F488919

General Info

Members Datasets Scaffolds Average Seq Length
1044 466 1024 261

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0115769|Ga0500559_0115769_295_1137
Length 280
Sequence VDAGFRIRSGSTEDQSFTGSILIMTTAPAPFHDLKQKWREGRPTFGAIATIPSIQTVRIMAQSLDWIIVDCEHGPIDLNTAHGMIMATSGTPCTPLVRIAANEPWLAKAPMDIGAMGINFPMVNSAADAAKAVSSLRYPPTGERLWGPFHAPFRWNTGMPDYMARADDSMICMVTIEHIDAVENIDTIMATPGIDIAVIGVGDLATSIGKRGQPGDPEVQALVARAEAGIRKSGVPLGGAALNAEMGNAMIDRGYVLLALGFDWSLFQRGIMAGFEGIKR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2791355199
7 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
13 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
14 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
15 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
16 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
135 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
136 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
137 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
138 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
210 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
211 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
212 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
213 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
219 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
270 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
271 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
272 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
273 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
274 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
279 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
298 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
301 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
302 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
352 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
353 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
354 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
372 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
383 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
384 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
385 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
386 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
387 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
397 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
415 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
416 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
417 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
418 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
419 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
420 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
421 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
422 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
423 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
424 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
425 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
426 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
427 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
428 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
429 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
430 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
431 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
432 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
433 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
434 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
435 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
436 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
437 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
438 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
439 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
440 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
441 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
442 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
443 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
444 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
445 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
446 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
449 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
450 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
451 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
452 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
453 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
454 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
457 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
458 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
459 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
460 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
461 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
462 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
463 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
464 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
465 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
466 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0.19
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.9
Nodule 2.39
Rhizoplane 7.66
Rhizosphere 65.61
Stem 0
Stem Tuber 0
Unclassified 8.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1004743 3300002073 Bacteria 1463
2 JGI25406J46586_10019112 3300003203 Bacteria 2800
3 JGI25153J46596_10000366 3300003215 Bacteria 31011
4 JGI25153J46596_10003459 3300003215 Bacteria 8844
5 JGI25153J46596_10004454 3300003215 Bacteria 7551
6 JGI25160J50197_1000729 3300003354 Bacteria 17998
7 JGI25160J50197_1005746 3300003354 Bacteria 5118
8 JGI25404J52841_10001176 3300003659 Bacteria 4465
9 JGI25404J52841_10005591 3300003659 Bacteria 2597
10 JGI25404J52841_10011264 3300003659 Bacteria 1927
11 JGI25404J52841_10020849 3300003659 Bacteria 1419
12 JGI25404J52841_10035503 3300003659 Bacteria 1062
13 Ga0055542_1012548 3300003762 Bacteria 1462
14 Ga0055543_1008363 3300004625 Bacteria 2295
15 Ga0065165_1000278 3300005262 Bacteria 87353
16 Ga0065165_1011041 3300005262 Bacteria 3821
17 Ga0065165_1013968 3300005262 Bacteria 3147
18 Ga0065715_10183263 3300005293 Bacteria 1462
19 Ga0070658_10075965 3300005327 Bacteria 2756
20 Ga0070676_10071609 3300005328 Bacteria 2082
21 Ga0070683_100163357 3300005329 Bacteria 2113
22 Ga0070690_100092911 3300005330 Bacteria 1990
23 Ga0070670_100281259 3300005331 Bacteria 1453
24 Ga0068869_100047994 3300005334 Bacteria 3085
25 Ga0068869_100055295 3300005334 Bacteria 2892
26 Ga0068869_100104819 3300005334 Bacteria 2144
27 Ga0070666_10388134 3300005335 Bacteria 1003
28 Ga0070680_100010206 3300005336 Bacteria 7240
29 Ga0070682_100183420 3300005337 Bacteria 1464
30 Ga0070682_100212131 3300005337 Bacteria 1373
31 Ga0068868_100015888 3300005338 Bacteria 5578
32 Ga0068868_100045227 3300005338 Bacteria 3444
33 Ga0070660_100024156 3300005339 Bacteria 4508
34 Ga0070660_100185563 3300005339 Bacteria 1684
35 Ga0070689_100123418 3300005340 Bacteria 2070
36 Ga0070691_10129254 3300005341 Bacteria 1278
37 Ga0070661_100079872 3300005344 Bacteria 2414
38 Ga0070661_100252637 3300005344 Bacteria 1361
39 Ga0070668_100012569 3300005347 Bacteria 6303
40 Ga0070668_100044471 3300005347 Bacteria 3406
41 Ga0070668_100176725 3300005347 Bacteria 1741
42 Ga0070668_100364711 3300005347 Bacteria 1226
43 Ga0070669_100019904 3300005353 Bacteria 4794
44 Ga0070669_100402251 3300005353 Bacteria 1120
45 Ga0070671_100083173 3300005355 Bacteria 2676
46 Ga0070674_100067707 3300005356 Bacteria 2512
47 Ga0070673_100125690 3300005364 Bacteria 2145
48 Ga0070688_100141898 3300005365 Bacteria 1633
49 Ga0070688_100286883 3300005365 Bacteria 1185
50 Ga0070667_100086637 3300005367 Bacteria 2688
51 Ga0070667_100183279 3300005367 Bacteria 1852
52 Ga0070709_10000321 3300005434 Bacteria 30544
53 Ga0070709_10031836 3300005434 Bacteria 3176
54 Ga0070709_10040970 3300005434 Bacteria 2850
55 Ga0070714_100186448 3300005435 Bacteria 1890
56 Ga0070714_100189894 3300005435 Bacteria 1874
57 Ga0070713_100034852 3300005436 Bacteria 4048
58 Ga0070713_100072247 3300005436 Bacteria 2917
59 Ga0070710_10000643 3300005437 Bacteria 16645
60 Ga0070710_10017631 3300005437 Bacteria 3658
61 Ga0070710_10120491 3300005437 Bacteria 1588
62 Ga0070711_100023304 3300005439 Bacteria 4024
63 Ga0070711_100067274 3300005439 Bacteria 2513
64 Ga0070700_100075552 3300005441 Bacteria 2161
65 Ga0070694_100175875 3300005444 Bacteria 1580
66 Ga0070663_100021332 3300005455 Bacteria 4307
67 Ga0070663_100051045 3300005455 Bacteria 2944
68 Ga0070663_100051598 3300005455 Bacteria 2931
69 Ga0070663_100173815 3300005455 Bacteria 1667
70 Ga0070663_100270029 3300005455 Bacteria 1352
71 Ga0070663_100373540 3300005455 Bacteria 1159
72 Ga0070678_100019116 3300005456 Bacteria 4457
73 Ga0070678_100068453 3300005456 Bacteria 2646
74 Ga0070678_100075032 3300005456 Bacteria 2543
75 Ga0070678_100102928 3300005456 Bacteria 2217
76 Ga0070662_100115690 3300005457 Bacteria 2049
77 Ga0070662_100117741 3300005457 Bacteria 2032
78 Ga0070662_100121975 3300005457 Bacteria 1999
79 Ga0070662_100173828 3300005457 Bacteria 1693
80 Ga0070681_10061815 3300005458 Bacteria 3719
81 Ga0070681_10111762 3300005458 Bacteria 2671
82 Ga0070681_10174929 3300005458 Bacteria 2068
83 Ga0070681_10265397 3300005458 Bacteria 1628
84 Ga0068867_100108604 3300005459 Bacteria 2128
85 Ga0068867_100110645 3300005459 Bacteria 2110
86 Ga0068867_100463638 3300005459 Bacteria 1082
87 Ga0070685_10160931 3300005466 Bacteria 1431
88 Ga0070698_100232538 3300005471 Bacteria 1777
89 Ga0070679_100018864 3300005530 Bacteria 6698
90 Ga0070679_100042441 3300005530 Bacteria 4529
91 Ga0070679_100321402 3300005530 Bacteria 1497
92 Ga0070679_100326100 3300005530 Bacteria 1484
93 Ga0070684_100015968 3300005535 Bacteria 6131
94 Ga0070684_100017476 3300005535 Bacteria 5889
95 Ga0070684_100095065 3300005535 Bacteria 2655
96 Ga0070697_100013902 3300005536 Bacteria 6318
97 Ga0068853_100011732 3300005539 Bacteria 7120
98 Ga0068853_100136803 3300005539 Bacteria 2197
99 Ga0068853_100151890 3300005539 Bacteria 2085
100 Ga0070686_100202531 3300005544 Bacteria 1424
101 Ga0070686_100266519 3300005544 Bacteria 1258
102 Ga0070693_100017871 3300005547 Bacteria 3696
103 Ga0070665_100008531 3300005548 Bacteria 10368
104 Ga0070665_100024503 3300005548 Bacteria 6078
105 Ga0070665_100094785 3300005548 Bacteria 2989
106 Ga0070665_100106328 3300005548 Bacteria 2808
107 Ga0070665_100215170 3300005548 Bacteria 1922
108 Ga0070665_100259378 3300005548 Bacteria 1739
109 Ga0070665_100474580 3300005548 Bacteria 1261
110 Ga0070665_100693089 3300005548 Bacteria 1032
111 Ga0068855_100060159 3300005563 Bacteria 4443
112 Ga0068855_100071075 3300005563 Bacteria 4047
113 Ga0068855_100123883 3300005563 Bacteria 2956
114 Ga0068855_100185338 3300005563 Bacteria 2351
115 Ga0070664_100033202 3300005564 Bacteria 4320
116 Ga0070664_100480797 3300005564 Bacteria 1143
117 Ga0068857_100044204 3300005577 Bacteria 3950
118 Ga0068857_100265276 3300005577 Bacteria 1577
119 Ga0068854_100092238 3300005578 Bacteria 2256
120 Ga0068856_100594570 3300005614 Bacteria 1128
121 Ga0070702_100338152 3300005615 Bacteria 1055
122 Ga0068852_100049132 3300005616 Bacteria 3607
123 Ga0068852_100059330 3300005616 Bacteria 3318
124 Ga0068852_100270940 3300005616 Bacteria 1634
125 Ga0068859_100075880 3300005617 Bacteria 3402
126 Ga0068859_100383615 3300005617 Bacteria 1501
127 Ga0068864_100100435 3300005618 Bacteria 2565
128 Ga0068864_100356219 3300005618 Bacteria 1382
129 Ga0068866_10019214 3300005718 Bacteria 3105
130 Ga0068866_10026450 3300005718 Bacteria 2740
131 Ga0068866_10075346 3300005718 Bacteria 1796
132 Ga0068861_100044893 3300005719 Bacteria 3325
133 Ga0068861_100071020 3300005719 Bacteria 2698
134 Ga0068861_100448540 3300005719 Bacteria 1155
135 Ga0068851_10042077 3300005834 Bacteria 2299
136 Ga0068863_100361737 3300005841 Bacteria 1415
137 Ga0068858_100130635 3300005842 Bacteria 2355
138 Ga0068858_100504165 3300005842 Bacteria 1169
139 Ga0068860_100028576 3300005843 Bacteria 5369
140 Ga0068860_100113935 3300005843 Bacteria 2586
141 Ga0068860_100272704 3300005843 Bacteria 1651
142 Ga0068860_100451934 3300005843 Bacteria 1278
143 Ga0068862_100044232 3300005844 Bacteria 3797
144 Ga0068862_100111239 3300005844 Bacteria 2404
145 Ga0068862_100153409 3300005844 Bacteria 2051
146 Ga0068862_100154996 3300005844 Bacteria 2041
147 Ga0068862_100294050 3300005844 Bacteria 1492
148 Ga0068862_100564389 3300005844 Bacteria 1088
149 Ga0081455_10002423 3300005937 Bacteria 22248
150 Ga0081455_10014321 3300005937 Bacteria 7781
151 Ga0081455_10027456 3300005937 Bacteria 5217
152 Ga0081455_10141150 3300005937 Bacteria 1871
153 Ga0081538_10043188 3300005981 Bacteria 2834
154 Ga0081540_1002773 3300005983 Bacteria 14213
155 Ga0081540_1003578 3300005983 Bacteria 12209
156 Ga0081540_1006176 3300005983 Bacteria 8783
157 Ga0081540_1011101 3300005983 Bacteria 6047
158 Ga0081540_1018496 3300005983 Bacteria 4272
159 Ga0081540_1019810 3300005983 Bacteria 4072
160 Ga0081540_1023306 3300005983 Bacteria 3623
161 Ga0081540_1030875 3300005983 Bacteria 2959
162 Ga0081540_1037049 3300005983 Bacteria 2590
163 Ga0081540_1050246 3300005983 Bacteria 2073
164 Ga0081540_1118772 3300005983 Bacteria 1102
165 Ga0081539_10000747 3300005985 Bacteria 64612
166 Ga0081539_10071601 3300005985 Bacteria 1856
167 Ga0070717_10080272 3300006028 Bacteria 2737
168 Ga0070717_10266497 3300006028 Bacteria 1516
169 Ga0075365_10027907 3300006038 Bacteria 3595
170 Ga0075365_10048361 3300006038 Bacteria 2799
171 Ga0075365_10055734 3300006038 Bacteria 2625
172 Ga0075365_10058056 3300006038 Bacteria 2575
173 Ga0075365_10073033 3300006038 Bacteria 2311
174 Ga0075368_10005485 3300006042 Bacteria 4364
175 Ga0075368_10037556 3300006042 Bacteria 1894
176 Ga0075368_10087362 3300006042 Bacteria 1273
177 Ga0075363_100015314 3300006048 Bacteria 3768
178 Ga0075364_10008417 3300006051 Bacteria 6165
179 Ga0075364_10027628 3300006051 Bacteria 3626
180 Ga0075364_10033448 3300006051 Bacteria 3311
181 Ga0075364_10074324 3300006051 Bacteria 2241
182 Ga0070716_100003039 3300006173 Bacteria 7830
183 Ga0070716_100063710 3300006173 Bacteria 2141
184 Ga0070716_100092284 3300006173 Bacteria 1835
185 Ga0070712_100001170 3300006175 Bacteria 15895
186 Ga0070712_100044408 3300006175 Bacteria 3064
187 Ga0070712_100050251 3300006175 Bacteria 2900
188 Ga0070712_100058594 3300006175 Bacteria 2709
189 Ga0075362_10033896 3300006177 Bacteria 2223
190 Ga0075362_10102798 3300006177 Bacteria 1338
191 Ga0075367_10030820 3300006178 Bacteria 3077
192 Ga0075367_10093254 3300006178 Bacteria 1834
193 Ga0075367_10228330 3300006178 Bacteria 1166
194 Ga0075369_10086957 3300006186 Bacteria 1392
195 Ga0075369_10147230 3300006186 Bacteria 1075
196 Ga0075366_10029871 3300006195 Bacteria 3202
197 Ga0075366_10031820 3300006195 Bacteria 3105
198 Ga0075366_10077094 3300006195 Bacteria 1989
199 Ga0097621_100058724 3300006237 Bacteria 3148
200 Ga0097621_100495607 3300006237 Bacteria 1106
201 Ga0075370_10015749 3300006353 Bacteria 4055
202 Ga0075370_10041235 3300006353 Bacteria 2605
203 Ga0075370_10084193 3300006353 Bacteria 1830
204 Ga0075370_10191964 3300006353 Bacteria 1204
205 Ga0075370_10208920 3300006353 Bacteria 1152
206 Ga0068871_100034617 3300006358 Bacteria 4009
207 Ga0068871_100087688 3300006358 Bacteria 2588
208 Ga0068871_100525786 3300006358 Bacteria 1069
209 Ga0075428_100077239 3300006844 Bacteria 3635
210 Ga0075434_100286281 3300006871 Bacteria 1668
211 Ga0075434_100377517 3300006871 Bacteria 1438
212 Ga0068865_100045334 3300006881 Bacteria 3014
213 Ga0097620_100075881 3300006931 Bacteria 3402
214 Ga0097620_100383566 3300006931 Bacteria 1501
215 Ga0099822_1011696 3300006943 Bacteria 10656
216 Ga0099795_10158387 3300007788 Bacteria 932
217 Ga0105240_10015488 3300009093 Bacteria 10365
218 Ga0105240_10027333 3300009093 Bacteria 7470
219 Ga0105240_10365826 3300009093 Bacteria 1632
220 Ga0105240_10486506 3300009093 Bacteria 1375
221 Ga0111539_10153919 3300009094 Bacteria 2691
222 Ga0105245_10038988 3300009098 Bacteria 4228
223 Ga0105245_10194108 3300009098 Bacteria 1947
224 Ga0105245_10458883 3300009098 Bacteria 1284
225 Ga0105247_10037260 3300009101 Bacteria 2967
226 Ga0114129_10189934 3300009147 Bacteria 2790
227 Ga0105243_10016903 3300009148 Bacteria 5516
228 Ga0105243_10213855 3300009148 Bacteria 1699
229 Ga0105241_10065293 3300009174 Bacteria 2812
230 Ga0105242_10044906 3300009176 Bacteria 3579
231 Ga0105242_10115794 3300009176 Bacteria 2292
232 Ga0105242_10295013 3300009176 Bacteria 1478
233 Ga0105242_10419850 3300009176 Bacteria 1253
234 Ga0105237_10052107 3300009545 Bacteria 4109
235 Ga0105237_10075722 3300009545 Bacteria 3356
236 Ga0105237_10209042 3300009545 Bacteria 1952
237 Ga0105238_10059171 3300009551 Bacteria 3839
238 Ga0105238_10340890 3300009551 Bacteria 1487
239 Ga0105249_10048330 3300009553 Bacteria 3879
240 Ga0105249_10369068 3300009553 Bacteria 1458
241 Ga0105239_10003918 3300010375 Bacteria 18036
242 Ga0105239_10032269 3300010375 Bacteria 5756
243 Ga0105239_10099980 3300010375 Bacteria 3207
244 Ga0105239_10105757 3300010375 Bacteria 3117
245 Ga0105239_10112481 3300010375 Bacteria 3019
246 Ga0105239_10143450 3300010375 Bacteria 2662
247 Ga0105239_10157493 3300010375 Bacteria 2537
248 Ga0105246_10022596 3300011119 Bacteria 4059
249 Ga0105246_10057218 3300011119 Bacteria 2697
250 Ga0105246_10091339 3300011119 Bacteria 2195
251 Ga0157371_10422817 3300013102 Bacteria 977
252 Ga0157370_10050985 3300013104 Bacteria 3954
253 Ga0157369_10011431 3300013105 Bacteria 10082
254 Ga0157369_10020578 3300013105 Bacteria 7376
255 Ga0157369_10052559 3300013105 Bacteria 4408
256 Ga0157369_10210940 3300013105 Bacteria 2035
257 Ga0157374_10192800 3300013296 Bacteria 1993
258 Ga0163162_10065624 3300013306 Bacteria 3677
259 Ga0163162_10108248 3300013306 Bacteria 2875
260 Ga0157372_10103537 3300013307 Bacteria 3253
261 Ga0157372_10105267 3300013307 Bacteria 3227
262 Ga0157375_10015934 3300013308 Bacteria 6741
263 Ga0157375_10047153 3300013308 Bacteria 4206
264 Ga0157375_10231730 3300013308 Bacteria 2006
265 Ga0157375_10253106 3300013308 Bacteria 1922
266 Ga0163163_10017116 3300014325 Bacteria 6752
267 Ga0163163_10118731 3300014325 Bacteria 2677
268 Ga0163163_10298116 3300014325 Unclassified 1664
269 Ga0157377_10118989 3300014745 Bacteria 1598
270 Ga0157377_10175732 3300014745 Bacteria 1343
271 Ga0157379_10023569 3300014968 Bacteria 5462
272 Ga0157376_10120561 3300014969 Bacteria 2324
273 Ga0157376_10287582 3300014969 Bacteria 1551
274 Ga0157376_10615556 3300014969 Bacteria 1082
275 Ga0163161_10056327 3300017792 Bacteria 2855
276 Ga0163161_10123971 3300017792 Bacteria 1944
277 Ga0163161_10127337 3300017792 Bacteria 1919
278 Ga0206354_11003357 3300020081 Bacteria 1718
279 Ga0214544_1000020 3300021320 Bacteria 178560
280 Ga0214542_1000024 3300021321 Bacteria 191218
281 Ga0214545_1000011 3300021324 Bacteria 190550
282 Ga0214545_1030682 3300021324 Bacteria 2257
283 Ga0214543_1000033 3300021327 Bacteria 190419
284 Ga0214543_1030560 3300021327 Bacteria 2257
285 Ga0213873_10017072 3300021358 Bacteria 1650
286 Ga0213872_10020912 3300021361 Bacteria 3015
287 Ga0213874_10008958 3300021377 Bacteria 2459
288 Ga0213876_10000969 3300021384 Bacteria 18866
289 Ga0213876_10067836 3300021384 Bacteria 1884
290 Ga0213871_10001134 3300021441 Bacteria 4248
291 Ga0209563_101494 3300025230 Bacteria 6143
292 Ga0209677_102419 3300025253 Bacteria 7054
293 Ga0209677_106143 3300025253 Bacteria 2925
294 Ga0209148_1000344 3300025254 Bacteria 61011
295 Ga0209233_1008105 3300025261 Bacteria 3280
296 Ga0209455_1001281 3300025272 Bacteria 11747
297 Ga0209564_1002208 3300025295 Bacteria 16231
298 Ga0209564_1016543 3300025295 Bacteria 2926
299 Ga0209564_1018309 3300025295 Bacteria 2677
300 Ga0209758_1000407 3300025297 Bacteria 73945
301 Ga0209758_1000900 3300025297 Bacteria 40401
302 Ga0209758_1000952 3300025297 Bacteria 39040
303 Ga0209758_1001988 3300025297 Bacteria 22050
304 Ga0209758_1002062 3300025297 Bacteria 21474
305 Ga0209758_1011752 3300025297 Bacteria 5019
306 Ga0209758_1017825 3300025297 Bacteria 3511
307 Ga0209256_1011331 3300025299 Bacteria 3580
308 Ga0207426_1000466 3300025302 Bacteria 62533
309 Ga0207426_1000865 3300025302 Bacteria 31635
310 Ga0207426_1003194 3300025302 Bacteria 9234
311 Ga0207426_1012503 3300025302 Bacteria 3184
312 Ga0207426_1019417 3300025302 Bacteria 2376
313 Ga0209257_1001445 3300025304 Bacteria 28079
314 Ga0207692_10001554 3300025898 Bacteria 8637
315 Ga0207692_10184881 3300025898 Bacteria 1216
316 Ga0207692_10190424 3300025898 Bacteria 1200
317 Ga0207642_10021279 3300025899 Bacteria 2551
318 Ga0207642_10037369 3300025899 Bacteria 2092
319 Ga0207642_10054435 3300025899 Bacteria 1825
320 Ga0207710_10022007 3300025900 Bacteria 2734
321 Ga0207710_10098550 3300025900 Bacteria 1376
322 Ga0207710_10189914 3300025900 Bacteria 1011
323 Ga0207688_10031130 3300025901 Bacteria 2944
324 Ga0207688_10298393 3300025901 Bacteria 985
325 Ga0207647_10037625 3300025904 Bacteria 3067
326 Ga0207699_10000550 3300025906 Bacteria 18494
327 Ga0207699_10026311 3300025906 Bacteria 3205
328 Ga0207645_10081511 3300025907 Bacteria 2074
329 Ga0207654_10031567 3300025911 Bacteria 2919
330 Ga0207707_10000466 3300025912 Bacteria 41992
331 Ga0207707_10001222 3300025912 Bacteria 24136
332 Ga0207707_10037513 3300025912 Bacteria 4235
333 Ga0207707_10096318 3300025912 Bacteria 2586
334 Ga0207707_10186582 3300025912 Bacteria 1810
335 Ga0207695_10000029 3300025913 Bacteria 548364
336 Ga0207695_10057285 3300025913 Bacteria 4049
337 Ga0207695_10318943 3300025913 Bacteria 1444
338 Ga0207695_10493222 3300025913 Bacteria 1107
339 Ga0207671_10026230 3300025914 Bacteria 4369
340 Ga0207671_10035977 3300025914 Bacteria 3672
341 Ga0207671_10091491 3300025914 Bacteria 2292
342 Ga0207671_10193027 3300025914 Bacteria 1588
343 Ga0207693_10002659 3300025915 Bacteria 15525
344 Ga0207693_10034621 3300025915 Bacteria 3983
345 Ga0207693_10047433 3300025915 Bacteria 3375
346 Ga0207693_10075916 3300025915 Bacteria 2632
347 Ga0207693_10101701 3300025915 Bacteria 2254
348 Ga0207663_10008869 3300025916 Bacteria 5288
349 Ga0207663_10303734 3300025916 Bacteria 1193
350 Ga0207660_10004908 3300025917 Bacteria 8710
351 Ga0207657_10004634 3300025919 Bacteria 14526
352 Ga0207657_10056992 3300025919 Bacteria 3370
353 Ga0207649_10361467 3300025920 Bacteria 1077
354 Ga0207652_10002138 3300025921 Bacteria 16939
355 Ga0207652_10011255 3300025921 Bacteria 7208
356 Ga0207652_10024322 3300025921 Bacteria 5024
357 Ga0207681_10088275 3300025923 Bacteria 2208
358 Ga0207681_10088634 3300025923 Bacteria 2204
359 Ga0207681_10203927 3300025923 Bacteria 1520
360 Ga0207694_10129317 3300025924 Bacteria 2023
361 Ga0207694_10160215 3300025924 Bacteria 1817
362 Ga0207650_10298792 3300025925 Bacteria 1314
363 Ga0207659_10069356 3300025926 Bacteria 2567
364 Ga0207687_10335989 3300025927 Bacteria 1227
365 Ga0207700_10013381 3300025928 Bacteria 5336
366 Ga0207700_10013938 3300025928 Bacteria 5252
367 Ga0207700_10024525 3300025928 Bacteria 4175
368 Ga0207700_10200662 3300025928 Bacteria 1681
369 Ga0207664_10024687 3300025929 Bacteria 4519
370 Ga0207664_10076606 3300025929 Bacteria 2708
371 Ga0207664_10209111 3300025929 Bacteria 1687
372 Ga0207664_10241565 3300025929 Bacteria 1573
373 Ga0207644_10032126 3300025931 Bacteria 3660
374 Ga0207644_10187048 3300025931 Bacteria 1627
375 Ga0207690_10065536 3300025932 Bacteria 2484
376 Ga0207690_10098731 3300025932 Bacteria 2081
377 Ga0207690_10114570 3300025932 Bacteria 1947
378 Ga0207706_10083950 3300025933 Bacteria 2800
379 Ga0207706_10095838 3300025933 Bacteria 2609
380 Ga0207706_10097118 3300025933 Bacteria 2591
381 Ga0207706_10173181 3300025933 Bacteria 1896
382 Ga0207686_10039113 3300025934 Bacteria 2876
383 Ga0207686_10071513 3300025934 Bacteria 2233
384 Ga0207686_10187205 3300025934 Bacteria 1473
385 Ga0207709_10112831 3300025935 Bacteria 1821
386 Ga0207670_10173074 3300025936 Bacteria 1620
387 Ga0207669_10421677 3300025937 Bacteria 1050
388 Ga0207704_10039581 3300025938 Bacteria 2747
389 Ga0207665_10007182 3300025939 Bacteria 7370
390 Ga0207665_10032684 3300025939 Bacteria 3445
391 Ga0207665_10167316 3300025939 Bacteria 1585
392 Ga0207691_10092265 3300025940 Bacteria 2712
393 Ga0207711_10108226 3300025941 Bacteria 2469
394 Ga0207711_10184304 3300025941 Bacteria 1900
395 Ga0207711_10219462 3300025941 Bacteria 1738
396 Ga0207689_10060253 3300025942 Bacteria 3121
397 Ga0207689_10064343 3300025942 Bacteria 3018
398 Ga0207661_10000499 3300025944 Bacteria 25254
399 Ga0207661_10015755 3300025944 Bacteria 5568
400 Ga0207667_10012774 3300025949 Bacteria 9646
401 Ga0207667_10180188 3300025949 Bacteria 2170
402 Ga0207667_10338680 3300025949 Bacteria 1535
403 Ga0207667_10449313 3300025949 Bacteria 1310
404 Ga0207667_10895369 3300025949 Bacteria 879
405 Ga0207651_10080927 3300025960 Bacteria 2340
406 Ga0207712_10158443 3300025961 Bacteria 1756
407 Ga0207668_10009427 3300025972 Bacteria 5852
408 Ga0207668_10022935 3300025972 Bacteria 4002
409 Ga0207668_10026363 3300025972 Bacteria 3773
410 Ga0207668_10154981 3300025972 Bacteria 1778
411 Ga0207640_10068680 3300025981 Bacteria 2376
412 Ga0207640_10142365 3300025981 Bacteria 1750
413 Ga0207658_10072837 3300025986 Bacteria 2606
414 Ga0207658_10452004 3300025986 Bacteria 1137
415 Ga0207677_10008684 3300026023 Bacteria 5688
416 Ga0207677_10022654 3300026023 Bacteria 3865
417 Ga0207677_10088035 3300026023 Bacteria 2250
418 Ga0207703_10320567 3300026035 Bacteria 1419
419 Ga0207639_10009801 3300026041 Bacteria 6620
420 Ga0207639_10062834 3300026041 Bacteria 2873
421 Ga0207639_10105759 3300026041 Bacteria 2284
422 Ga0207639_10233030 3300026041 Bacteria 1597
423 Ga0207678_10024050 3300026067 Bacteria 5323
424 Ga0207678_10029342 3300026067 Bacteria 4801
425 Ga0207678_10040741 3300026067 Bacteria 4027
426 Ga0207678_10056118 3300026067 Bacteria 3392
427 Ga0207678_10059827 3300026067 Bacteria 3278
428 Ga0207678_10073505 3300026067 Bacteria 2930
429 Ga0207708_10062207 3300026075 Bacteria 2851
430 Ga0207702_10138490 3300026078 Bacteria 2199
431 Ga0207702_10380955 3300026078 Bacteria 1356
432 Ga0207641_10135681 3300026088 Bacteria 2215
433 Ga0207641_10146719 3300026088 Bacteria 2134
434 Ga0207641_10249515 3300026088 Bacteria 1657
435 Ga0207648_10029160 3300026089 Bacteria 4894
436 Ga0207648_10075028 3300026089 Bacteria 2948
437 Ga0207648_10485215 3300026089 Bacteria 1129
438 Ga0207676_10046804 3300026095 Bacteria 3349
439 Ga0207676_10293180 3300026095 Bacteria 1482
440 Ga0207674_10117026 3300026116 Bacteria 2636
441 Ga0207674_10118244 3300026116 Bacteria 2620
442 Ga0207675_100018245 3300026118 Bacteria 6542
443 Ga0207675_100147700 3300026118 Bacteria 2236
444 Ga0207675_100164894 3300026118 Bacteria 2115
445 Ga0207675_100372987 3300026118 Bacteria 1402
446 Ga0207683_10011914 3300026121 Bacteria 7420
447 Ga0207683_10054649 3300026121 Bacteria 3501
448 Ga0207683_10082425 3300026121 Bacteria 2857
449 Ga0207683_10132129 3300026121 Bacteria 2246
450 Ga0207683_10263993 3300026121 Bacteria 1572
451 Ga0207698_10013308 3300026142 Bacteria 5424
452 Ga0207698_10015126 3300026142 Bacteria 5158
453 Ga0207698_11055064 3300026142 Bacteria 824
454 Ga0209389_1000025 3300027296 Bacteria 149588
455 Ga0209589_1000018 3300027357 Bacteria 192614
456 Ga0209589_1000066 3300027357 Bacteria 100795
457 Ga0209489_100026 3300027361 Bacteria 192614
458 Ga0209489_100030 3300027361 Bacteria 185999
459 Ga0209700_100035 3300027363 Bacteria 192614
460 Ga0209588_1010269 3300027671 Bacteria 2812
461 Ga0268266_10001465 3300028379 Bacteria 28078
462 Ga0268266_10003531 3300028379 Bacteria 15523
463 Ga0268266_10016020 3300028379 Bacteria 6410
464 Ga0268266_10088145 3300028379 Bacteria 2716
465 Ga0268266_10095655 3300028379 Bacteria 2609
466 Ga0268266_10099013 3300028379 Bacteria 2566
467 Ga0268266_10107456 3300028379 Bacteria 2468
468 Ga0268266_10115378 3300028379 Bacteria 2384
469 Ga0268266_10371584 3300028379 Bacteria 1347
470 Ga0268266_10468669 3300028379 Bacteria 1199
471 Ga0268266_10607966 3300028379 Bacteria 1050
472 Ga0268264_10000035 3300028381 Bacteria 398196
473 Ga0265319_1028990 3300028563 Bacteria 1947
474 Ga0265334_10002345 3300028573 Bacteria 8909
475 Ga0265318_10032922 3300028577 Bacteria 2003
476 Ga0265322_10070288 3300028654 Bacteria 993
477 Ga0265336_10005760 3300028666 Bacteria 4536
478 Ga0307515_10054331 3300028794 Bacteria 5883
479 Ga0265338_10000065 3300028800 Bacteria 188966
480 Ga0265330_10073333 3300031235 Bacteria 1480
481 Ga0265330_10073974 3300031235 Bacteria 1472
482 Ga0265340_10036665 3300031247 Bacteria 2429
483 Ga0307513_10466462 3300031456 Bacteria 985
484 Ga0307509_10029857 3300031507 Bacteria 6041
485 Ga0265313_10037155 3300031595 Bacteria 2438
486 Ga0307508_10000090 3300031616 Bacteria 106893
487 Ga0307508_10065785 3300031616 Bacteria 3193
488 Ga0265342_10059059 3300031712 Bacteria 2266
489 Ga0307516_10058192 3300031730 Bacteria 3763
490 Ga0307516_10107825 3300031730 Bacteria 2593
491 Ga0307405_10100094 3300031731 Bacteria 1942
492 Ga0307410_10439284 3300031852 Bacteria 1062
493 Ga0307406_10059976 3300031901 Bacteria 2452
494 Ga0307406_10168321 3300031901 Bacteria 1583
495 Ga0307406_10313123 3300031901 Bacteria 1211
496 Ga0307510_10004617 3300033180 Bacteria 16241
497 Ga0307510_10020616 3300033180 Bacteria 7699
498 Ga0307510_10049660 3300033180 Bacteria 4459
499 Ga0316215_1002836 3300033544 Bacteria 1645
500 Ga0373930_0004457 3300034816 Bacteria 2280
501 Ga0373959_0032990 3300034820 Bacteria 1055
502 Ga0373934_0012795 3300035086 Bacteria 3169
503 Ga0373951_0021428 3300035091 Bacteria 1485
504 Ga0373923_0008238 3300035111 Bacteria 3707
505 Ga0373923_0116093 3300035111 Bacteria 1192
506 Ga0373936_0006507 3300035113 Bacteria 4403
507 Ga0373936_0026971 3300035113 Bacteria 2252
508 Ga0373939_0054122 3300035114 Bacteria 1256
509 Ga0373945_0031927 3300035116 Bacteria 1863
510 Ga0373953_0003083 3300035117 Bacteria 5124
511 Ga0373953_0069216 3300035117 Bacteria 1454
512 Ga0373956_0000726 3300035119 Bacteria 13568
513 Ga0373957_0004882 3300035120 Bacteria 4115
514 Ga0373957_0128536 3300035120 Bacteria 1030
515 Ga0373943_0004812 3300035170 Bacteria 6099
516 Ga0373943_0139550 3300035170 Bacteria 1305
517 Ga0373946_0008147 3300035171 Bacteria 3846
518 Ga0373946_0010035 3300035171 Bacteria 3502
519 Ga0373946_0079458 3300035171 Bacteria 1433
520 Ga0373955_0003241 3300035172 Bacteria 7127
521 Ga0373955_0020612 3300035172 Bacteria 3317
522 Ga0373955_0287655 3300035172 Bacteria 989
523 Ga0373924_0021158 3300035410 Bacteria 2536
524 Ga0373924_0031946 3300035410 Bacteria 2119
525 Ga0373931_0001506 3300035691 Bacteria 10029
526 Ga0373935_0095620 3300035692 Bacteria 1951
527 Ga0373935_0216431 3300035692 Bacteria 1329
528 Ga0373927_0001005 3300035695 Bacteria 21497
529 Ga0373927_0005832 3300035695 Bacteria 8449
530 Ga0373927_0113569 3300035695 Bacteria 1765
531 Ga0373927_0143691 3300035695 Bacteria 1561
532 Ga0373927_0167717 3300035695 Bacteria 1439
533 Ga0373927_0173891 3300035695 Bacteria 1412
534 Ga0373933_0009400 3300035724 Bacteria 5339
535 Ga0373933_0020192 3300035724 Bacteria 3775
536 Ga0373933_0452595 3300035724 Bacteria 840
537 Ga0373947_0003823 3300035725 Bacteria 8867
538 Ga0373947_0005667 3300035725 Bacteria 7285
539 Ga0373947_0116907 3300035725 Bacteria 1691
540 Ga0373937_0002920 3300036401 Bacteria 14286
541 Ga0373937_0195852 3300036401 Bacteria 1899
542 Ga0372808_010437 3300036459 Bacteria 1307
543 Ga0373925_0006131 3300037068 Bacteria 8880
544 Ga0373925_0079952 3300037068 Bacteria 2484
545 Ga0373925_0108079 3300037068 Bacteria 2146
546 Ga0373925_0157269 3300037068 Bacteria 1788
547 Ga0373925_0687217 3300037068 Bacteria 844
548 Ga0395900_0081560 3300037418 Bacteria 3323
549 Ga0395898_0073328 3300037466 Bacteria 3307
550 Ga0395898_0179729 3300037466 Bacteria 2022
551 Ga0395905_0015966 3300037471 Bacteria 7137
552 Ga0395905_0099550 3300037471 Bacteria 2730
553 Ga0436364_1466266 3300037853 Bacteria 1304
554 Ga0395901_0039843 3300038443 Bacteria 4863
555 Ga0395901_0179868 3300038443 Bacteria 2218
556 Ga0436365_0244764 3300039437 Bacteria 1516
557 Ga0436365_0255894 3300039437 Bacteria 31807
558 Ga0436365_0870867 3300039437 Bacteria 2556
559 Ga0436365_1891143 3300039437 Bacteria 871
560 Ga0436360_0377935 3300039438 Bacteria 912
561 Ga0436360_1119017 3300039438 Bacteria 1895
562 Ga0436360_1272541 3300039438 Bacteria 5502
563 Ga0436361_0295266 3300039447 Bacteria 1079
564 Ga0436361_0442731 3300039447 Bacteria 3924
565 Ga0436363_0323974 3300039450 Bacteria 2268
566 Ga0436363_0607645 3300039450 Bacteria 899
567 Ga0436363_1259875 3300039450 Bacteria 3215
568 Ga0436363_1577576 3300039450 Bacteria 2027
569 Ga0436362_0240249 3300039453 Bacteria 1871
570 Ga0451798_0628637 3300041458 Bacteria 967
571 Ga0451833_0240175 3300041491 Bacteria 1644
572 Ga0451847_0360949 3300041503 Bacteria 1381
573 Ga0439459_0014524 3300042438 Bacteria 1432
574 Ga0466972_0000261 3300044658 Bacteria 34759
575 Ga0466972_0050816 3300044658 Bacteria 2000
576 Ga0466965_0049773 3300044683 Bacteria 2077
577 Ga0466966_0175167 3300044684 Bacteria 1303
578 Ga0466961_0270759 3300044693 Bacteria 1040
579 Ga0466963_0216899 3300044694 Bacteria 1339
580 Ga0466968_0114682 3300044735 Bacteria 1214
581 Ga0466970_0087256 3300044765 Bacteria 1692
582 Ga0466957_0066260 3300044842 Bacteria 2226
583 Ga0466960_0133158 3300044901 Bacteria 1314
584 Ga0466959_0128863 3300045049 Bacteria 1794
585 Ga0495617_032196 3300046452 Bacteria 1760
586 Ga0495592_0001015 3300046454 Bacteria 19460
587 Ga0495592_0003697 3300046454 Bacteria 11028
588 Ga0495592_0070438 3300046454 Bacteria 2547
589 Ga0495592_0090334 3300046454 Bacteria 2198
590 Ga0495603_0004652 3300046455 Bacteria 8202
591 Ga0495603_0010944 3300046455 Bacteria 5503
592 Ga0495603_0014448 3300046455 Bacteria 4775
593 Ga0495603_0077462 3300046455 Bacteria 1950
594 Ga0495629_0003238 3300046459 Bacteria 12332
595 Ga0495629_0011592 3300046459 Bacteria 6400
596 Ga0495629_0081525 3300046459 Bacteria 2258
597 Ga0495629_0255363 3300046459 Bacteria 1205
598 Ga0495638_0009098 3300046460 Bacteria 6993
599 Ga0495638_0064537 3300046460 Bacteria 2255
600 Ga0495638_0078499 3300046460 Bacteria 2008
601 Ga0495638_0200454 3300046460 Bacteria 1127
602 Ga0495641_0009631 3300046461 Bacteria 5717
603 Ga0495651_0013141 3300046462 Bacteria 6401
604 Ga0495651_0015940 3300046462 Bacteria 5820
605 Ga0495651_0033664 3300046462 Bacteria 3996
606 Ga0495651_0178957 3300046462 Bacteria 1502
607 Ga0495653_0000934 3300046463 Bacteria 22498
608 Ga0495653_0119690 3300046463 Bacteria 1879
609 Ga0495653_0356206 3300046463 Bacteria 940
610 Ga0495580_0000612 3300046472 Bacteria 30191
611 Ga0495580_0010282 3300046472 Bacteria 7298
612 Ga0495580_0119377 3300046472 Bacteria 1831
613 Ga0495582_0000831 3300046473 Bacteria 17092
614 Ga0495582_0019067 3300046473 Bacteria 3754
615 Ga0495582_0070749 3300046473 Bacteria 1930
616 Ga0495605_0160241 3300046474 Bacteria 999
617 Ga0495605_0171646 3300046474 Bacteria 958
618 Ga0495639_0000627 3300046475 Bacteria 16367
619 Ga0495639_0040188 3300046475 Bacteria 2104
620 Ga0495639_0048465 3300046475 Bacteria 1926
621 Ga0495662_0000686 3300046476 Bacteria 16015
622 Ga0495662_0119151 3300046476 Bacteria 1295
623 Ga0495664_0009563 3300046477 Bacteria 5425
624 Ga0495664_0096442 3300046477 Bacteria 1780
625 Ga0495664_0127983 3300046477 Bacteria 1537
626 Ga0495664_0367883 3300046477 Bacteria 865
627 Ga0495584_0064018 3300046491 Bacteria 1849
628 Ga0495585_0086988 3300046492 Bacteria 1687
629 Ga0495594_0007696 3300046499 Bacteria 5543
630 Ga0495596_0041380 3300046500 Bacteria 1817
631 Ga0495607_0063530 3300046501 Bacteria 2088
632 Ga0495607_0138068 3300046501 Bacteria 1261
633 Ga0495583_0087672 3300046506 Bacteria 1344
634 Ga0495583_0134317 3300046506 Bacteria 1034
635 Ga0495606_0035698 3300046507 Bacteria 3395
636 Ga0495606_0075938 3300046507 Bacteria 2101
637 Ga0495606_0090759 3300046507 Bacteria 1880
638 Ga0495608_0002093 3300046511 Bacteria 14381
639 Ga0495608_0077941 3300046511 Bacteria 2157
640 Ga0495618_0065862 3300046514 Bacteria 2302
641 Ga0495618_0239659 3300046514 Bacteria 1140
642 Ga0495628_0020462 3300046516 Bacteria 5456
643 Ga0495628_0046153 3300046516 Bacteria 3461
644 Ga0495630_0002217 3300046517 Bacteria 13536
645 Ga0495643_0030321 3300046522 Bacteria 3021
646 Ga0495648_0013331 3300046524 Bacteria 6084
647 Ga0495648_0016179 3300046524 Bacteria 5383
648 Ga0495666_0113226 3300046526 Bacteria 1274
649 Ga0495666_0158074 3300046526 Bacteria 1052
650 Ga0495642_0162479 3300046528 Bacteria 969
651 Ga0495652_0002209 3300046529 Bacteria 20424
652 Ga0495652_0159468 3300046529 Bacteria 1753
653 Ga0495652_0203001 3300046529 Bacteria 1503
654 Ga0495665_0000866 3300046531 Bacteria 15828
655 Ga0495640_0003099 3300046533 Bacteria 13412
656 Ga0495640_0020259 3300046533 Bacteria 4898
657 Ga0495640_0026887 3300046533 Bacteria 4153
658 Ga0495640_0260171 3300046533 Bacteria 1084
659 Ga0495587_0015200 3300046536 Bacteria 4810
660 Ga0495609_0157492 3300046538 Bacteria 964
661 Ga0495597_0168045 3300046542 Bacteria 892
662 Ga0495645_0012499 3300046543 Bacteria 5983
663 Ga0495645_0013311 3300046543 Bacteria 5815
664 Ga0495622_0022179 3300046557 Bacteria 2958
665 Ga0495622_0027395 3300046557 Bacteria 2660
666 Ga0495622_0040897 3300046557 Bacteria 2156
667 Ga0495633_0016209 3300046558 Bacteria 3850
668 Ga0495633_0054611 3300046558 Bacteria 1879
669 Ga0495667_0009515 3300046559 Bacteria 6585
670 Ga0495667_0031439 3300046559 Bacteria 3564
671 Ga0495668_0025884 3300046616 Bacteria 3332
672 Ga0495634_0002722 3300046642 Bacteria 14545
673 Ga0495634_0083525 3300046642 Bacteria 2084
674 Ga0495625_0070900 3300046660 Bacteria 2446
675 Ga0495635_0000540 3300046663 Bacteria 24055
676 Ga0495635_0007303 3300046663 Bacteria 7716
677 Ga0495635_0010103 3300046663 Bacteria 6600
678 Ga0495635_0013453 3300046663 Bacteria 5725
679 Ga0495635_0177916 3300046663 Bacteria 1446
680 Ga0495661_0044100 3300046665 Bacteria 2736
681 Ga0495661_0132550 3300046665 Bacteria 1364
682 Ga0495661_0200219 3300046665 Bacteria 1046
683 Ga0495588_0050990 3300046674 Bacteria 2130
684 Ga0495588_0095442 3300046674 Bacteria 1559
685 Ga0495588_0098362 3300046674 Bacteria 1536
686 Ga0495657_0001615 3300046675 Bacteria 19351
687 Ga0495657_0003319 3300046675 Bacteria 13189
688 Ga0495657_0014067 3300046675 Bacteria 5878
689 Ga0495657_0306693 3300046675 Bacteria 946
690 Ga0495599_0007666 3300046678 Bacteria 6555
691 Ga0495599_0060654 3300046678 Bacteria 2365
692 Ga0495599_0071308 3300046678 Bacteria 2169
693 Ga0495623_0012652 3300046679 Bacteria 5461
694 Ga0495623_0042546 3300046679 Bacteria 2893
695 Ga0495623_0069774 3300046679 Bacteria 2190
696 Ga0495646_0010030 3300046680 Bacteria 6021
697 Ga0495646_0025769 3300046680 Bacteria 3697
698 Ga0495646_0038036 3300046680 Bacteria 2973
699 Ga0495646_0088196 3300046680 Bacteria 1797
700 Ga0495646_0282907 3300046680 Bacteria 881
701 Ga0495647_0006540 3300046681 Bacteria 3865
702 Ga0495658_0000295 3300046683 Bacteria 28329
703 Ga0495658_0066331 3300046683 Bacteria 2085
704 Ga0495658_0146135 3300046683 Bacteria 1449
705 Ga0495658_0147849 3300046683 Bacteria 1441
706 Ga0495613_0004147 3300046689 Bacteria 10847
707 Ga0495613_0031591 3300046689 Bacteria 3934
708 Ga0495613_0069052 3300046689 Bacteria 2577
709 Ga0495613_0069070 3300046689 Bacteria 2577
710 Ga0495613_0105420 3300046689 Bacteria 2035
711 Ga0495613_0143346 3300046689 Bacteria 1706
712 Ga0495624_0000079 3300046690 Bacteria 63196
713 Ga0495624_0151375 3300046690 Bacteria 1419
714 Ga0495670_0020636 3300046691 Bacteria 3249
715 Ga0495670_0057400 3300046691 Bacteria 1954
716 Ga0495649_0030534 3300046694 Bacteria 2976
717 Ga0495649_0069232 3300046694 Bacteria 1893
718 Ga0495589_0152954 3300046794 Bacteria 1101
719 Ga0495600_0004052 3300046809 Bacteria 8710
720 Ga0495600_0007254 3300046809 Bacteria 6770
721 Ga0495600_0052689 3300046809 Bacteria 2657
722 Ga0495581_0000260 3300047315 Bacteria 25339
723 Ga0495581_0117764 3300047315 Bacteria 1545
724 Ga0495604_0021019 3300047317 Bacteria 5207
725 Ga0495604_0027245 3300047317 Bacteria 4546
726 Ga0495636_0104488 3300047318 Bacteria 1241
727 Ga0495674_0009590 3300047319 Bacteria 9195
728 Ga0495674_0032464 3300047319 Bacteria 4734
729 Ga0495674_0064849 3300047319 Bacteria 3174
730 Ga0495672_0079809 3300047320 Bacteria 1827
731 Ga0495672_0156642 3300047320 Bacteria 1176
732 Ga0495676_0094225 3300047321 Bacteria 2231
733 Ga0495676_0144076 3300047321 Bacteria 1704
734 Ga0495680_0012504 3300047322 Bacteria 7465
735 Ga0495680_0026735 3300047322 Bacteria 4751
736 Ga0495683_0064755 3300047323 Bacteria 1805
737 Ga0495687_026560 3300047443 Bacteria 2723
738 Ga0495675_0001958 3300047444 Bacteria 12284
739 Ga0495675_0051348 3300047444 Bacteria 2619
740 Ga0495677_0029096 3300047445 Bacteria 2008
741 Ga0495685_106021 3300047447 Bacteria 927
742 Ga0495673_0041199 3300047469 Bacteria 2081
743 Ga0495681_0031275 3300047470 Bacteria 2697
744 Ga0495681_0043594 3300047470 Bacteria 2162
745 Ga0495684_0001865 3300047471 Bacteria 16864
746 Ga0495684_0010601 3300047471 Bacteria 7124
747 Ga0495684_0074943 3300047471 Bacteria 2571
748 Ga0495684_0120786 3300047471 Bacteria 1974
749 Ga0495686_0065228 3300047472 Bacteria 2252
750 Ga0495593_0001632 3300047673 Bacteria 13278
751 Ga0495593_0042278 3300047673 Bacteria 2446
752 Ga0495593_0279050 3300047673 Bacteria 836
753 Ga0495602_0008574 3300048088 Bacteria 10676
754 Ga0495602_0009374 3300048088 Bacteria 10184
755 Ga0495614_0006328 3300048089 Bacteria 5320
756 Ga0495626_0124338 3300048091 Bacteria 1106
757 Ga0496100_0009348 3300048903 Bacteria 5508
758 Ga0496100_0015363 3300048903 Bacteria 4470
759 Ga0496100_0174741 3300048903 Bacteria 1550
760 Ga0496101_0045479 3300048904 Bacteria 3144
761 Ga0496101_0100207 3300048904 Bacteria 2167
762 Ga0496101_0128252 3300048904 Bacteria 1924
763 Ga0496101_0148183 3300048904 Bacteria 1793
764 Ga0496101_0184157 3300048904 Bacteria 1609
765 Ga0496101_0641512 3300048904 Bacteria 839
766 Ga0496102_0000518 3300048905 Bacteria 42014
767 Ga0496102_0018395 3300048905 Bacteria 6140
768 Ga0496102_0040527 3300048905 Bacteria 4213
769 Ga0496102_0051795 3300048905 Bacteria 3739
770 Ga0496102_0088496 3300048905 Bacteria 2863
771 Ga0496102_0143112 3300048905 Bacteria 2243
772 Ga0496102_0211252 3300048905 Bacteria 1829
773 Ga0496103_0032295 3300048906 Bacteria 3194
774 Ga0496104_0007085 3300048907 Bacteria 9887
775 Ga0496104_0019267 3300048907 Bacteria 6240
776 Ga0496104_0113960 3300048907 Bacteria 2593
777 Ga0496104_0144401 3300048907 Bacteria 2285
778 Ga0496104_0154376 3300048907 Bacteria 2203
779 Ga0496104_0369454 3300048907 Bacteria 1347
780 Ga0496104_0457144 3300048907 Bacteria 1188
781 Ga0496105_0004162 3300048908 Bacteria 10857
782 Ga0496105_0004256 3300048908 Bacteria 10766
783 Ga0496105_0058155 3300048908 Bacteria 3191
784 Ga0496105_0471040 3300048908 Bacteria 989
785 Ga0496106_0000116 3300048909 Bacteria 61237
786 Ga0496106_0015576 3300048909 Bacteria 5623
787 Ga0496106_0034762 3300048909 Bacteria 3766
788 Ga0496106_0052613 3300048909 Bacteria 3073
789 Ga0496106_0059004 3300048909 Bacteria 2906
790 Ga0496106_0159417 3300048909 Bacteria 1784
791 Ga0496106_0345858 3300048909 Bacteria 1194
792 Ga0496106_0381075 3300048909 Bacteria 1133
793 Ga0496107_0001003 3300048910 Bacteria 16852
794 Ga0496107_0042167 3300048910 Bacteria 3277
795 Ga0496107_0127221 3300048910 Bacteria 1880
796 Ga0496107_0200124 3300048910 Bacteria 1485
797 Ga0496107_0427037 3300048910 Bacteria 985
798 Ga0496108_0000523 3300048911 Bacteria 30064
799 Ga0496108_0005230 3300048911 Bacteria 10477
800 Ga0496108_0315518 3300048911 Bacteria 1362
801 Ga0496108_0375076 3300048911 Bacteria 1242
802 Ga0496109_0001407 3300048912 Bacteria 19953
803 Ga0496109_0005646 3300048912 Bacteria 10464
804 Ga0496109_0014037 3300048912 Bacteria 6963
805 Ga0496109_0040291 3300048912 Bacteria 4231
806 Ga0496109_0060989 3300048912 Bacteria 3447
807 Ga0496110_0096837 3300048913 Bacteria 2644
808 Ga0496110_0131033 3300048913 Bacteria 2264
809 Ga0496110_0159171 3300048913 Bacteria 2046
810 Ga0496110_0236942 3300048913 Bacteria 1660
811 Ga0496111_0059018 3300048914 Bacteria 2779
812 Ga0496111_0092499 3300048914 Bacteria 2217
813 Ga0496111_0192727 3300048914 Bacteria 1515
814 Ga0496112_0005822 3300048915 Bacteria 10731
815 Ga0496112_0089521 3300048915 Bacteria 3046
816 Ga0496112_0098378 3300048915 Bacteria 2895
817 Ga0496112_0259580 3300048915 Bacteria 1687
818 Ga0496112_0266573 3300048915 Bacteria 1661
819 Ga0496112_0278435 3300048915 Bacteria 1620
820 Ga0496112_0292241 3300048915 Bacteria 1575
821 Ga0496112_0480936 3300048915 Bacteria 1178
822 Ga0496113_0007261 3300048916 Bacteria 7107
823 Ga0496113_0040246 3300048916 Bacteria 3443
824 Ga0496113_0076535 3300048916 Bacteria 2556
825 Ga0496113_0155383 3300048916 Bacteria 1806
826 Ga0496114_0023481 3300048917 Bacteria 5033
827 Ga0496114_0105206 3300048917 Bacteria 2414
828 Ga0496114_0759064 3300048917 Bacteria 847
829 Ga0496115_0001962 3300048918 Bacteria 14682
830 Ga0496115_0007907 3300048918 Bacteria 7845
831 Ga0496115_0029187 3300048918 Bacteria 4330
832 Ga0496115_0133812 3300048918 Bacteria 2044
833 Ga0496115_0174257 3300048918 Bacteria 1779
834 Ga0496115_0321695 3300048918 Bacteria 1265
835 Ga0496116_0003309 3300048919 Bacteria 16026
836 Ga0496116_0219738 3300048919 Bacteria 975
837 Ga0496117_0039261 3300048920 Bacteria 3496
838 Ga0496117_0048231 3300048920 Bacteria 3045
839 Ga0496117_0092934 3300048920 Bacteria 1936
840 Ga0496117_0113604 3300048920 Bacteria 1681
841 Ga0496118_0057858 3300048921 Bacteria 2902
842 Ga0496118_0061411 3300048921 Bacteria 2783
843 Ga0496118_0062861 3300048921 Bacteria 2736
844 Ga0496118_0065275 3300048921 Bacteria 2664
845 Ga0496118_0084467 3300048921 Bacteria 2215
846 Ga0496118_0145442 3300048921 Bacteria 1494
847 Ga0496119_0149452 3300048922 Bacteria 1253
848 Ga0496119_0194687 3300048922 Bacteria 1054
849 Ga0496120_0151801 3300048923 Bacteria 1163
850 Ga0496121_0007140 3300048924 Bacteria 13552
851 Ga0496121_0012978 3300048924 Bacteria 9004
852 Ga0496121_0046097 3300048924 Bacteria 3735
853 Ga0496121_0052638 3300048924 Bacteria 3416
854 Ga0496121_0059500 3300048924 Bacteria 3149
855 Ga0496121_0069804 3300048924 Bacteria 2833
856 Ga0496121_0101392 3300048924 Bacteria 2220
857 Ga0496121_0110728 3300048924 Bacteria 2095
858 Ga0496121_0163465 3300048924 Bacteria 1625
859 Ga0496121_0233548 3300048924 Bacteria 1286
860 Ga0496122_0006885 3300048925 Bacteria 12857
861 Ga0496122_0028275 3300048925 Bacteria 4764
862 Ga0496122_0187982 3300048925 Bacteria 1223
863 Ga0496123_0008430 3300048926 Bacteria 9472
864 Ga0496124_0027923 3300048927 Bacteria 5054
865 Ga0496124_0200939 3300048927 Bacteria 1516
866 Ga0496124_0219331 3300048927 Bacteria 1432
867 Ga0496124_0226570 3300048927 Bacteria 1401
868 Ga0496124_0233211 3300048927 Bacteria 1374
869 Ga0496125_0000063 3300048928 Bacteria 250260
870 Ga0496125_0001163 3300048928 Bacteria 39846
871 Ga0496125_0009338 3300048928 Bacteria 10107
872 Ga0496125_0039283 3300048928 Bacteria 4078
873 Ga0496125_0044237 3300048928 Bacteria 3768
874 Ga0496125_0044370 3300048928 Bacteria 3761
875 Ga0496125_0082097 3300048928 Bacteria 2459
876 Ga0496125_0098417 3300048928 Bacteria 2164
877 Ga0496125_0139997 3300048928 Bacteria 1684
878 Ga0496126_0005437 3300048929 Bacteria 14524
879 Ga0496126_0010695 3300048929 Bacteria 9587
880 Ga0496126_0040655 3300048929 Bacteria 4310
881 Ga0496126_0063768 3300048929 Bacteria 3302
882 Ga0496126_0085671 3300048929 Bacteria 2777
883 Ga0496126_0088140 3300048929 Bacteria 2734
884 Ga0496126_0146154 3300048929 Bacteria 2030
885 Ga0496126_0175455 3300048929 Bacteria 1823
886 Ga0496126_0199497 3300048929 Bacteria 1690
887 Ga0496126_0229115 3300048929 Bacteria 1557
888 Ga0496126_0233140 3300048929 Bacteria 1541
889 Ga0496126_0315486 3300048929 Bacteria 1286
890 Ga0495682_0032256 3300049460 Bacteria 1935
891 Ga0495682_0098803 3300049460 Bacteria 1047
892 Ga0501031_0462377 3300049568 Bacteria 819
893 Ga0501037_0325957 3300049573 Bacteria 1063
894 Ga0501041_0056887 3300049577 Bacteria 2391
895 Ga0501042_0237073 3300049578 Bacteria 1316
896 Ga0501046_0159998 3300049580 Bacteria 1694
897 Ga0501047_0166415 3300049581 Bacteria 2075
898 Ga0501048_0515841 3300049582 Bacteria 857
899 Ga0501070_0101299 3300049586 Bacteria 2382
900 Ga0501073_0208108 3300049589 Bacteria 1352
901 Ga0501074_0054035 3300049590 Bacteria 2897
902 Ga0501080_0175445 3300049742 Bacteria 1975
903 Ga0501044_0060418 3300049823 Bacteria 3881
904 nmdc:mga03683_22924_c1 3300050489 Bacteria 2425
905 nmdc:mga03683_34046_c1 3300050489 Bacteria 2060
906 nmdc:mga03n38_10056_c1 3300050490 Bacteria 3465
907 nmdc:mga03n38_6302_c1 3300050490 Bacteria 4111
908 nmdc:mga03n38_64269_c1 3300050490 Bacteria 1679
909 nmdc:mga00v17_55445_c1 3300050491 Bacteria 2421
910 nmdc:mga00v17_57508_c1 3300050491 Bacteria 2379
911 nmdc:mga0yw44_11492_c1 3300050492 Bacteria 4575
912 nmdc:mga0yw44_158641_c1 3300050492 Bacteria 1480
913 nmdc:mga0yw44_16842_c1 3300050492 Bacteria 3959
914 nmdc:mga0yw44_41020_c1 3300050492 Bacteria 2753
915 nmdc:mga0yw44_53041_c1 3300050492 Bacteria 2461
916 nmdc:mga0yw44_60081_c1 3300050492 Bacteria 2328
917 nmdc:mga0k408_184721_c1 3300050493 Bacteria 1243
918 nmdc:mga06z11_166914_c1 3300050494 Bacteria 1262
919 nmdc:mga06z11_192205_c1 3300050494 Bacteria 1182
920 nmdc:mga06z11_229613_c1 3300050494 Bacteria 1087
921 nmdc:mga06z11_235824_c1 3300050494 Bacteria 1073
922 nmdc:mga06z11_244461_c1 3300050494 Bacteria 1055
923 nmdc:mga06z11_31830_c1 3300050494 Bacteria 2567
924 nmdc:mga06z11_75663_c1 3300050494 Bacteria 1471
925 nmdc:mga06z11_76619_c1 3300050494 Bacteria 1784
926 nmdc:mga07m45_138730_c1 3300050496 Bacteria 1408
927 nmdc:mga07m45_148882_c1 3300050496 Bacteria 1357
928 nmdc:mga07m45_15298_c1 3300050496 Bacteria 4096
929 nmdc:mga07m45_38376_c1 3300050496 Bacteria 2673
930 nmdc:mga05p37_73611_c1 3300050507 Bacteria 4204
931 nmdc:mga08y16_323386_c1 3300050511 Bacteria 1587
932 nmdc:mga0rr50_254246_c1 3300050513 Bacteria 1460
933 nmdc:mga0a205_509902_c1 3300050515 Bacteria 1059
934 nmdc:mga0sz30_43856_c1 3300050516 Bacteria 1883
935 nmdc:mga0sz30_94400_c1 3300050516 Bacteria 1304
936 Ga0495601_0116769 3300053077 Bacteria 1731
937 Ga0495601_0146288 3300053077 Bacteria 1542
938 Ga0495601_0344906 3300053077 Bacteria 969
939 Ga0495601_0349670 3300053077 Bacteria 961
940 Ga0495612_0057110 3300053078 Bacteria 1611
941 Ga0495655_0007442 3300053083 Bacteria 2037
942 Ga0495655_0055616 3300053083 Bacteria 1063
943 Ga0495595_0051140 3300053084 Bacteria 1914
944 Ga0495619_0024640 3300053085 Bacteria 3860
945 Ga0495619_0146567 3300053085 Bacteria 1628
946 Ga0495619_0235827 3300053085 Bacteria 1268
947 Ga0500643_000019 3300053087 Bacteria 294301
948 Ga0500646_0032516 3300053090 Bacteria 1440
949 Ga0500647_0030004 3300053091 Bacteria 2581
950 Ga0500647_0208506 3300053091 Bacteria 882
951 Ga0500651_0009449 3300053093 Bacteria 5796
952 Ga0500566_0000064 3300053094 Bacteria 50908
953 Ga0500566_0020051 3300053094 Bacteria 3925
954 Ga0500566_0073570 3300053094 Bacteria 1915
955 Ga0500566_0092758 3300053094 Bacteria 1667
956 Ga0500640_004979 3300053095 Bacteria 4892
957 Ga0500640_028015 3300053095 Bacteria 2459
958 Ga0500641_0016215 3300053096 Bacteria 2772
959 Ga0500641_0038291 3300053096 Bacteria 1926
960 Ga0500650_0000414 3300053098 Bacteria 10570
961 Ga0500554_006673 3300053102 Bacteria 2606
962 Ga0500554_015475 3300053102 Bacteria 1994
963 Ga0500555_001693 3300053103 Bacteria 6635
964 Ga0500556_0000024 3300053104 Bacteria 167556
965 Ga0500557_000039 3300053105 Bacteria 66862
966 Ga0500562_013356 3300053108 Bacteria 2096
967 Ga0500562_019094 3300053108 Bacteria 1771
968 Ga0500569_006619 3300053109 Bacteria 2552
969 Ga0500572_000026 3300053111 Bacteria 45518
970 Ga0500572_000344 3300053111 Bacteria 16637
971 Ga0500592_002695 3300053116 Bacteria 2857
972 Ga0500594_0026277 3300053118 Bacteria 1499
973 Ga0500595_002251 3300053119 Bacteria 9777
974 Ga0500595_002953 3300053119 Bacteria 8096
975 Ga0500595_013331 3300053119 Bacteria 3151
976 Ga0500595_019259 3300053119 Bacteria 2480
977 Ga0500607_079888 3300053121 Bacteria 1669
978 Ga0500614_001497 3300053123 Bacteria 5564
979 Ga0500618_005822 3300053125 Bacteria 3701
980 Ga0500642_0000273 3300053130 Bacteria 19371
981 Ga0500642_0001501 3300053130 Bacteria 6725
982 Ga0500642_0022680 3300053130 Bacteria 2510
983 Ga0500652_001229 3300053131 Bacteria 8140
984 Ga0500658_0027983 3300053134 Bacteria 2184
985 Ga0500658_0193358 3300053134 Bacteria 929
986 Ga0500559_0000652 3300053136 Bacteria 23359
987 Ga0500559_0001707 3300053136 Bacteria 12065
988 Ga0500559_0003076 3300053136 Bacteria 8326
989 Ga0500559_0007580 3300053136 Bacteria 4796
990 Ga0500559_0115769 3300053136 Bacteria 1244
991 Ga0500568_0011538 3300053139 Bacteria 4091
992 Ga0500577_0033268 3300053142 Bacteria 1821
993 Ga0500586_000905 3300053145 Bacteria 6095
994 Ga0500603_001132 3300053150 Bacteria 6234
995 Ga0500603_015252 3300053150 Bacteria 1807
996 Ga0500604_0013466 3300053151 Bacteria 2216
997 Ga0500616_0013535 3300053153 Bacteria 4731
998 Ga0500619_004900 3300053154 Bacteria 2927
999 Ga0500620_022019 3300053155 Bacteria 1913
1000 Ga0500622_0001676 3300053156 Bacteria 17264
1001 Ga0500630_000572 3300053159 Bacteria 16714
1002 Ga0500634_0025477 3300053161 Bacteria 3220
1003 Ga0500638_002262 3300053162 Bacteria 6596
1004 Ga0500638_025631 3300053162 Bacteria 2820
1005 Ga0500638_149893 3300053162 Bacteria 1038
1006 Ga0500638_165198 3300053162 Bacteria 970
1007 Ga0500639_000353 3300053163 Bacteria 22721
1008 Ga0500639_046810 3300053163 Bacteria 2260
1009 Ga0500639_092474 3300053163 Bacteria 1503
1010 Ga0500639_191023 3300053163 Bacteria 892
1011 Ga0500636_0000194 3300053177 Bacteria 32748
1012 Ga0500636_0098888 3300053177 Bacteria 1661
1013 Ga0500636_0169760 3300053177 Bacteria 1181
1014 Ga0500637_0000356 3300053178 Bacteria 17344
1015 Ga0500637_0027232 3300053178 Bacteria 3154
1016 Ga0500637_0031722 3300053178 Bacteria 2944
1017 Ga0500637_0059689 3300053178 Bacteria 2184
1018 Ga0500625_012209 3300053729 Bacteria 3923
1019 Ga0500596_004938 3300053735 Bacteria 2397
1020 Ga0500599_000542 3300053736 Bacteria 3970
1021 Ga0500601_000750 3300053737 Bacteria 4196
1022 Ga0500601_002435 3300053737 Bacteria 1999
1023 Ga0500661_010359 3300055283 Bacteria 1699
1024 Ga0466962_0183347 3300061719 Bacteria 1021

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053163 Ga0500639_046810 Ga0500639_046810_11_694 227
2 3300037466 Ga0395898_0073328 Ga0395898_0073328_433_1206 233
3 3300038443 Ga0395901_0179868 Ga0395901_0179868_1300_2073 233
4 3300039438 Ga0436360_1119017 Ga0436360_1119017_935_1708 239
5 3300003659 JGI25404J52841_10020849 JGI25404J52841_100208491 240
6 3300005983 Ga0081540_1011101 Ga0081540_10111012 240
7 3300003659 JGI25404J52841_10001176 JGI25404J52841_100011763 244
8 3300048928 Ga0496125_0000063 Ga0496125_0000063_2175_2945 244
9 3300042438 Ga0439459_0014524 Ga0439459_0014524_260_997 245
10 3300049568 Ga0501031_0462377 Ga0501031_0462377_20_757 245
11 3300049577 Ga0501041_0056887 Ga0501041_0056887_357_1094 245
12 3300049578 Ga0501042_0237073 Ga0501042_0237073_526_1263 245
13 3300049582 Ga0501048_0515841 Ga0501048_0515841_55_792 245
14 3300049742 Ga0501080_0175445 Ga0501080_0175445_407_1144 245
15 3300048910 Ga0496107_0127221 Ga0496107_0127221_459_1217 252
16 iso_pu_bacteria 2602042107 2603861027 252
17 iso_pu_bacteria 2893066018 2893069046 252
18 3300003659 JGI25404J52841_10035503 JGI25404J52841_100355031 253
19 3300005983 Ga0081540_1023306 Ga0081540_10233062 253
20 3300006871 Ga0075434_100377517 Ga0075434_1003775172 253
21 3300028379 Ga0268266_10371584 Ga0268266_103715842 253
22 3300048924 Ga0496121_0233548 Ga0496121_0233548_21_800 253
23 iso_pu_bacteria 2513237141 2513892027 253
24 iso_pu_bacteria 2903748898 2903750456 253
25 iso_pu_bacteria 8016583857 8016590789 253
26 3300005435 Ga0070714_100186448 Ga0070714_1001864483 254
27 3300005455 Ga0070663_100373540 Ga0070663_1003735402 254
28 3300005530 Ga0070679_100321402 Ga0070679_1003214021 254
29 3300048924 Ga0496121_0069804 Ga0496121_0069804_1315_2094 254
30 iso_pu_bacteria 2508501128 2509153765 254
31 iso_pu_bacteria 2857524615 2857528848 254
32 iso_pu_bacteria 2919073203 2919079270 254
33 3300005293 Ga0065715_10183263 Ga0065715_101832633 255
34 3300005539 Ga0068853_100136803 Ga0068853_1001368031 255
35 3300005616 Ga0068852_100049132 Ga0068852_1000491324 255
36 3300007788 Ga0099795_10158387 Ga0099795_101583871 255
37 3300009176 Ga0105242_10044906 Ga0105242_100449062 255
38 3300010375 Ga0105239_10003918 Ga0105239_1000391817 255
39 3300025924 Ga0207694_10160215 Ga0207694_101602152 255
40 3300025934 Ga0207686_10071513 Ga0207686_100715134 255
41 3300025941 Ga0207711_10184304 Ga0207711_101843042 255
42 3300026041 Ga0207639_10105759 Ga0207639_101057591 255
43 3300026089 Ga0207648_10485215 Ga0207648_104852152 255
44 3300026142 Ga0207698_10013308 Ga0207698_100133081 255
45 3300034816 Ga0373930_0004457 Ga0373930_0004457_1254_2024 255
46 3300034820 Ga0373959_0032990 Ga0373959_0032990_237_1007 255
47 3300035091 Ga0373951_0021428 Ga0373951_0021428_87_857 255
48 3300035114 Ga0373939_0054122 Ga0373939_0054122_273_1043 255
49 3300035170 Ga0373943_0139550 Ga0373943_0139550_178_945 255
50 3300035691 Ga0373931_0001506 Ga0373931_0001506_5942_6712 255
51 3300035695 Ga0373927_0167717 Ga0373927_0167717_384_1154 255
52 3300037068 Ga0373925_0157269 Ga0373925_0157269_983_1753 255
53 3300046455 Ga0495603_0014448 Ga0495603_0014448_1712_2479 255
54 3300046475 Ga0495639_0048465 Ga0495639_0048465_396_1163 255
55 3300048903 Ga0496100_0009348 Ga0496100_0009348_4439_5209 255
56 3300048904 Ga0496101_0148183 Ga0496101_0148183_787_1557 255
57 3300048905 Ga0496102_0018395 Ga0496102_0018395_29_799 255
58 3300048907 Ga0496104_0007085 Ga0496104_0007085_8636_9406 255
59 3300048908 Ga0496105_0004162 Ga0496105_0004162_4285_5055 255
60 3300048909 Ga0496106_0034762 Ga0496106_0034762_2649_3419 255
61 3300048910 Ga0496107_0427037 Ga0496107_0427037_176_943 255
62 3300048912 Ga0496109_0040291 Ga0496109_0040291_711_1481 255
63 3300048913 Ga0496110_0159171 Ga0496110_0159171_467_1237 255
64 3300048915 Ga0496112_0278435 Ga0496112_0278435_324_1094 255
65 3300048916 Ga0496113_0007261 Ga0496113_0007261_6110_6880 255
66 3300048918 Ga0496115_0007907 Ga0496115_0007907_1284_2054 255
67 3300048929 Ga0496126_0005437 Ga0496126_0005437_12487_13254 255
68 3300053119 Ga0500595_002953 Ga0500595_002953_5594_6361 255
69 3300053162 Ga0500638_149893 Ga0500638_149893_141_908 255
70 3300053178 Ga0500637_0031722 Ga0500637_0031722_1894_2661 255
71 iso_pu_bacteria 2513237101 2513696981 255
72 iso_pu_bacteria 2721755755 2723846424 255
73 iso_pu_bacteria 2791355199 2793076917 255
74 iso_pu_bacteria 2874604998 2874610608 255
75 iso_pu_bacteria 2876808645 2876816244 255
76 iso_pu_bacteria 2879110137 2879118670 255
77 iso_pu_bacteria 2889033259 2889039063 255
78 iso_pu_bacteria 2922361189 2922362235 255
79 iso_pu_bacteria 8006964411 8006964810 255
80 iso_pu_bacteria 8006984368 8006991793 255
81 iso_pu_bacteria 8006994254 8006995546 255
82 3300003659 JGI25404J52841_10011264 JGI25404J52841_100112642 256
83 3300005434 Ga0070709_10040970 Ga0070709_100409704 256
84 3300005436 Ga0070713_100072247 Ga0070713_1000722472 256
85 3300005437 Ga0070710_10017631 Ga0070710_100176314 256
86 3300005983 Ga0081540_1018496 Ga0081540_10184963 256
87 3300006178 Ga0075367_10093254 Ga0075367_100932542 256
88 3300006186 Ga0075369_10147230 Ga0075369_101472302 256
89 3300006353 Ga0075370_10191964 Ga0075370_101919642 256
90 3300025261 Ga0209233_1008105 Ga0209233_10081053 256
91 3300025295 Ga0209564_1018309 Ga0209564_10183092 256
92 3300025898 Ga0207692_10184881 Ga0207692_101848812 256
93 3300025906 Ga0207699_10026311 Ga0207699_100263114 256
94 3300025915 Ga0207693_10101701 Ga0207693_101017013 256
95 3300025928 Ga0207700_10200662 Ga0207700_102006621 256
96 3300025929 Ga0207664_10209111 Ga0207664_102091113 256
97 3300025939 Ga0207665_10167316 Ga0207665_101673162 256
98 3300025941 Ga0207711_10108226 Ga0207711_101082263 256
99 3300026067 Ga0207678_10024050 Ga0207678_100240503 256
100 3300028379 Ga0268266_10107456 Ga0268266_101074562 256
101 3300028794 Ga0307515_10054331 Ga0307515_100543315 256
102 3300031901 Ga0307406_10059976 Ga0307406_100599763 256
103 3300037853 Ga0436364_1466266 Ga0436364_1466266_230_1000 256
104 3300039450 Ga0436363_0607645 Ga0436363_0607645_62_832 256
105 3300046460 Ga0495638_0064537 Ga0495638_0064537_426_1196 256
106 3300046460 Ga0495638_0078499 Ga0495638_0078499_302_1072 256
107 3300046500 Ga0495596_0041380 Ga0495596_0041380_1022_1792 256
108 3300046501 Ga0495607_0063530 Ga0495607_0063530_1181_1951 256
109 3300046506 Ga0495583_0134317 Ga0495583_0134317_188_958 256
110 3300046542 Ga0495597_0168045 Ga0495597_0168045_61_831 256
111 3300046660 Ga0495625_0070900 Ga0495625_0070900_1419_2189 256
112 3300046665 Ga0495661_0044100 Ga0495661_0044100_1434_2204 256
113 3300046674 Ga0495588_0098362 Ga0495588_0098362_218_988 256
114 3300046683 Ga0495658_0066331 Ga0495658_0066331_1129_1899 256
115 3300046691 Ga0495670_0020636 Ga0495670_0020636_1280_2050 256
116 3300047470 Ga0495681_0031275 Ga0495681_0031275_656_1426 256
117 3300048919 Ga0496116_0003309 Ga0496116_0003309_6521_7291 256
118 3300048920 Ga0496117_0113604 Ga0496117_0113604_870_1640 256
119 3300048921 Ga0496118_0057858 Ga0496118_0057858_775_1545 256
120 3300048924 Ga0496121_0052638 Ga0496121_0052638_369_1139 256
121 3300048925 Ga0496122_0006885 Ga0496122_0006885_5533_6303 256
122 3300048926 Ga0496123_0008430 Ga0496123_0008430_7391_8161 256
123 3300048927 Ga0496124_0226570 Ga0496124_0226570_222_992 256
124 3300048928 Ga0496125_0001163 Ga0496125_0001163_9015_9785 256
125 3300048928 Ga0496125_0009338 Ga0496125_0009338_2294_3064 256
126 3300048928 Ga0496125_0044237 Ga0496125_0044237_884_1654 256
127 3300048929 Ga0496126_0088140 Ga0496126_0088140_1560_2330 256
128 3300048929 Ga0496126_0199497 Ga0496126_0199497_841_1611 256
129 3300050491 nmdc:mga00v17_57508_c1 nmdc:mga00v17_57508_c1_873_1643 256
130 3300050492 nmdc:mga0yw44_16842_c1 nmdc:mga0yw44_16842_c1_2731_3501 256
131 3300050494 nmdc:mga06z11_235824_c1 nmdc:mga06z11_235824_c1_186_956 256
132 3300053090 Ga0500646_0032516 Ga0500646_0032516_79_849 256
133 3300053096 Ga0500641_0016215 Ga0500641_0016215_1555_2325 256
134 3300053098 Ga0500650_0000414 Ga0500650_0000414_8359_9129 256
135 3300053104 Ga0500556_0000024 Ga0500556_0000024_144388_145158 256
136 3300053108 Ga0500562_019094 Ga0500562_019094_341_1111 256
137 3300053109 Ga0500569_006619 Ga0500569_006619_68_838 256
138 3300053111 Ga0500572_000344 Ga0500572_000344_10093_10863 256
139 3300053125 Ga0500618_005822 Ga0500618_005822_442_1212 256
140 3300053130 Ga0500642_0000273 Ga0500642_0000273_12125_12895 256
141 3300053131 Ga0500652_001229 Ga0500652_001229_5011_5781 256
142 3300053136 Ga0500559_0000652 Ga0500559_0000652_2123_2893 256
143 3300053136 Ga0500559_0001707 Ga0500559_0001707_9702_10472 256
144 3300053139 Ga0500568_0011538 Ga0500568_0011538_1868_2638 256
145 3300053142 Ga0500577_0033268 Ga0500577_0033268_965_1735 256
146 3300053145 Ga0500586_000905 Ga0500586_000905_3402_4172 256
147 3300053151 Ga0500604_0013466 Ga0500604_0013466_1424_2194 256
148 3300053153 Ga0500616_0013535 Ga0500616_0013535_2253_3023 256
149 3300053156 Ga0500622_0001676 Ga0500622_0001676_10668_11438 256
150 3300053161 Ga0500634_0025477 Ga0500634_0025477_165_935 256
151 3300053163 Ga0500639_092474 Ga0500639_092474_205_975 256
152 3300053178 Ga0500637_0059689 Ga0500637_0059689_303_1073 256
153 3300003215 JGI25153J46596_10003459 JGI25153J46596_100034593 257
154 3300003215 JGI25153J46596_10004454 JGI25153J46596_100044542 257
155 3300003354 JGI25160J50197_1000729 JGI25160J50197_10007294 257
156 3300003354 JGI25160J50197_1005746 JGI25160J50197_10057466 257
157 3300003659 JGI25404J52841_10005591 JGI25404J52841_100055912 257
158 3300003762 Ga0055542_1012548 Ga0055542_10125481 257
159 3300004625 Ga0055543_1008363 Ga0055543_10083631 257
160 3300005262 Ga0065165_1000278 Ga0065165_100027893 257
161 3300005262 Ga0065165_1011041 Ga0065165_10110413 257
162 3300005262 Ga0065165_1013968 Ga0065165_10139683 257
163 3300005355 Ga0070671_100083173 Ga0070671_1000831734 257
164 3300005367 Ga0070667_100086637 Ga0070667_1000866371 257
165 3300005434 Ga0070709_10000321 Ga0070709_1000032123 257
166 3300005435 Ga0070714_100189894 Ga0070714_1001898942 257
167 3300005437 Ga0070710_10000643 Ga0070710_1000064314 257
168 3300005439 Ga0070711_100023304 Ga0070711_1000233044 257
169 3300005455 Ga0070663_100051598 Ga0070663_1000515983 257
170 3300005455 Ga0070663_100173815 Ga0070663_1001738152 257
171 3300005457 Ga0070662_100121975 Ga0070662_1001219753 257
172 3300005548 Ga0070665_100215170 Ga0070665_1002151702 257
173 3300005614 Ga0068856_100594570 Ga0068856_1005945702 257
174 3300005616 Ga0068852_100270940 Ga0068852_1002709401 257
175 3300005618 Ga0068864_100356219 Ga0068864_1003562192 257
176 3300005843 Ga0068860_100451934 Ga0068860_1004519341 257
177 3300005844 Ga0068862_100044232 Ga0068862_1000442323 257
178 3300005937 Ga0081455_10027456 Ga0081455_100274563 257
179 3300005983 Ga0081540_1118772 Ga0081540_11187721 257
180 3300006038 Ga0075365_10055734 Ga0075365_100557343 257
181 3300006042 Ga0075368_10005485 Ga0075368_100054854 257
182 3300006051 Ga0075364_10008417 Ga0075364_100084174 257
183 3300006173 Ga0070716_100003039 Ga0070716_1000030393 257
184 3300006175 Ga0070712_100001170 Ga0070712_10000117015 257
185 3300006178 Ga0075367_10030820 Ga0075367_100308204 257
186 3300006186 Ga0075369_10086957 Ga0075369_100869571 257
187 3300006195 Ga0075366_10077094 Ga0075366_100770943 257
188 3300006237 Ga0097621_100495607 Ga0097621_1004956072 257
189 3300006353 Ga0075370_10041235 Ga0075370_100412352 257
190 3300006353 Ga0075370_10208920 Ga0075370_102089202 257
191 3300006943 Ga0099822_1011696 Ga0099822_10116969 257
192 3300009093 Ga0105240_10365826 Ga0105240_103658262 257
193 3300009148 Ga0105243_10213855 Ga0105243_102138552 257
194 3300009176 Ga0105242_10295013 Ga0105242_102950132 257
195 3300009545 Ga0105237_10075722 Ga0105237_100757223 257
196 3300009551 Ga0105238_10340890 Ga0105238_103408902 257
197 3300009553 Ga0105249_10369068 Ga0105249_103690682 257
198 3300010375 Ga0105239_10143450 Ga0105239_101434502 257
199 3300010375 Ga0105239_10157493 Ga0105239_101574931 257
200 3300011119 Ga0105246_10091339 Ga0105246_100913392 257
201 3300013308 Ga0157375_10253106 Ga0157375_102531063 257
202 3300014325 Ga0163163_10017116 Ga0163163_100171166 257
203 3300014969 Ga0157376_10615556 Ga0157376_106155561 257
204 3300017792 Ga0163161_10123971 Ga0163161_101239712 257
205 3300021320 Ga0214544_1000020 Ga0214544_1000020117 257
206 3300021321 Ga0214542_1000024 Ga0214542_1000024128 257
207 3300021324 Ga0214545_1000011 Ga0214545_1000011128 257
208 3300021324 Ga0214545_1030682 Ga0214545_10306822 257
209 3300021327 Ga0214543_1000033 Ga0214543_100003376 257
210 3300021327 Ga0214543_1030560 Ga0214543_10305602 257
211 3300021358 Ga0213873_10017072 Ga0213873_100170722 257
212 3300021361 Ga0213872_10020912 Ga0213872_100209122 257
213 3300021377 Ga0213874_10008958 Ga0213874_100089582 257
214 3300021384 Ga0213876_10000969 Ga0213876_1000096914 257
215 3300021384 Ga0213876_10067836 Ga0213876_100678361 257
216 3300021441 Ga0213871_10001134 Ga0213871_100011344 257
217 3300025230 Ga0209563_101494 Ga0209563_1014945 257
218 3300025253 Ga0209677_102419 Ga0209677_1024197 257
219 3300025253 Ga0209677_106143 Ga0209677_1061432 257
220 3300025254 Ga0209148_1000344 Ga0209148_100034435 257
221 3300025272 Ga0209455_1001281 Ga0209455_10012819 257
222 3300025295 Ga0209564_1002208 Ga0209564_10022082 257
223 3300025295 Ga0209564_1016543 Ga0209564_10165434 257
224 3300025297 Ga0209758_1000407 Ga0209758_100040732 257
225 3300025297 Ga0209758_1000900 Ga0209758_100090028 257
226 3300025297 Ga0209758_1000952 Ga0209758_10009526 257
227 3300025297 Ga0209758_1011752 Ga0209758_10117523 257
228 3300025297 Ga0209758_1017825 Ga0209758_10178253 257
229 3300025299 Ga0209256_1011331 Ga0209256_10113314 257
230 3300025302 Ga0207426_1000466 Ga0207426_100046643 257
231 3300025302 Ga0207426_1000865 Ga0207426_10008653 257
232 3300025302 Ga0207426_1003194 Ga0207426_10031944 257
233 3300025302 Ga0207426_1012503 Ga0207426_10125034 257
234 3300025302 Ga0207426_1019417 Ga0207426_10194172 257
235 3300025304 Ga0209257_1001445 Ga0209257_100144517 257
236 3300025898 Ga0207692_10001554 Ga0207692_100015542 257
237 3300025900 Ga0207710_10022007 Ga0207710_100220072 257
238 3300025904 Ga0207647_10037625 Ga0207647_100376252 257
239 3300025906 Ga0207699_10000550 Ga0207699_100005505 257
240 3300025911 Ga0207654_10031567 Ga0207654_100315673 257
241 3300025913 Ga0207695_10000029 Ga0207695_10000029144 257
242 3300025913 Ga0207695_10318943 Ga0207695_103189432 257
243 3300025914 Ga0207671_10026230 Ga0207671_100262302 257
244 3300025914 Ga0207671_10091491 Ga0207671_100914913 257
245 3300025915 Ga0207693_10002659 Ga0207693_100026599 257
246 3300025916 Ga0207663_10008869 Ga0207663_100088695 257
247 3300025923 Ga0207681_10203927 Ga0207681_102039272 257
248 3300025925 Ga0207650_10298792 Ga0207650_102987921 257
249 3300025927 Ga0207687_10335989 Ga0207687_103359892 257
250 3300025928 Ga0207700_10024525 Ga0207700_100245253 257
251 3300025929 Ga0207664_10024687 Ga0207664_100246875 257
252 3300025931 Ga0207644_10032126 Ga0207644_100321264 257
253 3300025933 Ga0207706_10097118 Ga0207706_100971183 257
254 3300025933 Ga0207706_10173181 Ga0207706_101731812 257
255 3300025939 Ga0207665_10007182 Ga0207665_100071822 257
256 3300025949 Ga0207667_10895369 Ga0207667_108953691 257
257 3300025986 Ga0207658_10452004 Ga0207658_104520042 257
258 3300026088 Ga0207641_10135681 Ga0207641_101356812 257
259 3300026088 Ga0207641_10146719 Ga0207641_101467191 257
260 3300026116 Ga0207674_10118244 Ga0207674_101182444 257
261 3300026142 Ga0207698_10015126 Ga0207698_100151265 257
262 3300027296 Ga0209389_1000025 Ga0209389_1000025148 257
263 3300027357 Ga0209589_1000018 Ga0209589_100001861 257
264 3300027357 Ga0209589_1000066 Ga0209589_100006697 257
265 3300027361 Ga0209489_100026 Ga0209489_10002661 257
266 3300027361 Ga0209489_100030 Ga0209489_10003016 257
267 3300027363 Ga0209700_100035 Ga0209700_10003561 257
268 3300028379 Ga0268266_10115378 Ga0268266_101153782 257
269 3300028379 Ga0268266_10607966 Ga0268266_106079661 257
270 3300028381 Ga0268264_10000035 Ga0268264_1000003554 257
271 3300028563 Ga0265319_1028990 Ga0265319_10289902 257
272 3300028577 Ga0265318_10032922 Ga0265318_100329222 257
273 3300028654 Ga0265322_10070288 Ga0265322_100702881 257
274 3300028666 Ga0265336_10005760 Ga0265336_100057604 257
275 3300028800 Ga0265338_10000065 Ga0265338_1000006582 257
276 3300031507 Ga0307509_10029857 Ga0307509_100298576 257
277 3300031616 Ga0307508_10000090 Ga0307508_1000009053 257
278 3300031730 Ga0307516_10058192 Ga0307516_100581921 257
279 3300035724 Ga0373933_0452595 Ga0373933_0452595_44_817 257
280 3300037068 Ga0373925_0687217 Ga0373925_0687217_29_805 257
281 3300037471 Ga0395905_0015966 Ga0395905_0015966_2963_3736 257
282 3300037471 Ga0395905_0099550 Ga0395905_0099550_66_839 257
283 3300039437 Ga0436365_0255894 Ga0436365_0255894_1511_2284 257
284 3300039437 Ga0436365_1891143 Ga0436365_1891143_37_810 257
285 3300039438 Ga0436360_0377935 Ga0436360_0377935_22_795 257
286 3300039438 Ga0436360_1272541 Ga0436360_1272541_4392_5165 257
287 3300039447 Ga0436361_0442731 Ga0436361_0442731_1477_2250 257
288 3300039450 Ga0436363_0323974 Ga0436363_0323974_1303_2076 257
289 3300039450 Ga0436363_1577576 Ga0436363_1577576_398_1171 257
290 3300039453 Ga0436362_0240249 Ga0436362_0240249_100_873 257
291 3300041491 Ga0451833_0240175 Ga0451833_0240175_488_1261 257
292 3300044658 Ga0466972_0000261 Ga0466972_0000261_30512_31285 257
293 3300044658 Ga0466972_0050816 Ga0466972_0050816_879_1652 257
294 3300044683 Ga0466965_0049773 Ga0466965_0049773_1290_2063 257
295 3300044693 Ga0466961_0270759 Ga0466961_0270759_102_875 257
296 3300044735 Ga0466968_0114682 Ga0466968_0114682_225_998 257
297 3300044765 Ga0466970_0087256 Ga0466970_0087256_247_1020 257
298 3300044901 Ga0466960_0133158 Ga0466960_0133158_59_832 257
299 3300045049 Ga0466959_0128863 Ga0466959_0128863_693_1466 257
300 3300046454 Ga0495592_0070438 Ga0495592_0070438_1602_2375 257
301 3300046454 Ga0495592_0090334 Ga0495592_0090334_239_1012 257
302 3300046459 Ga0495629_0255363 Ga0495629_0255363_223_996 257
303 3300046460 Ga0495638_0009098 Ga0495638_0009098_5333_6106 257
304 3300046462 Ga0495651_0013141 Ga0495651_0013141_3780_4553 257
305 3300046462 Ga0495651_0033664 Ga0495651_0033664_1482_2255 257
306 3300046463 Ga0495653_0119690 Ga0495653_0119690_871_1644 257
307 3300046463 Ga0495653_0356206 Ga0495653_0356206_48_821 257
308 3300046474 Ga0495605_0160241 Ga0495605_0160241_173_946 257
309 3300046476 Ga0495662_0119151 Ga0495662_0119151_339_1112 257
310 3300046477 Ga0495664_0009563 Ga0495664_0009563_1106_1879 257
311 3300046477 Ga0495664_0127983 Ga0495664_0127983_88_861 257
312 3300046477 Ga0495664_0367883 Ga0495664_0367883_15_791 257
313 3300046506 Ga0495583_0087672 Ga0495583_0087672_539_1312 257
314 3300046507 Ga0495606_0035698 Ga0495606_0035698_1077_1850 257
315 3300046507 Ga0495606_0075938 Ga0495606_0075938_815_1588 257
316 3300046511 Ga0495608_0077941 Ga0495608_0077941_30_803 257
317 3300046516 Ga0495628_0046153 Ga0495628_0046153_2677_3450 257
318 3300046522 Ga0495643_0030321 Ga0495643_0030321_386_1159 257
319 3300046524 Ga0495648_0013331 Ga0495648_0013331_4601_5374 257
320 3300046524 Ga0495648_0016179 Ga0495648_0016179_1188_1961 257
321 3300046526 Ga0495666_0158074 Ga0495666_0158074_262_1035 257
322 3300046533 Ga0495640_0020259 Ga0495640_0020259_3568_4341 257
323 3300046533 Ga0495640_0260171 Ga0495640_0260171_33_806 257
324 3300046557 Ga0495622_0027395 Ga0495622_0027395_457_1230 257
325 3300046559 Ga0495667_0031439 Ga0495667_0031439_1743_2516 257
326 3300046616 Ga0495668_0025884 Ga0495668_0025884_1890_2663 257
327 3300046663 Ga0495635_0010103 Ga0495635_0010103_1385_2158 257
328 3300046663 Ga0495635_0177916 Ga0495635_0177916_59_832 257
329 3300046675 Ga0495657_0003319 Ga0495657_0003319_4288_5061 257
330 3300046675 Ga0495657_0014067 Ga0495657_0014067_4084_4857 257
331 3300046678 Ga0495599_0060654 Ga0495599_0060654_739_1512 257
332 3300046679 Ga0495623_0012652 Ga0495623_0012652_3526_4299 257
333 3300046680 Ga0495646_0025769 Ga0495646_0025769_1129_1902 257
334 3300046680 Ga0495646_0088196 Ga0495646_0088196_471_1244 257
335 3300046689 Ga0495613_0031591 Ga0495613_0031591_1778_2551 257
336 3300046689 Ga0495613_0105420 Ga0495613_0105420_339_1112 257
337 3300046694 Ga0495649_0030534 Ga0495649_0030534_1305_2078 257
338 3300046694 Ga0495649_0069232 Ga0495649_0069232_625_1398 257
339 3300046809 Ga0495600_0007254 Ga0495600_0007254_3568_4341 257
340 3300047317 Ga0495604_0027245 Ga0495604_0027245_3568_4341 257
341 3300047322 Ga0495680_0026735 Ga0495680_0026735_411_1184 257
342 3300047323 Ga0495683_0064755 Ga0495683_0064755_440_1213 257
343 3300047443 Ga0495687_026560 Ga0495687_026560_1863_2636 257
344 3300047444 Ga0495675_0051348 Ga0495675_0051348_1312_2085 257
345 3300047469 Ga0495673_0041199 Ga0495673_0041199_1082_1855 257
346 3300047471 Ga0495684_0120786 Ga0495684_0120786_96_869 257
347 3300048088 Ga0495602_0009374 Ga0495602_0009374_3568_4341 257
348 3300048091 Ga0495626_0124338 Ga0495626_0124338_308_1081 257
349 3300048903 Ga0496100_0174741 Ga0496100_0174741_747_1520 257
350 3300048904 Ga0496101_0100207 Ga0496101_0100207_44_817 257
351 3300048904 Ga0496101_0184157 Ga0496101_0184157_333_1106 257
352 3300048905 Ga0496102_0211252 Ga0496102_0211252_387_1160 257
353 3300048906 Ga0496103_0032295 Ga0496103_0032295_1863_2636 257
354 3300048907 Ga0496104_0019267 Ga0496104_0019267_1485_2258 257
355 3300048907 Ga0496104_0144401 Ga0496104_0144401_24_797 257
356 3300048907 Ga0496104_0457144 Ga0496104_0457144_366_1139 257
357 3300048908 Ga0496105_0058155 Ga0496105_0058155_1398_2171 257
358 3300048909 Ga0496106_0159417 Ga0496106_0159417_123_896 257
359 3300048909 Ga0496106_0345858 Ga0496106_0345858_186_959 257
360 3300048911 Ga0496108_0375076 Ga0496108_0375076_128_901 257
361 3300048914 Ga0496111_0059018 Ga0496111_0059018_377_1150 257
362 3300048915 Ga0496112_0259580 Ga0496112_0259580_118_891 257
363 3300048916 Ga0496113_0076535 Ga0496113_0076535_1584_2357 257
364 3300048919 Ga0496116_0219738 Ga0496116_0219738_32_805 257
365 3300048920 Ga0496117_0039261 Ga0496117_0039261_313_1086 257
366 3300048920 Ga0496117_0048231 Ga0496117_0048231_1351_2124 257
367 3300048920 Ga0496117_0092934 Ga0496117_0092934_1021_1794 257
368 3300048921 Ga0496118_0061411 Ga0496118_0061411_697_1470 257
369 3300048921 Ga0496118_0062861 Ga0496118_0062861_1117_1890 257
370 3300048921 Ga0496118_0065275 Ga0496118_0065275_85_858 257
371 3300048921 Ga0496118_0084467 Ga0496118_0084467_752_1525 257
372 3300048921 Ga0496118_0145442 Ga0496118_0145442_233_1006 257
373 3300048922 Ga0496119_0194687 Ga0496119_0194687_109_882 257
374 3300048923 Ga0496120_0151801 Ga0496120_0151801_158_931 257
375 3300048924 Ga0496121_0012978 Ga0496121_0012978_310_1083 257
376 3300048924 Ga0496121_0046097 Ga0496121_0046097_1105_1878 257
377 3300048924 Ga0496121_0110728 Ga0496121_0110728_549_1322 257
378 3300048924 Ga0496121_0163465 Ga0496121_0163465_392_1165 257
379 3300048925 Ga0496122_0187982 Ga0496122_0187982_130_903 257
380 3300048927 Ga0496124_0027923 Ga0496124_0027923_3948_4721 257
381 3300048927 Ga0496124_0200939 Ga0496124_0200939_40_813 257
382 3300048927 Ga0496124_0219331 Ga0496124_0219331_461_1234 257
383 3300048928 Ga0496125_0039283 Ga0496125_0039283_1651_2424 257
384 3300048928 Ga0496125_0044370 Ga0496125_0044370_1895_2668 257
385 3300048928 Ga0496125_0082097 Ga0496125_0082097_858_1631 257
386 3300048928 Ga0496125_0098417 Ga0496125_0098417_215_988 257
387 3300048929 Ga0496126_0063768 Ga0496126_0063768_2144_2917 257
388 3300048929 Ga0496126_0085671 Ga0496126_0085671_444_1217 257
389 3300048929 Ga0496126_0175455 Ga0496126_0175455_398_1171 257
390 3300048929 Ga0496126_0229115 Ga0496126_0229115_222_995 257
391 3300048929 Ga0496126_0233140 Ga0496126_0233140_445_1218 257
392 3300049460 Ga0495682_0032256 Ga0495682_0032256_599_1372 257
393 3300050490 nmdc:mga03n38_10056_c1 nmdc:mga03n38_10056_c1_1977_2750 257
394 3300050492 nmdc:mga0yw44_41020_c1 nmdc:mga0yw44_41020_c1_475_1248 257
395 3300050492 nmdc:mga0yw44_53041_c1 nmdc:mga0yw44_53041_c1_580_1353 257
396 3300050492 nmdc:mga0yw44_60081_c1 nmdc:mga0yw44_60081_c1_196_969 257
397 3300050494 nmdc:mga06z11_166914_c1 nmdc:mga06z11_166914_c1_198_971 257
398 3300050494 nmdc:mga06z11_229613_c1 nmdc:mga06z11_229613_c1_146_919 257
399 3300050494 nmdc:mga06z11_75663_c1 nmdc:mga06z11_75663_c1_510_1283 257
400 3300050496 nmdc:mga07m45_38376_c1 nmdc:mga07m45_38376_c1_367_1140 257
401 3300050516 nmdc:mga0sz30_94400_c1 nmdc:mga0sz30_94400_c1_196_969 257
402 3300053077 Ga0495601_0116769 Ga0495601_0116769_470_1243 257
403 3300053077 Ga0495601_0344906 Ga0495601_0344906_89_862 257
404 3300053077 Ga0495601_0349670 Ga0495601_0349670_38_814 257
405 3300053083 Ga0495655_0007442 Ga0495655_0007442_688_1461 257
406 3300053085 Ga0495619_0235827 Ga0495619_0235827_348_1121 257
407 3300053091 Ga0500647_0208506 Ga0500647_0208506_47_820 257
408 3300053094 Ga0500566_0020051 Ga0500566_0020051_592_1365 257
409 3300053094 Ga0500566_0073570 Ga0500566_0073570_1027_1800 257
410 3300053095 Ga0500640_028015 Ga0500640_028015_398_1171 257
411 3300053103 Ga0500555_001693 Ga0500555_001693_4501_5274 257
412 3300053105 Ga0500557_000039 Ga0500557_000039_64449_65222 257
413 3300053108 Ga0500562_013356 Ga0500562_013356_1256_2029 257
414 3300053116 Ga0500592_002695 Ga0500592_002695_1608_2381 257
415 3300053121 Ga0500607_079888 Ga0500607_079888_445_1218 257
416 3300053134 Ga0500658_0027983 Ga0500658_0027983_131_904 257
417 3300053136 Ga0500559_0007580 Ga0500559_0007580_3620_4393 257
418 3300053154 Ga0500619_004900 Ga0500619_004900_1498_2271 257
419 3300053155 Ga0500620_022019 Ga0500620_022019_846_1619 257
420 3300053163 Ga0500639_191023 Ga0500639_191023_17_790 257
421 3300053177 Ga0500636_0000194 Ga0500636_0000194_15787_16560 257
422 3300053177 Ga0500636_0098888 Ga0500636_0098888_598_1371 257
423 3300053729 Ga0500625_012209 Ga0500625_012209_1518_2291 257
424 3300053735 Ga0500596_004938 Ga0500596_004938_956_1729 257
425 3300053737 Ga0500601_000750 Ga0500601_000750_373_1146 257
426 3300055283 Ga0500661_010359 Ga0500661_010359_488_1261 257
427 3300061719 Ga0466962_0183347 Ga0466962_0183347_112_885 257
428 3300003203 JGI25406J46586_10019112 JGI25406J46586_100191123 258
429 3300005434 Ga0070709_10031836 Ga0070709_100318362 258
430 3300005439 Ga0070711_100067274 Ga0070711_1000672742 258
431 3300005563 Ga0068855_100185338 Ga0068855_1001853383 258
432 3300005937 Ga0081455_10014321 Ga0081455_100143212 258
433 3300005983 Ga0081540_1002773 Ga0081540_10027737 258
434 3300005983 Ga0081540_1037049 Ga0081540_10370492 258
435 3300005985 Ga0081539_10000747 Ga0081539_1000074737 258
436 3300005985 Ga0081539_10071601 Ga0081539_100716011 258
437 3300006038 Ga0075365_10027907 Ga0075365_100279072 258
438 3300006051 Ga0075364_10033448 Ga0075364_100334482 258
439 3300006173 Ga0070716_100063710 Ga0070716_1000637101 258
440 3300006175 Ga0070712_100044408 Ga0070712_1000444082 258
441 3300013102 Ga0157371_10422817 Ga0157371_104228171 258
442 3300020081 Ga0206354_11003357 Ga0206354_110033572 258
443 3300025297 Ga0209758_1001988 Ga0209758_100198818 258
444 3300025915 Ga0207693_10047433 Ga0207693_100474333 258
445 3300025916 Ga0207663_10303734 Ga0207663_103037341 258
446 3300025929 Ga0207664_10076606 Ga0207664_100766062 258
447 3300025939 Ga0207665_10032684 Ga0207665_100326843 258
448 3300026067 Ga0207678_10073505 Ga0207678_100735052 258
449 3300028573 Ga0265334_10002345 Ga0265334_1000234510 258
450 3300031730 Ga0307516_10107825 Ga0307516_101078251 258
451 3300033544 Ga0316215_1002836 Ga0316215_10028363 258
452 3300035111 Ga0373923_0008238 Ga0373923_0008238_140_916 258
453 3300035113 Ga0373936_0026971 Ga0373936_0026971_409_1185 258
454 3300035117 Ga0373953_0069216 Ga0373953_0069216_629_1405 258
455 3300035120 Ga0373957_0128536 Ga0373957_0128536_93_869 258
456 3300035170 Ga0373943_0004812 Ga0373943_0004812_3671_4447 258
457 3300035171 Ga0373946_0010035 Ga0373946_0010035_1454_2230 258
458 3300035172 Ga0373955_0287655 Ga0373955_0287655_19_795 258
459 3300035410 Ga0373924_0031946 Ga0373924_0031946_714_1490 258
460 3300035692 Ga0373935_0095620 Ga0373935_0095620_365_1141 258
461 3300035695 Ga0373927_0005832 Ga0373927_0005832_3092_3868 258
462 3300035725 Ga0373947_0003823 Ga0373947_0003823_6065_6841 258
463 3300036401 Ga0373937_0195852 Ga0373937_0195852_196_972 258
464 3300036459 Ga0372808_010437 Ga0372808_010437_217_993 258
465 3300037068 Ga0373925_0006131 Ga0373925_0006131_4391_5167 258
466 3300037466 Ga0395898_0179729 Ga0395898_0179729_966_1742 258
467 3300039447 Ga0436361_0295266 Ga0436361_0295266_182_958 258
468 3300039450 Ga0436363_1259875 Ga0436363_1259875_2326_3102 258
469 3300044684 Ga0466966_0175167 Ga0466966_0175167_292_1068 258
470 3300046454 Ga0495592_0003697 Ga0495592_0003697_1466_2242 258
471 3300046455 Ga0495603_0004652 Ga0495603_0004652_1257_2033 258
472 3300046459 Ga0495629_0011592 Ga0495629_0011592_3268_4044 258
473 3300046461 Ga0495641_0009631 Ga0495641_0009631_3166_3942 258
474 3300046472 Ga0495580_0000612 Ga0495580_0000612_9226_10002 258
475 3300046473 Ga0495582_0000831 Ga0495582_0000831_1466_2242 258
476 3300046475 Ga0495639_0000627 Ga0495639_0000627_741_1517 258
477 3300046475 Ga0495639_0040188 Ga0495639_0040188_432_1208 258
478 3300046476 Ga0495662_0000686 Ga0495662_0000686_12994_13770 258
479 3300046477 Ga0495664_0096442 Ga0495664_0096442_309_1085 258
480 3300046499 Ga0495594_0007696 Ga0495594_0007696_434_1210 258
481 3300046514 Ga0495618_0239659 Ga0495618_0239659_39_815 258
482 3300046517 Ga0495630_0002217 Ga0495630_0002217_10539_11315 258
483 3300046529 Ga0495652_0159468 Ga0495652_0159468_776_1552 258
484 3300046531 Ga0495665_0000866 Ga0495665_0000866_3013_3789 258
485 3300046533 Ga0495640_0003099 Ga0495640_0003099_9409_10185 258
486 3300046543 Ga0495645_0013311 Ga0495645_0013311_3592_4368 258
487 3300046557 Ga0495622_0040897 Ga0495622_0040897_1143_1919 258
488 3300046558 Ga0495633_0016209 Ga0495633_0016209_1391_2167 258
489 3300046642 Ga0495634_0002722 Ga0495634_0002722_1573_2349 258
490 3300046663 Ga0495635_0013453 Ga0495635_0013453_495_1271 258
491 3300046674 Ga0495588_0050990 Ga0495588_0050990_706_1482 258
492 3300046678 Ga0495599_0071308 Ga0495599_0071308_314_1090 258
493 3300046680 Ga0495646_0038036 Ga0495646_0038036_1366_2142 258
494 3300046681 Ga0495647_0006540 Ga0495647_0006540_1313_2089 258
495 3300046683 Ga0495658_0000295 Ga0495658_0000295_1532_2308 258
496 3300046689 Ga0495613_0004147 Ga0495613_0004147_9695_10471 258
497 3300046690 Ga0495624_0000079 Ga0495624_0000079_39640_40416 258
498 3300046690 Ga0495624_0151375 Ga0495624_0151375_445_1221 258
499 3300046809 Ga0495600_0052689 Ga0495600_0052689_200_976 258
500 3300047315 Ga0495581_0000260 Ga0495581_0000260_13507_14283 258
501 3300047319 Ga0495674_0009590 Ga0495674_0009590_1885_2661 258
502 3300047321 Ga0495676_0144076 Ga0495676_0144076_263_1039 258
503 3300047471 Ga0495684_0010601 Ga0495684_0010601_3092_3868 258
504 3300047472 Ga0495686_0065228 Ga0495686_0065228_619_1395 258
505 3300047673 Ga0495593_0001632 Ga0495593_0001632_10955_11731 258
506 3300048089 Ga0495614_0006328 Ga0495614_0006328_813_1589 258
507 3300048925 Ga0496122_0028275 Ga0496122_0028275_2056_2832 258
508 3300048929 Ga0496126_0010695 Ga0496126_0010695_6722_7498 258
509 3300048929 Ga0496126_0040655 Ga0496126_0040655_2305_3081 258
510 3300050489 nmdc:mga03683_22924_c1 nmdc:mga03683_22924_c1_1490_2266 258
511 3300053077 Ga0495601_0146288 Ga0495601_0146288_418_1194 258
512 3300053078 Ga0495612_0057110 Ga0495612_0057110_628_1404 258
513 3300053119 Ga0500595_013331 Ga0500595_013331_1037_1813 258
514 3300053119 Ga0500595_019259 Ga0500595_019259_429_1205 258
515 3300005327 Ga0070658_10075965 Ga0070658_100759653 259
516 3300005328 Ga0070676_10071609 Ga0070676_100716092 259
517 3300005330 Ga0070690_100092911 Ga0070690_1000929111 259
518 3300005331 Ga0070670_100281259 Ga0070670_1002812592 259
519 3300005334 Ga0068869_100047994 Ga0068869_1000479943 259
520 3300005334 Ga0068869_100055295 Ga0068869_1000552951 259
521 3300005335 Ga0070666_10388134 Ga0070666_103881341 259
522 3300005336 Ga0070680_100010206 Ga0070680_1000102064 259
523 3300005337 Ga0070682_100183420 Ga0070682_1001834202 259
524 3300005337 Ga0070682_100212131 Ga0070682_1002121312 259
525 3300005338 Ga0068868_100015888 Ga0068868_1000158884 259
526 3300005339 Ga0070660_100024156 Ga0070660_1000241565 259
527 3300005340 Ga0070689_100123418 Ga0070689_1001234183 259
528 3300005341 Ga0070691_10129254 Ga0070691_101292542 259
529 3300005344 Ga0070661_100079872 Ga0070661_1000798723 259
530 3300005344 Ga0070661_100252637 Ga0070661_1002526371 259
531 3300005347 Ga0070668_100012569 Ga0070668_1000125693 259
532 3300005347 Ga0070668_100044471 Ga0070668_1000444713 259
533 3300005347 Ga0070668_100364711 Ga0070668_1003647111 259
534 3300005353 Ga0070669_100019904 Ga0070669_1000199045 259
535 3300005353 Ga0070669_100402251 Ga0070669_1004022512 259
536 3300005356 Ga0070674_100067707 Ga0070674_1000677072 259
537 3300005364 Ga0070673_100125690 Ga0070673_1001256903 259
538 3300005365 Ga0070688_100141898 Ga0070688_1001418982 259
539 3300005365 Ga0070688_100286883 Ga0070688_1002868832 259
540 3300005367 Ga0070667_100183279 Ga0070667_1001832791 259
541 3300005436 Ga0070713_100034852 Ga0070713_1000348524 259
542 3300005437 Ga0070710_10120491 Ga0070710_101204912 259
543 3300005441 Ga0070700_100075552 Ga0070700_1000755521 259
544 3300005455 Ga0070663_100021332 Ga0070663_1000213325 259
545 3300005455 Ga0070663_100051045 Ga0070663_1000510452 259
546 3300005456 Ga0070678_100068453 Ga0070678_1000684532 259
547 3300005456 Ga0070678_100075032 Ga0070678_1000750323 259
548 3300005457 Ga0070662_100115690 Ga0070662_1001156902 259
549 3300005457 Ga0070662_100117741 Ga0070662_1001177412 259
550 3300005458 Ga0070681_10061815 Ga0070681_100618151 259
551 3300005458 Ga0070681_10111762 Ga0070681_101117622 259
552 3300005458 Ga0070681_10174929 Ga0070681_101749292 259
553 3300005458 Ga0070681_10265397 Ga0070681_102653972 259
554 3300005459 Ga0068867_100110645 Ga0068867_1001106453 259
555 3300005466 Ga0070685_10160931 Ga0070685_101609312 259
556 3300005471 Ga0070698_100232538 Ga0070698_1002325382 259
557 3300005530 Ga0070679_100018864 Ga0070679_1000188646 259
558 3300005530 Ga0070679_100042441 Ga0070679_1000424412 259
559 3300005530 Ga0070679_100326100 Ga0070679_1003261001 259
560 3300005535 Ga0070684_100015968 Ga0070684_1000159686 259
561 3300005535 Ga0070684_100017476 Ga0070684_1000174765 259
562 3300005535 Ga0070684_100095065 Ga0070684_1000950652 259
563 3300005536 Ga0070697_100013902 Ga0070697_1000139024 259
564 3300005539 Ga0068853_100011732 Ga0068853_1000117323 259
565 3300005539 Ga0068853_100151890 Ga0068853_1001518903 259
566 3300005544 Ga0070686_100202531 Ga0070686_1002025312 259
567 3300005544 Ga0070686_100266519 Ga0070686_1002665192 259
568 3300005547 Ga0070693_100017871 Ga0070693_1000178712 259
569 3300005548 Ga0070665_100008531 Ga0070665_10000853111 259
570 3300005548 Ga0070665_100024503 Ga0070665_1000245035 259
571 3300005548 Ga0070665_100094785 Ga0070665_1000947852 259
572 3300005548 Ga0070665_100259378 Ga0070665_1002593783 259
573 3300005548 Ga0070665_100474580 Ga0070665_1004745801 259
574 3300005548 Ga0070665_100693089 Ga0070665_1006930891 259
575 3300005563 Ga0068855_100071075 Ga0068855_1000710752 259
576 3300005563 Ga0068855_100123883 Ga0068855_1001238832 259
577 3300005564 Ga0070664_100033202 Ga0070664_1000332022 259
578 3300005564 Ga0070664_100480797 Ga0070664_1004807972 259
579 3300005577 Ga0068857_100044204 Ga0068857_1000442043 259
580 3300005578 Ga0068854_100092238 Ga0068854_1000922382 259
581 3300005615 Ga0070702_100338152 Ga0070702_1003381521 259
582 3300005616 Ga0068852_100059330 Ga0068852_1000593303 259
583 3300005617 Ga0068859_100383615 Ga0068859_1003836152 259
584 3300005618 Ga0068864_100100435 Ga0068864_1001004353 259
585 3300005718 Ga0068866_10019214 Ga0068866_100192143 259
586 3300005718 Ga0068866_10075346 Ga0068866_100753462 259
587 3300005719 Ga0068861_100071020 Ga0068861_1000710202 259
588 3300005719 Ga0068861_100448540 Ga0068861_1004485402 259
589 3300005841 Ga0068863_100361737 Ga0068863_1003617372 259
590 3300005842 Ga0068858_100504165 Ga0068858_1005041652 259
591 3300005843 Ga0068860_100113935 Ga0068860_1001139352 259
592 3300005843 Ga0068860_100272704 Ga0068860_1002727042 259
593 3300005844 Ga0068862_100111239 Ga0068862_1001112392 259
594 3300005844 Ga0068862_100294050 Ga0068862_1002940502 259
595 3300005937 Ga0081455_10002423 Ga0081455_1000242315 259
596 3300005981 Ga0081538_10043188 Ga0081538_100431884 259
597 3300005983 Ga0081540_1003578 Ga0081540_10035783 259
598 3300005983 Ga0081540_1006176 Ga0081540_10061768 259
599 3300005983 Ga0081540_1019810 Ga0081540_10198106 259
600 3300005983 Ga0081540_1030875 Ga0081540_10308754 259
601 3300005983 Ga0081540_1050246 Ga0081540_10502461 259
602 3300006028 Ga0070717_10080272 Ga0070717_100802723 259
603 3300006038 Ga0075365_10048361 Ga0075365_100483613 259
604 3300006038 Ga0075365_10058056 Ga0075365_100580564 259
605 3300006038 Ga0075365_10073033 Ga0075365_100730332 259
606 3300006042 Ga0075368_10037556 Ga0075368_100375562 259
607 3300006042 Ga0075368_10087362 Ga0075368_100873621 259
608 3300006048 Ga0075363_100015314 Ga0075363_1000153144 259
609 3300006051 Ga0075364_10027628 Ga0075364_100276284 259
610 3300006051 Ga0075364_10074324 Ga0075364_100743242 259
611 3300006173 Ga0070716_100092284 Ga0070716_1000922842 259
612 3300006175 Ga0070712_100058594 Ga0070712_1000585944 259
613 3300006177 Ga0075362_10033896 Ga0075362_100338961 259
614 3300006177 Ga0075362_10102798 Ga0075362_101027982 259
615 3300006178 Ga0075367_10228330 Ga0075367_102283302 259
616 3300006195 Ga0075366_10029871 Ga0075366_100298712 259
617 3300006195 Ga0075366_10031820 Ga0075366_100318203 259
618 3300006237 Ga0097621_100058724 Ga0097621_1000587243 259
619 3300006353 Ga0075370_10015749 Ga0075370_100157493 259
620 3300006353 Ga0075370_10084193 Ga0075370_100841932 259
621 3300006358 Ga0068871_100034617 Ga0068871_1000346174 259
622 3300006358 Ga0068871_100087688 Ga0068871_1000876881 259
623 3300006358 Ga0068871_100525786 Ga0068871_1005257861 259
624 3300006844 Ga0075428_100077239 Ga0075428_1000772395 259
625 3300006871 Ga0075434_100286281 Ga0075434_1002862812 259
626 3300006931 Ga0097620_100383566 Ga0097620_1003835662 259
627 3300009093 Ga0105240_10027333 Ga0105240_100273336 259
628 3300009094 Ga0111539_10153919 Ga0111539_101539192 259
629 3300009098 Ga0105245_10038988 Ga0105245_100389884 259
630 3300009098 Ga0105245_10194108 Ga0105245_101941083 259
631 3300009098 Ga0105245_10458883 Ga0105245_104588831 259
632 3300009147 Ga0114129_10189934 Ga0114129_101899342 259
633 3300009148 Ga0105243_10016903 Ga0105243_100169037 259
634 3300009174 Ga0105241_10065293 Ga0105241_100652933 259
635 3300009176 Ga0105242_10419850 Ga0105242_104198502 259
636 3300009545 Ga0105237_10209042 Ga0105237_102090422 259
637 3300009553 Ga0105249_10048330 Ga0105249_100483303 259
638 3300010375 Ga0105239_10112481 Ga0105239_101124812 259
639 3300011119 Ga0105246_10022596 Ga0105246_100225963 259
640 3300011119 Ga0105246_10057218 Ga0105246_100572183 259
641 3300013105 Ga0157369_10011431 Ga0157369_100114316 259
642 3300013105 Ga0157369_10052559 Ga0157369_100525595 259
643 3300013105 Ga0157369_10210940 Ga0157369_102109402 259
644 3300013296 Ga0157374_10192800 Ga0157374_101928001 259
645 3300013306 Ga0163162_10065624 Ga0163162_100656243 259
646 3300013307 Ga0157372_10105267 Ga0157372_101052671 259
647 3300013308 Ga0157375_10231730 Ga0157375_102317303 259
648 3300014325 Ga0163163_10118731 Ga0163163_101187312 259
649 3300014325 Ga0163163_10298116 Ga0163163_102981162 259
650 3300014745 Ga0157377_10118989 Ga0157377_101189891 259
651 3300014968 Ga0157379_10023569 Ga0157379_100235696 259
652 3300014969 Ga0157376_10287582 Ga0157376_102875822 259
653 3300017792 Ga0163161_10127337 Ga0163161_101273373 259
654 3300025898 Ga0207692_10190424 Ga0207692_101904241 259
655 3300025899 Ga0207642_10021279 Ga0207642_100212792 259
656 3300025899 Ga0207642_10054435 Ga0207642_100544352 259
657 3300025900 Ga0207710_10098550 Ga0207710_100985502 259
658 3300025901 Ga0207688_10298393 Ga0207688_102983931 259
659 3300025907 Ga0207645_10081511 Ga0207645_100815111 259
660 3300025912 Ga0207707_10001222 Ga0207707_1000122224 259
661 3300025912 Ga0207707_10037513 Ga0207707_100375131 259
662 3300025912 Ga0207707_10096318 Ga0207707_100963183 259
663 3300025912 Ga0207707_10186582 Ga0207707_101865822 259
664 3300025914 Ga0207671_10193027 Ga0207671_101930272 259
665 3300025915 Ga0207693_10075916 Ga0207693_100759161 259
666 3300025919 Ga0207657_10056992 Ga0207657_100569923 259
667 3300025920 Ga0207649_10361467 Ga0207649_103614671 259
668 3300025921 Ga0207652_10011255 Ga0207652_100112552 259
669 3300025921 Ga0207652_10024322 Ga0207652_100243223 259
670 3300025923 Ga0207681_10088634 Ga0207681_100886343 259
671 3300025928 Ga0207700_10013938 Ga0207700_100139384 259
672 3300025929 Ga0207664_10241565 Ga0207664_102415651 259
673 3300025931 Ga0207644_10187048 Ga0207644_101870482 259
674 3300025932 Ga0207690_10065536 Ga0207690_100655362 259
675 3300025932 Ga0207690_10114570 Ga0207690_101145703 259
676 3300025933 Ga0207706_10083950 Ga0207706_100839503 259
677 3300025934 Ga0207686_10039113 Ga0207686_100391132 259
678 3300025935 Ga0207709_10112831 Ga0207709_101128312 259
679 3300025936 Ga0207670_10173074 Ga0207670_101730743 259
680 3300025937 Ga0207669_10421677 Ga0207669_104216772 259
681 3300025938 Ga0207704_10039581 Ga0207704_100395812 259
682 3300025940 Ga0207691_10092265 Ga0207691_100922653 259
683 3300025941 Ga0207711_10219462 Ga0207711_102194621 259
684 3300025942 Ga0207689_10060253 Ga0207689_100602533 259
685 3300025944 Ga0207661_10000499 Ga0207661_1000049919 259
686 3300025949 Ga0207667_10180188 Ga0207667_101801883 259
687 3300025949 Ga0207667_10338680 Ga0207667_103386802 259
688 3300025949 Ga0207667_10449313 Ga0207667_104493132 259
689 3300025960 Ga0207651_10080927 Ga0207651_100809272 259
690 3300025961 Ga0207712_10158443 Ga0207712_101584432 259
691 3300025972 Ga0207668_10009427 Ga0207668_100094276 259
692 3300025972 Ga0207668_10022935 Ga0207668_100229353 259
693 3300025972 Ga0207668_10026363 Ga0207668_100263633 259
694 3300025986 Ga0207658_10072837 Ga0207658_100728373 259
695 3300026023 Ga0207677_10008684 Ga0207677_100086845 259
696 3300026023 Ga0207677_10022654 Ga0207677_100226542 259
697 3300026035 Ga0207703_10320567 Ga0207703_103205672 259
698 3300026041 Ga0207639_10062834 Ga0207639_100628343 259
699 3300026041 Ga0207639_10233030 Ga0207639_102330302 259
700 3300026067 Ga0207678_10029342 Ga0207678_100293424 259
701 3300026067 Ga0207678_10040741 Ga0207678_100407413 259
702 3300026067 Ga0207678_10056118 Ga0207678_100561184 259
703 3300026067 Ga0207678_10059827 Ga0207678_100598274 259
704 3300026075 Ga0207708_10062207 Ga0207708_100622072 259
705 3300026078 Ga0207702_10138490 Ga0207702_101384902 259
706 3300026078 Ga0207702_10380955 Ga0207702_103809552 259
707 3300026088 Ga0207641_10249515 Ga0207641_102495152 259
708 3300026089 Ga0207648_10029160 Ga0207648_100291604 259
709 3300026095 Ga0207676_10046804 Ga0207676_100468042 259
710 3300026095 Ga0207676_10293180 Ga0207676_102931801 259
711 3300026118 Ga0207675_100018245 Ga0207675_1000182457 259
712 3300026118 Ga0207675_100164894 Ga0207675_1001648942 259
713 3300026118 Ga0207675_100372987 Ga0207675_1003729871 259
714 3300026121 Ga0207683_10054649 Ga0207683_100546493 259
715 3300026121 Ga0207683_10082425 Ga0207683_100824252 259
716 3300026121 Ga0207683_10263993 Ga0207683_102639932 259
717 3300026142 Ga0207698_11055064 Ga0207698_110550641 259
718 3300027671 Ga0209588_1010269 Ga0209588_10102693 259
719 3300028379 Ga0268266_10001465 Ga0268266_100014655 259
720 3300028379 Ga0268266_10003531 Ga0268266_1000353115 259
721 3300028379 Ga0268266_10016020 Ga0268266_100160201 259
722 3300028379 Ga0268266_10088145 Ga0268266_100881453 259
723 3300028379 Ga0268266_10095655 Ga0268266_100956554 259
724 3300028379 Ga0268266_10468669 Ga0268266_104686692 259
725 3300031235 Ga0265330_10073333 Ga0265330_100733332 259
726 3300031235 Ga0265330_10073974 Ga0265330_100739741 259
727 3300031247 Ga0265340_10036665 Ga0265340_100366652 259
728 3300031456 Ga0307513_10466462 Ga0307513_104664621 259
729 3300031595 Ga0265313_10037155 Ga0265313_100371552 259
730 3300031616 Ga0307508_10065785 Ga0307508_100657854 259
731 3300031712 Ga0265342_10059059 Ga0265342_100590592 259
732 3300031731 Ga0307405_10100094 Ga0307405_101000942 259
733 3300031852 Ga0307410_10439284 Ga0307410_104392842 259
734 3300031901 Ga0307406_10313123 Ga0307406_103131232 259
735 3300033180 Ga0307510_10004617 Ga0307510_1000461712 259
736 3300033180 Ga0307510_10020616 Ga0307510_100206168 259
737 3300033180 Ga0307510_10049660 Ga0307510_100496607 259
738 3300035086 Ga0373934_0012795 Ga0373934_0012795_1301_2080 259
739 3300035113 Ga0373936_0006507 Ga0373936_0006507_1347_2126 259
740 3300035116 Ga0373945_0031927 Ga0373945_0031927_688_1467 259
741 3300035117 Ga0373953_0003083 Ga0373953_0003083_1406_2185 259
742 3300035119 Ga0373956_0000726 Ga0373956_0000726_4640_5419 259
743 3300035120 Ga0373957_0004882 Ga0373957_0004882_1357_2136 259
744 3300035171 Ga0373946_0008147 Ga0373946_0008147_820_1599 259
745 3300035171 Ga0373946_0079458 Ga0373946_0079458_541_1320 259
746 3300035172 Ga0373955_0003241 Ga0373955_0003241_5150_5929 259
747 3300035172 Ga0373955_0020612 Ga0373955_0020612_153_932 259
748 3300035410 Ga0373924_0021158 Ga0373924_0021158_1631_2410 259
749 3300035695 Ga0373927_0001005 Ga0373927_0001005_2039_2818 259
750 3300035695 Ga0373927_0113569 Ga0373927_0113569_578_1357 259
751 3300035695 Ga0373927_0143691 Ga0373927_0143691_127_906 259
752 3300035695 Ga0373927_0173891 Ga0373927_0173891_273_1052 259
753 3300035724 Ga0373933_0009400 Ga0373933_0009400_2893_3672 259
754 3300035724 Ga0373933_0020192 Ga0373933_0020192_483_1262 259
755 3300035725 Ga0373947_0005667 Ga0373947_0005667_6071_6850 259
756 3300035725 Ga0373947_0116907 Ga0373947_0116907_857_1636 259
757 3300036401 Ga0373937_0002920 Ga0373937_0002920_8921_9700 259
758 3300037068 Ga0373925_0079952 Ga0373925_0079952_1688_2467 259
759 3300037068 Ga0373925_0108079 Ga0373925_0108079_899_1678 259
760 3300037418 Ga0395900_0081560 Ga0395900_0081560_2319_3098 259
761 3300038443 Ga0395901_0039843 Ga0395901_0039843_2440_3219 259
762 3300039437 Ga0436365_0244764 Ga0436365_0244764_340_1119 259
763 3300039437 Ga0436365_0870867 Ga0436365_0870867_1034_1813 259
764 3300041458 Ga0451798_0628637 Ga0451798_0628637_94_873 259
765 3300041503 Ga0451847_0360949 Ga0451847_0360949_388_1167 259
766 3300044694 Ga0466963_0216899 Ga0466963_0216899_545_1324 259
767 3300046452 Ga0495617_032196 Ga0495617_032196_17_796 259
768 3300046454 Ga0495592_0001015 Ga0495592_0001015_15069_15848 259
769 3300046455 Ga0495603_0010944 Ga0495603_0010944_1902_2681 259
770 3300046455 Ga0495603_0077462 Ga0495603_0077462_95_874 259
771 3300046459 Ga0495629_0003238 Ga0495629_0003238_1459_2238 259
772 3300046460 Ga0495638_0200454 Ga0495638_0200454_284_1063 259
773 3300046462 Ga0495651_0015940 Ga0495651_0015940_3394_4173 259
774 3300046463 Ga0495653_0000934 Ga0495653_0000934_3549_4328 259
775 3300046472 Ga0495580_0010282 Ga0495580_0010282_1646_2425 259
776 3300046472 Ga0495580_0119377 Ga0495580_0119377_804_1583 259
777 3300046473 Ga0495582_0019067 Ga0495582_0019067_1361_2140 259
778 3300046473 Ga0495582_0070749 Ga0495582_0070749_692_1471 259
779 3300046474 Ga0495605_0171646 Ga0495605_0171646_115_894 259
780 3300046491 Ga0495584_0064018 Ga0495584_0064018_842_1621 259
781 3300046492 Ga0495585_0086988 Ga0495585_0086988_452_1231 259
782 3300046501 Ga0495607_0138068 Ga0495607_0138068_20_799 259
783 3300046511 Ga0495608_0002093 Ga0495608_0002093_7508_8287 259
784 3300046514 Ga0495618_0065862 Ga0495618_0065862_1232_2011 259
785 3300046516 Ga0495628_0020462 Ga0495628_0020462_2230_3009 259
786 3300046528 Ga0495642_0162479 Ga0495642_0162479_98_877 259
787 3300046529 Ga0495652_0002209 Ga0495652_0002209_2704_3483 259
788 3300046529 Ga0495652_0203001 Ga0495652_0203001_599_1378 259
789 3300046533 Ga0495640_0026887 Ga0495640_0026887_2300_3079 259
790 3300046536 Ga0495587_0015200 Ga0495587_0015200_1262_2041 259
791 3300046538 Ga0495609_0157492 Ga0495609_0157492_122_901 259
792 3300046543 Ga0495645_0012499 Ga0495645_0012499_3113_3892 259
793 3300046557 Ga0495622_0022179 Ga0495622_0022179_1044_1823 259
794 3300046559 Ga0495667_0009515 Ga0495667_0009515_1499_2278 259
795 3300046642 Ga0495634_0083525 Ga0495634_0083525_806_1585 259
796 3300046663 Ga0495635_0000540 Ga0495635_0000540_17182_17961 259
797 3300046663 Ga0495635_0007303 Ga0495635_0007303_4044_4823 259
798 3300046665 Ga0495661_0132550 Ga0495661_0132550_19_798 259
799 3300046665 Ga0495661_0200219 Ga0495661_0200219_219_998 259
800 3300046674 Ga0495588_0095442 Ga0495588_0095442_589_1368 259
801 3300046675 Ga0495657_0001615 Ga0495657_0001615_14921_15700 259
802 3300046675 Ga0495657_0306693 Ga0495657_0306693_67_846 259
803 3300046679 Ga0495623_0042546 Ga0495623_0042546_467_1246 259
804 3300046679 Ga0495623_0069774 Ga0495623_0069774_609_1388 259
805 3300046680 Ga0495646_0010030 Ga0495646_0010030_4410_5189 259
806 3300046680 Ga0495646_0282907 Ga0495646_0282907_42_821 259
807 3300046683 Ga0495658_0146135 Ga0495658_0146135_501_1280 259
808 3300046683 Ga0495658_0147849 Ga0495658_0147849_515_1294 259
809 3300046689 Ga0495613_0069052 Ga0495613_0069052_221_1000 259
810 3300046689 Ga0495613_0069070 Ga0495613_0069070_1135_1914 259
811 3300046689 Ga0495613_0143346 Ga0495613_0143346_798_1577 259
812 3300046691 Ga0495670_0057400 Ga0495670_0057400_841_1620 259
813 3300046794 Ga0495589_0152954 Ga0495589_0152954_263_1042 259
814 3300046809 Ga0495600_0004052 Ga0495600_0004052_6884_7663 259
815 3300047317 Ga0495604_0021019 Ga0495604_0021019_2979_3758 259
816 3300047318 Ga0495636_0104488 Ga0495636_0104488_227_1006 259
817 3300047319 Ga0495674_0032464 Ga0495674_0032464_3900_4679 259
818 3300047319 Ga0495674_0064849 Ga0495674_0064849_852_1631 259
819 3300047320 Ga0495672_0079809 Ga0495672_0079809_454_1233 259
820 3300047320 Ga0495672_0156642 Ga0495672_0156642_64_843 259
821 3300047321 Ga0495676_0094225 Ga0495676_0094225_1036_1815 259
822 3300047322 Ga0495680_0012504 Ga0495680_0012504_3405_4184 259
823 3300047444 Ga0495675_0001958 Ga0495675_0001958_4361_5140 259
824 3300047445 Ga0495677_0029096 Ga0495677_0029096_663_1442 259
825 3300047447 Ga0495685_106021 Ga0495685_106021_136_915 259
826 3300047470 Ga0495681_0043594 Ga0495681_0043594_14_793 259
827 3300047471 Ga0495684_0001865 Ga0495684_0001865_3144_3923 259
828 3300047471 Ga0495684_0074943 Ga0495684_0074943_240_1019 259
829 3300047673 Ga0495593_0042278 Ga0495593_0042278_266_1045 259
830 3300047673 Ga0495593_0279050 Ga0495593_0279050_38_817 259
831 3300048088 Ga0495602_0008574 Ga0495602_0008574_9068_9847 259
832 3300048903 Ga0496100_0015363 Ga0496100_0015363_354_1133 259
833 3300048904 Ga0496101_0045479 Ga0496101_0045479_220_999 259
834 3300048904 Ga0496101_0128252 Ga0496101_0128252_24_803 259
835 3300048904 Ga0496101_0641512 Ga0496101_0641512_32_811 259
836 3300048905 Ga0496102_0000518 Ga0496102_0000518_36490_37269 259
837 3300048905 Ga0496102_0040527 Ga0496102_0040527_477_1256 259
838 3300048905 Ga0496102_0088496 Ga0496102_0088496_1467_2246 259
839 3300048907 Ga0496104_0154376 Ga0496104_0154376_715_1494 259
840 3300048908 Ga0496105_0004256 Ga0496105_0004256_8548_9327 259
841 3300048908 Ga0496105_0471040 Ga0496105_0471040_32_811 259
842 3300048909 Ga0496106_0000116 Ga0496106_0000116_13404_14183 259
843 3300048909 Ga0496106_0015576 Ga0496106_0015576_3388_4167 259
844 3300048909 Ga0496106_0052613 Ga0496106_0052613_1848_2627 259
845 3300048909 Ga0496106_0381075 Ga0496106_0381075_93_872 259
846 3300048910 Ga0496107_0001003 Ga0496107_0001003_10950_11729 259
847 3300048910 Ga0496107_0042167 Ga0496107_0042167_1222_2001 259
848 3300048910 Ga0496107_0200124 Ga0496107_0200124_23_802 259
849 3300048911 Ga0496108_0000523 Ga0496108_0000523_16800_17579 259
850 3300048911 Ga0496108_0005230 Ga0496108_0005230_3723_4502 259
851 3300048911 Ga0496108_0315518 Ga0496108_0315518_26_805 259
852 3300048912 Ga0496109_0001407 Ga0496109_0001407_2302_3081 259
853 3300048912 Ga0496109_0005646 Ga0496109_0005646_3083_3862 259
854 3300048912 Ga0496109_0014037 Ga0496109_0014037_5189_5968 259
855 3300048913 Ga0496110_0096837 Ga0496110_0096837_1409_2188 259
856 3300048913 Ga0496110_0131033 Ga0496110_0131033_415_1194 259
857 3300048913 Ga0496110_0236942 Ga0496110_0236942_809_1588 259
858 3300048914 Ga0496111_0092499 Ga0496111_0092499_697_1476 259
859 3300048914 Ga0496111_0192727 Ga0496111_0192727_96_875 259
860 3300048915 Ga0496112_0005822 Ga0496112_0005822_4955_5734 259
861 3300048915 Ga0496112_0089521 Ga0496112_0089521_431_1210 259
862 3300048915 Ga0496112_0266573 Ga0496112_0266573_272_1051 259
863 3300048915 Ga0496112_0292241 Ga0496112_0292241_414_1193 259
864 3300048916 Ga0496113_0040246 Ga0496113_0040246_372_1151 259
865 3300048916 Ga0496113_0155383 Ga0496113_0155383_888_1667 259
866 3300048917 Ga0496114_0023481 Ga0496114_0023481_1402_2181 259
867 3300048917 Ga0496114_0105206 Ga0496114_0105206_244_1023 259
868 3300048917 Ga0496114_0759064 Ga0496114_0759064_26_805 259
869 3300048918 Ga0496115_0001962 Ga0496115_0001962_3788_4567 259
870 3300048918 Ga0496115_0029187 Ga0496115_0029187_3086_3865 259
871 3300048918 Ga0496115_0174257 Ga0496115_0174257_157_936 259
872 3300048918 Ga0496115_0321695 Ga0496115_0321695_322_1101 259
873 3300048922 Ga0496119_0149452 Ga0496119_0149452_91_870 259
874 3300048924 Ga0496121_0007140 Ga0496121_0007140_2156_2941 259
875 3300048924 Ga0496121_0059500 Ga0496121_0059500_1680_2459 259
876 3300048924 Ga0496121_0101392 Ga0496121_0101392_269_1048 259
877 3300048927 Ga0496124_0233211 Ga0496124_0233211_585_1364 259
878 3300048928 Ga0496125_0139997 Ga0496125_0139997_384_1163 259
879 3300048929 Ga0496126_0146154 Ga0496126_0146154_269_1048 259
880 3300048929 Ga0496126_0315486 Ga0496126_0315486_473_1252 259
881 3300049460 Ga0495682_0098803 Ga0495682_0098803_18_797 259
882 3300049573 Ga0501037_0325957 Ga0501037_0325957_270_1049 259
883 3300049580 Ga0501046_0159998 Ga0501046_0159998_139_918 259
884 3300049581 Ga0501047_0166415 Ga0501047_0166415_398_1177 259
885 3300049586 Ga0501070_0101299 Ga0501070_0101299_1535_2314 259
886 3300049589 Ga0501073_0208108 Ga0501073_0208108_102_881 259
887 3300049590 Ga0501074_0054035 Ga0501074_0054035_224_1003 259
888 3300049823 Ga0501044_0060418 Ga0501044_0060418_1240_2019 259
889 3300050489 nmdc:mga03683_34046_c1 nmdc:mga03683_34046_c1_34_813 259
890 3300050490 nmdc:mga03n38_64269_c1 nmdc:mga03n38_64269_c1_191_970 259
891 3300050491 nmdc:mga00v17_55445_c1 nmdc:mga00v17_55445_c1_1197_1976 259
892 3300050492 nmdc:mga0yw44_158641_c1 nmdc:mga0yw44_158641_c1_26_805 259
893 3300050493 nmdc:mga0k408_184721_c1 nmdc:mga0k408_184721_c1_95_874 259
894 3300050494 nmdc:mga06z11_192205_c1 nmdc:mga06z11_192205_c1_149_928 259
895 3300050494 nmdc:mga06z11_244461_c1 nmdc:mga06z11_244461_c1_60_839 259
896 3300050494 nmdc:mga06z11_76619_c1 nmdc:mga06z11_76619_c1_544_1323 259
897 3300050496 nmdc:mga07m45_138730_c1 nmdc:mga07m45_138730_c1_116_895 259
898 3300050496 nmdc:mga07m45_148882_c1 nmdc:mga07m45_148882_c1_346_1125 259
899 3300050507 nmdc:mga05p37_73611_c1 nmdc:mga05p37_73611_c1_1282_2061 259
900 3300050511 nmdc:mga08y16_323386_c1 nmdc:mga08y16_323386_c1_684_1463 259
901 3300050513 nmdc:mga0rr50_254246_c1 nmdc:mga0rr50_254246_c1_472_1251 259
902 3300050515 nmdc:mga0a205_509902_c1 nmdc:mga0a205_509902_c1_121_900 259
903 3300050516 nmdc:mga0sz30_43856_c1 nmdc:mga0sz30_43856_c1_818_1597 259
904 3300053083 Ga0495655_0055616 Ga0495655_0055616_228_1007 259
905 3300053084 Ga0495595_0051140 Ga0495595_0051140_447_1226 259
906 3300053085 Ga0495619_0024640 Ga0495619_0024640_782_1561 259
907 3300053085 Ga0495619_0146567 Ga0495619_0146567_43_822 259
908 3300053091 Ga0500647_0030004 Ga0500647_0030004_573_1352 259
909 3300053093 Ga0500651_0009449 Ga0500651_0009449_2555_3334 259
910 3300053094 Ga0500566_0000064 Ga0500566_0000064_46489_47268 259
911 3300053095 Ga0500640_004979 Ga0500640_004979_3598_4377 259
912 3300053102 Ga0500554_006673 Ga0500554_006673_1636_2415 259
913 3300053111 Ga0500572_000026 Ga0500572_000026_43118_43897 259
914 3300053118 Ga0500594_0026277 Ga0500594_0026277_544_1323 259
915 3300053123 Ga0500614_001497 Ga0500614_001497_3631_4410 259
916 3300053130 Ga0500642_0001501 Ga0500642_0001501_3410_4189 259
917 3300053130 Ga0500642_0022680 Ga0500642_0022680_1179_1958 259
918 3300053134 Ga0500658_0193358 Ga0500658_0193358_49_828 259
919 3300053136 Ga0500559_0003076 Ga0500559_0003076_7232_8011 259
920 3300053150 Ga0500603_001132 Ga0500603_001132_1811_2590 259
921 3300053159 Ga0500630_000572 Ga0500630_000572_3647_4426 259
922 3300053162 Ga0500638_025631 Ga0500638_025631_1565_2344 259
923 3300053162 Ga0500638_165198 Ga0500638_165198_87_866 259
924 3300053163 Ga0500639_000353 Ga0500639_000353_3647_4426 259
925 3300053177 Ga0500636_0169760 Ga0500636_0169760_391_1170 259
926 3300053178 Ga0500637_0027232 Ga0500637_0027232_567_1346 259
927 3300053737 Ga0500601_002435 Ga0500601_002435_283_1062 259
928 3300006028 Ga0070717_10266497 Ga0070717_102664972 260
929 3300025913 Ga0207695_10493222 Ga0207695_104932221 260
930 3300025928 Ga0207700_10013381 Ga0207700_100133815 260
931 3300046462 Ga0495651_0178957 Ga0495651_0178957_523_1305 260
932 3300035111 Ga0373923_0116093 Ga0373923_0116093_128_913 261
933 3300046459 Ga0495629_0081525 Ga0495629_0081525_308_1093 261
934 3300046678 Ga0495599_0007666 Ga0495599_0007666_4505_5290 261
935 3300048915 Ga0496112_0098378 Ga0496112_0098378_1859_2644 261
936 3300048918 Ga0496115_0133812 Ga0496115_0133812_545_1330 261
937 iso_pu_bacteria 2922386360 2922388010 261
938 3300044842 Ga0466957_0066260 Ga0466957_0066260_1027_1818 263
939 3300005563 Ga0068855_100060159 Ga0068855_1000601593 265
940 3300005577 Ga0068857_100265276 Ga0068857_1002652762 265
941 3300005834 Ga0068851_10042077 Ga0068851_100420772 265
942 3300005844 Ga0068862_100153409 Ga0068862_1001534092 265
943 3300005844 Ga0068862_100564389 Ga0068862_1005643892 265
944 3300009093 Ga0105240_10015488 Ga0105240_1001548811 265
945 3300009545 Ga0105237_10052107 Ga0105237_100521073 265
946 3300009551 Ga0105238_10059171 Ga0105238_100591712 265
947 3300010375 Ga0105239_10032269 Ga0105239_100322694 265
948 3300013104 Ga0157370_10050985 Ga0157370_100509853 265
949 3300013105 Ga0157369_10020578 Ga0157369_100205786 265
950 3300025912 Ga0207707_10000466 Ga0207707_1000046635 265
951 3300025913 Ga0207695_10057285 Ga0207695_100572853 265
952 3300025914 Ga0207671_10035977 Ga0207671_100359773 265
953 3300025917 Ga0207660_10004908 Ga0207660_100049087 265
954 3300025919 Ga0207657_10004634 Ga0207657_100046349 265
955 3300025921 Ga0207652_10002138 Ga0207652_100021383 265
956 3300025924 Ga0207694_10129317 Ga0207694_101293172 265
957 3300025932 Ga0207690_10098731 Ga0207690_100987312 265
958 3300025944 Ga0207661_10015755 Ga0207661_100157551 265
959 3300025949 Ga0207667_10012774 Ga0207667_100127746 265
960 3300025981 Ga0207640_10142365 Ga0207640_101423652 265
961 3300026041 Ga0207639_10009801 Ga0207639_100098013 265
962 3300026116 Ga0207674_10117026 Ga0207674_101170263 265
963 3300035692 Ga0373935_0216431 Ga0373935_0216431_517_1317 266
964 3300046526 Ga0495666_0113226 Ga0495666_0113226_18_818 266
965 3300047315 Ga0495581_0117764 Ga0495581_0117764_621_1424 266
966 3300025297 Ga0209758_1002062 Ga0209758_100206221 267
967 3300005329 Ga0070683_100163357 Ga0070683_1001633572 268
968 3300046558 Ga0495633_0054611 Ga0495633_0054611_317_1129 270
969 3300048907 Ga0496104_0113960 Ga0496104_0113960_1474_2286 270
970 3300053096 Ga0500641_0038291 Ga0500641_0038291_349_1179 273
971 3300031901 Ga0307406_10168321 Ga0307406_101683211 275
972 3300053136 Ga0500559_0115769 Ga0500559_0115769_295_1137 275
973 3300005937 Ga0081455_10141150 Ga0081455_101411502 276
974 3300009093 Ga0105240_10486506 Ga0105240_104865062 276
975 3300048907 Ga0496104_0369454 Ga0496104_0369454_95_925 276
976 3300010375 Ga0105239_10105757 Ga0105239_101057572 277
977 3300053087 Ga0500643_000019 Ga0500643_000019_136610_137443 277
978 3300053736 Ga0500599_000542 Ga0500599_000542_1578_2411 277
979 3300005456 Ga0070678_100019116 Ga0070678_1000191164 281
980 3300005459 Ga0068867_100463638 Ga0068867_1004636381 281
981 3300010375 Ga0105239_10099980 Ga0105239_100999803 281
982 3300013308 Ga0157375_10047153 Ga0157375_100471534 281
983 3300014745 Ga0157377_10175732 Ga0157377_101757321 281
984 3300014969 Ga0157376_10120561 Ga0157376_101205612 281
985 3300025900 Ga0207710_10189914 Ga0207710_101899141 281
986 3300026121 Ga0207683_10011914 Ga0207683_100119143 281
987 3300046507 Ga0495606_0090759 Ga0495606_0090759_527_1372 281
988 3300003215 JGI25153J46596_10000366 JGI25153J46596_1000036620 288
989 3300048905 Ga0496102_0143112 Ga0496102_0143112_1088_1957 289
990 3300048909 Ga0496106_0059004 Ga0496106_0059004_1589_2458 289
991 3300050490 nmdc:mga03n38_6302_c1 nmdc:mga03n38_6302_c1_2135_3004 289
992 3300050492 nmdc:mga0yw44_11492_c1 nmdc:mga0yw44_11492_c1_3567_4436 289
993 3300050494 nmdc:mga06z11_31830_c1 nmdc:mga06z11_31830_c1_742_1611 289
994 3300050496 nmdc:mga07m45_15298_c1 nmdc:mga07m45_15298_c1_1911_2780 289
995 3300053094 Ga0500566_0092758 Ga0500566_0092758_266_1147 292
996 3300053102 Ga0500554_015475 Ga0500554_015475_236_1117 292
997 3300053119 Ga0500595_002251 Ga0500595_002251_3800_4681 292
998 3300053150 Ga0500603_015252 Ga0500603_015252_716_1597 292
999 3300053162 Ga0500638_002262 Ga0500638_002262_2551_3432 292
1000 3300053178 Ga0500637_0000356 Ga0500637_0000356_11669_12550 292
1001 3300048915 Ga0496112_0480936 Ga0496112_0480936_230_1117 295
1002 3300002073 JGI24745J21846_1004743 JGI24745J21846_10047431 317
1003 3300005334 Ga0068869_100104819 Ga0068869_1001048192 317
1004 3300005338 Ga0068868_100045227 Ga0068868_1000452272 317
1005 3300005339 Ga0070660_100185563 Ga0070660_1001855632 317
1006 3300005347 Ga0070668_100176725 Ga0070668_1001767251 317
1007 3300005444 Ga0070694_100175875 Ga0070694_1001758751 317
1008 3300005455 Ga0070663_100270029 Ga0070663_1002700291 317
1009 3300005456 Ga0070678_100102928 Ga0070678_1001029282 317
1010 3300005457 Ga0070662_100173828 Ga0070662_1001738281 317
1011 3300005459 Ga0068867_100108604 Ga0068867_1001086042 317
1012 3300005548 Ga0070665_100106328 Ga0070665_1001063281 317
1013 3300005617 Ga0068859_100075880 Ga0068859_1000758803 317
1014 3300005718 Ga0068866_10026450 Ga0068866_100264502 317
1015 3300005719 Ga0068861_100044893 Ga0068861_1000448933 317
1016 3300005842 Ga0068858_100130635 Ga0068858_1001306352 317
1017 3300005843 Ga0068860_100028576 Ga0068860_1000285765 317
1018 3300005844 Ga0068862_100154996 Ga0068862_1001549962 317
1019 3300006175 Ga0070712_100050251 Ga0070712_1000502512 317
1020 3300006881 Ga0068865_100045334 Ga0068865_1000453343 317
1021 3300006931 Ga0097620_100075881 Ga0097620_1000758813 317
1022 3300009101 Ga0105247_10037260 Ga0105247_100372602 317
1023 3300009176 Ga0105242_10115794 Ga0105242_101157941 317
1024 3300013306 Ga0163162_10108248 Ga0163162_101082483 317
1025 3300013307 Ga0157372_10103537 Ga0157372_101035373 317
1026 3300013308 Ga0157375_10015934 Ga0157375_100159347 317
1027 3300017792 Ga0163161_10056327 Ga0163161_100563273 317
1028 3300025899 Ga0207642_10037369 Ga0207642_100373692 317
1029 3300025901 Ga0207688_10031130 Ga0207688_100311303 317
1030 3300025915 Ga0207693_10034621 Ga0207693_100346212 317
1031 3300025923 Ga0207681_10088275 Ga0207681_100882753 317
1032 3300025926 Ga0207659_10069356 Ga0207659_100693562 317
1033 3300025933 Ga0207706_10095838 Ga0207706_100958382 317
1034 3300025934 Ga0207686_10187205 Ga0207686_101872052 317
1035 3300025942 Ga0207689_10064343 Ga0207689_100643432 317
1036 3300025972 Ga0207668_10154981 Ga0207668_101549812 317
1037 3300025981 Ga0207640_10068680 Ga0207640_100686802 317
1038 3300026023 Ga0207677_10088035 Ga0207677_100880352 317
1039 3300026089 Ga0207648_10075028 Ga0207648_100750283 317
1040 3300026118 Ga0207675_100147700 Ga0207675_1001477002 317
1041 3300026121 Ga0207683_10132129 Ga0207683_101321292 317
1042 3300028379 Ga0268266_10099013 Ga0268266_100990131 317
1043 3300048905 Ga0496102_0051795 Ga0496102_0051795_2416_3369 317
1044 3300048912 Ga0496109_0060989 Ga0496109_0060989_949_1902 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

51

269

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7et9-assembly1.cif.gz_A crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii 0.9076 68 306
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.9067 68 306
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.9057 68 306
2v5j-assembly1.cif.gz_B apo class ii aldolase hpch 0.9035 68 306
7v8t-assembly1.cif.gz_F crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. 0.9004 66 306
ID Description Score Start End Superfamily
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9119 68 305 3.20.20.60
af_Q4DGT6_3_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9045 65 306 3.20.20.60
4tv5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8964 67 313 3.20.20.60
6r62A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8948 68 306 3.20.20.60
af_Q4CQY1_6_194_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8928 71 252 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A6N9CWP1-F1-model_v4 deleted 0.9406 68 234
AF-A0A2E6ULC4-F1-model_v4 Aldolase 0.9391 93 263 GO:0005737
GO:0016832
AF-A0A7X7BD34-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.9372 68 241 GO:0005737
GO:0016832
AF-N1S4F7-F1-model_v4 2-keto-3-deoxy-L-rhamnonate aldolase 0.9345 79 278 GO:0005737
GO:0016832
AF-X1V378-F1-model_v4 HpcH/HpaI aldolase/citrate lyase domain-containing protein 0.9339 68 276 GO:0005737
GO:0016832

Feature Viewer

pLDDT pTM Quality
82.53 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map