga0496101_0001297_3255_3785 | 176 |
| 948 | 3300048904 | Ga0496101_0021335 | Ga0496101_0021335_1111_1641 | 176 |
| 949 | 3300048904 | Ga0496101_0697545 | Ga0496101_0697545_143_673 | 176 |
| 950 | 3300048905 | Ga0496102_0001628 | Ga0496102_0001628_7059_7589 | 176 |
| 951 | 3300048905 | Ga0496102_0031718 | Ga0496102_0031718_117_647 | 176 |
| 952 | 3300048905 | Ga0496102_0146655 | Ga0496102_0146655_611_1141 | 176 |
| 953 | 3300048905 | Ga0496102_0447252 | Ga0496102_0447252_145_675 | 176 |
| 954 | 3300048905 | Ga0496102_0465246 | Ga0496102_0465246_108_689 | 176 |
| 955 | 3300048906 | Ga0496103_0003313 | Ga0496103_0003313_9142_9672 | 176 |
| 956 | 3300048906 | Ga0496103_0016110 | Ga0496103_0016110_834_1364 | 176 |
| 957 | 3300048907 | Ga0496104_0000658 | Ga0496104_0000658_26585_27154 | 176 |
| 958 | 3300048907 | Ga0496104_0063613 | Ga0496104_0063613_2250_2780 | 176 |
| 959 | 3300048907 | Ga0496104_0143016 | Ga0496104_0143016_614_1144 | 176 |
| 960 | 3300048907 | Ga0496104_0242057 | Ga0496104_0242057_333_899 | 176 |
| 961 | 3300048907 | Ga0496104_0330861 | Ga0496104_0330861_491_1021 | 176 |
| 962 | 3300048907 | Ga0496104_0349874 | Ga0496104_0349874_720_1250 | 176 |
| 963 | 3300048907 | Ga0496104_0378776 | Ga0496104_0378776_128_658 | 176 |
| 964 | 3300048908 | Ga0496105_0003619 | Ga0496105_0003619_3769_4299 | 176 |
| 965 | 3300048908 | Ga0496105_0007433 | Ga0496105_0007433_3642_4211 | 176 |
| 966 | 3300048908 | Ga0496105_0051118 | Ga0496105_0051118_2796_3326 | 176 |
| 967 | 3300048908 | Ga0496105_0128809 | Ga0496105_0128809_1226_1756 | 176 |
| 968 | 3300048908 | Ga0496105_0713944 | Ga0496105_0713944_177_707 | 176 |
| 969 | 3300048909 | Ga0496106_0000518 | Ga0496106_0000518_11160_11690 | 176 |
| 970 | 3300048909 | Ga0496106_0013856 | Ga0496106_0013856_4376_4906 | 176 |
| 971 | 3300048909 | Ga0496106_0016140 | Ga0496106_0016140_3121_3702 | 176 |
| 972 | 3300048909 | Ga0496106_0036474 | Ga0496106_0036474_15_545 | 176 |
| 973 | 3300048909 | Ga0496106_0211603 | Ga0496106_0211603_651_1181 | 176 |
| 974 | 3300048910 | Ga0496107_0001129 | Ga0496107_0001129_3255_3785 | 176 |
| 975 | 3300048910 | Ga0496107_0008616 | Ga0496107_0008616_4842_5402 | 176 |
| 976 | 3300048910 | Ga0496107_0023162 | Ga0496107_0023162_3369_3899 | 176 |
| 977 | 3300048910 | Ga0496107_0061873 | Ga0496107_0061873_1688_2218 | 176 |
| 978 | 3300048910 | Ga0496107_0275409 | Ga0496107_0275409_384_950 | 176 |
| 979 | 3300048910 | Ga0496107_0981283 | Ga0496107_0981283_22_552 | 176 |
| 980 | 3300048911 | Ga0496108_0004254 | Ga0496108_0004254_8476_9006 | 176 |
| 981 | 3300048911 | Ga0496108_0044088 | Ga0496108_0044088_2035_2565 | 176 |
| 982 | 3300048912 | Ga0496109_0000390 | Ga0496109_0000390_26081_26611 | 176 |
| 983 | 3300048912 | Ga0496109_0002432 | Ga0496109_0002432_504_1034 | 176 |
| 984 | 3300048912 | Ga0496109_0023523 | Ga0496109_0023523_1670_2236 | 176 |
| 985 | 3300048912 | Ga0496109_0038068 | Ga0496109_0038068_584_1114 | 176 |
| 986 | 3300048913 | Ga0496110_0005641 | Ga0496110_0005641_4353_4883 | 176 |
| 987 | 3300048913 | Ga0496110_0014086 | Ga0496110_0014086_4631_5161 | 176 |
| 988 | 3300048913 | Ga0496110_0186510 | Ga0496110_0186510_167_697 | 176 |
| 989 | 3300048914 | Ga0496111_0020628 | Ga0496111_0020628_3967_4497 | 176 |
| 990 | 3300048914 | Ga0496111_0027669 | Ga0496111_0027669_2393_2923 | 176 |
| 991 | 3300048914 | Ga0496111_0092363 | Ga0496111_0092363_969_1499 | 176 |
| 992 | 3300048915 | Ga0496112_0025896 | Ga0496112_0025896_2291_2821 | 176 |
| 993 | 3300048916 | Ga0496113_0019170 | Ga0496113_0019170_277_807 | 176 |
| 994 | 3300048916 | Ga0496113_0120372 | Ga0496113_0120372_290_820 | 176 |
| 995 | 3300048917 | Ga0496114_0002944 | Ga0496114_0002944_612_1142 | 176 |
| 996 | 3300048917 | Ga0496114_0046938 | Ga0496114_0046938_1813_2343 | 176 |
| 997 | 3300048917 | Ga0496114_0266690 | Ga0496114_0266690_702_1232 | 176 |
| 998 | 3300048917 | Ga0496114_0704363 | Ga0496114_0704363_35_604 | 176 |
| 999 | 3300048918 | Ga0496115_0014682 | Ga0496115_0014682_4840_5409 | 176 |
| 1000 | 3300048918 | Ga0496115_0073108 | Ga0496115_0073108_1905_2435 | 176 |
| 1001 | 3300048918 | Ga0496115_0179507 | Ga0496115_0179507_835_1365 | 176 |
| 1002 | 3300048918 | Ga0496115_0586416 | Ga0496115_0586416_81_611 | 176 |
| 1003 | 3300048928 | Ga0496125_0300386 | Ga0496125_0300386_141_671 | 176 |
| 1004 | 3300049581 | Ga0501047_0425427 | Ga0501047_0425427_441_983 | 176 |
| 1005 | 3300049590 | Ga0501074_0095235 | Ga0501074_0095235_495_1031 | 176 |
| 1006 | 3300049592 | Ga0501076_0127841 | Ga0501076_0127841_603_1133 | 176 |
| 1007 | 3300049593 | Ga0501077_0358400 | Ga0501077_0358400_139_672 | 176 |
| 1008 | 3300049742 | Ga0501080_0178247 | Ga0501080_0178247_1264_1794 | 176 |
| 1009 | 3300049743 | Ga0501081_0389603 | Ga0501081_0389603_479_1009 | 176 |
| 1010 | 3300049824 | Ga0501045_0259239 | Ga0501045_0259239_625_1155 | 176 |
| 1011 | 3300050507 | nmdc:mga05p37_45_c1 | nmdc:mga05p37_45_c1_77887_78453 | 176 |
| 1012 | 3300050508 | nmdc:mga09592_1055_c1 | nmdc:mga09592_1055_c1_6991_7557 | 176 |
| 1013 | 3300050509 | nmdc:mga0qj67_701_c1 | nmdc:mga0qj67_701_c1_13590_14156 | 176 |
| 1014 | 3300050510 | nmdc:mga06r32_227_c1 | nmdc:mga06r32_227_c1_10651_11217 | 176 |
| 1015 | 3300050511 | nmdc:mga08y16_1666_c1 | nmdc:mga08y16_1666_c1_1523_2089 | 176 |
| 1016 | 3300050511 | nmdc:mga08y16_26694_c1 | nmdc:mga08y16_26694_c1_5182_5712 | 176 |
| 1017 | 3300050512 | nmdc:mga0n895_379872_c1 | nmdc:mga0n895_379872_c1_377_907 | 176 |
| 1018 | 3300050512 | nmdc:mga0n895_4930_c1 | nmdc:mga0n895_4930_c1_9121_9651 | 176 |
| 1019 | 3300050512 | nmdc:mga0n895_50_c1 | nmdc:mga0n895_50_c1_56571_57137 | 176 |
| 1020 | 3300050512 | nmdc:mga0n895_684569_c1 | nmdc:mga0n895_684569_c1_257_787 | 176 |
| 1021 | 3300050513 | nmdc:mga0rr50_17122_c1 | nmdc:mga0rr50_17122_c1_2976_3506 | 176 |
| 1022 | 3300050513 | nmdc:mga0rr50_19371_c1 | nmdc:mga0rr50_19371_c1_90_620 | 176 |
| 1023 | 3300050513 | nmdc:mga0rr50_485637_c1 | nmdc:mga0rr50_485637_c1_115_645 | 176 |
| 1024 | 3300050513 | nmdc:mga0rr50_67221_c1 | nmdc:mga0rr50_67221_c1_365_931 | 176 |
| 1025 | 3300050513 | nmdc:mga0rr50_77127_c1 | nmdc:mga0rr50_77127_c1_284_814 | 176 |
| 1026 | 3300050514 | nmdc:mga08x19_20074_c1 | nmdc:mga08x19_20074_c1_2665_3195 | 176 |
| 1027 | 3300050514 | nmdc:mga08x19_639141_c1 | nmdc:mga08x19_639141_c1_121_651 | 176 |
| 1028 | 3300050515 | nmdc:mga0a205_21352_c1 | nmdc:mga0a205_21352_c1_3441_3971 | 176 |
| 1029 | 3300050515 | nmdc:mga0a205_2228_c1 | nmdc:mga0a205_2228_c1_12512_13042 | 176 |
| 1030 | 3300050515 | nmdc:mga0a205_4901_c1 | nmdc:mga0a205_4901_c1_10073_10639 | 176 |
| 1031 | 3300053077 | Ga0495601_0000204 | Ga0495601_0000204_2302_2832 | 176 |
| 1032 | 3300053077 | Ga0495601_0002295 | Ga0495601_0002295_6522_7052 | 176 |
| 1033 | 3300053077 | Ga0495601_0002402 | Ga0495601_0002402_7488_8054 | 176 |
| 1034 | 3300053078 | Ga0495612_0000384 | Ga0495612_0000384_14900_15430 | 176 |
| 1035 | 3300053078 | Ga0495612_0011006 | Ga0495612_0011006_1280_1810 | 176 |
| 1036 | 3300053078 | Ga0495612_0012068 | Ga0495612_0012068_698_1264 | 176 |
| 1037 | 3300053084 | Ga0495595_0000577 | Ga0495595_0000577_2212_2742 | 176 |
| 1038 | 3300053084 | Ga0495595_0000686 | Ga0495595_0000686_825_1391 | 176 |
| 1039 | 3300053084 | Ga0495595_0001081 | Ga0495595_0001081_5413_5943 | 176 |
| 1040 | 3300053085 | Ga0495619_0000260 | Ga0495619_0000260_22849_23379 | 176 |
| 1041 | 3300053085 | Ga0495619_0000655 | Ga0495619_0000655_9984_10514 | 176 |
| 1042 | 3300053085 | Ga0495619_0017989 | Ga0495619_0017989_1659_2225 | 176 |
| 1043 | 3300053098 | Ga0500650_0164994 | Ga0500650_0164994_129_662 | 176 |
| 1044 | 3300060353 | Ga0501082_0601343 | Ga0501082_0601343_74_604 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r4q-assembly3.cif.gz_E-2 | crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens | 0.7985 | 23 | 140 |
| 1ecs-assembly1.cif.gz_B | the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 | 0.7927 | 24 | 143 |
| 3r4q-assembly2.cif.gz_D | crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens | 0.7903 | 23 | 140 |
| 4nb2-assembly1.cif.gz_B | crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure | 0.7887 | 23 | 145 |
| 5ump-assembly1.cif.gz_B | crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 | 0.7833 | 22 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O57457_206_298_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8451 | 114 | 141 | 2.30.29.30 |
| af_Q2FVA5_9_134_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8366 | 22 | 148 | 3.10.180.10 |
| af_Q2FYM3_1_61_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8341 | 24 | 70 | 3.10.180.10 |
| af_Q2FZ81_10_141_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8214 | 24 | 158 | 3.10.180.10 |
| af_Q2FVA5_9_134_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8183 | 22 | 148 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431P746-F1-model_v4 | deleted | 0.9878 | 94 | 173 |
|
| AF-A0A7Z9I5U6-F1-model_v4 | Glyoxalase | 0.9819 | 106 | 172 |
|
| AF-A0A838GBZ9-F1-model_v4 | VOC family protein | 0.9811 | 86 | 169 |
|
| AF-A0A4Q3WBU0-F1-model_v4 | Glyoxalase | 0.9675 | 86 | 168 |
|
| AF-A0A431P746-F1-model_v4 | deleted | 0.964 | 94 | 173 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar