F488927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1045 | 327 | 1044 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300006914|Ga0075436_100400939|Ga0075436_1004009391 |
| Length | 266 |
| Sequence | VIARARHANGAGRGAPASERAGGSGGAKPPGLMMKPAGTLQIAPSLLSADFARLGDAVALAERAGADLIHFDVMDGHFVPNITIGPPVVKSIKRVAHVPLDVHLMITDPDRYIDAFAEAGAAMMSVHVEVLPHLHRTVHAIKALGVRAGVVLNPSTPVVALEEVAGDVDYVLVMSVNPGFGGQTFIPRSESKVRDVRALLDRAGSRAAIEIDGGIDQRTVGRVVAAGARMIVAGSAIFHSGDPERATRDLKAAAMGALLPSTGIPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 189 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 225 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 226 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 227 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 228 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 229 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.86 |
| Nodule | 0 |
| Rhizoplane | 1.44 |
| Rhizosphere | 97.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002904 | 3300001977 | Unclassified | 2694 |
| 2 | JGI25406J46586_10096364 | 3300003203 | Bacteria | 886 |
| 3 | Ga0065714_10016598 | 3300005288 | Bacteria | 1770 |
| 4 | Ga0065714_10148072 | 3300005288 | Bacteria | 1124 |
| 5 | Ga0065712_10067826 | 3300005290 | Bacteria | 27846 |
| 6 | Ga0065712_10075828 | 3300005290 | Bacteria | 3780 |
| 7 | Ga0065712_10140567 | 3300005290 | Bacteria | 1454 |
| 8 | Ga0065712_10254537 | 3300005290 | Bacteria | 947 |
| 9 | Ga0065715_10008301 | 3300005293 | Bacteria | 4410 |
| 10 | Ga0065715_10092637 | 3300005293 | Bacteria | 5011 |
| 11 | Ga0065715_10168068 | 3300005293 | Bacteria | 1569 |
| 12 | Ga0065715_10171797 | 3300005293 | Bacteria | 1541 |
| 13 | Ga0065707_10001067 | 3300005295 | Bacteria | 13664 |
| 14 | Ga0065707_10037066 | 3300005295 | Bacteria | 1007 |
| 15 | Ga0065707_10247017 | 3300005295 | Bacteria | 1137 |
| 16 | Ga0065707_10271034 | 3300005295 | Bacteria | 1065 |
| 17 | Ga0070658_10261910 | 3300005327 | Bacteria | 1469 |
| 18 | Ga0070676_10023420 | 3300005328 | Unclassified | 3470 |
| 19 | Ga0070683_100143130 | 3300005329 | Bacteria | 2265 |
| 20 | Ga0070690_100000943 | 3300005330 | Bacteria | 14838 |
| 21 | Ga0070690_100001946 | 3300005330 | Bacteria | 10986 |
| 22 | Ga0070690_100007254 | 3300005330 | Bacteria | 6343 |
| 23 | Ga0070690_100060755 | 3300005330 | Bacteria | 2433 |
| 24 | Ga0070670_100000685 | 3300005331 | Bacteria | 26291 |
| 25 | Ga0070670_100013235 | 3300005331 | Bacteria | 7068 |
| 26 | Ga0070670_100052051 | 3300005331 | Bacteria | 3516 |
| 27 | Ga0070670_100190644 | 3300005331 | Bacteria | 1781 |
| 28 | Ga0070670_100221775 | 3300005331 | Bacteria | 1645 |
| 29 | Ga0070670_100362902 | 3300005331 | Bacteria | 1274 |
| 30 | Ga0070670_100451704 | 3300005331 | Bacteria | 1139 |
| 31 | Ga0070677_10022596 | 3300005333 | Bacteria | 2319 |
| 32 | Ga0070677_10042130 | 3300005333 | Bacteria | 1806 |
| 33 | Ga0068869_100007243 | 3300005334 | Bacteria | 7070 |
| 34 | Ga0068869_100260137 | 3300005334 | Bacteria | 1389 |
| 35 | Ga0070666_10001117 | 3300005335 | Bacteria | 16334 |
| 36 | Ga0070666_10007711 | 3300005335 | Bacteria | 6646 |
| 37 | Ga0070666_10039257 | 3300005335 | Bacteria | 3154 |
| 38 | Ga0070666_10066402 | 3300005335 | Bacteria | 2448 |
| 39 | Ga0070666_10267088 | 3300005335 | Bacteria | 1214 |
| 40 | Ga0070666_10441666 | 3300005335 | Bacteria | 939 |
| 41 | Ga0070680_100083699 | 3300005336 | Bacteria | 2634 |
| 42 | Ga0070680_100096219 | 3300005336 | Bacteria | 2455 |
| 43 | Ga0070682_100239653 | 3300005337 | Unclassified | 1301 |
| 44 | Ga0068868_100002612 | 3300005338 | Bacteria | 12493 |
| 45 | Ga0068868_100007095 | 3300005338 | Bacteria | 7964 |
| 46 | Ga0068868_100031591 | 3300005338 | Unclassified | 4069 |
| 47 | Ga0068868_100199368 | 3300005338 | Bacteria | 1668 |
| 48 | Ga0068868_100509064 | 3300005338 | Bacteria | 1055 |
| 49 | Ga0070660_100013279 | 3300005339 | Bacteria | 5903 |
| 50 | Ga0070660_100618897 | 3300005339 | Bacteria | 906 |
| 51 | Ga0070689_100017529 | 3300005340 | Bacteria | 5262 |
| 52 | Ga0070689_100036443 | 3300005340 | Bacteria | 3763 |
| 53 | Ga0070689_100037769 | 3300005340 | Unclassified | 3693 |
| 54 | Ga0070689_100069026 | 3300005340 | Bacteria | 2757 |
| 55 | Ga0070689_100085426 | 3300005340 | Bacteria | 2481 |
| 56 | Ga0070689_100235229 | 3300005340 | Bacteria | 1507 |
| 57 | Ga0070687_100006731 | 3300005343 | Bacteria | 4733 |
| 58 | Ga0070687_100018229 | 3300005343 | Bacteria | 3244 |
| 59 | Ga0070687_100043160 | 3300005343 | Bacteria | 2290 |
| 60 | Ga0070687_100043478 | 3300005343 | Bacteria | 2283 |
| 61 | Ga0070687_100364237 | 3300005343 | Bacteria | 937 |
| 62 | Ga0070661_100016239 | 3300005344 | Bacteria | 5260 |
| 63 | Ga0070661_100062768 | 3300005344 | Bacteria | 2728 |
| 64 | Ga0070661_100226572 | 3300005344 | Bacteria | 1435 |
| 65 | Ga0070668_100038946 | 3300005347 | Bacteria | 3636 |
| 66 | Ga0070668_100301093 | 3300005347 | Bacteria | 1345 |
| 67 | Ga0070669_100000985 | 3300005353 | Bacteria | 20776 |
| 68 | Ga0070669_100037262 | 3300005353 | Bacteria | 3527 |
| 69 | Ga0070669_100084340 | 3300005353 | Unclassified | 2370 |
| 70 | Ga0070669_100085447 | 3300005353 | Bacteria | 2356 |
| 71 | Ga0070669_100235214 | 3300005353 | Bacteria | 1454 |
| 72 | Ga0070669_100306722 | 3300005353 | Bacteria | 1278 |
| 73 | Ga0070669_100763896 | 3300005353 | Bacteria | 820 |
| 74 | Ga0070675_100000152 | 3300005354 | Bacteria | 41857 |
| 75 | Ga0070675_100000255 | 3300005354 | Bacteria | 34844 |
| 76 | Ga0070675_100008820 | 3300005354 | Bacteria | 7836 |
| 77 | Ga0070675_100021490 | 3300005354 | Bacteria | 5159 |
| 78 | Ga0070675_100037825 | 3300005354 | Unclassified | 3933 |
| 79 | Ga0070675_100049117 | 3300005354 | Bacteria | 3462 |
| 80 | Ga0070675_100088378 | 3300005354 | Bacteria | 2593 |
| 81 | Ga0070675_100096246 | 3300005354 | Bacteria | 2487 |
| 82 | Ga0070675_100116245 | 3300005354 | Bacteria | 2269 |
| 83 | Ga0070675_100117749 | 3300005354 | Bacteria | 2255 |
| 84 | Ga0070675_100149507 | 3300005354 | Bacteria | 2002 |
| 85 | Ga0070675_100601786 | 3300005354 | Bacteria | 997 |
| 86 | Ga0070671_100008711 | 3300005355 | Bacteria | 8139 |
| 87 | Ga0070671_100021093 | 3300005355 | Bacteria | 5319 |
| 88 | Ga0070671_100031711 | 3300005355 | Bacteria | 4368 |
| 89 | Ga0070671_100065589 | 3300005355 | Bacteria | 3025 |
| 90 | Ga0070671_100079392 | 3300005355 | Bacteria | 2743 |
| 91 | Ga0070671_100145702 | 3300005355 | Bacteria | 1999 |
| 92 | Ga0070671_100229770 | 3300005355 | Bacteria | 1574 |
| 93 | Ga0070671_100415539 | 3300005355 | Bacteria | 1152 |
| 94 | Ga0070671_100497844 | 3300005355 | Bacteria | 1048 |
| 95 | Ga0070674_100000190 | 3300005356 | Bacteria | 29304 |
| 96 | Ga0070674_100160095 | 3300005356 | Bacteria | 1707 |
| 97 | Ga0070674_100360219 | 3300005356 | Bacteria | 1177 |
| 98 | Ga0070674_100619684 | 3300005356 | Bacteria | 917 |
| 99 | Ga0070674_100800288 | 3300005356 | Bacteria | 814 |
| 100 | Ga0070674_100812647 | 3300005356 | Bacteria | 808 |
| 101 | Ga0070673_100003445 | 3300005364 | Bacteria | 9858 |
| 102 | Ga0070673_100003602 | 3300005364 | Bacteria | 9681 |
| 103 | Ga0070673_100008704 | 3300005364 | Bacteria | 6770 |
| 104 | Ga0070673_100018346 | 3300005364 | Bacteria | 4995 |
| 105 | Ga0070673_100048209 | 3300005364 | Bacteria | 3320 |
| 106 | Ga0070673_100065517 | 3300005364 | Bacteria | 2898 |
| 107 | Ga0070673_100101451 | 3300005364 | Bacteria | 2371 |
| 108 | Ga0070673_100149540 | 3300005364 | Bacteria | 1977 |
| 109 | Ga0070673_100170807 | 3300005364 | Bacteria | 1856 |
| 110 | Ga0070673_100187414 | 3300005364 | Bacteria | 1775 |
| 111 | Ga0070688_100006958 | 3300005365 | Bacteria | 6078 |
| 112 | Ga0070688_100030712 | 3300005365 | Bacteria | 3227 |
| 113 | Ga0070688_100121019 | 3300005365 | Unclassified | 1753 |
| 114 | Ga0070688_100147060 | 3300005365 | Bacteria | 1607 |
| 115 | Ga0070688_100165312 | 3300005365 | Bacteria | 1523 |
| 116 | Ga0070688_100230898 | 3300005365 | Bacteria | 1309 |
| 117 | Ga0070688_100297033 | 3300005365 | Bacteria | 1166 |
| 118 | Ga0070659_100076707 | 3300005366 | Bacteria | 2665 |
| 119 | Ga0070659_100237563 | 3300005366 | Bacteria | 1507 |
| 120 | Ga0070659_100270130 | 3300005366 | Bacteria | 1413 |
| 121 | Ga0070667_100000993 | 3300005367 | Bacteria | 26034 |
| 122 | Ga0070667_100002300 | 3300005367 | Bacteria | 16787 |
| 123 | Ga0070667_100013074 | 3300005367 | Bacteria | 6860 |
| 124 | Ga0070667_100091411 | 3300005367 | Bacteria | 2617 |
| 125 | Ga0070667_100098217 | 3300005367 | Bacteria | 2527 |
| 126 | Ga0070667_100270639 | 3300005367 | Bacteria | 1523 |
| 127 | Ga0070667_100367528 | 3300005367 | Bacteria | 1305 |
| 128 | Ga0070714_100057997 | 3300005435 | Bacteria | 3316 |
| 129 | Ga0070713_100040062 | 3300005436 | Bacteria | 3807 |
| 130 | Ga0070713_100061623 | 3300005436 | Bacteria | 3139 |
| 131 | Ga0070701_10009450 | 3300005438 | Bacteria | 4272 |
| 132 | Ga0070701_10098892 | 3300005438 | Unclassified | 1612 |
| 133 | Ga0070701_10173387 | 3300005438 | Bacteria | 1257 |
| 134 | Ga0070701_10224615 | 3300005438 | Bacteria | 1122 |
| 135 | Ga0070705_100012816 | 3300005440 | Bacteria | 4274 |
| 136 | Ga0070700_100073372 | 3300005441 | Unclassified | 2190 |
| 137 | Ga0070694_100178088 | 3300005444 | Bacteria | 1571 |
| 138 | Ga0070708_100019170 | 3300005445 | Bacteria | 5742 |
| 139 | Ga0070708_100335527 | 3300005445 | Bacteria | 1425 |
| 140 | Ga0070708_100586426 | 3300005445 | Bacteria | 1051 |
| 141 | Ga0070663_100089689 | 3300005455 | Unclassified | 2276 |
| 142 | Ga0070663_100645124 | 3300005455 | Bacteria | 895 |
| 143 | Ga0070678_100048372 | 3300005456 | Bacteria | 3062 |
| 144 | Ga0070678_100121064 | 3300005456 | Bacteria | 2064 |
| 145 | Ga0070662_100079620 | 3300005457 | Bacteria | 2437 |
| 146 | Ga0070662_100122339 | 3300005457 | Bacteria | 1996 |
| 147 | Ga0070681_10556187 | 3300005458 | Bacteria | 1061 |
| 148 | Ga0070681_10617054 | 3300005458 | Bacteria | 999 |
| 149 | Ga0068867_100078107 | 3300005459 | Unclassified | 2489 |
| 150 | Ga0068867_100389828 | 3300005459 | Bacteria | 1172 |
| 151 | Ga0070685_10006788 | 3300005466 | Bacteria | 5843 |
| 152 | Ga0070685_10012576 | 3300005466 | Bacteria | 4449 |
| 153 | Ga0070685_10211161 | 3300005466 | Bacteria | 1267 |
| 154 | Ga0070706_100615637 | 3300005467 | Bacteria | 1009 |
| 155 | Ga0070707_100044730 | 3300005468 | Bacteria | 4238 |
| 156 | Ga0070707_100386635 | 3300005468 | Bacteria | 1359 |
| 157 | Ga0070707_100580317 | 3300005468 | Bacteria | 1083 |
| 158 | Ga0070698_100049965 | 3300005471 | Bacteria | 4267 |
| 159 | Ga0070698_100114096 | 3300005471 | Bacteria | 2667 |
| 160 | Ga0070698_100183276 | 3300005471 | Bacteria | 2032 |
| 161 | Ga0070698_100436305 | 3300005471 | Bacteria | 1245 |
| 162 | Ga0070699_100011666 | 3300005518 | Bacteria | 7586 |
| 163 | Ga0070699_100042953 | 3300005518 | Bacteria | 3913 |
| 164 | Ga0070699_100264633 | 3300005518 | Bacteria | 1538 |
| 165 | Ga0070699_100500241 | 3300005518 | Bacteria | 1104 |
| 166 | Ga0070684_100068779 | 3300005535 | Unclassified | 3113 |
| 167 | Ga0068853_100061015 | 3300005539 | Bacteria | 3260 |
| 168 | Ga0070672_100001431 | 3300005543 | Bacteria | 14748 |
| 169 | Ga0070672_100001564 | 3300005543 | Bacteria | 14168 |
| 170 | Ga0070672_100010401 | 3300005543 | Bacteria | 6454 |
| 171 | Ga0070672_100011176 | 3300005543 | Bacteria | 6255 |
| 172 | Ga0070672_100013605 | 3300005543 | Bacteria | 5753 |
| 173 | Ga0070672_100022168 | 3300005543 | Bacteria | 4659 |
| 174 | Ga0070672_100071567 | 3300005543 | Bacteria | 2759 |
| 175 | Ga0070672_100085300 | 3300005543 | Bacteria | 2538 |
| 176 | Ga0070672_100096931 | 3300005543 | Unclassified | 2387 |
| 177 | Ga0070672_100227565 | 3300005543 | Bacteria | 1566 |
| 178 | Ga0070686_100001189 | 3300005544 | Bacteria | 14795 |
| 179 | Ga0070686_100008639 | 3300005544 | Bacteria | 5708 |
| 180 | Ga0070686_100046799 | 3300005544 | Bacteria | 2731 |
| 181 | Ga0070696_100022198 | 3300005546 | Bacteria | 4311 |
| 182 | Ga0070696_100119898 | 3300005546 | Bacteria | 1903 |
| 183 | Ga0070696_100336470 | 3300005546 | Bacteria | 1165 |
| 184 | Ga0070696_100398739 | 3300005546 | Bacteria | 1076 |
| 185 | Ga0070696_100462802 | 3300005546 | Bacteria | 1003 |
| 186 | Ga0070696_100488051 | 3300005546 | Bacteria | 978 |
| 187 | Ga0070696_100491396 | 3300005546 | Bacteria | 975 |
| 188 | Ga0070693_100128986 | 3300005547 | Bacteria | 1578 |
| 189 | Ga0070665_100025393 | 3300005548 | Bacteria | 5970 |
| 190 | Ga0070665_100053852 | 3300005548 | Bacteria | 4035 |
| 191 | Ga0070665_100624446 | 3300005548 | Bacteria | 1091 |
| 192 | Ga0070704_100024158 | 3300005549 | Bacteria | 3984 |
| 193 | Ga0070704_100058059 | 3300005549 | Bacteria | 2755 |
| 194 | Ga0070704_100324958 | 3300005549 | Bacteria | 1290 |
| 195 | Ga0070704_100463186 | 3300005549 | Bacteria | 1094 |
| 196 | Ga0070664_100000144 | 3300005564 | Bacteria | 48758 |
| 197 | Ga0070664_100002638 | 3300005564 | Bacteria | 14464 |
| 198 | Ga0070664_100004803 | 3300005564 | Bacteria | 10831 |
| 199 | Ga0070664_100030218 | 3300005564 | Bacteria | 4520 |
| 200 | Ga0070664_100258174 | 3300005564 | Bacteria | 1567 |
| 201 | Ga0068857_100076900 | 3300005577 | Bacteria | 2977 |
| 202 | Ga0068857_100089334 | 3300005577 | Bacteria | 2757 |
| 203 | Ga0068857_100208450 | 3300005577 | Bacteria | 1783 |
| 204 | Ga0068857_100796655 | 3300005577 | Bacteria | 902 |
| 205 | Ga0068854_100008495 | 3300005578 | Bacteria | 6607 |
| 206 | Ga0068854_100142935 | 3300005578 | Bacteria | 1838 |
| 207 | Ga0068854_100482471 | 3300005578 | Bacteria | 1041 |
| 208 | Ga0070702_100080525 | 3300005615 | Bacteria | 1949 |
| 209 | Ga0070702_100096962 | 3300005615 | Bacteria | 1801 |
| 210 | Ga0070702_100353747 | 3300005615 | Bacteria | 1035 |
| 211 | Ga0068852_100091207 | 3300005616 | Unclassified | 2726 |
| 212 | Ga0068859_100003201 | 3300005617 | Bacteria | 16670 |
| 213 | Ga0068859_100016051 | 3300005617 | Bacteria | 7525 |
| 214 | Ga0068859_100018494 | 3300005617 | Bacteria | 7003 |
| 215 | Ga0068859_100025103 | 3300005617 | Bacteria | 5981 |
| 216 | Ga0068859_100062510 | 3300005617 | Bacteria | 3753 |
| 217 | Ga0068859_100098441 | 3300005617 | Bacteria | 2979 |
| 218 | Ga0068859_100763379 | 3300005617 | Bacteria | 1056 |
| 219 | Ga0068864_100000486 | 3300005618 | Bacteria | 34405 |
| 220 | Ga0068864_100029816 | 3300005618 | Bacteria | 4623 |
| 221 | Ga0068864_100031124 | 3300005618 | Bacteria | 4526 |
| 222 | Ga0068864_100067028 | 3300005618 | Bacteria | 3117 |
| 223 | Ga0068864_100083484 | 3300005618 | Unclassified | 2805 |
| 224 | Ga0068864_100696762 | 3300005618 | Bacteria | 992 |
| 225 | Ga0068864_100708844 | 3300005618 | Bacteria | 984 |
| 226 | Ga0068866_10096320 | 3300005718 | Bacteria | 1623 |
| 227 | Ga0068861_100058288 | 3300005719 | Bacteria | 2953 |
| 228 | Ga0068861_100098464 | 3300005719 | Bacteria | 2321 |
| 229 | Ga0068861_100122823 | 3300005719 | Bacteria | 2097 |
| 230 | Ga0068861_100300161 | 3300005719 | Bacteria | 1391 |
| 231 | Ga0068861_100620563 | 3300005719 | Bacteria | 995 |
| 232 | Ga0068861_100654781 | 3300005719 | Bacteria | 971 |
| 233 | Ga0068851_10188600 | 3300005834 | Bacteria | 1145 |
| 234 | Ga0068870_10004169 | 3300005840 | Bacteria | 6201 |
| 235 | Ga0068870_10032396 | 3300005840 | Bacteria | 2657 |
| 236 | Ga0068870_10087975 | 3300005840 | Bacteria | 1730 |
| 237 | Ga0068870_10274638 | 3300005840 | Bacteria | 1054 |
| 238 | Ga0068870_10385982 | 3300005840 | Bacteria | 908 |
| 239 | Ga0068863_100000526 | 3300005841 | Bacteria | 39045 |
| 240 | Ga0068863_100001664 | 3300005841 | Bacteria | 21972 |
| 241 | Ga0068863_100005682 | 3300005841 | Bacteria | 12249 |
| 242 | Ga0068863_100032658 | 3300005841 | Bacteria | 4960 |
| 243 | Ga0068863_100129493 | 3300005841 | Bacteria | 2409 |
| 244 | Ga0068863_100246010 | 3300005841 | Bacteria | 1727 |
| 245 | Ga0068863_100254071 | 3300005841 | Bacteria | 1698 |
| 246 | Ga0068863_100448879 | 3300005841 | Bacteria | 1265 |
| 247 | Ga0068858_100004023 | 3300005842 | Bacteria | 14505 |
| 248 | Ga0068858_100004203 | 3300005842 | Bacteria | 14174 |
| 249 | Ga0068858_100004339 | 3300005842 | Bacteria | 13920 |
| 250 | Ga0068858_100032481 | 3300005842 | Bacteria | 4847 |
| 251 | Ga0068858_100062381 | 3300005842 | Unclassified | 3446 |
| 252 | Ga0068858_100072713 | 3300005842 | Bacteria | 3190 |
| 253 | Ga0068858_100084694 | 3300005842 | Bacteria | 2949 |
| 254 | Ga0068858_100128931 | 3300005842 | Bacteria | 2371 |
| 255 | Ga0068858_100594024 | 3300005842 | Bacteria | 1074 |
| 256 | Ga0068858_100709378 | 3300005842 | Bacteria | 979 |
| 257 | Ga0068858_100726785 | 3300005842 | Bacteria | 967 |
| 258 | Ga0068858_100830690 | 3300005842 | Bacteria | 902 |
| 259 | Ga0068860_100001145 | 3300005843 | Bacteria | 29096 |
| 260 | Ga0068860_100003450 | 3300005843 | Bacteria | 16260 |
| 261 | Ga0068860_100126642 | 3300005843 | Bacteria | 2448 |
| 262 | Ga0068860_100164750 | 3300005843 | Bacteria | 2139 |
| 263 | Ga0068860_100327563 | 3300005843 | Bacteria | 1504 |
| 264 | Ga0068860_100620517 | 3300005843 | Bacteria | 1088 |
| 265 | Ga0068862_100002759 | 3300005844 | Bacteria | 15391 |
| 266 | Ga0068862_100066537 | 3300005844 | Bacteria | 3105 |
| 267 | Ga0068862_100098609 | 3300005844 | Bacteria | 2553 |
| 268 | Ga0068862_100156512 | 3300005844 | Bacteria | 2032 |
| 269 | Ga0068862_100220673 | 3300005844 | Bacteria | 1716 |
| 270 | Ga0068862_100378337 | 3300005844 | Bacteria | 1320 |
| 271 | Ga0068862_100392169 | 3300005844 | Bacteria | 1297 |
| 272 | Ga0081455_10091618 | 3300005937 | Bacteria | 2461 |
| 273 | Ga0081539_10003749 | 3300005985 | Bacteria | 18053 |
| 274 | Ga0081539_10008963 | 3300005985 | Bacteria | 8515 |
| 275 | Ga0081539_10040616 | 3300005985 | Bacteria | 2729 |
| 276 | Ga0081539_10083995 | 3300005985 | Bacteria | 1665 |
| 277 | Ga0075364_10012103 | 3300006051 | Bacteria | 5265 |
| 278 | Ga0075432_10073402 | 3300006058 | Unclassified | 1232 |
| 279 | Ga0070715_10088888 | 3300006163 | Bacteria | 1417 |
| 280 | Ga0070715_10242795 | 3300006163 | Bacteria | 937 |
| 281 | Ga0070712_100177525 | 3300006175 | Bacteria | 1657 |
| 282 | Ga0075362_10008592 | 3300006177 | Bacteria | 3914 |
| 283 | Ga0075367_10010532 | 3300006178 | Bacteria | 4859 |
| 284 | Ga0075366_10028979 | 3300006195 | Bacteria | 3250 |
| 285 | Ga0097621_100001328 | 3300006237 | Bacteria | 17028 |
| 286 | Ga0097621_100028961 | 3300006237 | Bacteria | 4371 |
| 287 | Ga0097621_100035558 | 3300006237 | Bacteria | 3981 |
| 288 | Ga0097621_100040059 | 3300006237 | Bacteria | 3765 |
| 289 | Ga0097621_100051441 | 3300006237 | Bacteria | 3353 |
| 290 | Ga0097621_100076538 | 3300006237 | Bacteria | 2776 |
| 291 | Ga0097621_100165279 | 3300006237 | Bacteria | 1905 |
| 292 | Ga0097621_100366294 | 3300006237 | Bacteria | 1285 |
| 293 | Ga0068871_100011604 | 3300006358 | Bacteria | 6467 |
| 294 | Ga0068871_100030699 | 3300006358 | Bacteria | 4235 |
| 295 | Ga0068871_100058626 | 3300006358 | Bacteria | 3135 |
| 296 | Ga0068871_100105634 | 3300006358 | Bacteria | 2363 |
| 297 | Ga0075428_100003630 | 3300006844 | Bacteria | 16919 |
| 298 | Ga0075428_100005405 | 3300006844 | Bacteria | 14201 |
| 299 | Ga0075428_100008496 | 3300006844 | Bacteria | 11390 |
| 300 | Ga0075428_100209540 | 3300006844 | Bacteria | 2106 |
| 301 | Ga0075428_100245407 | 3300006844 | Bacteria | 1931 |
| 302 | Ga0075428_100330676 | 3300006844 | Bacteria | 1637 |
| 303 | Ga0075428_100418309 | 3300006844 | Unclassified | 1436 |
| 304 | Ga0075430_100010732 | 3300006846 | Bacteria | 7765 |
| 305 | Ga0075430_100054986 | 3300006846 | Bacteria | 3348 |
| 306 | Ga0075430_100064364 | 3300006846 | Bacteria | 3081 |
| 307 | Ga0075430_100121177 | 3300006846 | Bacteria | 2181 |
| 308 | Ga0075431_100000524 | 3300006847 | Bacteria | 32207 |
| 309 | Ga0075431_100003017 | 3300006847 | Bacteria | 16287 |
| 310 | Ga0075431_100052971 | 3300006847 | Bacteria | 4184 |
| 311 | Ga0075431_100067943 | 3300006847 | Bacteria | 3679 |
| 312 | Ga0075431_100087851 | 3300006847 | Bacteria | 3208 |
| 313 | Ga0075431_100223912 | 3300006847 | Bacteria | 1918 |
| 314 | Ga0075431_100402317 | 3300006847 | Bacteria | 1370 |
| 315 | Ga0075431_100595534 | 3300006847 | Bacteria | 1090 |
| 316 | Ga0075433_10002292 | 3300006852 | Bacteria | 14572 |
| 317 | Ga0075433_10037646 | 3300006852 | Bacteria | 4174 |
| 318 | Ga0075433_10109080 | 3300006852 | Bacteria | 2456 |
| 319 | Ga0075433_10147317 | 3300006852 | Bacteria | 2093 |
| 320 | Ga0075433_10167879 | 3300006852 | Bacteria | 1953 |
| 321 | Ga0075433_10444371 | 3300006852 | Bacteria | 1143 |
| 322 | Ga0075434_100000354 | 3300006871 | Bacteria | 33179 |
| 323 | Ga0075434_100000656 | 3300006871 | Bacteria | 26835 |
| 324 | Ga0075434_100013008 | 3300006871 | Bacteria | 7903 |
| 325 | Ga0075434_100031766 | 3300006871 | Bacteria | 5207 |
| 326 | Ga0075434_100066260 | 3300006871 | Bacteria | 3597 |
| 327 | Ga0075434_100134242 | 3300006871 | Bacteria | 2494 |
| 328 | Ga0075434_100286859 | 3300006871 | Bacteria | 1666 |
| 329 | Ga0075434_100404071 | 3300006871 | Bacteria | 1387 |
| 330 | Ga0075429_100004361 | 3300006880 | Bacteria | 12150 |
| 331 | Ga0075429_100033446 | 3300006880 | Bacteria | 4468 |
| 332 | Ga0075429_100067883 | 3300006880 | Bacteria | 3104 |
| 333 | Ga0075429_100077293 | 3300006880 | Bacteria | 2900 |
| 334 | Ga0075429_100210682 | 3300006880 | Bacteria | 1703 |
| 335 | Ga0075429_100219405 | 3300006880 | Bacteria | 1666 |
| 336 | Ga0075429_100319352 | 3300006880 | Bacteria | 1359 |
| 337 | Ga0068865_100033009 | 3300006881 | Bacteria | 3463 |
| 338 | Ga0068865_100108538 | 3300006881 | Unclassified | 2043 |
| 339 | Ga0075436_100002547 | 3300006914 | Bacteria | 12544 |
| 340 | Ga0075436_100086196 | 3300006914 | Bacteria | 2181 |
| 341 | Ga0075436_100400939 | 3300006914 | Bacteria | 994 |
| 342 | Ga0097620_100003201 | 3300006931 | Bacteria | 16670 |
| 343 | Ga0097620_100016051 | 3300006931 | Bacteria | 7525 |
| 344 | Ga0097620_100018493 | 3300006931 | Bacteria | 7003 |
| 345 | Ga0097620_100025103 | 3300006931 | Bacteria | 5981 |
| 346 | Ga0097620_100062512 | 3300006931 | Bacteria | 3753 |
| 347 | Ga0097620_100098445 | 3300006931 | Bacteria | 2979 |
| 348 | Ga0097620_100331062 | 3300006931 | Bacteria | 1617 |
| 349 | Ga0097620_100763328 | 3300006931 | Bacteria | 1056 |
| 350 | Ga0075435_100000424 | 3300007076 | Bacteria | 25964 |
| 351 | Ga0075435_100009726 | 3300007076 | Bacteria | 6988 |
| 352 | Ga0075435_100028075 | 3300007076 | Bacteria | 4411 |
| 353 | Ga0075435_100045790 | 3300007076 | Bacteria | 3508 |
| 354 | Ga0075435_100051328 | 3300007076 | Bacteria | 3322 |
| 355 | Ga0105240_10013771 | 3300009093 | Bacteria | 11082 |
| 356 | Ga0105240_10040805 | 3300009093 | Bacteria | 5931 |
| 357 | Ga0105240_10274018 | 3300009093 | Bacteria | 1942 |
| 358 | Ga0105240_10291447 | 3300009093 | Bacteria | 1870 |
| 359 | Ga0105240_10900445 | 3300009093 | Bacteria | 952 |
| 360 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 361 | Ga0111539_10006812 | 3300009094 | Bacteria | 14693 |
| 362 | Ga0111539_10014033 | 3300009094 | Bacteria | 10011 |
| 363 | Ga0111539_10026148 | 3300009094 | Bacteria | 7144 |
| 364 | Ga0111539_10041877 | 3300009094 | Bacteria | 5503 |
| 365 | Ga0111539_10082243 | 3300009094 | Bacteria | 3787 |
| 366 | Ga0111539_10190067 | 3300009094 | Bacteria | 2396 |
| 367 | Ga0111539_10306692 | 3300009094 | Bacteria | 1847 |
| 368 | Ga0111539_11013283 | 3300009094 | Bacteria | 965 |
| 369 | Ga0105245_10028953 | 3300009098 | Bacteria | 4890 |
| 370 | Ga0105245_10266303 | 3300009098 | Unclassified | 1669 |
| 371 | Ga0105245_10361590 | 3300009098 | Bacteria | 1440 |
| 372 | Ga0105247_10303567 | 3300009101 | Bacteria | 1108 |
| 373 | Ga0114129_10006412 | 3300009147 | Bacteria | 16680 |
| 374 | Ga0114129_10014262 | 3300009147 | Bacteria | 11325 |
| 375 | Ga0114129_10016354 | 3300009147 | Bacteria | 10560 |
| 376 | Ga0114129_10020769 | 3300009147 | Bacteria | 9333 |
| 377 | Ga0114129_10039435 | 3300009147 | Bacteria | 6659 |
| 378 | Ga0114129_10051285 | 3300009147 | Bacteria | 5793 |
| 379 | Ga0114129_10061382 | 3300009147 | Bacteria | 5253 |
| 380 | Ga0114129_10107673 | 3300009147 | Bacteria | 3849 |
| 381 | Ga0114129_10150493 | 3300009147 | Bacteria | 3185 |
| 382 | Ga0114129_10156387 | 3300009147 | Bacteria | 3117 |
| 383 | Ga0114129_10205768 | 3300009147 | Bacteria | 2663 |
| 384 | Ga0114129_10824749 | 3300009147 | Bacteria | 1181 |
| 385 | Ga0105241_10779841 | 3300009174 | Bacteria | 879 |
| 386 | Ga0105241_10947578 | 3300009174 | Bacteria | 802 |
| 387 | Ga0105242_10026194 | 3300009176 | Bacteria | 4621 |
| 388 | Ga0105242_10029457 | 3300009176 | Bacteria | 4379 |
| 389 | Ga0105242_10302379 | 3300009176 | Bacteria | 1461 |
| 390 | Ga0105242_11144506 | 3300009176 | Bacteria | 794 |
| 391 | Ga0105248_10000236 | 3300009177 | Bacteria | 63750 |
| 392 | Ga0105248_10001572 | 3300009177 | Bacteria | 25420 |
| 393 | Ga0105248_10013439 | 3300009177 | Bacteria | 9012 |
| 394 | Ga0105248_10023875 | 3300009177 | Bacteria | 6796 |
| 395 | Ga0105248_10084092 | 3300009177 | Bacteria | 3579 |
| 396 | Ga0105248_10093447 | 3300009177 | Bacteria | 3387 |
| 397 | Ga0105248_10120857 | 3300009177 | Bacteria | 2955 |
| 398 | Ga0105248_10141080 | 3300009177 | Bacteria | 2718 |
| 399 | Ga0105248_10153342 | 3300009177 | Bacteria | 2599 |
| 400 | Ga0105248_10207491 | 3300009177 | Bacteria | 2208 |
| 401 | Ga0105248_10336047 | 3300009177 | Bacteria | 1701 |
| 402 | Ga0105248_10375900 | 3300009177 | Bacteria | 1600 |
| 403 | Ga0105248_10443087 | 3300009177 | Bacteria | 1463 |
| 404 | Ga0105248_10501080 | 3300009177 | Bacteria | 1369 |
| 405 | Ga0105248_10737840 | 3300009177 | Bacteria | 1111 |
| 406 | Ga0105237_10078532 | 3300009545 | Bacteria | 3290 |
| 407 | Ga0105238_10011306 | 3300009551 | Bacteria | 8980 |
| 408 | Ga0105238_10154211 | 3300009551 | Bacteria | 2272 |
| 409 | Ga0105238_10327984 | 3300009551 | Bacteria | 1517 |
| 410 | Ga0105249_10000849 | 3300009553 | Bacteria | 27295 |
| 411 | Ga0105249_10121430 | 3300009553 | Bacteria | 2483 |
| 412 | Ga0105249_10174354 | 3300009553 | Bacteria | 2087 |
| 413 | Ga0105249_10290333 | 3300009553 | Bacteria | 1637 |
| 414 | Ga0157315_1000725 | 3300012508 | Bacteria | 1611 |
| 415 | Ga0157374_10028374 | 3300013296 | Bacteria | 5056 |
| 416 | Ga0157374_10044119 | 3300013296 | Bacteria | 4121 |
| 417 | Ga0157374_10114249 | 3300013296 | Bacteria | 2599 |
| 418 | Ga0157374_10178565 | 3300013296 | Bacteria | 2073 |
| 419 | Ga0157374_10417870 | 3300013296 | Unclassified | 1339 |
| 420 | Ga0157374_10467337 | 3300013296 | Bacteria | 1264 |
| 421 | Ga0157378_10005352 | 3300013297 | Bacteria | 11258 |
| 422 | Ga0157378_10027081 | 3300013297 | Bacteria | 5057 |
| 423 | Ga0157378_10085486 | 3300013297 | Bacteria | 2857 |
| 424 | Ga0157378_10090328 | 3300013297 | Bacteria | 2783 |
| 425 | Ga0157378_10098116 | 3300013297 | Bacteria | 2671 |
| 426 | Ga0157378_10405649 | 3300013297 | Bacteria | 1344 |
| 427 | Ga0157378_10648580 | 3300013297 | Bacteria | 1071 |
| 428 | Ga0163162_10003531 | 3300013306 | Bacteria | 14961 |
| 429 | Ga0163162_10003813 | 3300013306 | Bacteria | 14456 |
| 430 | Ga0163162_10006551 | 3300013306 | Bacteria | 11280 |
| 431 | Ga0163162_10592216 | 3300013306 | Bacteria | 1235 |
| 432 | Ga0157375_10000523 | 3300013308 | Bacteria | 34505 |
| 433 | Ga0157375_10000607 | 3300013308 | Bacteria | 31829 |
| 434 | Ga0157375_10017168 | 3300013308 | Bacteria | 6524 |
| 435 | Ga0157375_10133588 | 3300013308 | Bacteria | 2603 |
| 436 | Ga0157375_10227177 | 3300013308 | Bacteria | 2025 |
| 437 | Ga0157375_10237545 | 3300013308 | Bacteria | 1982 |
| 438 | Ga0157375_10247886 | 3300013308 | Bacteria | 1941 |
| 439 | Ga0157375_10248564 | 3300013308 | Bacteria | 1939 |
| 440 | Ga0157375_10258182 | 3300013308 | Bacteria | 1904 |
| 441 | Ga0157375_10326539 | 3300013308 | Bacteria | 1699 |
| 442 | Ga0157375_10341652 | 3300013308 | Bacteria | 1662 |
| 443 | Ga0157375_10621484 | 3300013308 | Bacteria | 1238 |
| 444 | Ga0157375_10758953 | 3300013308 | Bacteria | 1121 |
| 445 | Ga0157375_10920887 | 3300013308 | Bacteria | 1017 |
| 446 | Ga0157375_11331709 | 3300013308 | Bacteria | 845 |
| 447 | Ga0163163_10003203 | 3300014325 | Bacteria | 13866 |
| 448 | Ga0163163_10003739 | 3300014325 | Bacteria | 12955 |
| 449 | Ga0163163_10005951 | 3300014325 | Bacteria | 10612 |
| 450 | Ga0163163_10010757 | 3300014325 | Bacteria | 8253 |
| 451 | Ga0163163_10037345 | 3300014325 | Bacteria | 4725 |
| 452 | Ga0163163_10152621 | 3300014325 | Bacteria | 2353 |
| 453 | Ga0163163_10233150 | 3300014325 | Bacteria | 1890 |
| 454 | Ga0157380_10011572 | 3300014326 | Bacteria | 6377 |
| 455 | Ga0157380_10022314 | 3300014326 | Bacteria | 4763 |
| 456 | Ga0157380_10065871 | 3300014326 | Unclassified | 2913 |
| 457 | Ga0157380_10089553 | 3300014326 | Bacteria | 2535 |
| 458 | Ga0157380_10193850 | 3300014326 | Bacteria | 1796 |
| 459 | Ga0157380_10445877 | 3300014326 | Bacteria | 1241 |
| 460 | Ga0157377_10026948 | 3300014745 | Unclassified | 3081 |
| 461 | Ga0157377_10088800 | 3300014745 | Bacteria | 1821 |
| 462 | Ga0157377_10347620 | 3300014745 | Bacteria | 994 |
| 463 | Ga0157377_10362294 | 3300014745 | Bacteria | 976 |
| 464 | Ga0157379_10000308 | 3300014968 | Bacteria | 38803 |
| 465 | Ga0157379_10003703 | 3300014968 | Bacteria | 13006 |
| 466 | Ga0157379_10015640 | 3300014968 | Bacteria | 6665 |
| 467 | Ga0157379_10017731 | 3300014968 | Bacteria | 6273 |
| 468 | Ga0157379_10115724 | 3300014968 | Bacteria | 2411 |
| 469 | Ga0157376_10067745 | 3300014969 | Bacteria | 3020 |
| 470 | Ga0157376_10093766 | 3300014969 | Unclassified | 2607 |
| 471 | Ga0157376_10095257 | 3300014969 | Bacteria | 2588 |
| 472 | Ga0157376_10150761 | 3300014969 | Bacteria | 2096 |
| 473 | Ga0157376_10197185 | 3300014969 | Bacteria | 1850 |
| 474 | Ga0157376_10395389 | 3300014969 | Bacteria | 1335 |
| 475 | Ga0157376_10785521 | 3300014969 | Bacteria | 964 |
| 476 | Ga0163161_10018189 | 3300017792 | Bacteria | 4926 |
| 477 | Ga0163161_10036888 | 3300017792 | Bacteria | 3502 |
| 478 | Ga0163161_10219905 | 3300017792 | Bacteria | 1470 |
| 479 | Ga0207666_1004394 | 3300025271 | Unclassified | 1769 |
| 480 | Ga0207697_10000700 | 3300025315 | Bacteria | 19071 |
| 481 | Ga0207697_10083824 | 3300025315 | Bacteria | 1345 |
| 482 | Ga0207656_10112031 | 3300025321 | Bacteria | 1262 |
| 483 | Ga0207682_10039016 | 3300025893 | Bacteria | 1929 |
| 484 | Ga0207682_10052244 | 3300025893 | Bacteria | 1693 |
| 485 | Ga0207642_10042787 | 3300025899 | Bacteria | 1993 |
| 486 | Ga0207710_10038119 | 3300025900 | Bacteria | 2125 |
| 487 | Ga0207710_10128300 | 3300025900 | Bacteria | 1216 |
| 488 | Ga0207710_10193850 | 3300025900 | Bacteria | 1001 |
| 489 | Ga0207688_10003374 | 3300025901 | Bacteria | 8717 |
| 490 | Ga0207688_10245298 | 3300025901 | Bacteria | 1084 |
| 491 | Ga0207680_10040615 | 3300025903 | Bacteria | 2708 |
| 492 | Ga0207680_10053799 | 3300025903 | Bacteria | 2418 |
| 493 | Ga0207680_10101912 | 3300025903 | Unclassified | 1846 |
| 494 | Ga0207680_10145582 | 3300025903 | Bacteria | 1575 |
| 495 | Ga0207680_10186226 | 3300025903 | Bacteria | 1407 |
| 496 | Ga0207680_10359799 | 3300025903 | Bacteria | 1023 |
| 497 | Ga0207645_10002538 | 3300025907 | Bacteria | 14289 |
| 498 | Ga0207645_10007582 | 3300025907 | Bacteria | 7650 |
| 499 | Ga0207645_10093439 | 3300025907 | Bacteria | 1935 |
| 500 | Ga0207643_10000138 | 3300025908 | Bacteria | 49379 |
| 501 | Ga0207643_10046925 | 3300025908 | Bacteria | 2442 |
| 502 | Ga0207643_10086223 | 3300025908 | Bacteria | 1824 |
| 503 | Ga0207643_10096580 | 3300025908 | Bacteria | 1728 |
| 504 | Ga0207643_10133864 | 3300025908 | Bacteria | 1476 |
| 505 | Ga0207684_10094890 | 3300025910 | Bacteria | 2545 |
| 506 | Ga0207684_10740599 | 3300025910 | Bacteria | 833 |
| 507 | Ga0207654_10095968 | 3300025911 | Bacteria | 1817 |
| 508 | Ga0207695_10050891 | 3300025913 | Bacteria | 4354 |
| 509 | Ga0207695_10094527 | 3300025913 | Bacteria | 2996 |
| 510 | Ga0207695_10736730 | 3300025913 | Bacteria | 866 |
| 511 | Ga0207671_10064312 | 3300025914 | Bacteria | 2727 |
| 512 | Ga0207693_10141578 | 3300025915 | Bacteria | 1891 |
| 513 | Ga0207660_10116877 | 3300025917 | Bacteria | 2015 |
| 514 | Ga0207660_10590019 | 3300025917 | Bacteria | 905 |
| 515 | Ga0207662_10000720 | 3300025918 | Bacteria | 15093 |
| 516 | Ga0207662_10043190 | 3300025918 | Bacteria | 2658 |
| 517 | Ga0207662_10049434 | 3300025918 | Bacteria | 2495 |
| 518 | Ga0207662_10161644 | 3300025918 | Bacteria | 1431 |
| 519 | Ga0207657_10009210 | 3300025919 | Bacteria | 9953 |
| 520 | Ga0207657_10525046 | 3300025919 | Bacteria | 926 |
| 521 | Ga0207649_10176585 | 3300025920 | Bacteria | 1492 |
| 522 | Ga0207649_10185555 | 3300025920 | Bacteria | 1459 |
| 523 | Ga0207649_10201308 | 3300025920 | Bacteria | 1407 |
| 524 | Ga0207649_10233012 | 3300025920 | Bacteria | 1318 |
| 525 | Ga0207646_10116739 | 3300025922 | Bacteria | 2397 |
| 526 | Ga0207646_10243206 | 3300025922 | Bacteria | 1626 |
| 527 | Ga0207646_10470276 | 3300025922 | Bacteria | 1134 |
| 528 | Ga0207681_10017757 | 3300025923 | Bacteria | 4471 |
| 529 | Ga0207681_10032854 | 3300025923 | Bacteria | 3400 |
| 530 | Ga0207681_10053906 | 3300025923 | Bacteria | 2732 |
| 531 | Ga0207681_10084850 | 3300025923 | Unclassified | 2246 |
| 532 | Ga0207681_10220250 | 3300025923 | Bacteria | 1468 |
| 533 | Ga0207681_10310001 | 3300025923 | Bacteria | 1251 |
| 534 | Ga0207681_10625381 | 3300025923 | Bacteria | 891 |
| 535 | Ga0207681_10629340 | 3300025923 | Bacteria | 888 |
| 536 | Ga0207681_10642738 | 3300025923 | Bacteria | 879 |
| 537 | Ga0207694_10006176 | 3300025924 | Bacteria | 9154 |
| 538 | Ga0207694_10238565 | 3300025924 | Bacteria | 1486 |
| 539 | Ga0207650_10001879 | 3300025925 | Bacteria | 14822 |
| 540 | Ga0207650_10021983 | 3300025925 | Bacteria | 4514 |
| 541 | Ga0207650_10032843 | 3300025925 | Bacteria | 3756 |
| 542 | Ga0207650_10115220 | 3300025925 | Bacteria | 2085 |
| 543 | Ga0207650_10128287 | 3300025925 | Bacteria | 1982 |
| 544 | Ga0207650_10858264 | 3300025925 | Bacteria | 770 |
| 545 | Ga0207659_10000405 | 3300025926 | Bacteria | 26027 |
| 546 | Ga0207659_10000879 | 3300025926 | Bacteria | 17854 |
| 547 | Ga0207659_10001940 | 3300025926 | Bacteria | 12272 |
| 548 | Ga0207659_10015544 | 3300025926 | Bacteria | 4935 |
| 549 | Ga0207659_10030594 | 3300025926 | Bacteria | 3680 |
| 550 | Ga0207659_10038417 | 3300025926 | Bacteria | 3329 |
| 551 | Ga0207659_10043655 | 3300025926 | Bacteria | 3150 |
| 552 | Ga0207659_10061761 | 3300025926 | Bacteria | 2702 |
| 553 | Ga0207659_10163026 | 3300025926 | Unclassified | 1752 |
| 554 | Ga0207659_10235518 | 3300025926 | Bacteria | 1479 |
| 555 | Ga0207659_10337437 | 3300025926 | Bacteria | 1247 |
| 556 | Ga0207659_10375867 | 3300025926 | Bacteria | 1184 |
| 557 | Ga0207659_10466143 | 3300025926 | Bacteria | 1066 |
| 558 | Ga0207659_10764982 | 3300025926 | Bacteria | 829 |
| 559 | Ga0207687_10016186 | 3300025927 | Bacteria | 4896 |
| 560 | Ga0207687_10390028 | 3300025927 | Bacteria | 1143 |
| 561 | Ga0207687_10407674 | 3300025927 | Unclassified | 1119 |
| 562 | Ga0207700_10054752 | 3300025928 | Bacteria | 2996 |
| 563 | Ga0207664_10025522 | 3300025929 | Bacteria | 4455 |
| 564 | Ga0207644_10065981 | 3300025931 | Unclassified | 2634 |
| 565 | Ga0207644_10080511 | 3300025931 | Bacteria | 2406 |
| 566 | Ga0207644_10114335 | 3300025931 | Bacteria | 2045 |
| 567 | Ga0207644_10213517 | 3300025931 | Bacteria | 1527 |
| 568 | Ga0207644_10354307 | 3300025931 | Bacteria | 1192 |
| 569 | Ga0207644_10451593 | 3300025931 | Bacteria | 1056 |
| 570 | Ga0207690_10069614 | 3300025932 | Unclassified | 2421 |
| 571 | Ga0207706_10002156 | 3300025933 | Bacteria | 19227 |
| 572 | Ga0207706_10044668 | 3300025933 | Bacteria | 3927 |
| 573 | Ga0207706_10133245 | 3300025933 | Bacteria | 2185 |
| 574 | Ga0207706_10167789 | 3300025933 | Bacteria | 1929 |
| 575 | Ga0207706_10174387 | 3300025933 | Bacteria | 1889 |
| 576 | Ga0207706_10679086 | 3300025933 | Bacteria | 881 |
| 577 | Ga0207686_10157511 | 3300025934 | Bacteria | 1588 |
| 578 | Ga0207686_10332757 | 3300025934 | Bacteria | 1138 |
| 579 | Ga0207709_10023026 | 3300025935 | Bacteria | 3541 |
| 580 | Ga0207709_10355629 | 3300025935 | Bacteria | 1107 |
| 581 | Ga0207670_10011480 | 3300025936 | Bacteria | 5146 |
| 582 | Ga0207670_10150444 | 3300025936 | Bacteria | 1727 |
| 583 | Ga0207670_10167523 | 3300025936 | Bacteria | 1645 |
| 584 | Ga0207670_10203027 | 3300025936 | Bacteria | 1507 |
| 585 | Ga0207670_10554196 | 3300025936 | Bacteria | 940 |
| 586 | Ga0207669_10002409 | 3300025937 | Bacteria | 7971 |
| 587 | Ga0207669_10058891 | 3300025937 | Bacteria | 2346 |
| 588 | Ga0207669_10140963 | 3300025937 | Bacteria | 1673 |
| 589 | Ga0207669_10290875 | 3300025937 | Bacteria | 1237 |
| 590 | Ga0207669_10478815 | 3300025937 | Bacteria | 992 |
| 591 | Ga0207669_10702891 | 3300025937 | Bacteria | 831 |
| 592 | Ga0207669_10715961 | 3300025937 | Bacteria | 824 |
| 593 | Ga0207704_10055270 | 3300025938 | Bacteria | 2425 |
| 594 | Ga0207691_10002649 | 3300025940 | Bacteria | 17491 |
| 595 | Ga0207691_10003124 | 3300025940 | Bacteria | 16174 |
| 596 | Ga0207691_10022103 | 3300025940 | Bacteria | 6001 |
| 597 | Ga0207691_10024181 | 3300025940 | Bacteria | 5712 |
| 598 | Ga0207691_10027787 | 3300025940 | Bacteria | 5302 |
| 599 | Ga0207691_10031394 | 3300025940 | Bacteria | 4958 |
| 600 | Ga0207691_10032956 | 3300025940 | Bacteria | 4827 |
| 601 | Ga0207691_10112521 | 3300025940 | Bacteria | 2419 |
| 602 | Ga0207691_10169262 | 3300025940 | Bacteria | 1914 |
| 603 | Ga0207691_10377575 | 3300025940 | Bacteria | 1210 |
| 604 | Ga0207691_10397580 | 3300025940 | Bacteria | 1176 |
| 605 | Ga0207691_10862468 | 3300025940 | Bacteria | 759 |
| 606 | Ga0207711_10000601 | 3300025941 | Bacteria | 36340 |
| 607 | Ga0207711_10006548 | 3300025941 | Bacteria | 9809 |
| 608 | Ga0207711_10050135 | 3300025941 | Bacteria | 3574 |
| 609 | Ga0207711_10050303 | 3300025941 | Bacteria | 3567 |
| 610 | Ga0207711_10057699 | 3300025941 | Bacteria | 3338 |
| 611 | Ga0207711_10062770 | 3300025941 | Bacteria | 3206 |
| 612 | Ga0207711_10103059 | 3300025941 | Unclassified | 2527 |
| 613 | Ga0207711_10142017 | 3300025941 | Bacteria | 2161 |
| 614 | Ga0207711_10169291 | 3300025941 | Bacteria | 1981 |
| 615 | Ga0207711_10209838 | 3300025941 | Bacteria | 1779 |
| 616 | Ga0207711_10628863 | 3300025941 | Bacteria | 1002 |
| 617 | Ga0207711_10649855 | 3300025941 | Bacteria | 984 |
| 618 | Ga0207711_10756446 | 3300025941 | Bacteria | 906 |
| 619 | Ga0207711_10810795 | 3300025941 | Bacteria | 872 |
| 620 | Ga0207711_10922425 | 3300025941 | Bacteria | 812 |
| 621 | Ga0207689_10001347 | 3300025942 | Bacteria | 23609 |
| 622 | Ga0207689_10027935 | 3300025942 | Bacteria | 4720 |
| 623 | Ga0207689_10105182 | 3300025942 | Bacteria | 2319 |
| 624 | Ga0207689_10431041 | 3300025942 | Bacteria | 1101 |
| 625 | Ga0207689_10806911 | 3300025942 | Bacteria | 792 |
| 626 | Ga0207661_10037371 | 3300025944 | Bacteria | 3798 |
| 627 | Ga0207679_10013926 | 3300025945 | Bacteria | 5273 |
| 628 | Ga0207679_10125927 | 3300025945 | Bacteria | 2047 |
| 629 | Ga0207679_10701809 | 3300025945 | Bacteria | 918 |
| 630 | Ga0207667_10095180 | 3300025949 | Bacteria | 3075 |
| 631 | Ga0207651_10000566 | 3300025960 | Bacteria | 15605 |
| 632 | Ga0207651_10004402 | 3300025960 | Bacteria | 7093 |
| 633 | Ga0207651_10020655 | 3300025960 | Bacteria | 3981 |
| 634 | Ga0207651_10100362 | 3300025960 | Bacteria | 2146 |
| 635 | Ga0207651_10107245 | 3300025960 | Bacteria | 2087 |
| 636 | Ga0207651_10108365 | 3300025960 | Bacteria | 2079 |
| 637 | Ga0207651_10158497 | 3300025960 | Bacteria | 1771 |
| 638 | Ga0207651_10610293 | 3300025960 | Bacteria | 954 |
| 639 | Ga0207651_10674730 | 3300025960 | Bacteria | 909 |
| 640 | Ga0207712_10010563 | 3300025961 | Bacteria | 5864 |
| 641 | Ga0207712_10517049 | 3300025961 | Bacteria | 1022 |
| 642 | Ga0207712_10593420 | 3300025961 | Bacteria | 957 |
| 643 | Ga0207668_10057438 | 3300025972 | Bacteria | 2715 |
| 644 | Ga0207668_10192356 | 3300025972 | Bacteria | 1618 |
| 645 | Ga0207668_10327593 | 3300025972 | Bacteria | 1273 |
| 646 | Ga0207668_10348069 | 3300025972 | Bacteria | 1238 |
| 647 | Ga0207640_10038454 | 3300025981 | Bacteria | 3019 |
| 648 | Ga0207640_10340913 | 3300025981 | Bacteria | 1200 |
| 649 | Ga0207640_10719134 | 3300025981 | Bacteria | 858 |
| 650 | Ga0207658_10021141 | 3300025986 | Bacteria | 4513 |
| 651 | Ga0207658_10060962 | 3300025986 | Bacteria | 2817 |
| 652 | Ga0207658_10205005 | 3300025986 | Bacteria | 1649 |
| 653 | Ga0207658_10328460 | 3300025986 | Bacteria | 1326 |
| 654 | Ga0207658_10549681 | 3300025986 | Bacteria | 1033 |
| 655 | Ga0207677_10008442 | 3300026023 | Bacteria | 5753 |
| 656 | Ga0207677_10160010 | 3300026023 | Bacteria | 1748 |
| 657 | Ga0207677_10172137 | 3300026023 | Bacteria | 1694 |
| 658 | Ga0207677_10219283 | 3300026023 | Bacteria | 1524 |
| 659 | Ga0207677_10591460 | 3300026023 | Bacteria | 973 |
| 660 | Ga0207703_10005935 | 3300026035 | Bacteria | 9786 |
| 661 | Ga0207703_10019346 | 3300026035 | Bacteria | 5320 |
| 662 | Ga0207703_10046137 | 3300026035 | Bacteria | 3509 |
| 663 | Ga0207703_10047676 | 3300026035 | Bacteria | 3456 |
| 664 | Ga0207703_10059758 | 3300026035 | Bacteria | 3114 |
| 665 | Ga0207703_10068184 | 3300026035 | Unclassified | 2931 |
| 666 | Ga0207703_10089187 | 3300026035 | Bacteria | 2590 |
| 667 | Ga0207703_10127719 | 3300026035 | Bacteria | 2191 |
| 668 | Ga0207703_10151641 | 3300026035 | Bacteria | 2022 |
| 669 | Ga0207703_10174423 | 3300026035 | Bacteria | 1893 |
| 670 | Ga0207703_10678756 | 3300026035 | Bacteria | 979 |
| 671 | Ga0207639_10097959 | 3300026041 | Bacteria | 2363 |
| 672 | Ga0207678_10132000 | 3300026067 | Bacteria | 2131 |
| 673 | Ga0207678_10541223 | 3300026067 | Bacteria | 1018 |
| 674 | Ga0207708_10023190 | 3300026075 | Bacteria | 4689 |
| 675 | Ga0207708_10092791 | 3300026075 | Unclassified | 2330 |
| 676 | Ga0207708_10094470 | 3300026075 | Bacteria | 2308 |
| 677 | Ga0207708_10095294 | 3300026075 | Bacteria | 2298 |
| 678 | Ga0207641_10000618 | 3300026088 | Bacteria | 38777 |
| 679 | Ga0207641_10000931 | 3300026088 | Bacteria | 30226 |
| 680 | Ga0207641_10048663 | 3300026088 | Bacteria | 3579 |
| 681 | Ga0207641_10074265 | 3300026088 | Unclassified | 2932 |
| 682 | Ga0207641_10372646 | 3300026088 | Bacteria | 1365 |
| 683 | Ga0207648_10018013 | 3300026089 | Bacteria | 6402 |
| 684 | Ga0207648_10050677 | 3300026089 | Unclassified | 3629 |
| 685 | Ga0207648_10075748 | 3300026089 | Bacteria | 2933 |
| 686 | Ga0207648_10111132 | 3300026089 | Bacteria | 2406 |
| 687 | Ga0207676_10010580 | 3300026095 | Bacteria | 6576 |
| 688 | Ga0207676_10026350 | 3300026095 | Bacteria | 4324 |
| 689 | Ga0207676_10073794 | 3300026095 | Bacteria | 2747 |
| 690 | Ga0207676_10079332 | 3300026095 | Unclassified | 2662 |
| 691 | Ga0207676_10332440 | 3300026095 | Bacteria | 1399 |
| 692 | Ga0207676_11084643 | 3300026095 | Bacteria | 791 |
| 693 | Ga0207674_10357320 | 3300026116 | Bacteria | 1412 |
| 694 | Ga0207675_100003041 | 3300026118 | Bacteria | 16446 |
| 695 | Ga0207675_100012703 | 3300026118 | Bacteria | 7870 |
| 696 | Ga0207675_100021398 | 3300026118 | Bacteria | 6024 |
| 697 | Ga0207675_100208078 | 3300026118 | Bacteria | 1881 |
| 698 | Ga0207675_100337815 | 3300026118 | Bacteria | 1474 |
| 699 | Ga0207675_100374348 | 3300026118 | Bacteria | 1399 |
| 700 | Ga0207675_100453401 | 3300026118 | Bacteria | 1271 |
| 701 | Ga0207675_100711786 | 3300026118 | Bacteria | 1014 |
| 702 | Ga0207675_101003419 | 3300026118 | Bacteria | 853 |
| 703 | Ga0207683_10080305 | 3300026121 | Bacteria | 2893 |
| 704 | Ga0207683_10133515 | 3300026121 | Bacteria | 2233 |
| 705 | Ga0207683_10165640 | 3300026121 | Bacteria | 2000 |
| 706 | Ga0207683_10192918 | 3300026121 | Bacteria | 1850 |
| 707 | Ga0207683_10606406 | 3300026121 | Bacteria | 1013 |
| 708 | Ga0207683_10713402 | 3300026121 | Bacteria | 930 |
| 709 | Ga0207683_10946113 | 3300026121 | Bacteria | 800 |
| 710 | Ga0207698_10270431 | 3300026142 | Unclassified | 1566 |
| 711 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 712 | Ga0207428_10000498 | 3300027907 | Bacteria | 46872 |
| 713 | Ga0207428_10004323 | 3300027907 | Bacteria | 13563 |
| 714 | Ga0207428_10006675 | 3300027907 | Bacteria | 10597 |
| 715 | Ga0207428_10028634 | 3300027907 | Unclassified | 4626 |
| 716 | Ga0207428_10134591 | 3300027907 | Bacteria | 1890 |
| 717 | Ga0207428_10136105 | 3300027907 | Bacteria | 1878 |
| 718 | Ga0268266_10011683 | 3300028379 | Bacteria | 7621 |
| 719 | Ga0268266_10105558 | 3300028379 | Unclassified | 2489 |
| 720 | Ga0268265_10002782 | 3300028380 | Bacteria | 12889 |
| 721 | Ga0268265_10025651 | 3300028380 | Bacteria | 4187 |
| 722 | Ga0268265_10172505 | 3300028380 | Bacteria | 1850 |
| 723 | Ga0268265_10282924 | 3300028380 | Bacteria | 1485 |
| 724 | Ga0268265_10531489 | 3300028380 | Bacteria | 1113 |
| 725 | Ga0268265_10843172 | 3300028380 | Bacteria | 896 |
| 726 | Ga0268265_10904431 | 3300028380 | Bacteria | 867 |
| 727 | Ga0268265_10973554 | 3300028380 | Bacteria | 837 |
| 728 | Ga0268264_10128079 | 3300028381 | Bacteria | 2246 |
| 729 | Ga0268264_10179759 | 3300028381 | Bacteria | 1920 |
| 730 | Ga0268264_10324845 | 3300028381 | Unclassified | 1456 |
| 731 | Ga0268264_10625134 | 3300028381 | Bacteria | 1064 |
| 732 | Ga0307408_100018869 | 3300031548 | Bacteria | 4638 |
| 733 | Ga0307408_100586644 | 3300031548 | Bacteria | 988 |
| 734 | Ga0265314_10025458 | 3300031711 | Bacteria | 4463 |
| 735 | Ga0265314_10097387 | 3300031711 | Bacteria | 1900 |
| 736 | Ga0307405_10766623 | 3300031731 | Bacteria | 805 |
| 737 | Ga0316577_10021421 | 3300031733 | Bacteria | 3586 |
| 738 | Ga0316577_10286331 | 3300031733 | Bacteria | 933 |
| 739 | Ga0316577_10309082 | 3300031733 | Bacteria | 896 |
| 740 | Ga0307410_10155592 | 3300031852 | Bacteria | 1707 |
| 741 | Ga0307407_10424409 | 3300031903 | Bacteria | 959 |
| 742 | Ga0307416_100796024 | 3300032002 | Bacteria | 1041 |
| 743 | Ga0307416_100926214 | 3300032002 | Bacteria | 972 |
| 744 | Ga0307415_100162838 | 3300032126 | Bacteria | 1731 |
| 745 | Ga0373930_0000481 | 3300034816 | Bacteria | 5405 |
| 746 | Ga0373948_0000587 | 3300034817 | Bacteria | 4656 |
| 747 | Ga0373950_0004065 | 3300034818 | Bacteria | 2129 |
| 748 | Ga0373958_0000404 | 3300034819 | Bacteria | 5240 |
| 749 | Ga0373958_0002235 | 3300034819 | Unclassified | 2693 |
| 750 | Ga0373959_0002640 | 3300034820 | Bacteria | 2845 |
| 751 | Ga0373938_0003896 | 3300034957 | Bacteria | 2467 |
| 752 | Ga0373928_0014015 | 3300035084 | Bacteria | 1615 |
| 753 | Ga0373929_0000196 | 3300035085 | Bacteria | 10823 |
| 754 | Ga0373929_0056283 | 3300035085 | Bacteria | 911 |
| 755 | Ga0373934_0085491 | 3300035086 | Bacteria | 1269 |
| 756 | Ga0373940_0014005 | 3300035088 | Bacteria | 1950 |
| 757 | Ga0373944_0033627 | 3300035089 | Bacteria | 1554 |
| 758 | Ga0373949_0006475 | 3300035090 | Unclassified | 2574 |
| 759 | Ga0373949_0007247 | 3300035090 | Bacteria | 2428 |
| 760 | Ga0373951_0000268 | 3300035091 | Bacteria | 16605 |
| 761 | Ga0373952_0002993 | 3300035092 | Bacteria | 3050 |
| 762 | Ga0373932_0000829 | 3300035112 | Bacteria | 9131 |
| 763 | Ga0373932_0110799 | 3300035112 | Bacteria | 904 |
| 764 | Ga0373932_0171155 | 3300035112 | Bacteria | 757 |
| 765 | Ga0373936_0020241 | 3300035113 | Bacteria | 2584 |
| 766 | Ga0373939_0000363 | 3300035114 | Bacteria | 11480 |
| 767 | Ga0373941_0004028 | 3300035115 | Bacteria | 3367 |
| 768 | Ga0373941_0113985 | 3300035115 | Bacteria | 956 |
| 769 | Ga0373945_0075372 | 3300035116 | Bacteria | 1284 |
| 770 | Ga0373954_0079879 | 3300035118 | Bacteria | 1562 |
| 771 | Ga0373956_0027069 | 3300035119 | Bacteria | 2487 |
| 772 | Ga0373956_0075663 | 3300035119 | Unclassified | 1540 |
| 773 | Ga0373956_0263122 | 3300035119 | Bacteria | 820 |
| 774 | Ga0373960_0000784 | 3300035121 | Bacteria | 6662 |
| 775 | Ga0373943_0010594 | 3300035170 | Bacteria | 4135 |
| 776 | Ga0373943_0143166 | 3300035170 | Bacteria | 1290 |
| 777 | Ga0373946_0014905 | 3300035171 | Bacteria | 2938 |
| 778 | Ga0373946_0212753 | 3300035171 | Bacteria | 931 |
| 779 | Ga0373955_0069320 | 3300035172 | Bacteria | 1967 |
| 780 | Ga0373955_0145717 | 3300035172 | Bacteria | 1391 |
| 781 | Ga0373942_0000106 | 3300035207 | Bacteria | 18802 |
| 782 | Ga0373961_0001445 | 3300035241 | Bacteria | 6999 |
| 783 | Ga0373961_0033559 | 3300035241 | Bacteria | 1446 |
| 784 | Ga0373962_0000782 | 3300035242 | Bacteria | 7262 |
| 785 | Ga0373924_0010465 | 3300035410 | Bacteria | 3420 |
| 786 | Ga0373924_0105760 | 3300035410 | Bacteria | 1213 |
| 787 | Ga0373931_0002897 | 3300035691 | Bacteria | 7649 |
| 788 | Ga0373931_0070323 | 3300035691 | Unclassified | 1909 |
| 789 | Ga0373931_0280311 | 3300035691 | Bacteria | 1023 |
| 790 | Ga0373935_0058187 | 3300035692 | Bacteria | 2468 |
| 791 | Ga0373935_0075145 | 3300035692 | Bacteria | 2186 |
| 792 | Ga0373927_0384829 | 3300035695 | Bacteria | 925 |
| 793 | Ga0373933_0161036 | 3300035724 | Bacteria | 1425 |
| 794 | Ga0373947_0145276 | 3300035725 | Bacteria | 1524 |
| 795 | Ga0373937_0018052 | 3300036401 | Bacteria | 6292 |
| 796 | Ga0373937_0037227 | 3300036401 | Bacteria | 4434 |
| 797 | Ga0373937_0051703 | 3300036401 | Bacteria | 3766 |
| 798 | Ga0373937_1167659 | 3300036401 | Bacteria | 718 |
| 799 | Ga0316584_0024677 | 3300036712 | Bacteria | 4403 |
| 800 | Ga0316584_0121707 | 3300036712 | Bacteria | 1950 |
| 801 | Ga0373925_0004526 | 3300037068 | Bacteria | 10501 |
| 802 | Ga0373925_0107399 | 3300037068 | Bacteria | 2153 |
| 803 | Ga0373925_0143287 | 3300037068 | Bacteria | 1872 |
| 804 | Ga0373925_0205364 | 3300037068 | Bacteria | 1568 |
| 805 | Ga0373925_0246977 | 3300037068 | Bacteria | 1431 |
| 806 | Ga0373925_0324081 | 3300037068 | Bacteria | 1247 |
| 807 | Ga0400489_37299 | 3300039093 | Bacteria | 63307 |
| 808 | Ga0451853_2376905 | 3300041512 | Bacteria | 1220 |
| 809 | Ga0439462_0010325 | 3300042015 | Bacteria | 2365 |
| 810 | Ga0439446_0010878 | 3300042156 | Bacteria | 2459 |
| 811 | Ga0439434_0033992 | 3300042435 | Bacteria | 1556 |
| 812 | Ga0439435_0001998 | 3300042436 | Bacteria | 3937 |
| 813 | Ga0439460_0022010 | 3300042461 | Bacteria | 1746 |
| 814 | Ga0450916_004616 | 3300042530 | Bacteria | 1562 |
| 815 | Ga0451577_0001213 | 3300042876 | Bacteria | 36010 |
| 816 | Ga0439440_0003015 | 3300042993 | Bacteria | 3209 |
| 817 | Ga0453684_0006396 | 3300044712 | Bacteria | 22426 |
| 818 | Ga0453684_0104817 | 3300044712 | Bacteria | 3451 |
| 819 | Ga0451576_0004289 | 3300045051 | Bacteria | 18673 |
| 820 | Ga0451576_0082457 | 3300045051 | Bacteria | 3345 |
| 821 | Ga0451576_0194662 | 3300045051 | Unclassified | 2117 |
| 822 | Ga0451576_0675770 | 3300045051 | Bacteria | 1085 |
| 823 | Ga0451576_1185863 | 3300045051 | Bacteria | 798 |
| 824 | Ga0495592_0005092 | 3300046454 | Bacteria | 9680 |
| 825 | Ga0495592_0039393 | 3300046454 | Bacteria | 3550 |
| 826 | Ga0495592_0223442 | 3300046454 | Bacteria | 1258 |
| 827 | Ga0495603_0016614 | 3300046455 | Bacteria | 4453 |
| 828 | Ga0495603_0042338 | 3300046455 | Bacteria | 2722 |
| 829 | Ga0495603_0319125 | 3300046455 | Bacteria | 892 |
| 830 | Ga0495629_0010215 | 3300046459 | Bacteria | 6839 |
| 831 | Ga0495629_0058559 | 3300046459 | Bacteria | 2694 |
| 832 | Ga0495629_0132393 | 3300046459 | Bacteria | 1737 |
| 833 | Ga0495651_0111619 | 3300046462 | Bacteria | 2021 |
| 834 | Ga0495653_0134080 | 3300046463 | Bacteria | 1749 |
| 835 | Ga0495653_0190698 | 3300046463 | Bacteria | 1399 |
| 836 | Ga0495580_0037732 | 3300046472 | Bacteria | 3465 |
| 837 | Ga0495580_0388141 | 3300046472 | Bacteria | 943 |
| 838 | Ga0495582_0061536 | 3300046473 | Bacteria | 2073 |
| 839 | Ga0495582_0200025 | 3300046473 | Bacteria | 1141 |
| 840 | Ga0495639_0012511 | 3300046475 | Bacteria | 3660 |
| 841 | Ga0495664_0177225 | 3300046477 | Bacteria | 1293 |
| 842 | Ga0495594_0004637 | 3300046499 | Bacteria | 7079 |
| 843 | Ga0495594_0014029 | 3300046499 | Bacteria | 4196 |
| 844 | Ga0495608_0007525 | 3300046511 | Bacteria | 7688 |
| 845 | Ga0495608_0092718 | 3300046511 | Bacteria | 1952 |
| 846 | Ga0495618_0221369 | 3300046514 | Bacteria | 1194 |
| 847 | Ga0495628_0197877 | 3300046516 | Bacteria | 1515 |
| 848 | Ga0495630_0008326 | 3300046517 | Bacteria | 7444 |
| 849 | Ga0495630_0036510 | 3300046517 | Bacteria | 3674 |
| 850 | Ga0495630_0097400 | 3300046517 | Bacteria | 2225 |
| 851 | Ga0495644_0037590 | 3300046523 | Bacteria | 1827 |
| 852 | Ga0495642_0096140 | 3300046528 | Bacteria | 1257 |
| 853 | Ga0495640_0109196 | 3300046533 | Bacteria | 1809 |
| 854 | Ga0495586_0039319 | 3300046535 | Bacteria | 2543 |
| 855 | Ga0495587_0116698 | 3300046536 | Bacteria | 1531 |
| 856 | Ga0495587_0247391 | 3300046536 | Bacteria | 1003 |
| 857 | Ga0495621_0009004 | 3300046539 | Bacteria | 3015 |
| 858 | Ga0495621_0011882 | 3300046539 | Bacteria | 2706 |
| 859 | Ga0495621_0026434 | 3300046539 | Bacteria | 1958 |
| 860 | Ga0495645_0013479 | 3300046543 | Bacteria | 5781 |
| 861 | Ga0495645_0015615 | 3300046543 | Bacteria | 5402 |
| 862 | Ga0495634_0044133 | 3300046642 | Bacteria | 3019 |
| 863 | Ga0495634_0045756 | 3300046642 | Bacteria | 2957 |
| 864 | Ga0495634_0174840 | 3300046642 | Bacteria | 1348 |
| 865 | Ga0495635_0234419 | 3300046663 | Bacteria | 1239 |
| 866 | Ga0495635_0304722 | 3300046663 | Bacteria | 1068 |
| 867 | Ga0495659_0048190 | 3300046664 | Bacteria | 1543 |
| 868 | Ga0495588_0008824 | 3300046674 | Bacteria | 4635 |
| 869 | Ga0495588_0295183 | 3300046674 | Bacteria | 854 |
| 870 | Ga0495599_0024841 | 3300046678 | Bacteria | 3747 |
| 871 | Ga0495599_0057269 | 3300046678 | Bacteria | 2439 |
| 872 | Ga0495599_0106541 | 3300046678 | Bacteria | 1747 |
| 873 | Ga0495599_0196586 | 3300046678 | Bacteria | 1240 |
| 874 | Ga0495623_0060575 | 3300046679 | Bacteria | 2375 |
| 875 | Ga0495647_0037525 | 3300046681 | Bacteria | 1829 |
| 876 | Ga0495647_0152718 | 3300046681 | Bacteria | 991 |
| 877 | Ga0495658_0076337 | 3300046683 | Bacteria | 1958 |
| 878 | Ga0495658_0287906 | 3300046683 | Bacteria | 1038 |
| 879 | Ga0495669_0003252 | 3300046684 | Bacteria | 6683 |
| 880 | Ga0495669_0013479 | 3300046684 | Bacteria | 3484 |
| 881 | Ga0495669_0017563 | 3300046684 | Bacteria | 3071 |
| 882 | Ga0495669_0112128 | 3300046684 | Bacteria | 1274 |
| 883 | Ga0495613_0028263 | 3300046689 | Bacteria | 4171 |
| 884 | Ga0495613_0500560 | 3300046689 | Bacteria | 818 |
| 885 | Ga0495649_0202299 | 3300046694 | Bacteria | 1031 |
| 886 | Ga0495581_0363829 | 3300047315 | Bacteria | 844 |
| 887 | Ga0495604_0037493 | 3300047317 | Bacteria | 3817 |
| 888 | Ga0495604_0215550 | 3300047317 | Bacteria | 1325 |
| 889 | Ga0495674_0002541 | 3300047319 | Bacteria | 17769 |
| 890 | Ga0495674_0121031 | 3300047319 | Bacteria | 2211 |
| 891 | Ga0495674_0417646 | 3300047319 | Bacteria | 1081 |
| 892 | Ga0495676_0064474 | 3300047321 | Bacteria | 2849 |
| 893 | Ga0495675_0129063 | 3300047444 | Bacteria | 1572 |
| 894 | Ga0495675_0192007 | 3300047444 | Unclassified | 1246 |
| 895 | Ga0495677_0051702 | 3300047445 | Bacteria | 1513 |
| 896 | Ga0495684_0000483 | 3300047471 | Bacteria | 32529 |
| 897 | Ga0495684_0071397 | 3300047471 | Bacteria | 2638 |
| 898 | Ga0495684_0191703 | 3300047471 | Bacteria | 1511 |
| 899 | Ga0496101_0004437 | 3300048904 | Bacteria | 8834 |
| 900 | Ga0496104_0006222 | 3300048907 | Bacteria | 10492 |
| 901 | Ga0496104_0130690 | 3300048907 | Bacteria | 2412 |
| 902 | Ga0496104_0204704 | 3300048907 | Bacteria | 1885 |
| 903 | Ga0496104_0333470 | 3300048907 | Bacteria | 1430 |
| 904 | Ga0496105_0065877 | 3300048908 | Bacteria | 2990 |
| 905 | Ga0496106_0080166 | 3300048909 | Bacteria | 2507 |
| 906 | Ga0496109_0101312 | 3300048912 | Unclassified | 2673 |
| 907 | Ga0496109_0107745 | 3300048912 | Bacteria | 2589 |
| 908 | Ga0496110_0034737 | 3300048913 | Bacteria | 4370 |
| 909 | Ga0496110_0405177 | 3300048913 | Bacteria | 1243 |
| 910 | Ga0496112_0144982 | 3300048915 | Bacteria | 2343 |
| 911 | Ga0496112_1029679 | 3300048915 | Bacteria | 743 |
| 912 | Ga0496114_0000323 | 3300048917 | Bacteria | 35005 |
| 913 | Ga0496114_0456467 | 3300048917 | Bacteria | 1131 |
| 914 | Ga0501033_0037372 | 3300049570 | Bacteria | 3635 |
| 915 | Ga0501034_0411366 | 3300049571 | Bacteria | 1275 |
| 916 | Ga0501034_0420919 | 3300049571 | Bacteria | 1257 |
| 917 | Ga0501036_0011194 | 3300049572 | Bacteria | 7423 |
| 918 | Ga0501036_0162297 | 3300049572 | Bacteria | 1884 |
| 919 | Ga0501036_0223668 | 3300049572 | Bacteria | 1580 |
| 920 | Ga0501037_0321111 | 3300049573 | Bacteria | 1072 |
| 921 | Ga0501038_0074848 | 3300049574 | Bacteria | 2864 |
| 922 | Ga0501039_0052450 | 3300049575 | Bacteria | 3156 |
| 923 | Ga0501039_0137610 | 3300049575 | Bacteria | 1918 |
| 924 | Ga0501039_0527312 | 3300049575 | Bacteria | 927 |
| 925 | Ga0501040_0026771 | 3300049576 | Bacteria | 3879 |
| 926 | Ga0501040_0034146 | 3300049576 | Bacteria | 3446 |
| 927 | Ga0501041_0033465 | 3300049577 | Bacteria | 3110 |
| 928 | Ga0501041_0195566 | 3300049577 | Bacteria | 1267 |
| 929 | Ga0501042_0007112 | 3300049578 | Bacteria | 7316 |
| 930 | Ga0501042_0011481 | 3300049578 | Bacteria | 5980 |
| 931 | Ga0501042_0035523 | 3300049578 | Bacteria | 3536 |
| 932 | Ga0501042_0140702 | 3300049578 | Bacteria | 1740 |
| 933 | Ga0501046_0017522 | 3300049580 | Bacteria | 5973 |
| 934 | Ga0501046_0097362 | 3300049580 | Bacteria | 2260 |
| 935 | Ga0501046_0168788 | 3300049580 | Bacteria | 1643 |
| 936 | Ga0501046_0422051 | 3300049580 | Bacteria | 961 |
| 937 | Ga0501067_0032662 | 3300049583 | Bacteria | 2889 |
| 938 | Ga0501068_0303689 | 3300049584 | Bacteria | 1022 |
| 939 | Ga0501071_0010224 | 3300049587 | Bacteria | 6280 |
| 940 | Ga0501071_0025277 | 3300049587 | Bacteria | 4159 |
| 941 | Ga0501072_0055149 | 3300049588 | Bacteria | 3133 |
| 942 | Ga0501072_0214421 | 3300049588 | Bacteria | 1534 |
| 943 | Ga0501072_0379862 | 3300049588 | Bacteria | 1121 |
| 944 | Ga0501075_0011967 | 3300049591 | Bacteria | 6157 |
| 945 | Ga0501075_0078357 | 3300049591 | Bacteria | 2501 |
| 946 | Ga0501075_0123528 | 3300049591 | Bacteria | 1970 |
| 947 | Ga0501076_0004291 | 3300049592 | Bacteria | 10106 |
| 948 | Ga0501076_0336704 | 3300049592 | Bacteria | 1238 |
| 949 | Ga0501249_026565 | 3300049679 | Bacteria | 1280 |
| 950 | Ga0501079_0023050 | 3300049741 | Bacteria | 4779 |
| 951 | Ga0501079_0084656 | 3300049741 | Bacteria | 2453 |
| 952 | Ga0501079_0340037 | 3300049741 | Bacteria | 1176 |
| 953 | Ga0501080_0043985 | 3300049742 | Bacteria | 4158 |
| 954 | Ga0501081_0001907 | 3300049743 | Bacteria | 12936 |
| 955 | Ga0501081_0007180 | 3300049743 | Bacteria | 7246 |
| 956 | Ga0501081_0355403 | 3300049743 | Bacteria | 1080 |
| 957 | Ga0501083_0193024 | 3300049744 | Bacteria | 1329 |
| 958 | Ga0501035_0087425 | 3300049822 | Bacteria | 2747 |
| 959 | Ga0501044_0100182 | 3300049823 | Bacteria | 2916 |
| 960 | Ga0501045_0005841 | 3300049824 | Bacteria | 8522 |
| 961 | Ga0501045_0075531 | 3300049824 | Bacteria | 2482 |
| 962 | Ga0501045_0081204 | 3300049824 | Bacteria | 2390 |
| 963 | Ga0501045_0104253 | 3300049824 | Bacteria | 2101 |
| 964 | Ga0501045_0502184 | 3300049824 | Bacteria | 901 |
| 965 | nmdc:mga03683_41612_c1 | 3300050489 | Bacteria | 1888 |
| 966 | nmdc:mga00v17_41723_c1 | 3300050491 | Bacteria | 2757 |
| 967 | nmdc:mga0k408_5006_c1 | 3300050493 | Bacteria | 7017 |
| 968 | nmdc:mga06z11_10949_c1 | 3300050494 | Bacteria | 3889 |
| 969 | nmdc:mga05p37_107236_c1 | 3300050507 | Bacteria | 3437 |
| 970 | nmdc:mga05p37_168945_c1 | 3300050507 | Bacteria | 2668 |
| 971 | nmdc:mga05p37_214936_c1 | 3300050507 | Bacteria | 2323 |
| 972 | nmdc:mga05p37_216724_c1 | 3300050507 | Bacteria | 2312 |
| 973 | nmdc:mga05p37_21703_c1 | 3300050507 | Bacteria | 7778 |
| 974 | nmdc:mga05p37_220104_c1 | 3300050507 | Bacteria | 2291 |
| 975 | nmdc:mga05p37_250891_c1 | 3300050507 | Bacteria | 2123 |
| 976 | nmdc:mga05p37_27529_c1 | 3300050507 | Bacteria | 6921 |
| 977 | nmdc:mga05p37_285361_c1 | 3300050507 | Bacteria | 1967 |
| 978 | nmdc:mga05p37_50178_c1 | 3300050507 | Bacteria | 5131 |
| 979 | nmdc:mga05p37_507175_c1 | 3300050507 | Bacteria | 1383 |
| 980 | nmdc:mga05p37_54488_c1 | 3300050507 | Bacteria | 4920 |
| 981 | nmdc:mga05p37_729_c1 | 3300050507 | Bacteria | 36493 |
| 982 | nmdc:mga05p37_95715_c1 | 3300050507 | Bacteria | 3658 |
| 983 | nmdc:mga09592_128695_c1 | 3300050508 | Bacteria | 2177 |
| 984 | nmdc:mga09592_18264_c1 | 3300050508 | Bacteria | 5750 |
| 985 | nmdc:mga09592_31693_c1 | 3300050508 | Bacteria | 4405 |
| 986 | nmdc:mga09592_4217_c1 | 3300050508 | Bacteria | 11609 |
| 987 | nmdc:mga09592_433009_c1 | 3300050508 | Bacteria | 1135 |
| 988 | nmdc:mga09592_64647_c1 | 3300050508 | Bacteria | 3097 |
| 989 | nmdc:mga0qj67_10794_c1 | 3300050509 | Bacteria | 6831 |
| 990 | nmdc:mga0qj67_223700_c1 | 3300050509 | Bacteria | 1528 |
| 991 | nmdc:mga0qj67_239257_c1 | 3300050509 | Bacteria | 1473 |
| 992 | nmdc:mga0qj67_33079_c1 | 3300050509 | Bacteria | 4034 |
| 993 | nmdc:mga06r32_117282_c1 | 3300050510 | Bacteria | 2624 |
| 994 | nmdc:mga06r32_142226_c1 | 3300050510 | Bacteria | 2376 |
| 995 | nmdc:mga06r32_24864_c1 | 3300050510 | Bacteria | 5566 |
| 996 | nmdc:mga06r32_46173_c1 | 3300050510 | Bacteria | 4156 |
| 997 | nmdc:mga06r32_670589_c1 | 3300050510 | Bacteria | 1004 |
| 998 | nmdc:mga06r32_84115_c1 | 3300050510 | Bacteria | 3100 |
| 999 | nmdc:mga06r32_95431_c1 | 3300050510 | Bacteria | 2911 |
| 1000 | nmdc:mga08y16_10686_c1 | 3300050511 | Bacteria | 9632 |
| 1001 | nmdc:mga08y16_16048_c1 | 3300050511 | Bacteria | 7874 |
| 1002 | nmdc:mga08y16_2315_c1 | 3300050511 | Bacteria | 19506 |
| 1003 | nmdc:mga08y16_327936_c1 | 3300050511 | Bacteria | 1575 |
| 1004 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 1005 | nmdc:mga08y16_41140_c1 | 3300050511 | Bacteria | 4842 |
| 1006 | nmdc:mga08y16_60376_c1 | 3300050511 | Bacteria | 3961 |
| 1007 | nmdc:mga08y16_825935_c1 | 3300050511 | Bacteria | 918 |
| 1008 | nmdc:mga0n895_10073_c1 | 3300050512 | Bacteria | 8319 |
| 1009 | nmdc:mga0n895_148545_c1 | 3300050512 | Unclassified | 2373 |
| 1010 | nmdc:mga0n895_265357_c1 | 3300050512 | Bacteria | 1742 |
| 1011 | nmdc:mga0n895_391216_c1 | 3300050512 | Bacteria | 1406 |
| 1012 | nmdc:mga0n895_44088_c1 | 3300050512 | Bacteria | 4350 |
| 1013 | nmdc:mga0n895_46964_c1 | 3300050512 | Bacteria | 4220 |
| 1014 | nmdc:mga0n895_491061_c1 | 3300050512 | Bacteria | 1238 |
| 1015 | nmdc:mga0n895_8576_c1 | 3300050512 | Bacteria | 8863 |
| 1016 | nmdc:mga0rr50_12374_c1 | 3300050513 | Bacteria | 5513 |
| 1017 | nmdc:mga0rr50_28496_c1 | 3300050513 | Bacteria | 3927 |
| 1018 | nmdc:mga0rr50_412486_c1 | 3300050513 | Unclassified | 1142 |
| 1019 | nmdc:mga08x19_3138_c1 | 3300050514 | Bacteria | 9922 |
| 1020 | nmdc:mga08x19_585880_c1 | 3300050514 | Bacteria | 790 |
| 1021 | nmdc:mga0a205_134513_c1 | 3300050515 | Unclassified | 2373 |
| 1022 | nmdc:mga0a205_198400_c1 | 3300050515 | Bacteria | 1898 |
| 1023 | nmdc:mga0a205_211576_c1 | 3300050515 | Bacteria | 1827 |
| 1024 | nmdc:mga0a205_44111_c1 | 3300050515 | Bacteria | 4298 |
| 1025 | nmdc:mga0a205_54635_c1 | 3300050515 | Bacteria | 3856 |
| 1026 | nmdc:mga0a205_85489_c1 | 3300050515 | Bacteria | 3046 |
| 1027 | Ga0495595_0022962 | 3300053084 | Bacteria | 2743 |
| 1028 | Ga0495619_0005642 | 3300053085 | Bacteria | 7935 |
| 1029 | Ga0495619_0025745 | 3300053085 | Bacteria | 3780 |
| 1030 | Ga0495619_0062239 | 3300053085 | Bacteria | 2484 |
| 1031 | Ga0495619_0584314 | 3300053085 | Bacteria | 765 |
| 1032 | Ga0500556_0026638 | 3300053104 | Bacteria | 1922 |
| 1033 | Ga0501084_0018944 | 3300054114 | Bacteria | 5730 |
| 1034 | Ga0501084_0021867 | 3300054114 | Bacteria | 5334 |
| 1035 | Ga0501084_0460448 | 3300054114 | Bacteria | 1075 |
| 1036 | Ga0590071_000262 | 3300059421 | Bacteria | 15367 |
| 1037 | Ga0590074_002317 | 3300059423 | Bacteria | 3121 |
| 1038 | Ga0590075_000379 | 3300059424 | Bacteria | 12188 |
| 1039 | Ga0590077_000100 | 3300059426 | Bacteria | 22536 |
| 1040 | Ga0501082_0003546 | 3300060353 | Bacteria | 13629 |
| 1041 | Ga0501082_0052391 | 3300060353 | Bacteria | 3518 |
| 1042 | Ga0501082_1033112 | 3300060353 | Bacteria | 719 |
| 1043 | Ga0530510_0101840 | 3300061734 | Bacteria | 2100 |
| 1044 | Ga0530510_0186629 | 3300061734 | Bacteria | 1539 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100392169 | Ga0068862_1003921692 | 210 |
| 2 | 3300025942 | Ga0207689_10806911 | Ga0207689_108069111 | 210 |
| 3 | 3300005549 | Ga0070704_100463186 | Ga0070704_1004631862 | 212 |
| 4 | 3300009177 | Ga0105248_10141080 | Ga0105248_101410803 | 212 |
| 5 | 3300013308 | Ga0157375_10258182 | Ga0157375_102581822 | 212 |
| 6 | 3300025941 | Ga0207711_10050303 | Ga0207711_100503033 | 212 |
| 7 | 3300009093 | Ga0105240_10040805 | Ga0105240_100408053 | 213 |
| 8 | 3300025913 | Ga0207695_10050891 | Ga0207695_100508915 | 213 |
| 9 | 3300039093 | Ga0400489_37299 | Ga0400489_37299_51105_51752 | 214 |
| 10 | 3300050510 | nmdc:mga06r32_142226_c1 | nmdc:mga06r32_142226_c1_87_743 | 214 |
| 11 | iso_pu_bacteria | 2864997549 | 2865000082 | 214 |
| 12 | 3300005288 | Ga0065714_10148072 | Ga0065714_101480722 | 215 |
| 13 | 3300005290 | Ga0065712_10067826 | Ga0065712_100678267 | 215 |
| 14 | 3300005354 | Ga0070675_100116245 | Ga0070675_1001162453 | 215 |
| 15 | 3300005354 | Ga0070675_100601786 | Ga0070675_1006017861 | 215 |
| 16 | 3300005355 | Ga0070671_100415539 | Ga0070671_1004155392 | 215 |
| 17 | 3300005366 | Ga0070659_100237563 | Ga0070659_1002375632 | 215 |
| 18 | 3300005564 | Ga0070664_100258174 | Ga0070664_1002581742 | 215 |
| 19 | 3300005841 | Ga0068863_100254071 | Ga0068863_1002540712 | 215 |
| 20 | 3300013308 | Ga0157375_10920887 | Ga0157375_109208872 | 215 |
| 21 | 3300014326 | Ga0157380_10445877 | Ga0157380_104458772 | 215 |
| 22 | 3300014745 | Ga0157377_10088800 | Ga0157377_100888002 | 215 |
| 23 | 3300025908 | Ga0207643_10133864 | Ga0207643_101338642 | 215 |
| 24 | 3300025926 | Ga0207659_10375867 | Ga0207659_103758672 | 215 |
| 25 | 3300025931 | Ga0207644_10354307 | Ga0207644_103543072 | 215 |
| 26 | 3300025945 | Ga0207679_10125927 | Ga0207679_101259272 | 215 |
| 27 | 3300026088 | Ga0207641_10372646 | Ga0207641_103726462 | 215 |
| 28 | 3300035171 | Ga0373946_0212753 | Ga0373946_0212753_186_866 | 215 |
| 29 | 3300036712 | Ga0316584_0121707 | Ga0316584_0121707_1082_1732 | 215 |
| 30 | 3300037068 | Ga0373925_0324081 | Ga0373925_0324081_455_1135 | 215 |
| 31 | 3300050507 | nmdc:mga05p37_27529_c1 | nmdc:mga05p37_27529_c1_1347_2021 | 215 |
| 32 | 3300050512 | nmdc:mga0n895_491061_c1 | nmdc:mga0n895_491061_c1_23_697 | 215 |
| 33 | 3300003203 | JGI25406J46586_10096364 | JGI25406J46586_100963641 | 216 |
| 34 | 3300005445 | Ga0070708_100586426 | Ga0070708_1005864262 | 216 |
| 35 | 3300005458 | Ga0070681_10556187 | Ga0070681_105561872 | 216 |
| 36 | 3300005985 | Ga0081539_10003749 | Ga0081539_1000374916 | 216 |
| 37 | 3300006871 | Ga0075434_100134242 | Ga0075434_1001342423 | 216 |
| 38 | 3300009094 | Ga0111539_10306692 | Ga0111539_103066922 | 216 |
| 39 | 3300009094 | Ga0111539_11013283 | Ga0111539_110132832 | 216 |
| 40 | 3300009147 | Ga0114129_10107673 | Ga0114129_101076736 | 216 |
| 41 | 3300013308 | Ga0157375_11331709 | Ga0157375_113317091 | 216 |
| 42 | 3300025933 | Ga0207706_10679086 | Ga0207706_106790861 | 216 |
| 43 | 3300026067 | Ga0207678_10541223 | Ga0207678_105412231 | 216 |
| 44 | 3300027907 | Ga0207428_10134591 | Ga0207428_101345912 | 216 |
| 45 | 3300050507 | nmdc:mga05p37_285361_c1 | nmdc:mga05p37_285361_c1_797_1471 | 216 |
| 46 | 3300050507 | nmdc:mga05p37_507175_c1 | nmdc:mga05p37_507175_c1_234_923 | 216 |
| 47 | 3300050511 | nmdc:mga08y16_327936_c1 | nmdc:mga08y16_327936_c1_401_1090 | 216 |
| 48 | 3300050512 | nmdc:mga0n895_265357_c1 | nmdc:mga0n895_265357_c1_38_727 | 216 |
| 49 | 3300059424 | Ga0590075_000379 | Ga0590075_000379_9660_10343 | 216 |
| 50 | 3300031733 | Ga0316577_10021421 | Ga0316577_100214212 | 217 |
| 51 | 3300031733 | Ga0316577_10309082 | Ga0316577_103090822 | 217 |
| 52 | 3300036712 | Ga0316584_0024677 | Ga0316584_0024677_2976_3632 | 217 |
| 53 | 3300042461 | Ga0439460_0022010 | Ga0439460_0022010_484_1143 | 217 |
| 54 | 3300049578 | Ga0501042_0140702 | Ga0501042_0140702_169_828 | 217 |
| 55 | 3300005547 | Ga0070693_100128986 | Ga0070693_1001289862 | 218 |
| 56 | 3300049571 | Ga0501034_0420919 | Ga0501034_0420919_502_1167 | 218 |
| 57 | 3300049823 | Ga0501044_0100182 | Ga0501044_0100182_531_1196 | 218 |
| 58 | 3300005293 | Ga0065715_10171797 | Ga0065715_101717972 | 219 |
| 59 | 3300005331 | Ga0070670_100190644 | Ga0070670_1001906442 | 219 |
| 60 | 3300005340 | Ga0070689_100069026 | Ga0070689_1000690263 | 219 |
| 61 | 3300005353 | Ga0070669_100085447 | Ga0070669_1000854474 | 219 |
| 62 | 3300005355 | Ga0070671_100079392 | Ga0070671_1000793922 | 219 |
| 63 | 3300005355 | Ga0070671_100497844 | Ga0070671_1004978441 | 219 |
| 64 | 3300005356 | Ga0070674_100360219 | Ga0070674_1003602192 | 219 |
| 65 | 3300005364 | Ga0070673_100048209 | Ga0070673_1000482092 | 219 |
| 66 | 3300005364 | Ga0070673_100170807 | Ga0070673_1001708073 | 219 |
| 67 | 3300005365 | Ga0070688_100147060 | Ga0070688_1001470601 | 219 |
| 68 | 3300005438 | Ga0070701_10173387 | Ga0070701_101733872 | 219 |
| 69 | 3300005445 | Ga0070708_100019170 | Ga0070708_1000191703 | 219 |
| 70 | 3300005445 | Ga0070708_100335527 | Ga0070708_1003355272 | 219 |
| 71 | 3300005459 | Ga0068867_100389828 | Ga0068867_1003898282 | 219 |
| 72 | 3300005468 | Ga0070707_100580317 | Ga0070707_1005803172 | 219 |
| 73 | 3300005543 | Ga0070672_100071567 | Ga0070672_1000715673 | 219 |
| 74 | 3300005546 | Ga0070696_100488051 | Ga0070696_1004880512 | 219 |
| 75 | 3300005549 | Ga0070704_100058059 | Ga0070704_1000580593 | 219 |
| 76 | 3300005617 | Ga0068859_100016051 | Ga0068859_1000160515 | 219 |
| 77 | 3300005719 | Ga0068861_100122823 | Ga0068861_1001228233 | 219 |
| 78 | 3300006237 | Ga0097621_100076538 | Ga0097621_1000765383 | 219 |
| 79 | 3300006237 | Ga0097621_100366294 | Ga0097621_1003662941 | 219 |
| 80 | 3300006931 | Ga0097620_100016051 | Ga0097620_1000160516 | 219 |
| 81 | 3300007076 | Ga0075435_100045790 | Ga0075435_1000457904 | 219 |
| 82 | 3300009147 | Ga0114129_10006412 | Ga0114129_100064126 | 219 |
| 83 | 3300009553 | Ga0105249_10174354 | Ga0105249_101743543 | 219 |
| 84 | 3300013296 | Ga0157374_10114249 | Ga0157374_101142492 | 219 |
| 85 | 3300013297 | Ga0157378_10005352 | Ga0157378_100053529 | 219 |
| 86 | 3300014969 | Ga0157376_10395389 | Ga0157376_103953892 | 219 |
| 87 | 3300025922 | Ga0207646_10116739 | Ga0207646_101167394 | 219 |
| 88 | 3300025925 | Ga0207650_10021983 | Ga0207650_100219833 | 219 |
| 89 | 3300025926 | Ga0207659_10466143 | Ga0207659_104661431 | 219 |
| 90 | 3300025931 | Ga0207644_10451593 | Ga0207644_104515932 | 219 |
| 91 | 3300025933 | Ga0207706_10167789 | Ga0207706_101677893 | 219 |
| 92 | 3300025937 | Ga0207669_10702891 | Ga0207669_107028912 | 219 |
| 93 | 3300025940 | Ga0207691_10169262 | Ga0207691_101692622 | 219 |
| 94 | 3300025941 | Ga0207711_10062770 | Ga0207711_100627704 | 219 |
| 95 | 3300025942 | Ga0207689_10431041 | Ga0207689_104310412 | 219 |
| 96 | 3300025960 | Ga0207651_10100362 | Ga0207651_101003623 | 219 |
| 97 | 3300026118 | Ga0207675_100208078 | Ga0207675_1002080783 | 219 |
| 98 | 3300026121 | Ga0207683_10192918 | Ga0207683_101929184 | 219 |
| 99 | 3300028380 | Ga0268265_10282924 | Ga0268265_102829242 | 219 |
| 100 | 3300031733 | Ga0316577_10286331 | Ga0316577_102863312 | 219 |
| 101 | 3300042876 | Ga0451577_0001213 | Ga0451577_0001213_21998_22663 | 219 |
| 102 | 3300044712 | Ga0453684_0104817 | Ga0453684_0104817_2432_3097 | 219 |
| 103 | 3300046463 | Ga0495653_0134080 | Ga0495653_0134080_551_1216 | 219 |
| 104 | 3300046536 | Ga0495587_0247391 | Ga0495587_0247391_30_695 | 219 |
| 105 | 3300049570 | Ga0501033_0037372 | Ga0501033_0037372_957_1634 | 219 |
| 106 | 3300049572 | Ga0501036_0011194 | Ga0501036_0011194_2155_2832 | 219 |
| 107 | 3300049574 | Ga0501038_0074848 | Ga0501038_0074848_1959_2636 | 219 |
| 108 | 3300049575 | Ga0501039_0052450 | Ga0501039_0052450_1997_2674 | 219 |
| 109 | 3300049576 | Ga0501040_0034146 | Ga0501040_0034146_450_1127 | 219 |
| 110 | 3300049578 | Ga0501042_0011481 | Ga0501042_0011481_2952_3629 | 219 |
| 111 | 3300049580 | Ga0501046_0017522 | Ga0501046_0017522_4856_5533 | 219 |
| 112 | 3300049587 | Ga0501071_0010224 | Ga0501071_0010224_1099_1776 | 219 |
| 113 | 3300049588 | Ga0501072_0214421 | Ga0501072_0214421_525_1202 | 219 |
| 114 | 3300049591 | Ga0501075_0123528 | Ga0501075_0123528_12_689 | 219 |
| 115 | 3300049592 | Ga0501076_0004291 | Ga0501076_0004291_3097_3774 | 219 |
| 116 | 3300049741 | Ga0501079_0023050 | Ga0501079_0023050_2952_3629 | 219 |
| 117 | 3300049742 | Ga0501080_0043985 | Ga0501080_0043985_2661_3338 | 219 |
| 118 | 3300049743 | Ga0501081_0001907 | Ga0501081_0001907_2807_3484 | 219 |
| 119 | 3300049744 | Ga0501083_0193024 | Ga0501083_0193024_441_1118 | 219 |
| 120 | 3300049822 | Ga0501035_0087425 | Ga0501035_0087425_207_884 | 219 |
| 121 | 3300049824 | Ga0501045_0005841 | Ga0501045_0005841_1351_2028 | 219 |
| 122 | 3300050513 | nmdc:mga0rr50_28496_c1 | nmdc:mga0rr50_28496_c1_2053_2730 | 219 |
| 123 | 3300054114 | Ga0501084_0018944 | Ga0501084_0018944_4490_5167 | 219 |
| 124 | 3300060353 | Ga0501082_0003546 | Ga0501082_0003546_7681_8358 | 219 |
| 125 | 3300005290 | Ga0065712_10140567 | Ga0065712_101405672 | 220 |
| 126 | 3300005293 | Ga0065715_10168068 | Ga0065715_101680682 | 220 |
| 127 | 3300005295 | Ga0065707_10001067 | Ga0065707_100010674 | 220 |
| 128 | 3300005330 | Ga0070690_100007254 | Ga0070690_1000072544 | 220 |
| 129 | 3300005335 | Ga0070666_10039257 | Ga0070666_100392573 | 220 |
| 130 | 3300005338 | Ga0068868_100007095 | Ga0068868_1000070955 | 220 |
| 131 | 3300005340 | Ga0070689_100235229 | Ga0070689_1002352293 | 220 |
| 132 | 3300005343 | Ga0070687_100043160 | Ga0070687_1000431603 | 220 |
| 133 | 3300005354 | Ga0070675_100096246 | Ga0070675_1000962463 | 220 |
| 134 | 3300005354 | Ga0070675_100149507 | Ga0070675_1001495072 | 220 |
| 135 | 3300005355 | Ga0070671_100229770 | Ga0070671_1002297702 | 220 |
| 136 | 3300005367 | Ga0070667_100091411 | Ga0070667_1000914112 | 220 |
| 137 | 3300005467 | Ga0070706_100615637 | Ga0070706_1006156372 | 220 |
| 138 | 3300005468 | Ga0070707_100386635 | Ga0070707_1003866352 | 220 |
| 139 | 3300005518 | Ga0070699_100011666 | Ga0070699_1000116663 | 220 |
| 140 | 3300005539 | Ga0068853_100061015 | Ga0068853_1000610152 | 220 |
| 141 | 3300005543 | Ga0070672_100085300 | Ga0070672_1000853002 | 220 |
| 142 | 3300005544 | Ga0070686_100001189 | Ga0070686_10000118913 | 220 |
| 143 | 3300005546 | Ga0070696_100462802 | Ga0070696_1004628022 | 220 |
| 144 | 3300005546 | Ga0070696_100491396 | Ga0070696_1004913962 | 220 |
| 145 | 3300005548 | Ga0070665_100053852 | Ga0070665_1000538524 | 220 |
| 146 | 3300005564 | Ga0070664_100030218 | Ga0070664_1000302185 | 220 |
| 147 | 3300005577 | Ga0068857_100796655 | Ga0068857_1007966552 | 220 |
| 148 | 3300005578 | Ga0068854_100008495 | Ga0068854_1000084957 | 220 |
| 149 | 3300005578 | Ga0068854_100482471 | Ga0068854_1004824712 | 220 |
| 150 | 3300005719 | Ga0068861_100654781 | Ga0068861_1006547811 | 220 |
| 151 | 3300005842 | Ga0068858_100004023 | Ga0068858_10000402313 | 220 |
| 152 | 3300005843 | Ga0068860_100126642 | Ga0068860_1001266423 | 220 |
| 153 | 3300005985 | Ga0081539_10040616 | Ga0081539_100406162 | 220 |
| 154 | 3300006163 | Ga0070715_10242795 | Ga0070715_102427951 | 220 |
| 155 | 3300006237 | Ga0097621_100001328 | Ga0097621_1000013282 | 220 |
| 156 | 3300006237 | Ga0097621_100051441 | Ga0097621_1000514414 | 220 |
| 157 | 3300006237 | Ga0097621_100165279 | Ga0097621_1001652792 | 220 |
| 158 | 3300006358 | Ga0068871_100011604 | Ga0068871_1000116042 | 220 |
| 159 | 3300006847 | Ga0075431_100067943 | Ga0075431_1000679434 | 220 |
| 160 | 3300006871 | Ga0075434_100000354 | Ga0075434_10000035420 | 220 |
| 161 | 3300006871 | Ga0075434_100286859 | Ga0075434_1002868592 | 220 |
| 162 | 3300006880 | Ga0075429_100319352 | Ga0075429_1003193523 | 220 |
| 163 | 3300006914 | Ga0075436_100002547 | Ga0075436_1000025478 | 220 |
| 164 | 3300007076 | Ga0075435_100051328 | Ga0075435_1000513284 | 220 |
| 165 | 3300009093 | Ga0105240_10900445 | Ga0105240_109004452 | 220 |
| 166 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001175 | 220 |
| 167 | 3300009098 | Ga0105245_10028953 | Ga0105245_100289533 | 220 |
| 168 | 3300009176 | Ga0105242_10026194 | Ga0105242_100261943 | 220 |
| 169 | 3300009177 | Ga0105248_10375900 | Ga0105248_103759003 | 220 |
| 170 | 3300009177 | Ga0105248_10501080 | Ga0105248_105010802 | 220 |
| 171 | 3300009545 | Ga0105237_10078532 | Ga0105237_100785323 | 220 |
| 172 | 3300009551 | Ga0105238_10011306 | Ga0105238_100113066 | 220 |
| 173 | 3300013296 | Ga0157374_10044119 | Ga0157374_100441193 | 220 |
| 174 | 3300013296 | Ga0157374_10178565 | Ga0157374_101785652 | 220 |
| 175 | 3300013297 | Ga0157378_10090328 | Ga0157378_100903282 | 220 |
| 176 | 3300014326 | Ga0157380_10022314 | Ga0157380_100223144 | 220 |
| 177 | 3300014326 | Ga0157380_10193850 | Ga0157380_101938501 | 220 |
| 178 | 3300025321 | Ga0207656_10112031 | Ga0207656_101120312 | 220 |
| 179 | 3300025900 | Ga0207710_10128300 | Ga0207710_101283002 | 220 |
| 180 | 3300025903 | Ga0207680_10053799 | Ga0207680_100537993 | 220 |
| 181 | 3300025903 | Ga0207680_10145582 | Ga0207680_101455822 | 220 |
| 182 | 3300025910 | Ga0207684_10740599 | Ga0207684_107405991 | 220 |
| 183 | 3300025911 | Ga0207654_10095968 | Ga0207654_100959681 | 220 |
| 184 | 3300025914 | Ga0207671_10064312 | Ga0207671_100643123 | 220 |
| 185 | 3300025918 | Ga0207662_10049434 | Ga0207662_100494343 | 220 |
| 186 | 3300025922 | Ga0207646_10243206 | Ga0207646_102432062 | 220 |
| 187 | 3300025924 | Ga0207694_10006176 | Ga0207694_100061767 | 220 |
| 188 | 3300025926 | Ga0207659_10061761 | Ga0207659_100617613 | 220 |
| 189 | 3300025926 | Ga0207659_10337437 | Ga0207659_103374372 | 220 |
| 190 | 3300025931 | Ga0207644_10114335 | Ga0207644_101143352 | 220 |
| 191 | 3300025933 | Ga0207706_10174387 | Ga0207706_101743872 | 220 |
| 192 | 3300025934 | Ga0207686_10157511 | Ga0207686_101575112 | 220 |
| 193 | 3300025940 | Ga0207691_10397580 | Ga0207691_103975802 | 220 |
| 194 | 3300025940 | Ga0207691_10862468 | Ga0207691_108624681 | 220 |
| 195 | 3300025941 | Ga0207711_10057699 | Ga0207711_100576992 | 220 |
| 196 | 3300025941 | Ga0207711_10922425 | Ga0207711_109224251 | 220 |
| 197 | 3300025981 | Ga0207640_10038454 | Ga0207640_100384543 | 220 |
| 198 | 3300025981 | Ga0207640_10340913 | Ga0207640_103409132 | 220 |
| 199 | 3300025986 | Ga0207658_10060962 | Ga0207658_100609622 | 220 |
| 200 | 3300026023 | Ga0207677_10160010 | Ga0207677_101600102 | 220 |
| 201 | 3300026035 | Ga0207703_10046137 | Ga0207703_100461374 | 220 |
| 202 | 3300026041 | Ga0207639_10097959 | Ga0207639_100979592 | 220 |
| 203 | 3300026118 | Ga0207675_100453401 | Ga0207675_1004534012 | 220 |
| 204 | 3300026118 | Ga0207675_101003419 | Ga0207675_1010034192 | 220 |
| 205 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002187 | 220 |
| 206 | 3300028379 | Ga0268266_10011683 | Ga0268266_100116837 | 220 |
| 207 | 3300031548 | Ga0307408_100018869 | Ga0307408_1000188694 | 220 |
| 208 | 3300031852 | Ga0307410_10155592 | Ga0307410_101555922 | 220 |
| 209 | 3300032126 | Ga0307415_100162838 | Ga0307415_1001628381 | 220 |
| 210 | 3300034816 | Ga0373930_0000481 | Ga0373930_0000481_262_942 | 220 |
| 211 | 3300034817 | Ga0373948_0000587 | Ga0373948_0000587_2779_3459 | 220 |
| 212 | 3300034818 | Ga0373950_0004065 | Ga0373950_0004065_25_705 | 220 |
| 213 | 3300034819 | Ga0373958_0000404 | Ga0373958_0000404_3142_3822 | 220 |
| 214 | 3300034820 | Ga0373959_0002640 | Ga0373959_0002640_188_868 | 220 |
| 215 | 3300034957 | Ga0373938_0003896 | Ga0373938_0003896_295_975 | 220 |
| 216 | 3300035084 | Ga0373928_0014015 | Ga0373928_0014015_437_1117 | 220 |
| 217 | 3300035085 | Ga0373929_0000196 | Ga0373929_0000196_5873_6553 | 220 |
| 218 | 3300035088 | Ga0373940_0014005 | Ga0373940_0014005_495_1175 | 220 |
| 219 | 3300035090 | Ga0373949_0007247 | Ga0373949_0007247_1099_1779 | 220 |
| 220 | 3300035091 | Ga0373951_0000268 | Ga0373951_0000268_3528_4208 | 220 |
| 221 | 3300035092 | Ga0373952_0002993 | Ga0373952_0002993_918_1598 | 220 |
| 222 | 3300035112 | Ga0373932_0000829 | Ga0373932_0000829_4459_5139 | 220 |
| 223 | 3300035112 | Ga0373932_0110799 | Ga0373932_0110799_127_798 | 220 |
| 224 | 3300035114 | Ga0373939_0000363 | Ga0373939_0000363_8123_8803 | 220 |
| 225 | 3300035115 | Ga0373941_0004028 | Ga0373941_0004028_2525_3205 | 220 |
| 226 | 3300035115 | Ga0373941_0113985 | Ga0373941_0113985_140_814 | 220 |
| 227 | 3300035119 | Ga0373956_0263122 | Ga0373956_0263122_132_806 | 220 |
| 228 | 3300035121 | Ga0373960_0000784 | Ga0373960_0000784_5568_6248 | 220 |
| 229 | 3300035207 | Ga0373942_0000106 | Ga0373942_0000106_16512_17192 | 220 |
| 230 | 3300035241 | Ga0373961_0001445 | Ga0373961_0001445_5168_5848 | 220 |
| 231 | 3300035242 | Ga0373962_0000782 | Ga0373962_0000782_2919_3599 | 220 |
| 232 | 3300035691 | Ga0373931_0002897 | Ga0373931_0002897_4043_4723 | 220 |
| 233 | 3300041512 | Ga0451853_2376905 | Ga0451853_2376905_390_1052 | 220 |
| 234 | 3300046472 | Ga0495580_0037732 | Ga0495580_0037732_1801_2475 | 220 |
| 235 | 3300046475 | Ga0495639_0012511 | Ga0495639_0012511_1855_2529 | 220 |
| 236 | 3300046684 | Ga0495669_0017563 | Ga0495669_0017563_1812_2507 | 220 |
| 237 | 3300049572 | Ga0501036_0223668 | Ga0501036_0223668_206_883 | 220 |
| 238 | 3300049580 | Ga0501046_0168788 | Ga0501046_0168788_914_1591 | 220 |
| 239 | 3300049588 | Ga0501072_0379862 | Ga0501072_0379862_382_1050 | 220 |
| 240 | 3300049591 | Ga0501075_0078357 | Ga0501075_0078357_159_836 | 220 |
| 241 | 3300049592 | Ga0501076_0336704 | Ga0501076_0336704_85_762 | 220 |
| 242 | 3300049679 | Ga0501249_026565 | Ga0501249_026565_144_818 | 220 |
| 243 | 3300049743 | Ga0501081_0355403 | Ga0501081_0355403_340_1008 | 220 |
| 244 | 3300049824 | Ga0501045_0104253 | Ga0501045_0104253_278_955 | 220 |
| 245 | 3300049824 | Ga0501045_0502184 | Ga0501045_0502184_68_751 | 220 |
| 246 | 3300050510 | nmdc:mga06r32_46173_c1 | nmdc:mga06r32_46173_c1_2606_3286 | 220 |
| 247 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_203575_204255 | 220 |
| 248 | 3300050512 | nmdc:mga0n895_8576_c1 | nmdc:mga0n895_8576_c1_7557_8228 | 220 |
| 249 | 3300050514 | nmdc:mga08x19_3138_c1 | nmdc:mga08x19_3138_c1_5787_6488 | 220 |
| 250 | 3300061734 | Ga0530510_0186629 | Ga0530510_0186629_679_1356 | 220 |
| 251 | 3300005290 | Ga0065712_10075828 | Ga0065712_100758283 | 221 |
| 252 | 3300005295 | Ga0065707_10037066 | Ga0065707_100370662 | 221 |
| 253 | 3300005295 | Ga0065707_10271034 | Ga0065707_102710342 | 221 |
| 254 | 3300005327 | Ga0070658_10261910 | Ga0070658_102619102 | 221 |
| 255 | 3300005329 | Ga0070683_100143130 | Ga0070683_1001431303 | 221 |
| 256 | 3300005330 | Ga0070690_100001946 | Ga0070690_1000019468 | 221 |
| 257 | 3300005331 | Ga0070670_100000685 | Ga0070670_10000068510 | 221 |
| 258 | 3300005333 | Ga0070677_10022596 | Ga0070677_100225963 | 221 |
| 259 | 3300005335 | Ga0070666_10001117 | Ga0070666_1000111713 | 221 |
| 260 | 3300005335 | Ga0070666_10066402 | Ga0070666_100664023 | 221 |
| 261 | 3300005335 | Ga0070666_10267088 | Ga0070666_102670882 | 221 |
| 262 | 3300005336 | Ga0070680_100096219 | Ga0070680_1000962192 | 221 |
| 263 | 3300005338 | Ga0068868_100002612 | Ga0068868_1000026122 | 221 |
| 264 | 3300005338 | Ga0068868_100199368 | Ga0068868_1001993682 | 221 |
| 265 | 3300005338 | Ga0068868_100509064 | Ga0068868_1005090642 | 221 |
| 266 | 3300005339 | Ga0070660_100013279 | Ga0070660_1000132793 | 221 |
| 267 | 3300005339 | Ga0070660_100618897 | Ga0070660_1006188972 | 221 |
| 268 | 3300005340 | Ga0070689_100036443 | Ga0070689_1000364432 | 221 |
| 269 | 3300005340 | Ga0070689_100085426 | Ga0070689_1000854263 | 221 |
| 270 | 3300005343 | Ga0070687_100364237 | Ga0070687_1003642372 | 221 |
| 271 | 3300005344 | Ga0070661_100016239 | Ga0070661_1000162394 | 221 |
| 272 | 3300005344 | Ga0070661_100062768 | Ga0070661_1000627683 | 221 |
| 273 | 3300005353 | Ga0070669_100037262 | Ga0070669_1000372625 | 221 |
| 274 | 3300005353 | Ga0070669_100084340 | Ga0070669_1000843403 | 221 |
| 275 | 3300005353 | Ga0070669_100763896 | Ga0070669_1007638961 | 221 |
| 276 | 3300005354 | Ga0070675_100000152 | Ga0070675_10000015225 | 221 |
| 277 | 3300005354 | Ga0070675_100000255 | Ga0070675_10000025525 | 221 |
| 278 | 3300005354 | Ga0070675_100008820 | Ga0070675_1000088201 | 221 |
| 279 | 3300005354 | Ga0070675_100037825 | Ga0070675_1000378253 | 221 |
| 280 | 3300005354 | Ga0070675_100049117 | Ga0070675_1000491174 | 221 |
| 281 | 3300005354 | Ga0070675_100117749 | Ga0070675_1001177492 | 221 |
| 282 | 3300005355 | Ga0070671_100008711 | Ga0070671_1000087116 | 221 |
| 283 | 3300005355 | Ga0070671_100021093 | Ga0070671_1000210933 | 221 |
| 284 | 3300005355 | Ga0070671_100031711 | Ga0070671_1000317113 | 221 |
| 285 | 3300005356 | Ga0070674_100812647 | Ga0070674_1008126471 | 221 |
| 286 | 3300005364 | Ga0070673_100008704 | Ga0070673_1000087044 | 221 |
| 287 | 3300005364 | Ga0070673_100018346 | Ga0070673_1000183462 | 221 |
| 288 | 3300005364 | Ga0070673_100101451 | Ga0070673_1001014512 | 221 |
| 289 | 3300005364 | Ga0070673_100149540 | Ga0070673_1001495402 | 221 |
| 290 | 3300005365 | Ga0070688_100006958 | Ga0070688_1000069584 | 221 |
| 291 | 3300005365 | Ga0070688_100030712 | Ga0070688_1000307124 | 221 |
| 292 | 3300005365 | Ga0070688_100297033 | Ga0070688_1002970332 | 221 |
| 293 | 3300005366 | Ga0070659_100076707 | Ga0070659_1000767073 | 221 |
| 294 | 3300005366 | Ga0070659_100270130 | Ga0070659_1002701302 | 221 |
| 295 | 3300005367 | Ga0070667_100000993 | Ga0070667_10000099323 | 221 |
| 296 | 3300005367 | Ga0070667_100002300 | Ga0070667_1000023008 | 221 |
| 297 | 3300005367 | Ga0070667_100098217 | Ga0070667_1000982173 | 221 |
| 298 | 3300005435 | Ga0070714_100057997 | Ga0070714_1000579973 | 221 |
| 299 | 3300005436 | Ga0070713_100040062 | Ga0070713_1000400625 | 221 |
| 300 | 3300005436 | Ga0070713_100061623 | Ga0070713_1000616233 | 221 |
| 301 | 3300005438 | Ga0070701_10224615 | Ga0070701_102246152 | 221 |
| 302 | 3300005440 | Ga0070705_100012816 | Ga0070705_1000128164 | 221 |
| 303 | 3300005456 | Ga0070678_100121064 | Ga0070678_1001210641 | 221 |
| 304 | 3300005457 | Ga0070662_100122339 | Ga0070662_1001223392 | 221 |
| 305 | 3300005458 | Ga0070681_10617054 | Ga0070681_106170542 | 221 |
| 306 | 3300005466 | Ga0070685_10006788 | Ga0070685_100067884 | 221 |
| 307 | 3300005466 | Ga0070685_10211161 | Ga0070685_102111612 | 221 |
| 308 | 3300005468 | Ga0070707_100044730 | Ga0070707_1000447303 | 221 |
| 309 | 3300005471 | Ga0070698_100049965 | Ga0070698_1000499655 | 221 |
| 310 | 3300005471 | Ga0070698_100114096 | Ga0070698_1001140963 | 221 |
| 311 | 3300005471 | Ga0070698_100183276 | Ga0070698_1001832762 | 221 |
| 312 | 3300005471 | Ga0070698_100436305 | Ga0070698_1004363051 | 221 |
| 313 | 3300005518 | Ga0070699_100042953 | Ga0070699_1000429533 | 221 |
| 314 | 3300005518 | Ga0070699_100264633 | Ga0070699_1002646331 | 221 |
| 315 | 3300005518 | Ga0070699_100500241 | Ga0070699_1005002412 | 221 |
| 316 | 3300005535 | Ga0070684_100068779 | Ga0070684_1000687793 | 221 |
| 317 | 3300005543 | Ga0070672_100001564 | Ga0070672_10000156414 | 221 |
| 318 | 3300005543 | Ga0070672_100011176 | Ga0070672_1000111765 | 221 |
| 319 | 3300005543 | Ga0070672_100013605 | Ga0070672_1000136055 | 221 |
| 320 | 3300005543 | Ga0070672_100096931 | Ga0070672_1000969312 | 221 |
| 321 | 3300005543 | Ga0070672_100227565 | Ga0070672_1002275652 | 221 |
| 322 | 3300005546 | Ga0070696_100022198 | Ga0070696_1000221985 | 221 |
| 323 | 3300005546 | Ga0070696_100119898 | Ga0070696_1001198983 | 221 |
| 324 | 3300005546 | Ga0070696_100336470 | Ga0070696_1003364701 | 221 |
| 325 | 3300005546 | Ga0070696_100398739 | Ga0070696_1003987391 | 221 |
| 326 | 3300005548 | Ga0070665_100624446 | Ga0070665_1006244462 | 221 |
| 327 | 3300005549 | Ga0070704_100024158 | Ga0070704_1000241582 | 221 |
| 328 | 3300005564 | Ga0070664_100000144 | Ga0070664_1000001442 | 221 |
| 329 | 3300005577 | Ga0068857_100208450 | Ga0068857_1002084503 | 221 |
| 330 | 3300005578 | Ga0068854_100142935 | Ga0068854_1001429352 | 221 |
| 331 | 3300005615 | Ga0070702_100096962 | Ga0070702_1000969622 | 221 |
| 332 | 3300005617 | Ga0068859_100003201 | Ga0068859_1000032013 | 221 |
| 333 | 3300005617 | Ga0068859_100098441 | Ga0068859_1000984413 | 221 |
| 334 | 3300005617 | Ga0068859_100763379 | Ga0068859_1007633792 | 221 |
| 335 | 3300005618 | Ga0068864_100000486 | Ga0068864_10000048620 | 221 |
| 336 | 3300005618 | Ga0068864_100031124 | Ga0068864_1000311244 | 221 |
| 337 | 3300005618 | Ga0068864_100067028 | Ga0068864_1000670282 | 221 |
| 338 | 3300005618 | Ga0068864_100696762 | Ga0068864_1006967622 | 221 |
| 339 | 3300005718 | Ga0068866_10096320 | Ga0068866_100963203 | 221 |
| 340 | 3300005719 | Ga0068861_100098464 | Ga0068861_1000984643 | 221 |
| 341 | 3300005719 | Ga0068861_100300161 | Ga0068861_1003001613 | 221 |
| 342 | 3300005834 | Ga0068851_10188600 | Ga0068851_101886002 | 221 |
| 343 | 3300005840 | Ga0068870_10274638 | Ga0068870_102746382 | 221 |
| 344 | 3300005840 | Ga0068870_10385982 | Ga0068870_103859821 | 221 |
| 345 | 3300005841 | Ga0068863_100000526 | Ga0068863_10000052631 | 221 |
| 346 | 3300005841 | Ga0068863_100001664 | Ga0068863_10000166415 | 221 |
| 347 | 3300005841 | Ga0068863_100005682 | Ga0068863_1000056823 | 221 |
| 348 | 3300005841 | Ga0068863_100129493 | Ga0068863_1001294933 | 221 |
| 349 | 3300005841 | Ga0068863_100448879 | Ga0068863_1004488792 | 221 |
| 350 | 3300005842 | Ga0068858_100004203 | Ga0068858_1000042036 | 221 |
| 351 | 3300005842 | Ga0068858_100004339 | Ga0068858_10000433911 | 221 |
| 352 | 3300005842 | Ga0068858_100032481 | Ga0068858_1000324815 | 221 |
| 353 | 3300005842 | Ga0068858_100062381 | Ga0068858_1000623812 | 221 |
| 354 | 3300005842 | Ga0068858_100084694 | Ga0068858_1000846942 | 221 |
| 355 | 3300005842 | Ga0068858_100594024 | Ga0068858_1005940242 | 221 |
| 356 | 3300005842 | Ga0068858_100709378 | Ga0068858_1007093782 | 221 |
| 357 | 3300005842 | Ga0068858_100726785 | Ga0068858_1007267852 | 221 |
| 358 | 3300005842 | Ga0068858_100830690 | Ga0068858_1008306902 | 221 |
| 359 | 3300005843 | Ga0068860_100001145 | Ga0068860_1000011455 | 221 |
| 360 | 3300005843 | Ga0068860_100164750 | Ga0068860_1001647502 | 221 |
| 361 | 3300005843 | Ga0068860_100327563 | Ga0068860_1003275632 | 221 |
| 362 | 3300005843 | Ga0068860_100620517 | Ga0068860_1006205172 | 221 |
| 363 | 3300005844 | Ga0068862_100066537 | Ga0068862_1000665373 | 221 |
| 364 | 3300005844 | Ga0068862_100098609 | Ga0068862_1000986093 | 221 |
| 365 | 3300005844 | Ga0068862_100156512 | Ga0068862_1001565123 | 221 |
| 366 | 3300005937 | Ga0081455_10091618 | Ga0081455_100916183 | 221 |
| 367 | 3300005985 | Ga0081539_10008963 | Ga0081539_100089637 | 221 |
| 368 | 3300006051 | Ga0075364_10012103 | Ga0075364_100121033 | 221 |
| 369 | 3300006163 | Ga0070715_10088888 | Ga0070715_100888883 | 221 |
| 370 | 3300006177 | Ga0075362_10008592 | Ga0075362_100085922 | 221 |
| 371 | 3300006178 | Ga0075367_10010532 | Ga0075367_100105322 | 221 |
| 372 | 3300006195 | Ga0075366_10028979 | Ga0075366_100289795 | 221 |
| 373 | 3300006237 | Ga0097621_100035558 | Ga0097621_1000355584 | 221 |
| 374 | 3300006237 | Ga0097621_100040059 | Ga0097621_1000400593 | 221 |
| 375 | 3300006358 | Ga0068871_100030699 | Ga0068871_1000306994 | 221 |
| 376 | 3300006358 | Ga0068871_100058626 | Ga0068871_1000586263 | 221 |
| 377 | 3300006358 | Ga0068871_100105634 | Ga0068871_1001056342 | 221 |
| 378 | 3300006844 | Ga0075428_100245407 | Ga0075428_1002454073 | 221 |
| 379 | 3300006844 | Ga0075428_100330676 | Ga0075428_1003306762 | 221 |
| 380 | 3300006847 | Ga0075431_100087851 | Ga0075431_1000878512 | 221 |
| 381 | 3300006847 | Ga0075431_100402317 | Ga0075431_1004023173 | 221 |
| 382 | 3300006852 | Ga0075433_10037646 | Ga0075433_100376462 | 221 |
| 383 | 3300006852 | Ga0075433_10109080 | Ga0075433_101090803 | 221 |
| 384 | 3300006852 | Ga0075433_10167879 | Ga0075433_101678792 | 221 |
| 385 | 3300006871 | Ga0075434_100000656 | Ga0075434_10000065629 | 221 |
| 386 | 3300006871 | Ga0075434_100031766 | Ga0075434_1000317662 | 221 |
| 387 | 3300006871 | Ga0075434_100404071 | Ga0075434_1004040713 | 221 |
| 388 | 3300006880 | Ga0075429_100210682 | Ga0075429_1002106823 | 221 |
| 389 | 3300006880 | Ga0075429_100219405 | Ga0075429_1002194052 | 221 |
| 390 | 3300006881 | Ga0068865_100033009 | Ga0068865_1000330093 | 221 |
| 391 | 3300006914 | Ga0075436_100086196 | Ga0075436_1000861962 | 221 |
| 392 | 3300006914 | Ga0075436_100400939 | Ga0075436_1004009391 | 221 |
| 393 | 3300006931 | Ga0097620_100003201 | Ga0097620_1000032013 | 221 |
| 394 | 3300006931 | Ga0097620_100098445 | Ga0097620_1000984453 | 221 |
| 395 | 3300006931 | Ga0097620_100331062 | Ga0097620_1003310621 | 221 |
| 396 | 3300006931 | Ga0097620_100763328 | Ga0097620_1007633282 | 221 |
| 397 | 3300007076 | Ga0075435_100000424 | Ga0075435_10000042414 | 221 |
| 398 | 3300007076 | Ga0075435_100009726 | Ga0075435_1000097265 | 221 |
| 399 | 3300009093 | Ga0105240_10013771 | Ga0105240_100137718 | 221 |
| 400 | 3300009093 | Ga0105240_10274018 | Ga0105240_102740182 | 221 |
| 401 | 3300009093 | Ga0105240_10291447 | Ga0105240_102914472 | 221 |
| 402 | 3300009094 | Ga0111539_10041877 | Ga0111539_100418773 | 221 |
| 403 | 3300009094 | Ga0111539_10190067 | Ga0111539_101900672 | 221 |
| 404 | 3300009098 | Ga0105245_10361590 | Ga0105245_103615902 | 221 |
| 405 | 3300009101 | Ga0105247_10303567 | Ga0105247_103035671 | 221 |
| 406 | 3300009147 | Ga0114129_10016354 | Ga0114129_100163547 | 221 |
| 407 | 3300009147 | Ga0114129_10020769 | Ga0114129_1002076911 | 221 |
| 408 | 3300009147 | Ga0114129_10039435 | Ga0114129_100394352 | 221 |
| 409 | 3300009147 | Ga0114129_10051285 | Ga0114129_100512855 | 221 |
| 410 | 3300009147 | Ga0114129_10156387 | Ga0114129_101563872 | 221 |
| 411 | 3300009147 | Ga0114129_10824749 | Ga0114129_108247492 | 221 |
| 412 | 3300009174 | Ga0105241_10779841 | Ga0105241_107798412 | 221 |
| 413 | 3300009174 | Ga0105241_10947578 | Ga0105241_109475781 | 221 |
| 414 | 3300009176 | Ga0105242_10029457 | Ga0105242_100294574 | 221 |
| 415 | 3300009176 | Ga0105242_10302379 | Ga0105242_103023793 | 221 |
| 416 | 3300009176 | Ga0105242_11144506 | Ga0105242_111445061 | 221 |
| 417 | 3300009177 | Ga0105248_10000236 | Ga0105248_1000023610 | 221 |
| 418 | 3300009177 | Ga0105248_10001572 | Ga0105248_1000157220 | 221 |
| 419 | 3300009177 | Ga0105248_10013439 | Ga0105248_100134397 | 221 |
| 420 | 3300009177 | Ga0105248_10084092 | Ga0105248_100840922 | 221 |
| 421 | 3300009177 | Ga0105248_10120857 | Ga0105248_101208572 | 221 |
| 422 | 3300009177 | Ga0105248_10153342 | Ga0105248_101533423 | 221 |
| 423 | 3300009177 | Ga0105248_10207491 | Ga0105248_102074913 | 221 |
| 424 | 3300009177 | Ga0105248_10336047 | Ga0105248_103360472 | 221 |
| 425 | 3300009177 | Ga0105248_10443087 | Ga0105248_104430872 | 221 |
| 426 | 3300009177 | Ga0105248_10737840 | Ga0105248_107378402 | 221 |
| 427 | 3300009551 | Ga0105238_10154211 | Ga0105238_101542113 | 221 |
| 428 | 3300009551 | Ga0105238_10327984 | Ga0105238_103279842 | 221 |
| 429 | 3300013296 | Ga0157374_10028374 | Ga0157374_100283744 | 221 |
| 430 | 3300013296 | Ga0157374_10467337 | Ga0157374_104673372 | 221 |
| 431 | 3300013297 | Ga0157378_10027081 | Ga0157378_100270814 | 221 |
| 432 | 3300013297 | Ga0157378_10098116 | Ga0157378_100981163 | 221 |
| 433 | 3300013297 | Ga0157378_10405649 | Ga0157378_104056491 | 221 |
| 434 | 3300013297 | Ga0157378_10648580 | Ga0157378_106485802 | 221 |
| 435 | 3300013306 | Ga0163162_10003813 | Ga0163162_100038137 | 221 |
| 436 | 3300013306 | Ga0163162_10006551 | Ga0163162_100065518 | 221 |
| 437 | 3300013306 | Ga0163162_10592216 | Ga0163162_105922162 | 221 |
| 438 | 3300013308 | Ga0157375_10000523 | Ga0157375_100005234 | 221 |
| 439 | 3300013308 | Ga0157375_10000607 | Ga0157375_1000060722 | 221 |
| 440 | 3300013308 | Ga0157375_10237545 | Ga0157375_102375452 | 221 |
| 441 | 3300013308 | Ga0157375_10248564 | Ga0157375_102485643 | 221 |
| 442 | 3300013308 | Ga0157375_10326539 | Ga0157375_103265392 | 221 |
| 443 | 3300013308 | Ga0157375_10621484 | Ga0157375_106214842 | 221 |
| 444 | 3300013308 | Ga0157375_10758953 | Ga0157375_107589532 | 221 |
| 445 | 3300014325 | Ga0163163_10003203 | Ga0163163_1000320318 | 221 |
| 446 | 3300014325 | Ga0163163_10003739 | Ga0163163_100037393 | 221 |
| 447 | 3300014325 | Ga0163163_10037345 | Ga0163163_100373453 | 221 |
| 448 | 3300014325 | Ga0163163_10152621 | Ga0163163_101526212 | 221 |
| 449 | 3300014325 | Ga0163163_10233150 | Ga0163163_102331502 | 221 |
| 450 | 3300014326 | Ga0157380_10089553 | Ga0157380_100895532 | 221 |
| 451 | 3300014745 | Ga0157377_10347620 | Ga0157377_103476202 | 221 |
| 452 | 3300014745 | Ga0157377_10362294 | Ga0157377_103622942 | 221 |
| 453 | 3300014968 | Ga0157379_10000308 | Ga0157379_1000030810 | 221 |
| 454 | 3300014968 | Ga0157379_10003703 | Ga0157379_100037037 | 221 |
| 455 | 3300014968 | Ga0157379_10017731 | Ga0157379_100177314 | 221 |
| 456 | 3300014968 | Ga0157379_10115724 | Ga0157379_101157242 | 221 |
| 457 | 3300014969 | Ga0157376_10067745 | Ga0157376_100677453 | 221 |
| 458 | 3300014969 | Ga0157376_10095257 | Ga0157376_100952573 | 221 |
| 459 | 3300014969 | Ga0157376_10150761 | Ga0157376_101507613 | 221 |
| 460 | 3300014969 | Ga0157376_10197185 | Ga0157376_101971853 | 221 |
| 461 | 3300014969 | Ga0157376_10785521 | Ga0157376_107855212 | 221 |
| 462 | 3300017792 | Ga0163161_10018189 | Ga0163161_100181894 | 221 |
| 463 | 3300017792 | Ga0163161_10219905 | Ga0163161_102199052 | 221 |
| 464 | 3300025900 | Ga0207710_10038119 | Ga0207710_100381193 | 221 |
| 465 | 3300025900 | Ga0207710_10193850 | Ga0207710_101938501 | 221 |
| 466 | 3300025903 | Ga0207680_10040615 | Ga0207680_100406153 | 221 |
| 467 | 3300025903 | Ga0207680_10186226 | Ga0207680_101862262 | 221 |
| 468 | 3300025903 | Ga0207680_10359799 | Ga0207680_103597992 | 221 |
| 469 | 3300025908 | Ga0207643_10086223 | Ga0207643_100862232 | 221 |
| 470 | 3300025908 | Ga0207643_10096580 | Ga0207643_100965802 | 221 |
| 471 | 3300025910 | Ga0207684_10094890 | Ga0207684_100948903 | 221 |
| 472 | 3300025913 | Ga0207695_10094527 | Ga0207695_100945273 | 221 |
| 473 | 3300025913 | Ga0207695_10736730 | Ga0207695_107367302 | 221 |
| 474 | 3300025917 | Ga0207660_10116877 | Ga0207660_101168772 | 221 |
| 475 | 3300025917 | Ga0207660_10590019 | Ga0207660_105900192 | 221 |
| 476 | 3300025918 | Ga0207662_10161644 | Ga0207662_101616443 | 221 |
| 477 | 3300025919 | Ga0207657_10009210 | Ga0207657_100092106 | 221 |
| 478 | 3300025919 | Ga0207657_10525046 | Ga0207657_105250462 | 221 |
| 479 | 3300025920 | Ga0207649_10176585 | Ga0207649_101765852 | 221 |
| 480 | 3300025920 | Ga0207649_10185555 | Ga0207649_101855552 | 221 |
| 481 | 3300025920 | Ga0207649_10201308 | Ga0207649_102013082 | 221 |
| 482 | 3300025922 | Ga0207646_10470276 | Ga0207646_104702762 | 221 |
| 483 | 3300025923 | Ga0207681_10084850 | Ga0207681_100848503 | 221 |
| 484 | 3300025923 | Ga0207681_10310001 | Ga0207681_103100012 | 221 |
| 485 | 3300025923 | Ga0207681_10629340 | Ga0207681_106293402 | 221 |
| 486 | 3300025923 | Ga0207681_10642738 | Ga0207681_106427381 | 221 |
| 487 | 3300025924 | Ga0207694_10238565 | Ga0207694_102385652 | 221 |
| 488 | 3300025925 | Ga0207650_10001879 | Ga0207650_1000187912 | 221 |
| 489 | 3300025925 | Ga0207650_10858264 | Ga0207650_108582641 | 221 |
| 490 | 3300025926 | Ga0207659_10000405 | Ga0207659_1000040520 | 221 |
| 491 | 3300025926 | Ga0207659_10001940 | Ga0207659_100019406 | 221 |
| 492 | 3300025926 | Ga0207659_10015544 | Ga0207659_100155445 | 221 |
| 493 | 3300025926 | Ga0207659_10030594 | Ga0207659_100305944 | 221 |
| 494 | 3300025926 | Ga0207659_10235518 | Ga0207659_102355182 | 221 |
| 495 | 3300025926 | Ga0207659_10764982 | Ga0207659_107649822 | 221 |
| 496 | 3300025927 | Ga0207687_10016186 | Ga0207687_100161863 | 221 |
| 497 | 3300025927 | Ga0207687_10390028 | Ga0207687_103900282 | 221 |
| 498 | 3300025928 | Ga0207700_10054752 | Ga0207700_100547523 | 221 |
| 499 | 3300025929 | Ga0207664_10025522 | Ga0207664_100255225 | 221 |
| 500 | 3300025931 | Ga0207644_10080511 | Ga0207644_100805112 | 221 |
| 501 | 3300025933 | Ga0207706_10044668 | Ga0207706_100446683 | 221 |
| 502 | 3300025934 | Ga0207686_10332757 | Ga0207686_103327572 | 221 |
| 503 | 3300025935 | Ga0207709_10023026 | Ga0207709_100230265 | 221 |
| 504 | 3300025935 | Ga0207709_10355629 | Ga0207709_103556292 | 221 |
| 505 | 3300025936 | Ga0207670_10011480 | Ga0207670_100114802 | 221 |
| 506 | 3300025936 | Ga0207670_10150444 | Ga0207670_101504442 | 221 |
| 507 | 3300025936 | Ga0207670_10167523 | Ga0207670_101675232 | 221 |
| 508 | 3300025936 | Ga0207670_10554196 | Ga0207670_105541962 | 221 |
| 509 | 3300025937 | Ga0207669_10058891 | Ga0207669_100588913 | 221 |
| 510 | 3300025937 | Ga0207669_10290875 | Ga0207669_102908752 | 221 |
| 511 | 3300025937 | Ga0207669_10715961 | Ga0207669_107159611 | 221 |
| 512 | 3300025938 | Ga0207704_10055270 | Ga0207704_100552702 | 221 |
| 513 | 3300025940 | Ga0207691_10024181 | Ga0207691_100241815 | 221 |
| 514 | 3300025940 | Ga0207691_10031394 | Ga0207691_100313944 | 221 |
| 515 | 3300025940 | Ga0207691_10032956 | Ga0207691_100329562 | 221 |
| 516 | 3300025940 | Ga0207691_10112521 | Ga0207691_101125212 | 221 |
| 517 | 3300025940 | Ga0207691_10377575 | Ga0207691_103775752 | 221 |
| 518 | 3300025941 | Ga0207711_10000601 | Ga0207711_100006019 | 221 |
| 519 | 3300025941 | Ga0207711_10006548 | Ga0207711_100065482 | 221 |
| 520 | 3300025941 | Ga0207711_10050135 | Ga0207711_100501355 | 221 |
| 521 | 3300025941 | Ga0207711_10142017 | Ga0207711_101420173 | 221 |
| 522 | 3300025941 | Ga0207711_10169291 | Ga0207711_101692912 | 221 |
| 523 | 3300025941 | Ga0207711_10209838 | Ga0207711_102098382 | 221 |
| 524 | 3300025941 | Ga0207711_10628863 | Ga0207711_106288632 | 221 |
| 525 | 3300025941 | Ga0207711_10649855 | Ga0207711_106498552 | 221 |
| 526 | 3300025941 | Ga0207711_10756446 | Ga0207711_107564461 | 221 |
| 527 | 3300025941 | Ga0207711_10810795 | Ga0207711_108107951 | 221 |
| 528 | 3300025944 | Ga0207661_10037371 | Ga0207661_100373713 | 221 |
| 529 | 3300025949 | Ga0207667_10095180 | Ga0207667_100951804 | 221 |
| 530 | 3300025960 | Ga0207651_10020655 | Ga0207651_100206554 | 221 |
| 531 | 3300025960 | Ga0207651_10107245 | Ga0207651_101072452 | 221 |
| 532 | 3300025960 | Ga0207651_10108365 | Ga0207651_101083653 | 221 |
| 533 | 3300025960 | Ga0207651_10158497 | Ga0207651_101584972 | 221 |
| 534 | 3300025960 | Ga0207651_10610293 | Ga0207651_106102932 | 221 |
| 535 | 3300025960 | Ga0207651_10674730 | Ga0207651_106747302 | 221 |
| 536 | 3300025961 | Ga0207712_10517049 | Ga0207712_105170492 | 221 |
| 537 | 3300025972 | Ga0207668_10057438 | Ga0207668_100574383 | 221 |
| 538 | 3300025972 | Ga0207668_10192356 | Ga0207668_101923562 | 221 |
| 539 | 3300025972 | Ga0207668_10327593 | Ga0207668_103275932 | 221 |
| 540 | 3300025981 | Ga0207640_10719134 | Ga0207640_107191341 | 221 |
| 541 | 3300025986 | Ga0207658_10021141 | Ga0207658_100211413 | 221 |
| 542 | 3300025986 | Ga0207658_10549681 | Ga0207658_105496811 | 221 |
| 543 | 3300026023 | Ga0207677_10008442 | Ga0207677_100084422 | 221 |
| 544 | 3300026023 | Ga0207677_10172137 | Ga0207677_101721373 | 221 |
| 545 | 3300026023 | Ga0207677_10219283 | Ga0207677_102192832 | 221 |
| 546 | 3300026023 | Ga0207677_10591460 | Ga0207677_105914602 | 221 |
| 547 | 3300026035 | Ga0207703_10005935 | Ga0207703_100059355 | 221 |
| 548 | 3300026035 | Ga0207703_10019346 | Ga0207703_100193464 | 221 |
| 549 | 3300026035 | Ga0207703_10047676 | Ga0207703_100476765 | 221 |
| 550 | 3300026035 | Ga0207703_10059758 | Ga0207703_100597584 | 221 |
| 551 | 3300026035 | Ga0207703_10127719 | Ga0207703_101277192 | 221 |
| 552 | 3300026035 | Ga0207703_10151641 | Ga0207703_101516413 | 221 |
| 553 | 3300026035 | Ga0207703_10174423 | Ga0207703_101744232 | 221 |
| 554 | 3300026035 | Ga0207703_10678756 | Ga0207703_106787562 | 221 |
| 555 | 3300026075 | Ga0207708_10095294 | Ga0207708_100952943 | 221 |
| 556 | 3300026088 | Ga0207641_10000618 | Ga0207641_1000061834 | 221 |
| 557 | 3300026088 | Ga0207641_10000931 | Ga0207641_1000093123 | 221 |
| 558 | 3300026088 | Ga0207641_10048663 | Ga0207641_100486634 | 221 |
| 559 | 3300026089 | Ga0207648_10075748 | Ga0207648_100757483 | 221 |
| 560 | 3300026089 | Ga0207648_10111132 | Ga0207648_101111323 | 221 |
| 561 | 3300026095 | Ga0207676_10026350 | Ga0207676_100263504 | 221 |
| 562 | 3300026095 | Ga0207676_10073794 | Ga0207676_100737943 | 221 |
| 563 | 3300026095 | Ga0207676_11084643 | Ga0207676_110846432 | 221 |
| 564 | 3300026118 | Ga0207675_100021398 | Ga0207675_1000213987 | 221 |
| 565 | 3300026118 | Ga0207675_100374348 | Ga0207675_1003743482 | 221 |
| 566 | 3300026121 | Ga0207683_10133515 | Ga0207683_101335152 | 221 |
| 567 | 3300026121 | Ga0207683_10165640 | Ga0207683_101656403 | 221 |
| 568 | 3300026121 | Ga0207683_10946113 | Ga0207683_109461131 | 221 |
| 569 | 3300027907 | Ga0207428_10028634 | Ga0207428_100286343 | 221 |
| 570 | 3300027907 | Ga0207428_10136105 | Ga0207428_101361052 | 221 |
| 571 | 3300028380 | Ga0268265_10025651 | Ga0268265_100256514 | 221 |
| 572 | 3300028380 | Ga0268265_10531489 | Ga0268265_105314891 | 221 |
| 573 | 3300028380 | Ga0268265_10843172 | Ga0268265_108431721 | 221 |
| 574 | 3300028381 | Ga0268264_10128079 | Ga0268264_101280793 | 221 |
| 575 | 3300028381 | Ga0268264_10179759 | Ga0268264_101797593 | 221 |
| 576 | 3300028381 | Ga0268264_10625134 | Ga0268264_106251342 | 221 |
| 577 | 3300031548 | Ga0307408_100586644 | Ga0307408_1005866442 | 221 |
| 578 | 3300031711 | Ga0265314_10025458 | Ga0265314_100254585 | 221 |
| 579 | 3300031711 | Ga0265314_10097387 | Ga0265314_100973872 | 221 |
| 580 | 3300031731 | Ga0307405_10766623 | Ga0307405_107666232 | 221 |
| 581 | 3300031903 | Ga0307407_10424409 | Ga0307407_104244092 | 221 |
| 582 | 3300032002 | Ga0307416_100796024 | Ga0307416_1007960242 | 221 |
| 583 | 3300035085 | Ga0373929_0056283 | Ga0373929_0056283_67_753 | 221 |
| 584 | 3300035086 | Ga0373934_0085491 | Ga0373934_0085491_548_1219 | 221 |
| 585 | 3300035089 | Ga0373944_0033627 | Ga0373944_0033627_418_1098 | 221 |
| 586 | 3300035112 | Ga0373932_0171155 | Ga0373932_0171155_36_731 | 221 |
| 587 | 3300035113 | Ga0373936_0020241 | Ga0373936_0020241_676_1359 | 221 |
| 588 | 3300035116 | Ga0373945_0075372 | Ga0373945_0075372_184_870 | 221 |
| 589 | 3300035118 | Ga0373954_0079879 | Ga0373954_0079879_819_1502 | 221 |
| 590 | 3300035119 | Ga0373956_0027069 | Ga0373956_0027069_829_1500 | 221 |
| 591 | 3300035119 | Ga0373956_0075663 | Ga0373956_0075663_59_742 | 221 |
| 592 | 3300035170 | Ga0373943_0010594 | Ga0373943_0010594_36_719 | 221 |
| 593 | 3300035170 | Ga0373943_0143166 | Ga0373943_0143166_289_975 | 221 |
| 594 | 3300035171 | Ga0373946_0014905 | Ga0373946_0014905_454_1137 | 221 |
| 595 | 3300035172 | Ga0373955_0069320 | Ga0373955_0069320_249_935 | 221 |
| 596 | 3300035172 | Ga0373955_0145717 | Ga0373955_0145717_180_863 | 221 |
| 597 | 3300035241 | Ga0373961_0033559 | Ga0373961_0033559_15_701 | 221 |
| 598 | 3300035410 | Ga0373924_0010465 | Ga0373924_0010465_2424_3107 | 221 |
| 599 | 3300035410 | Ga0373924_0105760 | Ga0373924_0105760_505_1176 | 221 |
| 600 | 3300035692 | Ga0373935_0058187 | Ga0373935_0058187_1316_1999 | 221 |
| 601 | 3300035692 | Ga0373935_0075145 | Ga0373935_0075145_338_1018 | 221 |
| 602 | 3300035695 | Ga0373927_0384829 | Ga0373927_0384829_100_786 | 221 |
| 603 | 3300035724 | Ga0373933_0161036 | Ga0373933_0161036_574_1257 | 221 |
| 604 | 3300035725 | Ga0373947_0145276 | Ga0373947_0145276_81_767 | 221 |
| 605 | 3300036401 | Ga0373937_0018052 | Ga0373937_0018052_2688_3359 | 221 |
| 606 | 3300036401 | Ga0373937_0037227 | Ga0373937_0037227_923_1606 | 221 |
| 607 | 3300036401 | Ga0373937_0051703 | Ga0373937_0051703_2355_3041 | 221 |
| 608 | 3300036401 | Ga0373937_1167659 | Ga0373937_1167659_24_704 | 221 |
| 609 | 3300037068 | Ga0373925_0004526 | Ga0373925_0004526_6222_6905 | 221 |
| 610 | 3300037068 | Ga0373925_0107399 | Ga0373925_0107399_722_1405 | 221 |
| 611 | 3300037068 | Ga0373925_0143287 | Ga0373925_0143287_581_1261 | 221 |
| 612 | 3300037068 | Ga0373925_0205364 | Ga0373925_0205364_816_1502 | 221 |
| 613 | 3300037068 | Ga0373925_0246977 | Ga0373925_0246977_264_950 | 221 |
| 614 | 3300042015 | Ga0439462_0010325 | Ga0439462_0010325_366_1040 | 221 |
| 615 | 3300042156 | Ga0439446_0010878 | Ga0439446_0010878_1527_2201 | 221 |
| 616 | 3300045051 | Ga0451576_0082457 | Ga0451576_0082457_2017_2706 | 221 |
| 617 | 3300045051 | Ga0451576_1185863 | Ga0451576_1185863_38_721 | 221 |
| 618 | 3300046454 | Ga0495592_0005092 | Ga0495592_0005092_661_1344 | 221 |
| 619 | 3300046454 | Ga0495592_0039393 | Ga0495592_0039393_1117_1800 | 221 |
| 620 | 3300046454 | Ga0495592_0223442 | Ga0495592_0223442_91_762 | 221 |
| 621 | 3300046455 | Ga0495603_0319125 | Ga0495603_0319125_151_837 | 221 |
| 622 | 3300046459 | Ga0495629_0058559 | Ga0495629_0058559_720_1397 | 221 |
| 623 | 3300046459 | Ga0495629_0132393 | Ga0495629_0132393_713_1399 | 221 |
| 624 | 3300046462 | Ga0495651_0111619 | Ga0495651_0111619_467_1153 | 221 |
| 625 | 3300046463 | Ga0495653_0190698 | Ga0495653_0190698_357_1028 | 221 |
| 626 | 3300046472 | Ga0495580_0388141 | Ga0495580_0388141_205_888 | 221 |
| 627 | 3300046473 | Ga0495582_0061536 | Ga0495582_0061536_814_1491 | 221 |
| 628 | 3300046477 | Ga0495664_0177225 | Ga0495664_0177225_154_840 | 221 |
| 629 | 3300046511 | Ga0495608_0007525 | Ga0495608_0007525_966_1649 | 221 |
| 630 | 3300046511 | Ga0495608_0092718 | Ga0495608_0092718_309_995 | 221 |
| 631 | 3300046514 | Ga0495618_0221369 | Ga0495618_0221369_481_1152 | 221 |
| 632 | 3300046516 | Ga0495628_0197877 | Ga0495628_0197877_76_747 | 221 |
| 633 | 3300046517 | Ga0495630_0008326 | Ga0495630_0008326_4176_4859 | 221 |
| 634 | 3300046517 | Ga0495630_0036510 | Ga0495630_0036510_1306_1992 | 221 |
| 635 | 3300046517 | Ga0495630_0097400 | Ga0495630_0097400_1165_1845 | 221 |
| 636 | 3300046533 | Ga0495640_0109196 | Ga0495640_0109196_837_1523 | 221 |
| 637 | 3300046535 | Ga0495586_0039319 | Ga0495586_0039319_795_1478 | 221 |
| 638 | 3300046536 | Ga0495587_0116698 | Ga0495587_0116698_266_949 | 221 |
| 639 | 3300046539 | Ga0495621_0009004 | Ga0495621_0009004_2143_2814 | 221 |
| 640 | 3300046543 | Ga0495645_0013479 | Ga0495645_0013479_2336_3007 | 221 |
| 641 | 3300046543 | Ga0495645_0015615 | Ga0495645_0015615_2841_3524 | 221 |
| 642 | 3300046642 | Ga0495634_0044133 | Ga0495634_0044133_1602_2285 | 221 |
| 643 | 3300046642 | Ga0495634_0045756 | Ga0495634_0045756_1729_2412 | 221 |
| 644 | 3300046642 | Ga0495634_0174840 | Ga0495634_0174840_238_924 | 221 |
| 645 | 3300046663 | Ga0495635_0234419 | Ga0495635_0234419_253_936 | 221 |
| 646 | 3300046663 | Ga0495635_0304722 | Ga0495635_0304722_99_785 | 221 |
| 647 | 3300046678 | Ga0495599_0024841 | Ga0495599_0024841_963_1646 | 221 |
| 648 | 3300046678 | Ga0495599_0057269 | Ga0495599_0057269_1408_2091 | 221 |
| 649 | 3300046678 | Ga0495599_0106541 | Ga0495599_0106541_1014_1700 | 221 |
| 650 | 3300046678 | Ga0495599_0196586 | Ga0495599_0196586_102_788 | 221 |
| 651 | 3300046679 | Ga0495623_0060575 | Ga0495623_0060575_809_1492 | 221 |
| 652 | 3300046681 | Ga0495647_0037525 | Ga0495647_0037525_392_1078 | 221 |
| 653 | 3300046681 | Ga0495647_0152718 | Ga0495647_0152718_138_821 | 221 |
| 654 | 3300046683 | Ga0495658_0076337 | Ga0495658_0076337_497_1174 | 221 |
| 655 | 3300046683 | Ga0495658_0287906 | Ga0495658_0287906_239_916 | 221 |
| 656 | 3300046684 | Ga0495669_0003252 | Ga0495669_0003252_5772_6455 | 221 |
| 657 | 3300046684 | Ga0495669_0112128 | Ga0495669_0112128_586_1257 | 221 |
| 658 | 3300046689 | Ga0495613_0028263 | Ga0495613_0028263_3433_4116 | 221 |
| 659 | 3300046689 | Ga0495613_0500560 | Ga0495613_0500560_66_746 | 221 |
| 660 | 3300046694 | Ga0495649_0202299 | Ga0495649_0202299_151_831 | 221 |
| 661 | 3300047317 | Ga0495604_0037493 | Ga0495604_0037493_2539_3225 | 221 |
| 662 | 3300047317 | Ga0495604_0215550 | Ga0495604_0215550_63_734 | 221 |
| 663 | 3300047319 | Ga0495674_0002541 | Ga0495674_0002541_9640_10323 | 221 |
| 664 | 3300047319 | Ga0495674_0121031 | Ga0495674_0121031_593_1264 | 221 |
| 665 | 3300047319 | Ga0495674_0417646 | Ga0495674_0417646_381_1064 | 221 |
| 666 | 3300047444 | Ga0495675_0129063 | Ga0495675_0129063_27_710 | 221 |
| 667 | 3300047444 | Ga0495675_0192007 | Ga0495675_0192007_53_736 | 221 |
| 668 | 3300047471 | Ga0495684_0000483 | Ga0495684_0000483_24096_24779 | 221 |
| 669 | 3300047471 | Ga0495684_0071397 | Ga0495684_0071397_745_1416 | 221 |
| 670 | 3300047471 | Ga0495684_0191703 | Ga0495684_0191703_750_1433 | 221 |
| 671 | 3300048904 | Ga0496101_0004437 | Ga0496101_0004437_2075_2758 | 221 |
| 672 | 3300048907 | Ga0496104_0006222 | Ga0496104_0006222_8358_9041 | 221 |
| 673 | 3300048907 | Ga0496104_0130690 | Ga0496104_0130690_928_1602 | 221 |
| 674 | 3300048907 | Ga0496104_0204704 | Ga0496104_0204704_399_1082 | 221 |
| 675 | 3300048907 | Ga0496104_0333470 | Ga0496104_0333470_487_1164 | 221 |
| 676 | 3300048908 | Ga0496105_0065877 | Ga0496105_0065877_1247_1930 | 221 |
| 677 | 3300048909 | Ga0496106_0080166 | Ga0496106_0080166_214_900 | 221 |
| 678 | 3300048912 | Ga0496109_0107745 | Ga0496109_0107745_1747_2433 | 221 |
| 679 | 3300048913 | Ga0496110_0034737 | Ga0496110_0034737_3436_4122 | 221 |
| 680 | 3300048913 | Ga0496110_0405177 | Ga0496110_0405177_397_1080 | 221 |
| 681 | 3300048915 | Ga0496112_0144982 | Ga0496112_0144982_859_1548 | 221 |
| 682 | 3300048915 | Ga0496112_1029679 | Ga0496112_1029679_27_713 | 221 |
| 683 | 3300048917 | Ga0496114_0000323 | Ga0496114_0000323_24466_25149 | 221 |
| 684 | 3300048917 | Ga0496114_0456467 | Ga0496114_0456467_375_1058 | 221 |
| 685 | 3300049571 | Ga0501034_0411366 | Ga0501034_0411366_11_697 | 221 |
| 686 | 3300049577 | Ga0501041_0195566 | Ga0501041_0195566_125_796 | 221 |
| 687 | 3300049584 | Ga0501068_0303689 | Ga0501068_0303689_174_863 | 221 |
| 688 | 3300049741 | Ga0501079_0340037 | Ga0501079_0340037_59_733 | 221 |
| 689 | 3300050489 | nmdc:mga03683_41612_c1 | nmdc:mga03683_41612_c1_1011_1694 | 221 |
| 690 | 3300050491 | nmdc:mga00v17_41723_c1 | nmdc:mga00v17_41723_c1_685_1368 | 221 |
| 691 | 3300050493 | nmdc:mga0k408_5006_c1 | nmdc:mga0k408_5006_c1_3628_4311 | 221 |
| 692 | 3300050494 | nmdc:mga06z11_10949_c1 | nmdc:mga06z11_10949_c1_2481_3164 | 221 |
| 693 | 3300050507 | nmdc:mga05p37_107236_c1 | nmdc:mga05p37_107236_c1_224_910 | 221 |
| 694 | 3300050507 | nmdc:mga05p37_214936_c1 | nmdc:mga05p37_214936_c1_660_1355 | 221 |
| 695 | 3300050507 | nmdc:mga05p37_216724_c1 | nmdc:mga05p37_216724_c1_846_1526 | 221 |
| 696 | 3300050507 | nmdc:mga05p37_21703_c1 | nmdc:mga05p37_21703_c1_891_1577 | 221 |
| 697 | 3300050507 | nmdc:mga05p37_220104_c1 | nmdc:mga05p37_220104_c1_414_1097 | 221 |
| 698 | 3300050507 | nmdc:mga05p37_250891_c1 | nmdc:mga05p37_250891_c1_419_1105 | 221 |
| 699 | 3300050507 | nmdc:mga05p37_54488_c1 | nmdc:mga05p37_54488_c1_892_1575 | 221 |
| 700 | 3300050507 | nmdc:mga05p37_95715_c1 | nmdc:mga05p37_95715_c1_238_921 | 221 |
| 701 | 3300050508 | nmdc:mga09592_128695_c1 | nmdc:mga09592_128695_c1_619_1296 | 221 |
| 702 | 3300050510 | nmdc:mga06r32_84115_c1 | nmdc:mga06r32_84115_c1_2045_2731 | 221 |
| 703 | 3300050511 | nmdc:mga08y16_2315_c1 | nmdc:mga08y16_2315_c1_17116_17799 | 221 |
| 704 | 3300050511 | nmdc:mga08y16_825935_c1 | nmdc:mga08y16_825935_c1_168_854 | 221 |
| 705 | 3300050512 | nmdc:mga0n895_10073_c1 | nmdc:mga0n895_10073_c1_6822_7505 | 221 |
| 706 | 3300050512 | nmdc:mga0n895_391216_c1 | nmdc:mga0n895_391216_c1_597_1283 | 221 |
| 707 | 3300050512 | nmdc:mga0n895_46964_c1 | nmdc:mga0n895_46964_c1_415_1110 | 221 |
| 708 | 3300050513 | nmdc:mga0rr50_12374_c1 | nmdc:mga0rr50_12374_c1_2245_2934 | 221 |
| 709 | 3300050514 | nmdc:mga08x19_585880_c1 | nmdc:mga08x19_585880_c1_23_712 | 221 |
| 710 | 3300050515 | nmdc:mga0a205_198400_c1 | nmdc:mga0a205_198400_c1_554_1249 | 221 |
| 711 | 3300050515 | nmdc:mga0a205_211576_c1 | nmdc:mga0a205_211576_c1_415_1092 | 221 |
| 712 | 3300050515 | nmdc:mga0a205_54635_c1 | nmdc:mga0a205_54635_c1_522_1205 | 221 |
| 713 | 3300050515 | nmdc:mga0a205_85489_c1 | nmdc:mga0a205_85489_c1_318_1004 | 221 |
| 714 | 3300053085 | Ga0495619_0005642 | Ga0495619_0005642_5698_6381 | 221 |
| 715 | 3300053085 | Ga0495619_0025745 | Ga0495619_0025745_2207_2878 | 221 |
| 716 | 3300053085 | Ga0495619_0062239 | Ga0495619_0062239_1207_1893 | 221 |
| 717 | 3300053085 | Ga0495619_0584314 | Ga0495619_0584314_48_728 | 221 |
| 718 | 3300053104 | Ga0500556_0026638 | Ga0500556_0026638_441_1130 | 221 |
| 719 | 3300054114 | Ga0501084_0460448 | Ga0501084_0460448_298_984 | 221 |
| 720 | 3300060353 | Ga0501082_1033112 | Ga0501082_1033112_27_701 | 221 |
| 721 | 3300005295 | Ga0065707_10247017 | Ga0065707_102470172 | 222 |
| 722 | 3300005331 | Ga0070670_100221775 | Ga0070670_1002217752 | 222 |
| 723 | 3300005354 | Ga0070675_100088378 | Ga0070675_1000883784 | 222 |
| 724 | 3300005365 | Ga0070688_100230898 | Ga0070688_1002308981 | 222 |
| 725 | 3300005444 | Ga0070694_100178088 | Ga0070694_1001780881 | 222 |
| 726 | 3300005577 | Ga0068857_100089334 | Ga0068857_1000893342 | 222 |
| 727 | 3300005844 | Ga0068862_100378337 | Ga0068862_1003783372 | 222 |
| 728 | 3300006844 | Ga0075428_100005405 | Ga0075428_1000054055 | 222 |
| 729 | 3300006852 | Ga0075433_10147317 | Ga0075433_101473173 | 222 |
| 730 | 3300006871 | Ga0075434_100013008 | Ga0075434_1000130088 | 222 |
| 731 | 3300006880 | Ga0075429_100067883 | Ga0075429_1000678833 | 222 |
| 732 | 3300009094 | Ga0111539_10082243 | Ga0111539_100822432 | 222 |
| 733 | 3300009147 | Ga0114129_10014262 | Ga0114129_100142628 | 222 |
| 734 | 3300009147 | Ga0114129_10061382 | Ga0114129_100613822 | 222 |
| 735 | 3300013297 | Ga0157378_10085486 | Ga0157378_100854864 | 222 |
| 736 | 3300013308 | Ga0157375_10341652 | Ga0157375_103416523 | 222 |
| 737 | 3300025926 | Ga0207659_10038417 | Ga0207659_100384173 | 222 |
| 738 | 3300025942 | Ga0207689_10105182 | Ga0207689_101051823 | 222 |
| 739 | 3300035691 | Ga0373931_0280311 | Ga0373931_0280311_148_834 | 222 |
| 740 | 3300045051 | Ga0451576_0675770 | Ga0451576_0675770_30_716 | 222 |
| 741 | 3300046455 | Ga0495603_0016614 | Ga0495603_0016614_2016_2705 | 222 |
| 742 | 3300046455 | Ga0495603_0042338 | Ga0495603_0042338_1545_2222 | 222 |
| 743 | 3300046459 | Ga0495629_0010215 | Ga0495629_0010215_2187_2876 | 222 |
| 744 | 3300046473 | Ga0495582_0200025 | Ga0495582_0200025_180_857 | 222 |
| 745 | 3300046499 | Ga0495594_0004637 | Ga0495594_0004637_3618_4295 | 222 |
| 746 | 3300046499 | Ga0495594_0014029 | Ga0495594_0014029_899_1588 | 222 |
| 747 | 3300046523 | Ga0495644_0037590 | Ga0495644_0037590_863_1549 | 222 |
| 748 | 3300046528 | Ga0495642_0096140 | Ga0495642_0096140_150_836 | 222 |
| 749 | 3300046539 | Ga0495621_0026434 | Ga0495621_0026434_871_1557 | 222 |
| 750 | 3300046664 | Ga0495659_0048190 | Ga0495659_0048190_547_1233 | 222 |
| 751 | 3300046674 | Ga0495588_0008824 | Ga0495588_0008824_830_1507 | 222 |
| 752 | 3300046674 | Ga0495588_0295183 | Ga0495588_0295183_108_794 | 222 |
| 753 | 3300046684 | Ga0495669_0013479 | Ga0495669_0013479_2014_2700 | 222 |
| 754 | 3300047315 | Ga0495581_0363829 | Ga0495581_0363829_27_716 | 222 |
| 755 | 3300047321 | Ga0495676_0064474 | Ga0495676_0064474_279_968 | 222 |
| 756 | 3300047445 | Ga0495677_0051702 | Ga0495677_0051702_460_1146 | 222 |
| 757 | 3300049573 | Ga0501037_0321111 | Ga0501037_0321111_353_1057 | 222 |
| 758 | 3300049575 | Ga0501039_0527312 | Ga0501039_0527312_61_729 | 222 |
| 759 | 3300049578 | Ga0501042_0035523 | Ga0501042_0035523_1505_2209 | 222 |
| 760 | 3300049580 | Ga0501046_0422051 | Ga0501046_0422051_142_846 | 222 |
| 761 | 3300049583 | Ga0501067_0032662 | Ga0501067_0032662_2158_2844 | 222 |
| 762 | 3300049587 | Ga0501071_0025277 | Ga0501071_0025277_1580_2284 | 222 |
| 763 | 3300049824 | Ga0501045_0075531 | Ga0501045_0075531_247_951 | 222 |
| 764 | 3300050507 | nmdc:mga05p37_50178_c1 | nmdc:mga05p37_50178_c1_4244_4930 | 222 |
| 765 | 3300050507 | nmdc:mga05p37_729_c1 | nmdc:mga05p37_729_c1_11238_11924 | 222 |
| 766 | 3300050508 | nmdc:mga09592_64647_c1 | nmdc:mga09592_64647_c1_821_1507 | 222 |
| 767 | 3300050512 | nmdc:mga0n895_44088_c1 | nmdc:mga0n895_44088_c1_793_1479 | 222 |
| 768 | 3300050515 | nmdc:mga0a205_44111_c1 | nmdc:mga0a205_44111_c1_2159_2845 | 222 |
| 769 | 3300053084 | Ga0495595_0022962 | Ga0495595_0022962_2031_2717 | 222 |
| 770 | 3300059421 | Ga0590071_000262 | Ga0590071_000262_6690_7373 | 222 |
| 771 | 3300059423 | Ga0590074_002317 | Ga0590074_002317_296_979 | 222 |
| 772 | 3300059426 | Ga0590077_000100 | Ga0590077_000100_14606_15289 | 222 |
| 773 | 3300005343 | Ga0070687_100043478 | Ga0070687_1000434784 | 223 |
| 774 | 3300006175 | Ga0070712_100177525 | Ga0070712_1001775252 | 223 |
| 775 | 3300025915 | Ga0207693_10141578 | Ga0207693_101415783 | 223 |
| 776 | 3300032002 | Ga0307416_100926214 | Ga0307416_1009262142 | 223 |
| 777 | 3300044712 | Ga0453684_0006396 | Ga0453684_0006396_4606_5361 | 223 |
| 778 | 3300045051 | Ga0451576_0004289 | Ga0451576_0004289_14385_15140 | 223 |
| 779 | 3300005331 | Ga0070670_100451704 | Ga0070670_1004517042 | 224 |
| 780 | 3300005367 | Ga0070667_100270639 | Ga0070667_1002706392 | 224 |
| 781 | 3300009177 | Ga0105248_10023875 | Ga0105248_100238758 | 224 |
| 782 | 3300014325 | Ga0163163_10010757 | Ga0163163_100107578 | 224 |
| 783 | 3300025986 | Ga0207658_10328460 | Ga0207658_103284602 | 224 |
| 784 | 3300005288 | Ga0065714_10016598 | Ga0065714_100165983 | 225 |
| 785 | 3300005293 | Ga0065715_10092637 | Ga0065715_100926373 | 225 |
| 786 | 3300005330 | Ga0070690_100060755 | Ga0070690_1000607553 | 225 |
| 787 | 3300005331 | Ga0070670_100052051 | Ga0070670_1000520512 | 225 |
| 788 | 3300005335 | Ga0070666_10441666 | Ga0070666_104416661 | 225 |
| 789 | 3300005336 | Ga0070680_100083699 | Ga0070680_1000836994 | 225 |
| 790 | 3300005340 | Ga0070689_100017529 | Ga0070689_1000175294 | 225 |
| 791 | 3300005343 | Ga0070687_100018229 | Ga0070687_1000182294 | 225 |
| 792 | 3300005344 | Ga0070661_100226572 | Ga0070661_1002265722 | 225 |
| 793 | 3300005347 | Ga0070668_100038946 | Ga0070668_1000389465 | 225 |
| 794 | 3300005347 | Ga0070668_100301093 | Ga0070668_1003010932 | 225 |
| 795 | 3300005354 | Ga0070675_100021490 | Ga0070675_1000214906 | 225 |
| 796 | 3300005356 | Ga0070674_100800288 | Ga0070674_1008002881 | 225 |
| 797 | 3300005364 | Ga0070673_100003445 | Ga0070673_1000034459 | 225 |
| 798 | 3300005364 | Ga0070673_100187414 | Ga0070673_1001874142 | 225 |
| 799 | 3300005365 | Ga0070688_100165312 | Ga0070688_1001653122 | 225 |
| 800 | 3300005438 | Ga0070701_10009450 | Ga0070701_100094506 | 225 |
| 801 | 3300005455 | Ga0070663_100645124 | Ga0070663_1006451241 | 225 |
| 802 | 3300005543 | Ga0070672_100010401 | Ga0070672_1000104014 | 225 |
| 803 | 3300005543 | Ga0070672_100022168 | Ga0070672_1000221682 | 225 |
| 804 | 3300005544 | Ga0070686_100046799 | Ga0070686_1000467994 | 225 |
| 805 | 3300005549 | Ga0070704_100324958 | Ga0070704_1003249582 | 225 |
| 806 | 3300005564 | Ga0070664_100004803 | Ga0070664_10000480315 | 225 |
| 807 | 3300005577 | Ga0068857_100076900 | Ga0068857_1000769003 | 225 |
| 808 | 3300005617 | Ga0068859_100025103 | Ga0068859_1000251032 | 225 |
| 809 | 3300005618 | Ga0068864_100029816 | Ga0068864_1000298162 | 225 |
| 810 | 3300005719 | Ga0068861_100620563 | Ga0068861_1006205631 | 225 |
| 811 | 3300005841 | Ga0068863_100246010 | Ga0068863_1002460103 | 225 |
| 812 | 3300005842 | Ga0068858_100128931 | Ga0068858_1001289312 | 225 |
| 813 | 3300005985 | Ga0081539_10083995 | Ga0081539_100839952 | 225 |
| 814 | 3300006844 | Ga0075428_100003630 | Ga0075428_10000363011 | 225 |
| 815 | 3300006847 | Ga0075431_100052971 | Ga0075431_1000529715 | 225 |
| 816 | 3300006880 | Ga0075429_100033446 | Ga0075429_1000334464 | 225 |
| 817 | 3300006931 | Ga0097620_100025103 | Ga0097620_1000251032 | 225 |
| 818 | 3300009094 | Ga0111539_10006812 | Ga0111539_100068127 | 225 |
| 819 | 3300009553 | Ga0105249_10121430 | Ga0105249_101214303 | 225 |
| 820 | 3300013308 | Ga0157375_10133588 | Ga0157375_101335883 | 225 |
| 821 | 3300013308 | Ga0157375_10227177 | Ga0157375_102271772 | 225 |
| 822 | 3300014325 | Ga0163163_10005951 | Ga0163163_100059517 | 225 |
| 823 | 3300025918 | Ga0207662_10043190 | Ga0207662_100431902 | 225 |
| 824 | 3300025920 | Ga0207649_10233012 | Ga0207649_102330122 | 225 |
| 825 | 3300025923 | Ga0207681_10053906 | Ga0207681_100539063 | 225 |
| 826 | 3300025923 | Ga0207681_10220250 | Ga0207681_102202502 | 225 |
| 827 | 3300025925 | Ga0207650_10032843 | Ga0207650_100328435 | 225 |
| 828 | 3300025926 | Ga0207659_10000879 | Ga0207659_1000087912 | 225 |
| 829 | 3300025926 | Ga0207659_10043655 | Ga0207659_100436552 | 225 |
| 830 | 3300025937 | Ga0207669_10478815 | Ga0207669_104788152 | 225 |
| 831 | 3300025940 | Ga0207691_10003124 | Ga0207691_1000312410 | 225 |
| 832 | 3300025940 | Ga0207691_10027787 | Ga0207691_100277873 | 225 |
| 833 | 3300025945 | Ga0207679_10701809 | Ga0207679_107018092 | 225 |
| 834 | 3300025960 | Ga0207651_10000566 | Ga0207651_1000056612 | 225 |
| 835 | 3300025960 | Ga0207651_10004402 | Ga0207651_100044029 | 225 |
| 836 | 3300025961 | Ga0207712_10593420 | Ga0207712_105934202 | 225 |
| 837 | 3300025972 | Ga0207668_10348069 | Ga0207668_103480691 | 225 |
| 838 | 3300026035 | Ga0207703_10089187 | Ga0207703_100891873 | 225 |
| 839 | 3300026095 | Ga0207676_10010580 | Ga0207676_100105806 | 225 |
| 840 | 3300026116 | Ga0207674_10357320 | Ga0207674_103573202 | 225 |
| 841 | 3300026118 | Ga0207675_100337815 | Ga0207675_1003378152 | 225 |
| 842 | 3300026121 | Ga0207683_10713402 | Ga0207683_107134022 | 225 |
| 843 | 3300028380 | Ga0268265_10904431 | Ga0268265_109044312 | 225 |
| 844 | 3300028380 | Ga0268265_10973554 | Ga0268265_109735541 | 225 |
| 845 | 3300042435 | Ga0439434_0033992 | Ga0439434_0033992_113_811 | 225 |
| 846 | 3300042436 | Ga0439435_0001998 | Ga0439435_0001998_1729_2418 | 225 |
| 847 | 3300042530 | Ga0450916_004616 | Ga0450916_004616_842_1531 | 225 |
| 848 | 3300046539 | Ga0495621_0011882 | Ga0495621_0011882_854_1543 | 225 |
| 849 | 3300050508 | nmdc:mga09592_31693_c1 | nmdc:mga09592_31693_c1_1502_2191 | 225 |
| 850 | 3300050509 | nmdc:mga0qj67_33079_c1 | nmdc:mga0qj67_33079_c1_666_1355 | 225 |
| 851 | 3300050510 | nmdc:mga06r32_95431_c1 | nmdc:mga06r32_95431_c1_189_878 | 225 |
| 852 | 3300050511 | nmdc:mga08y16_10686_c1 | nmdc:mga08y16_10686_c1_5153_5842 | 225 |
| 853 | 3300001977 | JGI24746J21847_1002904 | JGI24746J21847_10029044 | 226 |
| 854 | 3300005290 | Ga0065712_10254537 | Ga0065712_102545371 | 226 |
| 855 | 3300005293 | Ga0065715_10008301 | Ga0065715_100083014 | 226 |
| 856 | 3300005328 | Ga0070676_10023420 | Ga0070676_100234202 | 226 |
| 857 | 3300005330 | Ga0070690_100000943 | Ga0070690_10000094311 | 226 |
| 858 | 3300005331 | Ga0070670_100013235 | Ga0070670_1000132359 | 226 |
| 859 | 3300005331 | Ga0070670_100362902 | Ga0070670_1003629022 | 226 |
| 860 | 3300005333 | Ga0070677_10042130 | Ga0070677_100421303 | 226 |
| 861 | 3300005334 | Ga0068869_100007243 | Ga0068869_1000072432 | 226 |
| 862 | 3300005334 | Ga0068869_100260137 | Ga0068869_1002601372 | 226 |
| 863 | 3300005335 | Ga0070666_10007711 | Ga0070666_100077117 | 226 |
| 864 | 3300005337 | Ga0070682_100239653 | Ga0070682_1002396532 | 226 |
| 865 | 3300005338 | Ga0068868_100031591 | Ga0068868_1000315913 | 226 |
| 866 | 3300005340 | Ga0070689_100037769 | Ga0070689_1000377694 | 226 |
| 867 | 3300005343 | Ga0070687_100006731 | Ga0070687_1000067313 | 226 |
| 868 | 3300005353 | Ga0070669_100000985 | Ga0070669_1000009857 | 226 |
| 869 | 3300005353 | Ga0070669_100235214 | Ga0070669_1002352142 | 226 |
| 870 | 3300005353 | Ga0070669_100306722 | Ga0070669_1003067222 | 226 |
| 871 | 3300005355 | Ga0070671_100065589 | Ga0070671_1000655894 | 226 |
| 872 | 3300005355 | Ga0070671_100145702 | Ga0070671_1001457023 | 226 |
| 873 | 3300005356 | Ga0070674_100000190 | Ga0070674_10000019018 | 226 |
| 874 | 3300005356 | Ga0070674_100160095 | Ga0070674_1001600953 | 226 |
| 875 | 3300005356 | Ga0070674_100619684 | Ga0070674_1006196841 | 226 |
| 876 | 3300005364 | Ga0070673_100003602 | Ga0070673_1000036022 | 226 |
| 877 | 3300005364 | Ga0070673_100065517 | Ga0070673_1000655174 | 226 |
| 878 | 3300005365 | Ga0070688_100121019 | Ga0070688_1001210192 | 226 |
| 879 | 3300005367 | Ga0070667_100013074 | Ga0070667_1000130741 | 226 |
| 880 | 3300005367 | Ga0070667_100367528 | Ga0070667_1003675282 | 226 |
| 881 | 3300005438 | Ga0070701_10098892 | Ga0070701_100988922 | 226 |
| 882 | 3300005441 | Ga0070700_100073372 | Ga0070700_1000733722 | 226 |
| 883 | 3300005455 | Ga0070663_100089689 | Ga0070663_1000896892 | 226 |
| 884 | 3300005456 | Ga0070678_100048372 | Ga0070678_1000483724 | 226 |
| 885 | 3300005457 | Ga0070662_100079620 | Ga0070662_1000796203 | 226 |
| 886 | 3300005459 | Ga0068867_100078107 | Ga0068867_1000781074 | 226 |
| 887 | 3300005466 | Ga0070685_10012576 | Ga0070685_100125763 | 226 |
| 888 | 3300005543 | Ga0070672_100001431 | Ga0070672_1000014317 | 226 |
| 889 | 3300005544 | Ga0070686_100008639 | Ga0070686_1000086394 | 226 |
| 890 | 3300005548 | Ga0070665_100025393 | Ga0070665_1000253937 | 226 |
| 891 | 3300005564 | Ga0070664_100002638 | Ga0070664_1000026384 | 226 |
| 892 | 3300005615 | Ga0070702_100080525 | Ga0070702_1000805252 | 226 |
| 893 | 3300005615 | Ga0070702_100353747 | Ga0070702_1003537471 | 226 |
| 894 | 3300005616 | Ga0068852_100091207 | Ga0068852_1000912073 | 226 |
| 895 | 3300005617 | Ga0068859_100018494 | Ga0068859_1000184947 | 226 |
| 896 | 3300005617 | Ga0068859_100062510 | Ga0068859_1000625102 | 226 |
| 897 | 3300005618 | Ga0068864_100083484 | Ga0068864_1000834843 | 226 |
| 898 | 3300005618 | Ga0068864_100708844 | Ga0068864_1007088441 | 226 |
| 899 | 3300005719 | Ga0068861_100058288 | Ga0068861_1000582884 | 226 |
| 900 | 3300005840 | Ga0068870_10004169 | Ga0068870_100041693 | 226 |
| 901 | 3300005840 | Ga0068870_10032396 | Ga0068870_100323963 | 226 |
| 902 | 3300005840 | Ga0068870_10087975 | Ga0068870_100879752 | 226 |
| 903 | 3300005841 | Ga0068863_100032658 | Ga0068863_1000326582 | 226 |
| 904 | 3300005842 | Ga0068858_100072713 | Ga0068858_1000727134 | 226 |
| 905 | 3300005843 | Ga0068860_100003450 | Ga0068860_10000345016 | 226 |
| 906 | 3300005844 | Ga0068862_100002759 | Ga0068862_1000027597 | 226 |
| 907 | 3300005844 | Ga0068862_100220673 | Ga0068862_1002206732 | 226 |
| 908 | 3300006058 | Ga0075432_10073402 | Ga0075432_100734022 | 226 |
| 909 | 3300006237 | Ga0097621_100028961 | Ga0097621_1000289612 | 226 |
| 910 | 3300006844 | Ga0075428_100008496 | Ga0075428_1000084967 | 226 |
| 911 | 3300006844 | Ga0075428_100209540 | Ga0075428_1002095403 | 226 |
| 912 | 3300006844 | Ga0075428_100418309 | Ga0075428_1004183092 | 226 |
| 913 | 3300006846 | Ga0075430_100010732 | Ga0075430_1000107324 | 226 |
| 914 | 3300006846 | Ga0075430_100054986 | Ga0075430_1000549862 | 226 |
| 915 | 3300006846 | Ga0075430_100064364 | Ga0075430_1000643641 | 226 |
| 916 | 3300006846 | Ga0075430_100121177 | Ga0075430_1001211773 | 226 |
| 917 | 3300006847 | Ga0075431_100000524 | Ga0075431_1000005243 | 226 |
| 918 | 3300006847 | Ga0075431_100003017 | Ga0075431_1000030177 | 226 |
| 919 | 3300006847 | Ga0075431_100223912 | Ga0075431_1002239123 | 226 |
| 920 | 3300006847 | Ga0075431_100595534 | Ga0075431_1005955342 | 226 |
| 921 | 3300006852 | Ga0075433_10002292 | Ga0075433_100022928 | 226 |
| 922 | 3300006852 | Ga0075433_10444371 | Ga0075433_104443712 | 226 |
| 923 | 3300006871 | Ga0075434_100066260 | Ga0075434_1000662602 | 226 |
| 924 | 3300006880 | Ga0075429_100004361 | Ga0075429_1000043617 | 226 |
| 925 | 3300006880 | Ga0075429_100077293 | Ga0075429_1000772932 | 226 |
| 926 | 3300006881 | Ga0068865_100108538 | Ga0068865_1001085382 | 226 |
| 927 | 3300006931 | Ga0097620_100018493 | Ga0097620_1000184937 | 226 |
| 928 | 3300006931 | Ga0097620_100062512 | Ga0097620_1000625122 | 226 |
| 929 | 3300007076 | Ga0075435_100028075 | Ga0075435_1000280757 | 226 |
| 930 | 3300009094 | Ga0111539_10014033 | Ga0111539_100140337 | 226 |
| 931 | 3300009094 | Ga0111539_10026148 | Ga0111539_100261488 | 226 |
| 932 | 3300009098 | Ga0105245_10266303 | Ga0105245_102663033 | 226 |
| 933 | 3300009147 | Ga0114129_10150493 | Ga0114129_101504933 | 226 |
| 934 | 3300009147 | Ga0114129_10205768 | Ga0114129_102057683 | 226 |
| 935 | 3300009177 | Ga0105248_10093447 | Ga0105248_100934474 | 226 |
| 936 | 3300009553 | Ga0105249_10000849 | Ga0105249_1000084931 | 226 |
| 937 | 3300009553 | Ga0105249_10290333 | Ga0105249_102903332 | 226 |
| 938 | 3300012508 | Ga0157315_1000725 | Ga0157315_10007252 | 226 |
| 939 | 3300013296 | Ga0157374_10417870 | Ga0157374_104178702 | 226 |
| 940 | 3300013306 | Ga0163162_10003531 | Ga0163162_1000353113 | 226 |
| 941 | 3300013308 | Ga0157375_10017168 | Ga0157375_100171682 | 226 |
| 942 | 3300013308 | Ga0157375_10247886 | Ga0157375_102478862 | 226 |
| 943 | 3300014326 | Ga0157380_10011572 | Ga0157380_100115727 | 226 |
| 944 | 3300014326 | Ga0157380_10065871 | Ga0157380_100658714 | 226 |
| 945 | 3300014745 | Ga0157377_10026948 | Ga0157377_100269483 | 226 |
| 946 | 3300014968 | Ga0157379_10015640 | Ga0157379_100156402 | 226 |
| 947 | 3300014969 | Ga0157376_10093766 | Ga0157376_100937662 | 226 |
| 948 | 3300017792 | Ga0163161_10036888 | Ga0163161_100368886 | 226 |
| 949 | 3300025271 | Ga0207666_1004394 | Ga0207666_10043942 | 226 |
| 950 | 3300025315 | Ga0207697_10000700 | Ga0207697_1000070027 | 226 |
| 951 | 3300025315 | Ga0207697_10083824 | Ga0207697_100838242 | 226 |
| 952 | 3300025893 | Ga0207682_10039016 | Ga0207682_100390163 | 226 |
| 953 | 3300025893 | Ga0207682_10052244 | Ga0207682_100522443 | 226 |
| 954 | 3300025899 | Ga0207642_10042787 | Ga0207642_100427872 | 226 |
| 955 | 3300025901 | Ga0207688_10003374 | Ga0207688_100033743 | 226 |
| 956 | 3300025901 | Ga0207688_10245298 | Ga0207688_102452982 | 226 |
| 957 | 3300025903 | Ga0207680_10101912 | Ga0207680_101019122 | 226 |
| 958 | 3300025907 | Ga0207645_10002538 | Ga0207645_1000253820 | 226 |
| 959 | 3300025907 | Ga0207645_10007582 | Ga0207645_1000758210 | 226 |
| 960 | 3300025907 | Ga0207645_10093439 | Ga0207645_100934392 | 226 |
| 961 | 3300025908 | Ga0207643_10000138 | Ga0207643_1000013842 | 226 |
| 962 | 3300025908 | Ga0207643_10046925 | Ga0207643_100469253 | 226 |
| 963 | 3300025918 | Ga0207662_10000720 | Ga0207662_100007208 | 226 |
| 964 | 3300025923 | Ga0207681_10017757 | Ga0207681_100177576 | 226 |
| 965 | 3300025923 | Ga0207681_10032854 | Ga0207681_100328542 | 226 |
| 966 | 3300025923 | Ga0207681_10625381 | Ga0207681_106253811 | 226 |
| 967 | 3300025925 | Ga0207650_10115220 | Ga0207650_101152202 | 226 |
| 968 | 3300025925 | Ga0207650_10128287 | Ga0207650_101282872 | 226 |
| 969 | 3300025926 | Ga0207659_10163026 | Ga0207659_101630261 | 226 |
| 970 | 3300025927 | Ga0207687_10407674 | Ga0207687_104076742 | 226 |
| 971 | 3300025931 | Ga0207644_10065981 | Ga0207644_100659813 | 226 |
| 972 | 3300025931 | Ga0207644_10213517 | Ga0207644_102135171 | 226 |
| 973 | 3300025932 | Ga0207690_10069614 | Ga0207690_100696143 | 226 |
| 974 | 3300025933 | Ga0207706_10002156 | Ga0207706_100021563 | 226 |
| 975 | 3300025933 | Ga0207706_10133245 | Ga0207706_101332452 | 226 |
| 976 | 3300025936 | Ga0207670_10203027 | Ga0207670_102030272 | 226 |
| 977 | 3300025937 | Ga0207669_10002409 | Ga0207669_100024094 | 226 |
| 978 | 3300025937 | Ga0207669_10140963 | Ga0207669_101409633 | 226 |
| 979 | 3300025940 | Ga0207691_10002649 | Ga0207691_100026492 | 226 |
| 980 | 3300025940 | Ga0207691_10022103 | Ga0207691_100221039 | 226 |
| 981 | 3300025941 | Ga0207711_10103059 | Ga0207711_101030592 | 226 |
| 982 | 3300025942 | Ga0207689_10001347 | Ga0207689_1000134728 | 226 |
| 983 | 3300025942 | Ga0207689_10027935 | Ga0207689_100279353 | 226 |
| 984 | 3300025945 | Ga0207679_10013926 | Ga0207679_100139264 | 226 |
| 985 | 3300025961 | Ga0207712_10010563 | Ga0207712_100105634 | 226 |
| 986 | 3300025986 | Ga0207658_10205005 | Ga0207658_102050051 | 226 |
| 987 | 3300026035 | Ga0207703_10068184 | Ga0207703_100681842 | 226 |
| 988 | 3300026067 | Ga0207678_10132000 | Ga0207678_101320003 | 226 |
| 989 | 3300026075 | Ga0207708_10023190 | Ga0207708_100231903 | 226 |
| 990 | 3300026075 | Ga0207708_10092791 | Ga0207708_100927912 | 226 |
| 991 | 3300026075 | Ga0207708_10094470 | Ga0207708_100944702 | 226 |
| 992 | 3300026088 | Ga0207641_10074265 | Ga0207641_100742652 | 226 |
| 993 | 3300026089 | Ga0207648_10018013 | Ga0207648_100180131 | 226 |
| 994 | 3300026089 | Ga0207648_10050677 | Ga0207648_100506773 | 226 |
| 995 | 3300026095 | Ga0207676_10079332 | Ga0207676_100793322 | 226 |
| 996 | 3300026095 | Ga0207676_10332440 | Ga0207676_103324402 | 226 |
| 997 | 3300026118 | Ga0207675_100003041 | Ga0207675_1000030419 | 226 |
| 998 | 3300026118 | Ga0207675_100012703 | Ga0207675_1000127039 | 226 |
| 999 | 3300026118 | Ga0207675_100711786 | Ga0207675_1007117862 | 226 |
| 1000 | 3300026121 | Ga0207683_10080305 | Ga0207683_100803054 | 226 |
| 1001 | 3300026121 | Ga0207683_10606406 | Ga0207683_106064062 | 226 |
| 1002 | 3300026142 | Ga0207698_10270431 | Ga0207698_102704312 | 226 |
| 1003 | 3300027907 | Ga0207428_10000498 | Ga0207428_1000049825 | 226 |
| 1004 | 3300027907 | Ga0207428_10004323 | Ga0207428_1000432310 | 226 |
| 1005 | 3300027907 | Ga0207428_10006675 | Ga0207428_100066757 | 226 |
| 1006 | 3300028379 | Ga0268266_10105558 | Ga0268266_101055582 | 226 |
| 1007 | 3300028380 | Ga0268265_10002782 | Ga0268265_1000278211 | 226 |
| 1008 | 3300028380 | Ga0268265_10172505 | Ga0268265_101725052 | 226 |
| 1009 | 3300028381 | Ga0268264_10324845 | Ga0268264_103248452 | 226 |
| 1010 | 3300034819 | Ga0373958_0002235 | Ga0373958_0002235_1207_1887 | 226 |
| 1011 | 3300035090 | Ga0373949_0006475 | Ga0373949_0006475_887_1567 | 226 |
| 1012 | 3300035691 | Ga0373931_0070323 | Ga0373931_0070323_926_1606 | 226 |
| 1013 | 3300042993 | Ga0439440_0003015 | Ga0439440_0003015_1609_2289 | 226 |
| 1014 | 3300045051 | Ga0451576_0194662 | Ga0451576_0194662_197_877 | 226 |
| 1015 | 3300048912 | Ga0496109_0101312 | Ga0496109_0101312_387_1067 | 226 |
| 1016 | 3300049572 | Ga0501036_0162297 | Ga0501036_0162297_1055_1747 | 226 |
| 1017 | 3300049575 | Ga0501039_0137610 | Ga0501039_0137610_184_876 | 226 |
| 1018 | 3300049576 | Ga0501040_0026771 | Ga0501040_0026771_2446_3138 | 226 |
| 1019 | 3300049577 | Ga0501041_0033465 | Ga0501041_0033465_1151_1843 | 226 |
| 1020 | 3300049578 | Ga0501042_0007112 | Ga0501042_0007112_2588_3280 | 226 |
| 1021 | 3300049580 | Ga0501046_0097362 | Ga0501046_0097362_869_1561 | 226 |
| 1022 | 3300049588 | Ga0501072_0055149 | Ga0501072_0055149_1289_1981 | 226 |
| 1023 | 3300049591 | Ga0501075_0011967 | Ga0501075_0011967_5447_6139 | 226 |
| 1024 | 3300049741 | Ga0501079_0084656 | Ga0501079_0084656_384_1076 | 226 |
| 1025 | 3300049743 | Ga0501081_0007180 | Ga0501081_0007180_1114_1806 | 226 |
| 1026 | 3300049824 | Ga0501045_0081204 | Ga0501045_0081204_895_1587 | 226 |
| 1027 | 3300050507 | nmdc:mga05p37_168945_c1 | nmdc:mga05p37_168945_c1_897_1577 | 226 |
| 1028 | 3300050508 | nmdc:mga09592_18264_c1 | nmdc:mga09592_18264_c1_4301_4981 | 226 |
| 1029 | 3300050508 | nmdc:mga09592_4217_c1 | nmdc:mga09592_4217_c1_5190_5870 | 226 |
| 1030 | 3300050508 | nmdc:mga09592_433009_c1 | nmdc:mga09592_433009_c1_111_797 | 226 |
| 1031 | 3300050509 | nmdc:mga0qj67_10794_c1 | nmdc:mga0qj67_10794_c1_1284_1964 | 226 |
| 1032 | 3300050509 | nmdc:mga0qj67_223700_c1 | nmdc:mga0qj67_223700_c1_817_1509 | 226 |
| 1033 | 3300050509 | nmdc:mga0qj67_239257_c1 | nmdc:mga0qj67_239257_c1_473_1153 | 226 |
| 1034 | 3300050510 | nmdc:mga06r32_117282_c1 | nmdc:mga06r32_117282_c1_1420_2100 | 226 |
| 1035 | 3300050510 | nmdc:mga06r32_24864_c1 | nmdc:mga06r32_24864_c1_855_1541 | 226 |
| 1036 | 3300050510 | nmdc:mga06r32_670589_c1 | nmdc:mga06r32_670589_c1_72_764 | 226 |
| 1037 | 3300050511 | nmdc:mga08y16_16048_c1 | nmdc:mga08y16_16048_c1_2424_3116 | 226 |
| 1038 | 3300050511 | nmdc:mga08y16_41140_c1 | nmdc:mga08y16_41140_c1_565_1257 | 226 |
| 1039 | 3300050511 | nmdc:mga08y16_60376_c1 | nmdc:mga08y16_60376_c1_458_1138 | 226 |
| 1040 | 3300050512 | nmdc:mga0n895_148545_c1 | nmdc:mga0n895_148545_c1_859_1539 | 226 |
| 1041 | 3300050513 | nmdc:mga0rr50_412486_c1 | nmdc:mga0rr50_412486_c1_377_1057 | 226 |
| 1042 | 3300050515 | nmdc:mga0a205_134513_c1 | nmdc:mga0a205_134513_c1_1444_2124 | 226 |
| 1043 | 3300054114 | Ga0501084_0021867 | Ga0501084_0021867_3242_3934 | 226 |
| 1044 | 3300060353 | Ga0501082_0052391 | Ga0501082_0052391_1753_2445 | 226 |
| 1045 | 3300061734 | Ga0530510_0101840 | Ga0530510_0101840_285_977 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9637 | 6 | 219 |
| 5umf-assembly1.cif.gz_C | crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate | 0.9609 | 6 | 222 |
| 1tqj-assembly1.cif.gz_D | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9561 | 5 | 219 |
| 1tqj-assembly1.cif.gz_E | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9551 | 5 | 219 |
| 1tqj-assembly1.cif.gz_F | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9541 | 5 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9669 | 6 | 222 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.964 | 5 | 219 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9635 | 5 | 221 | 3.20.20.70 |
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9561 | 5 | 219 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9539 | 6 | 222 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7NBK9-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9875 | 5 | 222 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A3B8RQ74-F1-model_v4 | Ribulose-phosphate 3-epimerase | 0.985 | 54 | 223 |
GO:0005975
GO:0016857 |
| AF-G2LHA7-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9819 | 3 | 222 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A1F2VLA7-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9814 | 5 | 226 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A7Y4UCZ2-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9813 | 6 | 191 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar