F488927

General Info

Members Datasets Scaffolds Average Seq Length
1045 327 1044 227

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100400939|Ga0075436_1004009391
Length 266
Sequence VIARARHANGAGRGAPASERAGGSGGAKPPGLMMKPAGTLQIAPSLLSADFARLGDAVALAERAGADLIHFDVMDGHFVPNITIGPPVVKSIKRVAHVPLDVHLMITDPDRYIDAFAEAGAAMMSVHVEVLPHLHRTVHAIKALGVRAGVVLNPSTPVVALEEVAGDVDYVLVMSVNPGFGGQTFIPRSESKVRDVRALLDRAGSRAAIEIDGGIDQRTVGRVVAAGARMIVAGSAIFHSGDPERATRDLKAAAMGALLPSTGIPG

Samples

Sample ID Description Type Environment
1 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
188 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
228 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
229 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 1.44
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002904 3300001977 Unclassified 2694
2 JGI25406J46586_10096364 3300003203 Bacteria 886
3 Ga0065714_10016598 3300005288 Bacteria 1770
4 Ga0065714_10148072 3300005288 Bacteria 1124
5 Ga0065712_10067826 3300005290 Bacteria 27846
6 Ga0065712_10075828 3300005290 Bacteria 3780
7 Ga0065712_10140567 3300005290 Bacteria 1454
8 Ga0065712_10254537 3300005290 Bacteria 947
9 Ga0065715_10008301 3300005293 Bacteria 4410
10 Ga0065715_10092637 3300005293 Bacteria 5011
11 Ga0065715_10168068 3300005293 Bacteria 1569
12 Ga0065715_10171797 3300005293 Bacteria 1541
13 Ga0065707_10001067 3300005295 Bacteria 13664
14 Ga0065707_10037066 3300005295 Bacteria 1007
15 Ga0065707_10247017 3300005295 Bacteria 1137
16 Ga0065707_10271034 3300005295 Bacteria 1065
17 Ga0070658_10261910 3300005327 Bacteria 1469
18 Ga0070676_10023420 3300005328 Unclassified 3470
19 Ga0070683_100143130 3300005329 Bacteria 2265
20 Ga0070690_100000943 3300005330 Bacteria 14838
21 Ga0070690_100001946 3300005330 Bacteria 10986
22 Ga0070690_100007254 3300005330 Bacteria 6343
23 Ga0070690_100060755 3300005330 Bacteria 2433
24 Ga0070670_100000685 3300005331 Bacteria 26291
25 Ga0070670_100013235 3300005331 Bacteria 7068
26 Ga0070670_100052051 3300005331 Bacteria 3516
27 Ga0070670_100190644 3300005331 Bacteria 1781
28 Ga0070670_100221775 3300005331 Bacteria 1645
29 Ga0070670_100362902 3300005331 Bacteria 1274
30 Ga0070670_100451704 3300005331 Bacteria 1139
31 Ga0070677_10022596 3300005333 Bacteria 2319
32 Ga0070677_10042130 3300005333 Bacteria 1806
33 Ga0068869_100007243 3300005334 Bacteria 7070
34 Ga0068869_100260137 3300005334 Bacteria 1389
35 Ga0070666_10001117 3300005335 Bacteria 16334
36 Ga0070666_10007711 3300005335 Bacteria 6646
37 Ga0070666_10039257 3300005335 Bacteria 3154
38 Ga0070666_10066402 3300005335 Bacteria 2448
39 Ga0070666_10267088 3300005335 Bacteria 1214
40 Ga0070666_10441666 3300005335 Bacteria 939
41 Ga0070680_100083699 3300005336 Bacteria 2634
42 Ga0070680_100096219 3300005336 Bacteria 2455
43 Ga0070682_100239653 3300005337 Unclassified 1301
44 Ga0068868_100002612 3300005338 Bacteria 12493
45 Ga0068868_100007095 3300005338 Bacteria 7964
46 Ga0068868_100031591 3300005338 Unclassified 4069
47 Ga0068868_100199368 3300005338 Bacteria 1668
48 Ga0068868_100509064 3300005338 Bacteria 1055
49 Ga0070660_100013279 3300005339 Bacteria 5903
50 Ga0070660_100618897 3300005339 Bacteria 906
51 Ga0070689_100017529 3300005340 Bacteria 5262
52 Ga0070689_100036443 3300005340 Bacteria 3763
53 Ga0070689_100037769 3300005340 Unclassified 3693
54 Ga0070689_100069026 3300005340 Bacteria 2757
55 Ga0070689_100085426 3300005340 Bacteria 2481
56 Ga0070689_100235229 3300005340 Bacteria 1507
57 Ga0070687_100006731 3300005343 Bacteria 4733
58 Ga0070687_100018229 3300005343 Bacteria 3244
59 Ga0070687_100043160 3300005343 Bacteria 2290
60 Ga0070687_100043478 3300005343 Bacteria 2283
61 Ga0070687_100364237 3300005343 Bacteria 937
62 Ga0070661_100016239 3300005344 Bacteria 5260
63 Ga0070661_100062768 3300005344 Bacteria 2728
64 Ga0070661_100226572 3300005344 Bacteria 1435
65 Ga0070668_100038946 3300005347 Bacteria 3636
66 Ga0070668_100301093 3300005347 Bacteria 1345
67 Ga0070669_100000985 3300005353 Bacteria 20776
68 Ga0070669_100037262 3300005353 Bacteria 3527
69 Ga0070669_100084340 3300005353 Unclassified 2370
70 Ga0070669_100085447 3300005353 Bacteria 2356
71 Ga0070669_100235214 3300005353 Bacteria 1454
72 Ga0070669_100306722 3300005353 Bacteria 1278
73 Ga0070669_100763896 3300005353 Bacteria 820
74 Ga0070675_100000152 3300005354 Bacteria 41857
75 Ga0070675_100000255 3300005354 Bacteria 34844
76 Ga0070675_100008820 3300005354 Bacteria 7836
77 Ga0070675_100021490 3300005354 Bacteria 5159
78 Ga0070675_100037825 3300005354 Unclassified 3933
79 Ga0070675_100049117 3300005354 Bacteria 3462
80 Ga0070675_100088378 3300005354 Bacteria 2593
81 Ga0070675_100096246 3300005354 Bacteria 2487
82 Ga0070675_100116245 3300005354 Bacteria 2269
83 Ga0070675_100117749 3300005354 Bacteria 2255
84 Ga0070675_100149507 3300005354 Bacteria 2002
85 Ga0070675_100601786 3300005354 Bacteria 997
86 Ga0070671_100008711 3300005355 Bacteria 8139
87 Ga0070671_100021093 3300005355 Bacteria 5319
88 Ga0070671_100031711 3300005355 Bacteria 4368
89 Ga0070671_100065589 3300005355 Bacteria 3025
90 Ga0070671_100079392 3300005355 Bacteria 2743
91 Ga0070671_100145702 3300005355 Bacteria 1999
92 Ga0070671_100229770 3300005355 Bacteria 1574
93 Ga0070671_100415539 3300005355 Bacteria 1152
94 Ga0070671_100497844 3300005355 Bacteria 1048
95 Ga0070674_100000190 3300005356 Bacteria 29304
96 Ga0070674_100160095 3300005356 Bacteria 1707
97 Ga0070674_100360219 3300005356 Bacteria 1177
98 Ga0070674_100619684 3300005356 Bacteria 917
99 Ga0070674_100800288 3300005356 Bacteria 814
100 Ga0070674_100812647 3300005356 Bacteria 808
101 Ga0070673_100003445 3300005364 Bacteria 9858
102 Ga0070673_100003602 3300005364 Bacteria 9681
103 Ga0070673_100008704 3300005364 Bacteria 6770
104 Ga0070673_100018346 3300005364 Bacteria 4995
105 Ga0070673_100048209 3300005364 Bacteria 3320
106 Ga0070673_100065517 3300005364 Bacteria 2898
107 Ga0070673_100101451 3300005364 Bacteria 2371
108 Ga0070673_100149540 3300005364 Bacteria 1977
109 Ga0070673_100170807 3300005364 Bacteria 1856
110 Ga0070673_100187414 3300005364 Bacteria 1775
111 Ga0070688_100006958 3300005365 Bacteria 6078
112 Ga0070688_100030712 3300005365 Bacteria 3227
113 Ga0070688_100121019 3300005365 Unclassified 1753
114 Ga0070688_100147060 3300005365 Bacteria 1607
115 Ga0070688_100165312 3300005365 Bacteria 1523
116 Ga0070688_100230898 3300005365 Bacteria 1309
117 Ga0070688_100297033 3300005365 Bacteria 1166
118 Ga0070659_100076707 3300005366 Bacteria 2665
119 Ga0070659_100237563 3300005366 Bacteria 1507
120 Ga0070659_100270130 3300005366 Bacteria 1413
121 Ga0070667_100000993 3300005367 Bacteria 26034
122 Ga0070667_100002300 3300005367 Bacteria 16787
123 Ga0070667_100013074 3300005367 Bacteria 6860
124 Ga0070667_100091411 3300005367 Bacteria 2617
125 Ga0070667_100098217 3300005367 Bacteria 2527
126 Ga0070667_100270639 3300005367 Bacteria 1523
127 Ga0070667_100367528 3300005367 Bacteria 1305
128 Ga0070714_100057997 3300005435 Bacteria 3316
129 Ga0070713_100040062 3300005436 Bacteria 3807
130 Ga0070713_100061623 3300005436 Bacteria 3139
131 Ga0070701_10009450 3300005438 Bacteria 4272
132 Ga0070701_10098892 3300005438 Unclassified 1612
133 Ga0070701_10173387 3300005438 Bacteria 1257
134 Ga0070701_10224615 3300005438 Bacteria 1122
135 Ga0070705_100012816 3300005440 Bacteria 4274
136 Ga0070700_100073372 3300005441 Unclassified 2190
137 Ga0070694_100178088 3300005444 Bacteria 1571
138 Ga0070708_100019170 3300005445 Bacteria 5742
139 Ga0070708_100335527 3300005445 Bacteria 1425
140 Ga0070708_100586426 3300005445 Bacteria 1051
141 Ga0070663_100089689 3300005455 Unclassified 2276
142 Ga0070663_100645124 3300005455 Bacteria 895
143 Ga0070678_100048372 3300005456 Bacteria 3062
144 Ga0070678_100121064 3300005456 Bacteria 2064
145 Ga0070662_100079620 3300005457 Bacteria 2437
146 Ga0070662_100122339 3300005457 Bacteria 1996
147 Ga0070681_10556187 3300005458 Bacteria 1061
148 Ga0070681_10617054 3300005458 Bacteria 999
149 Ga0068867_100078107 3300005459 Unclassified 2489
150 Ga0068867_100389828 3300005459 Bacteria 1172
151 Ga0070685_10006788 3300005466 Bacteria 5843
152 Ga0070685_10012576 3300005466 Bacteria 4449
153 Ga0070685_10211161 3300005466 Bacteria 1267
154 Ga0070706_100615637 3300005467 Bacteria 1009
155 Ga0070707_100044730 3300005468 Bacteria 4238
156 Ga0070707_100386635 3300005468 Bacteria 1359
157 Ga0070707_100580317 3300005468 Bacteria 1083
158 Ga0070698_100049965 3300005471 Bacteria 4267
159 Ga0070698_100114096 3300005471 Bacteria 2667
160 Ga0070698_100183276 3300005471 Bacteria 2032
161 Ga0070698_100436305 3300005471 Bacteria 1245
162 Ga0070699_100011666 3300005518 Bacteria 7586
163 Ga0070699_100042953 3300005518 Bacteria 3913
164 Ga0070699_100264633 3300005518 Bacteria 1538
165 Ga0070699_100500241 3300005518 Bacteria 1104
166 Ga0070684_100068779 3300005535 Unclassified 3113
167 Ga0068853_100061015 3300005539 Bacteria 3260
168 Ga0070672_100001431 3300005543 Bacteria 14748
169 Ga0070672_100001564 3300005543 Bacteria 14168
170 Ga0070672_100010401 3300005543 Bacteria 6454
171 Ga0070672_100011176 3300005543 Bacteria 6255
172 Ga0070672_100013605 3300005543 Bacteria 5753
173 Ga0070672_100022168 3300005543 Bacteria 4659
174 Ga0070672_100071567 3300005543 Bacteria 2759
175 Ga0070672_100085300 3300005543 Bacteria 2538
176 Ga0070672_100096931 3300005543 Unclassified 2387
177 Ga0070672_100227565 3300005543 Bacteria 1566
178 Ga0070686_100001189 3300005544 Bacteria 14795
179 Ga0070686_100008639 3300005544 Bacteria 5708
180 Ga0070686_100046799 3300005544 Bacteria 2731
181 Ga0070696_100022198 3300005546 Bacteria 4311
182 Ga0070696_100119898 3300005546 Bacteria 1903
183 Ga0070696_100336470 3300005546 Bacteria 1165
184 Ga0070696_100398739 3300005546 Bacteria 1076
185 Ga0070696_100462802 3300005546 Bacteria 1003
186 Ga0070696_100488051 3300005546 Bacteria 978
187 Ga0070696_100491396 3300005546 Bacteria 975
188 Ga0070693_100128986 3300005547 Bacteria 1578
189 Ga0070665_100025393 3300005548 Bacteria 5970
190 Ga0070665_100053852 3300005548 Bacteria 4035
191 Ga0070665_100624446 3300005548 Bacteria 1091
192 Ga0070704_100024158 3300005549 Bacteria 3984
193 Ga0070704_100058059 3300005549 Bacteria 2755
194 Ga0070704_100324958 3300005549 Bacteria 1290
195 Ga0070704_100463186 3300005549 Bacteria 1094
196 Ga0070664_100000144 3300005564 Bacteria 48758
197 Ga0070664_100002638 3300005564 Bacteria 14464
198 Ga0070664_100004803 3300005564 Bacteria 10831
199 Ga0070664_100030218 3300005564 Bacteria 4520
200 Ga0070664_100258174 3300005564 Bacteria 1567
201 Ga0068857_100076900 3300005577 Bacteria 2977
202 Ga0068857_100089334 3300005577 Bacteria 2757
203 Ga0068857_100208450 3300005577 Bacteria 1783
204 Ga0068857_100796655 3300005577 Bacteria 902
205 Ga0068854_100008495 3300005578 Bacteria 6607
206 Ga0068854_100142935 3300005578 Bacteria 1838
207 Ga0068854_100482471 3300005578 Bacteria 1041
208 Ga0070702_100080525 3300005615 Bacteria 1949
209 Ga0070702_100096962 3300005615 Bacteria 1801
210 Ga0070702_100353747 3300005615 Bacteria 1035
211 Ga0068852_100091207 3300005616 Unclassified 2726
212 Ga0068859_100003201 3300005617 Bacteria 16670
213 Ga0068859_100016051 3300005617 Bacteria 7525
214 Ga0068859_100018494 3300005617 Bacteria 7003
215 Ga0068859_100025103 3300005617 Bacteria 5981
216 Ga0068859_100062510 3300005617 Bacteria 3753
217 Ga0068859_100098441 3300005617 Bacteria 2979
218 Ga0068859_100763379 3300005617 Bacteria 1056
219 Ga0068864_100000486 3300005618 Bacteria 34405
220 Ga0068864_100029816 3300005618 Bacteria 4623
221 Ga0068864_100031124 3300005618 Bacteria 4526
222 Ga0068864_100067028 3300005618 Bacteria 3117
223 Ga0068864_100083484 3300005618 Unclassified 2805
224 Ga0068864_100696762 3300005618 Bacteria 992
225 Ga0068864_100708844 3300005618 Bacteria 984
226 Ga0068866_10096320 3300005718 Bacteria 1623
227 Ga0068861_100058288 3300005719 Bacteria 2953
228 Ga0068861_100098464 3300005719 Bacteria 2321
229 Ga0068861_100122823 3300005719 Bacteria 2097
230 Ga0068861_100300161 3300005719 Bacteria 1391
231 Ga0068861_100620563 3300005719 Bacteria 995
232 Ga0068861_100654781 3300005719 Bacteria 971
233 Ga0068851_10188600 3300005834 Bacteria 1145
234 Ga0068870_10004169 3300005840 Bacteria 6201
235 Ga0068870_10032396 3300005840 Bacteria 2657
236 Ga0068870_10087975 3300005840 Bacteria 1730
237 Ga0068870_10274638 3300005840 Bacteria 1054
238 Ga0068870_10385982 3300005840 Bacteria 908
239 Ga0068863_100000526 3300005841 Bacteria 39045
240 Ga0068863_100001664 3300005841 Bacteria 21972
241 Ga0068863_100005682 3300005841 Bacteria 12249
242 Ga0068863_100032658 3300005841 Bacteria 4960
243 Ga0068863_100129493 3300005841 Bacteria 2409
244 Ga0068863_100246010 3300005841 Bacteria 1727
245 Ga0068863_100254071 3300005841 Bacteria 1698
246 Ga0068863_100448879 3300005841 Bacteria 1265
247 Ga0068858_100004023 3300005842 Bacteria 14505
248 Ga0068858_100004203 3300005842 Bacteria 14174
249 Ga0068858_100004339 3300005842 Bacteria 13920
250 Ga0068858_100032481 3300005842 Bacteria 4847
251 Ga0068858_100062381 3300005842 Unclassified 3446
252 Ga0068858_100072713 3300005842 Bacteria 3190
253 Ga0068858_100084694 3300005842 Bacteria 2949
254 Ga0068858_100128931 3300005842 Bacteria 2371
255 Ga0068858_100594024 3300005842 Bacteria 1074
256 Ga0068858_100709378 3300005842 Bacteria 979
257 Ga0068858_100726785 3300005842 Bacteria 967
258 Ga0068858_100830690 3300005842 Bacteria 902
259 Ga0068860_100001145 3300005843 Bacteria 29096
260 Ga0068860_100003450 3300005843 Bacteria 16260
261 Ga0068860_100126642 3300005843 Bacteria 2448
262 Ga0068860_100164750 3300005843 Bacteria 2139
263 Ga0068860_100327563 3300005843 Bacteria 1504
264 Ga0068860_100620517 3300005843 Bacteria 1088
265 Ga0068862_100002759 3300005844 Bacteria 15391
266 Ga0068862_100066537 3300005844 Bacteria 3105
267 Ga0068862_100098609 3300005844 Bacteria 2553
268 Ga0068862_100156512 3300005844 Bacteria 2032
269 Ga0068862_100220673 3300005844 Bacteria 1716
270 Ga0068862_100378337 3300005844 Bacteria 1320
271 Ga0068862_100392169 3300005844 Bacteria 1297
272 Ga0081455_10091618 3300005937 Bacteria 2461
273 Ga0081539_10003749 3300005985 Bacteria 18053
274 Ga0081539_10008963 3300005985 Bacteria 8515
275 Ga0081539_10040616 3300005985 Bacteria 2729
276 Ga0081539_10083995 3300005985 Bacteria 1665
277 Ga0075364_10012103 3300006051 Bacteria 5265
278 Ga0075432_10073402 3300006058 Unclassified 1232
279 Ga0070715_10088888 3300006163 Bacteria 1417
280 Ga0070715_10242795 3300006163 Bacteria 937
281 Ga0070712_100177525 3300006175 Bacteria 1657
282 Ga0075362_10008592 3300006177 Bacteria 3914
283 Ga0075367_10010532 3300006178 Bacteria 4859
284 Ga0075366_10028979 3300006195 Bacteria 3250
285 Ga0097621_100001328 3300006237 Bacteria 17028
286 Ga0097621_100028961 3300006237 Bacteria 4371
287 Ga0097621_100035558 3300006237 Bacteria 3981
288 Ga0097621_100040059 3300006237 Bacteria 3765
289 Ga0097621_100051441 3300006237 Bacteria 3353
290 Ga0097621_100076538 3300006237 Bacteria 2776
291 Ga0097621_100165279 3300006237 Bacteria 1905
292 Ga0097621_100366294 3300006237 Bacteria 1285
293 Ga0068871_100011604 3300006358 Bacteria 6467
294 Ga0068871_100030699 3300006358 Bacteria 4235
295 Ga0068871_100058626 3300006358 Bacteria 3135
296 Ga0068871_100105634 3300006358 Bacteria 2363
297 Ga0075428_100003630 3300006844 Bacteria 16919
298 Ga0075428_100005405 3300006844 Bacteria 14201
299 Ga0075428_100008496 3300006844 Bacteria 11390
300 Ga0075428_100209540 3300006844 Bacteria 2106
301 Ga0075428_100245407 3300006844 Bacteria 1931
302 Ga0075428_100330676 3300006844 Bacteria 1637
303 Ga0075428_100418309 3300006844 Unclassified 1436
304 Ga0075430_100010732 3300006846 Bacteria 7765
305 Ga0075430_100054986 3300006846 Bacteria 3348
306 Ga0075430_100064364 3300006846 Bacteria 3081
307 Ga0075430_100121177 3300006846 Bacteria 2181
308 Ga0075431_100000524 3300006847 Bacteria 32207
309 Ga0075431_100003017 3300006847 Bacteria 16287
310 Ga0075431_100052971 3300006847 Bacteria 4184
311 Ga0075431_100067943 3300006847 Bacteria 3679
312 Ga0075431_100087851 3300006847 Bacteria 3208
313 Ga0075431_100223912 3300006847 Bacteria 1918
314 Ga0075431_100402317 3300006847 Bacteria 1370
315 Ga0075431_100595534 3300006847 Bacteria 1090
316 Ga0075433_10002292 3300006852 Bacteria 14572
317 Ga0075433_10037646 3300006852 Bacteria 4174
318 Ga0075433_10109080 3300006852 Bacteria 2456
319 Ga0075433_10147317 3300006852 Bacteria 2093
320 Ga0075433_10167879 3300006852 Bacteria 1953
321 Ga0075433_10444371 3300006852 Bacteria 1143
322 Ga0075434_100000354 3300006871 Bacteria 33179
323 Ga0075434_100000656 3300006871 Bacteria 26835
324 Ga0075434_100013008 3300006871 Bacteria 7903
325 Ga0075434_100031766 3300006871 Bacteria 5207
326 Ga0075434_100066260 3300006871 Bacteria 3597
327 Ga0075434_100134242 3300006871 Bacteria 2494
328 Ga0075434_100286859 3300006871 Bacteria 1666
329 Ga0075434_100404071 3300006871 Bacteria 1387
330 Ga0075429_100004361 3300006880 Bacteria 12150
331 Ga0075429_100033446 3300006880 Bacteria 4468
332 Ga0075429_100067883 3300006880 Bacteria 3104
333 Ga0075429_100077293 3300006880 Bacteria 2900
334 Ga0075429_100210682 3300006880 Bacteria 1703
335 Ga0075429_100219405 3300006880 Bacteria 1666
336 Ga0075429_100319352 3300006880 Bacteria 1359
337 Ga0068865_100033009 3300006881 Bacteria 3463
338 Ga0068865_100108538 3300006881 Unclassified 2043
339 Ga0075436_100002547 3300006914 Bacteria 12544
340 Ga0075436_100086196 3300006914 Bacteria 2181
341 Ga0075436_100400939 3300006914 Bacteria 994
342 Ga0097620_100003201 3300006931 Bacteria 16670
343 Ga0097620_100016051 3300006931 Bacteria 7525
344 Ga0097620_100018493 3300006931 Bacteria 7003
345 Ga0097620_100025103 3300006931 Bacteria 5981
346 Ga0097620_100062512 3300006931 Bacteria 3753
347 Ga0097620_100098445 3300006931 Bacteria 2979
348 Ga0097620_100331062 3300006931 Bacteria 1617
349 Ga0097620_100763328 3300006931 Bacteria 1056
350 Ga0075435_100000424 3300007076 Bacteria 25964
351 Ga0075435_100009726 3300007076 Bacteria 6988
352 Ga0075435_100028075 3300007076 Bacteria 4411
353 Ga0075435_100045790 3300007076 Bacteria 3508
354 Ga0075435_100051328 3300007076 Bacteria 3322
355 Ga0105240_10013771 3300009093 Bacteria 11082
356 Ga0105240_10040805 3300009093 Bacteria 5931
357 Ga0105240_10274018 3300009093 Bacteria 1942
358 Ga0105240_10291447 3300009093 Bacteria 1870
359 Ga0105240_10900445 3300009093 Bacteria 952
360 Ga0111539_10000001 3300009094 Bacteria 1035431
361 Ga0111539_10006812 3300009094 Bacteria 14693
362 Ga0111539_10014033 3300009094 Bacteria 10011
363 Ga0111539_10026148 3300009094 Bacteria 7144
364 Ga0111539_10041877 3300009094 Bacteria 5503
365 Ga0111539_10082243 3300009094 Bacteria 3787
366 Ga0111539_10190067 3300009094 Bacteria 2396
367 Ga0111539_10306692 3300009094 Bacteria 1847
368 Ga0111539_11013283 3300009094 Bacteria 965
369 Ga0105245_10028953 3300009098 Bacteria 4890
370 Ga0105245_10266303 3300009098 Unclassified 1669
371 Ga0105245_10361590 3300009098 Bacteria 1440
372 Ga0105247_10303567 3300009101 Bacteria 1108
373 Ga0114129_10006412 3300009147 Bacteria 16680
374 Ga0114129_10014262 3300009147 Bacteria 11325
375 Ga0114129_10016354 3300009147 Bacteria 10560
376 Ga0114129_10020769 3300009147 Bacteria 9333
377 Ga0114129_10039435 3300009147 Bacteria 6659
378 Ga0114129_10051285 3300009147 Bacteria 5793
379 Ga0114129_10061382 3300009147 Bacteria 5253
380 Ga0114129_10107673 3300009147 Bacteria 3849
381 Ga0114129_10150493 3300009147 Bacteria 3185
382 Ga0114129_10156387 3300009147 Bacteria 3117
383 Ga0114129_10205768 3300009147 Bacteria 2663
384 Ga0114129_10824749 3300009147 Bacteria 1181
385 Ga0105241_10779841 3300009174 Bacteria 879
386 Ga0105241_10947578 3300009174 Bacteria 802
387 Ga0105242_10026194 3300009176 Bacteria 4621
388 Ga0105242_10029457 3300009176 Bacteria 4379
389 Ga0105242_10302379 3300009176 Bacteria 1461
390 Ga0105242_11144506 3300009176 Bacteria 794
391 Ga0105248_10000236 3300009177 Bacteria 63750
392 Ga0105248_10001572 3300009177 Bacteria 25420
393 Ga0105248_10013439 3300009177 Bacteria 9012
394 Ga0105248_10023875 3300009177 Bacteria 6796
395 Ga0105248_10084092 3300009177 Bacteria 3579
396 Ga0105248_10093447 3300009177 Bacteria 3387
397 Ga0105248_10120857 3300009177 Bacteria 2955
398 Ga0105248_10141080 3300009177 Bacteria 2718
399 Ga0105248_10153342 3300009177 Bacteria 2599
400 Ga0105248_10207491 3300009177 Bacteria 2208
401 Ga0105248_10336047 3300009177 Bacteria 1701
402 Ga0105248_10375900 3300009177 Bacteria 1600
403 Ga0105248_10443087 3300009177 Bacteria 1463
404 Ga0105248_10501080 3300009177 Bacteria 1369
405 Ga0105248_10737840 3300009177 Bacteria 1111
406 Ga0105237_10078532 3300009545 Bacteria 3290
407 Ga0105238_10011306 3300009551 Bacteria 8980
408 Ga0105238_10154211 3300009551 Bacteria 2272
409 Ga0105238_10327984 3300009551 Bacteria 1517
410 Ga0105249_10000849 3300009553 Bacteria 27295
411 Ga0105249_10121430 3300009553 Bacteria 2483
412 Ga0105249_10174354 3300009553 Bacteria 2087
413 Ga0105249_10290333 3300009553 Bacteria 1637
414 Ga0157315_1000725 3300012508 Bacteria 1611
415 Ga0157374_10028374 3300013296 Bacteria 5056
416 Ga0157374_10044119 3300013296 Bacteria 4121
417 Ga0157374_10114249 3300013296 Bacteria 2599
418 Ga0157374_10178565 3300013296 Bacteria 2073
419 Ga0157374_10417870 3300013296 Unclassified 1339
420 Ga0157374_10467337 3300013296 Bacteria 1264
421 Ga0157378_10005352 3300013297 Bacteria 11258
422 Ga0157378_10027081 3300013297 Bacteria 5057
423 Ga0157378_10085486 3300013297 Bacteria 2857
424 Ga0157378_10090328 3300013297 Bacteria 2783
425 Ga0157378_10098116 3300013297 Bacteria 2671
426 Ga0157378_10405649 3300013297 Bacteria 1344
427 Ga0157378_10648580 3300013297 Bacteria 1071
428 Ga0163162_10003531 3300013306 Bacteria 14961
429 Ga0163162_10003813 3300013306 Bacteria 14456
430 Ga0163162_10006551 3300013306 Bacteria 11280
431 Ga0163162_10592216 3300013306 Bacteria 1235
432 Ga0157375_10000523 3300013308 Bacteria 34505
433 Ga0157375_10000607 3300013308 Bacteria 31829
434 Ga0157375_10017168 3300013308 Bacteria 6524
435 Ga0157375_10133588 3300013308 Bacteria 2603
436 Ga0157375_10227177 3300013308 Bacteria 2025
437 Ga0157375_10237545 3300013308 Bacteria 1982
438 Ga0157375_10247886 3300013308 Bacteria 1941
439 Ga0157375_10248564 3300013308 Bacteria 1939
440 Ga0157375_10258182 3300013308 Bacteria 1904
441 Ga0157375_10326539 3300013308 Bacteria 1699
442 Ga0157375_10341652 3300013308 Bacteria 1662
443 Ga0157375_10621484 3300013308 Bacteria 1238
444 Ga0157375_10758953 3300013308 Bacteria 1121
445 Ga0157375_10920887 3300013308 Bacteria 1017
446 Ga0157375_11331709 3300013308 Bacteria 845
447 Ga0163163_10003203 3300014325 Bacteria 13866
448 Ga0163163_10003739 3300014325 Bacteria 12955
449 Ga0163163_10005951 3300014325 Bacteria 10612
450 Ga0163163_10010757 3300014325 Bacteria 8253
451 Ga0163163_10037345 3300014325 Bacteria 4725
452 Ga0163163_10152621 3300014325 Bacteria 2353
453 Ga0163163_10233150 3300014325 Bacteria 1890
454 Ga0157380_10011572 3300014326 Bacteria 6377
455 Ga0157380_10022314 3300014326 Bacteria 4763
456 Ga0157380_10065871 3300014326 Unclassified 2913
457 Ga0157380_10089553 3300014326 Bacteria 2535
458 Ga0157380_10193850 3300014326 Bacteria 1796
459 Ga0157380_10445877 3300014326 Bacteria 1241
460 Ga0157377_10026948 3300014745 Unclassified 3081
461 Ga0157377_10088800 3300014745 Bacteria 1821
462 Ga0157377_10347620 3300014745 Bacteria 994
463 Ga0157377_10362294 3300014745 Bacteria 976
464 Ga0157379_10000308 3300014968 Bacteria 38803
465 Ga0157379_10003703 3300014968 Bacteria 13006
466 Ga0157379_10015640 3300014968 Bacteria 6665
467 Ga0157379_10017731 3300014968 Bacteria 6273
468 Ga0157379_10115724 3300014968 Bacteria 2411
469 Ga0157376_10067745 3300014969 Bacteria 3020
470 Ga0157376_10093766 3300014969 Unclassified 2607
471 Ga0157376_10095257 3300014969 Bacteria 2588
472 Ga0157376_10150761 3300014969 Bacteria 2096
473 Ga0157376_10197185 3300014969 Bacteria 1850
474 Ga0157376_10395389 3300014969 Bacteria 1335
475 Ga0157376_10785521 3300014969 Bacteria 964
476 Ga0163161_10018189 3300017792 Bacteria 4926
477 Ga0163161_10036888 3300017792 Bacteria 3502
478 Ga0163161_10219905 3300017792 Bacteria 1470
479 Ga0207666_1004394 3300025271 Unclassified 1769
480 Ga0207697_10000700 3300025315 Bacteria 19071
481 Ga0207697_10083824 3300025315 Bacteria 1345
482 Ga0207656_10112031 3300025321 Bacteria 1262
483 Ga0207682_10039016 3300025893 Bacteria 1929
484 Ga0207682_10052244 3300025893 Bacteria 1693
485 Ga0207642_10042787 3300025899 Bacteria 1993
486 Ga0207710_10038119 3300025900 Bacteria 2125
487 Ga0207710_10128300 3300025900 Bacteria 1216
488 Ga0207710_10193850 3300025900 Bacteria 1001
489 Ga0207688_10003374 3300025901 Bacteria 8717
490 Ga0207688_10245298 3300025901 Bacteria 1084
491 Ga0207680_10040615 3300025903 Bacteria 2708
492 Ga0207680_10053799 3300025903 Bacteria 2418
493 Ga0207680_10101912 3300025903 Unclassified 1846
494 Ga0207680_10145582 3300025903 Bacteria 1575
495 Ga0207680_10186226 3300025903 Bacteria 1407
496 Ga0207680_10359799 3300025903 Bacteria 1023
497 Ga0207645_10002538 3300025907 Bacteria 14289
498 Ga0207645_10007582 3300025907 Bacteria 7650
499 Ga0207645_10093439 3300025907 Bacteria 1935
500 Ga0207643_10000138 3300025908 Bacteria 49379
501 Ga0207643_10046925 3300025908 Bacteria 2442
502 Ga0207643_10086223 3300025908 Bacteria 1824
503 Ga0207643_10096580 3300025908 Bacteria 1728
504 Ga0207643_10133864 3300025908 Bacteria 1476
505 Ga0207684_10094890 3300025910 Bacteria 2545
506 Ga0207684_10740599 3300025910 Bacteria 833
507 Ga0207654_10095968 3300025911 Bacteria 1817
508 Ga0207695_10050891 3300025913 Bacteria 4354
509 Ga0207695_10094527 3300025913 Bacteria 2996
510 Ga0207695_10736730 3300025913 Bacteria 866
511 Ga0207671_10064312 3300025914 Bacteria 2727
512 Ga0207693_10141578 3300025915 Bacteria 1891
513 Ga0207660_10116877 3300025917 Bacteria 2015
514 Ga0207660_10590019 3300025917 Bacteria 905
515 Ga0207662_10000720 3300025918 Bacteria 15093
516 Ga0207662_10043190 3300025918 Bacteria 2658
517 Ga0207662_10049434 3300025918 Bacteria 2495
518 Ga0207662_10161644 3300025918 Bacteria 1431
519 Ga0207657_10009210 3300025919 Bacteria 9953
520 Ga0207657_10525046 3300025919 Bacteria 926
521 Ga0207649_10176585 3300025920 Bacteria 1492
522 Ga0207649_10185555 3300025920 Bacteria 1459
523 Ga0207649_10201308 3300025920 Bacteria 1407
524 Ga0207649_10233012 3300025920 Bacteria 1318
525 Ga0207646_10116739 3300025922 Bacteria 2397
526 Ga0207646_10243206 3300025922 Bacteria 1626
527 Ga0207646_10470276 3300025922 Bacteria 1134
528 Ga0207681_10017757 3300025923 Bacteria 4471
529 Ga0207681_10032854 3300025923 Bacteria 3400
530 Ga0207681_10053906 3300025923 Bacteria 2732
531 Ga0207681_10084850 3300025923 Unclassified 2246
532 Ga0207681_10220250 3300025923 Bacteria 1468
533 Ga0207681_10310001 3300025923 Bacteria 1251
534 Ga0207681_10625381 3300025923 Bacteria 891
535 Ga0207681_10629340 3300025923 Bacteria 888
536 Ga0207681_10642738 3300025923 Bacteria 879
537 Ga0207694_10006176 3300025924 Bacteria 9154
538 Ga0207694_10238565 3300025924 Bacteria 1486
539 Ga0207650_10001879 3300025925 Bacteria 14822
540 Ga0207650_10021983 3300025925 Bacteria 4514
541 Ga0207650_10032843 3300025925 Bacteria 3756
542 Ga0207650_10115220 3300025925 Bacteria 2085
543 Ga0207650_10128287 3300025925 Bacteria 1982
544 Ga0207650_10858264 3300025925 Bacteria 770
545 Ga0207659_10000405 3300025926 Bacteria 26027
546 Ga0207659_10000879 3300025926 Bacteria 17854
547 Ga0207659_10001940 3300025926 Bacteria 12272
548 Ga0207659_10015544 3300025926 Bacteria 4935
549 Ga0207659_10030594 3300025926 Bacteria 3680
550 Ga0207659_10038417 3300025926 Bacteria 3329
551 Ga0207659_10043655 3300025926 Bacteria 3150
552 Ga0207659_10061761 3300025926 Bacteria 2702
553 Ga0207659_10163026 3300025926 Unclassified 1752
554 Ga0207659_10235518 3300025926 Bacteria 1479
555 Ga0207659_10337437 3300025926 Bacteria 1247
556 Ga0207659_10375867 3300025926 Bacteria 1184
557 Ga0207659_10466143 3300025926 Bacteria 1066
558 Ga0207659_10764982 3300025926 Bacteria 829
559 Ga0207687_10016186 3300025927 Bacteria 4896
560 Ga0207687_10390028 3300025927 Bacteria 1143
561 Ga0207687_10407674 3300025927 Unclassified 1119
562 Ga0207700_10054752 3300025928 Bacteria 2996
563 Ga0207664_10025522 3300025929 Bacteria 4455
564 Ga0207644_10065981 3300025931 Unclassified 2634
565 Ga0207644_10080511 3300025931 Bacteria 2406
566 Ga0207644_10114335 3300025931 Bacteria 2045
567 Ga0207644_10213517 3300025931 Bacteria 1527
568 Ga0207644_10354307 3300025931 Bacteria 1192
569 Ga0207644_10451593 3300025931 Bacteria 1056
570 Ga0207690_10069614 3300025932 Unclassified 2421
571 Ga0207706_10002156 3300025933 Bacteria 19227
572 Ga0207706_10044668 3300025933 Bacteria 3927
573 Ga0207706_10133245 3300025933 Bacteria 2185
574 Ga0207706_10167789 3300025933 Bacteria 1929
575 Ga0207706_10174387 3300025933 Bacteria 1889
576 Ga0207706_10679086 3300025933 Bacteria 881
577 Ga0207686_10157511 3300025934 Bacteria 1588
578 Ga0207686_10332757 3300025934 Bacteria 1138
579 Ga0207709_10023026 3300025935 Bacteria 3541
580 Ga0207709_10355629 3300025935 Bacteria 1107
581 Ga0207670_10011480 3300025936 Bacteria 5146
582 Ga0207670_10150444 3300025936 Bacteria 1727
583 Ga0207670_10167523 3300025936 Bacteria 1645
584 Ga0207670_10203027 3300025936 Bacteria 1507
585 Ga0207670_10554196 3300025936 Bacteria 940
586 Ga0207669_10002409 3300025937 Bacteria 7971
587 Ga0207669_10058891 3300025937 Bacteria 2346
588 Ga0207669_10140963 3300025937 Bacteria 1673
589 Ga0207669_10290875 3300025937 Bacteria 1237
590 Ga0207669_10478815 3300025937 Bacteria 992
591 Ga0207669_10702891 3300025937 Bacteria 831
592 Ga0207669_10715961 3300025937 Bacteria 824
593 Ga0207704_10055270 3300025938 Bacteria 2425
594 Ga0207691_10002649 3300025940 Bacteria 17491
595 Ga0207691_10003124 3300025940 Bacteria 16174
596 Ga0207691_10022103 3300025940 Bacteria 6001
597 Ga0207691_10024181 3300025940 Bacteria 5712
598 Ga0207691_10027787 3300025940 Bacteria 5302
599 Ga0207691_10031394 3300025940 Bacteria 4958
600 Ga0207691_10032956 3300025940 Bacteria 4827
601 Ga0207691_10112521 3300025940 Bacteria 2419
602 Ga0207691_10169262 3300025940 Bacteria 1914
603 Ga0207691_10377575 3300025940 Bacteria 1210
604 Ga0207691_10397580 3300025940 Bacteria 1176
605 Ga0207691_10862468 3300025940 Bacteria 759
606 Ga0207711_10000601 3300025941 Bacteria 36340
607 Ga0207711_10006548 3300025941 Bacteria 9809
608 Ga0207711_10050135 3300025941 Bacteria 3574
609 Ga0207711_10050303 3300025941 Bacteria 3567
610 Ga0207711_10057699 3300025941 Bacteria 3338
611 Ga0207711_10062770 3300025941 Bacteria 3206
612 Ga0207711_10103059 3300025941 Unclassified 2527
613 Ga0207711_10142017 3300025941 Bacteria 2161
614 Ga0207711_10169291 3300025941 Bacteria 1981
615 Ga0207711_10209838 3300025941 Bacteria 1779
616 Ga0207711_10628863 3300025941 Bacteria 1002
617 Ga0207711_10649855 3300025941 Bacteria 984
618 Ga0207711_10756446 3300025941 Bacteria 906
619 Ga0207711_10810795 3300025941 Bacteria 872
620 Ga0207711_10922425 3300025941 Bacteria 812
621 Ga0207689_10001347 3300025942 Bacteria 23609
622 Ga0207689_10027935 3300025942 Bacteria 4720
623 Ga0207689_10105182 3300025942 Bacteria 2319
624 Ga0207689_10431041 3300025942 Bacteria 1101
625 Ga0207689_10806911 3300025942 Bacteria 792
626 Ga0207661_10037371 3300025944 Bacteria 3798
627 Ga0207679_10013926 3300025945 Bacteria 5273
628 Ga0207679_10125927 3300025945 Bacteria 2047
629 Ga0207679_10701809 3300025945 Bacteria 918
630 Ga0207667_10095180 3300025949 Bacteria 3075
631 Ga0207651_10000566 3300025960 Bacteria 15605
632 Ga0207651_10004402 3300025960 Bacteria 7093
633 Ga0207651_10020655 3300025960 Bacteria 3981
634 Ga0207651_10100362 3300025960 Bacteria 2146
635 Ga0207651_10107245 3300025960 Bacteria 2087
636 Ga0207651_10108365 3300025960 Bacteria 2079
637 Ga0207651_10158497 3300025960 Bacteria 1771
638 Ga0207651_10610293 3300025960 Bacteria 954
639 Ga0207651_10674730 3300025960 Bacteria 909
640 Ga0207712_10010563 3300025961 Bacteria 5864
641 Ga0207712_10517049 3300025961 Bacteria 1022
642 Ga0207712_10593420 3300025961 Bacteria 957
643 Ga0207668_10057438 3300025972 Bacteria 2715
644 Ga0207668_10192356 3300025972 Bacteria 1618
645 Ga0207668_10327593 3300025972 Bacteria 1273
646 Ga0207668_10348069 3300025972 Bacteria 1238
647 Ga0207640_10038454 3300025981 Bacteria 3019
648 Ga0207640_10340913 3300025981 Bacteria 1200
649 Ga0207640_10719134 3300025981 Bacteria 858
650 Ga0207658_10021141 3300025986 Bacteria 4513
651 Ga0207658_10060962 3300025986 Bacteria 2817
652 Ga0207658_10205005 3300025986 Bacteria 1649
653 Ga0207658_10328460 3300025986 Bacteria 1326
654 Ga0207658_10549681 3300025986 Bacteria 1033
655 Ga0207677_10008442 3300026023 Bacteria 5753
656 Ga0207677_10160010 3300026023 Bacteria 1748
657 Ga0207677_10172137 3300026023 Bacteria 1694
658 Ga0207677_10219283 3300026023 Bacteria 1524
659 Ga0207677_10591460 3300026023 Bacteria 973
660 Ga0207703_10005935 3300026035 Bacteria 9786
661 Ga0207703_10019346 3300026035 Bacteria 5320
662 Ga0207703_10046137 3300026035 Bacteria 3509
663 Ga0207703_10047676 3300026035 Bacteria 3456
664 Ga0207703_10059758 3300026035 Bacteria 3114
665 Ga0207703_10068184 3300026035 Unclassified 2931
666 Ga0207703_10089187 3300026035 Bacteria 2590
667 Ga0207703_10127719 3300026035 Bacteria 2191
668 Ga0207703_10151641 3300026035 Bacteria 2022
669 Ga0207703_10174423 3300026035 Bacteria 1893
670 Ga0207703_10678756 3300026035 Bacteria 979
671 Ga0207639_10097959 3300026041 Bacteria 2363
672 Ga0207678_10132000 3300026067 Bacteria 2131
673 Ga0207678_10541223 3300026067 Bacteria 1018
674 Ga0207708_10023190 3300026075 Bacteria 4689
675 Ga0207708_10092791 3300026075 Unclassified 2330
676 Ga0207708_10094470 3300026075 Bacteria 2308
677 Ga0207708_10095294 3300026075 Bacteria 2298
678 Ga0207641_10000618 3300026088 Bacteria 38777
679 Ga0207641_10000931 3300026088 Bacteria 30226
680 Ga0207641_10048663 3300026088 Bacteria 3579
681 Ga0207641_10074265 3300026088 Unclassified 2932
682 Ga0207641_10372646 3300026088 Bacteria 1365
683 Ga0207648_10018013 3300026089 Bacteria 6402
684 Ga0207648_10050677 3300026089 Unclassified 3629
685 Ga0207648_10075748 3300026089 Bacteria 2933
686 Ga0207648_10111132 3300026089 Bacteria 2406
687 Ga0207676_10010580 3300026095 Bacteria 6576
688 Ga0207676_10026350 3300026095 Bacteria 4324
689 Ga0207676_10073794 3300026095 Bacteria 2747
690 Ga0207676_10079332 3300026095 Unclassified 2662
691 Ga0207676_10332440 3300026095 Bacteria 1399
692 Ga0207676_11084643 3300026095 Bacteria 791
693 Ga0207674_10357320 3300026116 Bacteria 1412
694 Ga0207675_100003041 3300026118 Bacteria 16446
695 Ga0207675_100012703 3300026118 Bacteria 7870
696 Ga0207675_100021398 3300026118 Bacteria 6024
697 Ga0207675_100208078 3300026118 Bacteria 1881
698 Ga0207675_100337815 3300026118 Bacteria 1474
699 Ga0207675_100374348 3300026118 Bacteria 1399
700 Ga0207675_100453401 3300026118 Bacteria 1271
701 Ga0207675_100711786 3300026118 Bacteria 1014
702 Ga0207675_101003419 3300026118 Bacteria 853
703 Ga0207683_10080305 3300026121 Bacteria 2893
704 Ga0207683_10133515 3300026121 Bacteria 2233
705 Ga0207683_10165640 3300026121 Bacteria 2000
706 Ga0207683_10192918 3300026121 Bacteria 1850
707 Ga0207683_10606406 3300026121 Bacteria 1013
708 Ga0207683_10713402 3300026121 Bacteria 930
709 Ga0207683_10946113 3300026121 Bacteria 800
710 Ga0207698_10270431 3300026142 Unclassified 1566
711 Ga0207428_10000002 3300027907 Bacteria 854851
712 Ga0207428_10000498 3300027907 Bacteria 46872
713 Ga0207428_10004323 3300027907 Bacteria 13563
714 Ga0207428_10006675 3300027907 Bacteria 10597
715 Ga0207428_10028634 3300027907 Unclassified 4626
716 Ga0207428_10134591 3300027907 Bacteria 1890
717 Ga0207428_10136105 3300027907 Bacteria 1878
718 Ga0268266_10011683 3300028379 Bacteria 7621
719 Ga0268266_10105558 3300028379 Unclassified 2489
720 Ga0268265_10002782 3300028380 Bacteria 12889
721 Ga0268265_10025651 3300028380 Bacteria 4187
722 Ga0268265_10172505 3300028380 Bacteria 1850
723 Ga0268265_10282924 3300028380 Bacteria 1485
724 Ga0268265_10531489 3300028380 Bacteria 1113
725 Ga0268265_10843172 3300028380 Bacteria 896
726 Ga0268265_10904431 3300028380 Bacteria 867
727 Ga0268265_10973554 3300028380 Bacteria 837
728 Ga0268264_10128079 3300028381 Bacteria 2246
729 Ga0268264_10179759 3300028381 Bacteria 1920
730 Ga0268264_10324845 3300028381 Unclassified 1456
731 Ga0268264_10625134 3300028381 Bacteria 1064
732 Ga0307408_100018869 3300031548 Bacteria 4638
733 Ga0307408_100586644 3300031548 Bacteria 988
734 Ga0265314_10025458 3300031711 Bacteria 4463
735 Ga0265314_10097387 3300031711 Bacteria 1900
736 Ga0307405_10766623 3300031731 Bacteria 805
737 Ga0316577_10021421 3300031733 Bacteria 3586
738 Ga0316577_10286331 3300031733 Bacteria 933
739 Ga0316577_10309082 3300031733 Bacteria 896
740 Ga0307410_10155592 3300031852 Bacteria 1707
741 Ga0307407_10424409 3300031903 Bacteria 959
742 Ga0307416_100796024 3300032002 Bacteria 1041
743 Ga0307416_100926214 3300032002 Bacteria 972
744 Ga0307415_100162838 3300032126 Bacteria 1731
745 Ga0373930_0000481 3300034816 Bacteria 5405
746 Ga0373948_0000587 3300034817 Bacteria 4656
747 Ga0373950_0004065 3300034818 Bacteria 2129
748 Ga0373958_0000404 3300034819 Bacteria 5240
749 Ga0373958_0002235 3300034819 Unclassified 2693
750 Ga0373959_0002640 3300034820 Bacteria 2845
751 Ga0373938_0003896 3300034957 Bacteria 2467
752 Ga0373928_0014015 3300035084 Bacteria 1615
753 Ga0373929_0000196 3300035085 Bacteria 10823
754 Ga0373929_0056283 3300035085 Bacteria 911
755 Ga0373934_0085491 3300035086 Bacteria 1269
756 Ga0373940_0014005 3300035088 Bacteria 1950
757 Ga0373944_0033627 3300035089 Bacteria 1554
758 Ga0373949_0006475 3300035090 Unclassified 2574
759 Ga0373949_0007247 3300035090 Bacteria 2428
760 Ga0373951_0000268 3300035091 Bacteria 16605
761 Ga0373952_0002993 3300035092 Bacteria 3050
762 Ga0373932_0000829 3300035112 Bacteria 9131
763 Ga0373932_0110799 3300035112 Bacteria 904
764 Ga0373932_0171155 3300035112 Bacteria 757
765 Ga0373936_0020241 3300035113 Bacteria 2584
766 Ga0373939_0000363 3300035114 Bacteria 11480
767 Ga0373941_0004028 3300035115 Bacteria 3367
768 Ga0373941_0113985 3300035115 Bacteria 956
769 Ga0373945_0075372 3300035116 Bacteria 1284
770 Ga0373954_0079879 3300035118 Bacteria 1562
771 Ga0373956_0027069 3300035119 Bacteria 2487
772 Ga0373956_0075663 3300035119 Unclassified 1540
773 Ga0373956_0263122 3300035119 Bacteria 820
774 Ga0373960_0000784 3300035121 Bacteria 6662
775 Ga0373943_0010594 3300035170 Bacteria 4135
776 Ga0373943_0143166 3300035170 Bacteria 1290
777 Ga0373946_0014905 3300035171 Bacteria 2938
778 Ga0373946_0212753 3300035171 Bacteria 931
779 Ga0373955_0069320 3300035172 Bacteria 1967
780 Ga0373955_0145717 3300035172 Bacteria 1391
781 Ga0373942_0000106 3300035207 Bacteria 18802
782 Ga0373961_0001445 3300035241 Bacteria 6999
783 Ga0373961_0033559 3300035241 Bacteria 1446
784 Ga0373962_0000782 3300035242 Bacteria 7262
785 Ga0373924_0010465 3300035410 Bacteria 3420
786 Ga0373924_0105760 3300035410 Bacteria 1213
787 Ga0373931_0002897 3300035691 Bacteria 7649
788 Ga0373931_0070323 3300035691 Unclassified 1909
789 Ga0373931_0280311 3300035691 Bacteria 1023
790 Ga0373935_0058187 3300035692 Bacteria 2468
791 Ga0373935_0075145 3300035692 Bacteria 2186
792 Ga0373927_0384829 3300035695 Bacteria 925
793 Ga0373933_0161036 3300035724 Bacteria 1425
794 Ga0373947_0145276 3300035725 Bacteria 1524
795 Ga0373937_0018052 3300036401 Bacteria 6292
796 Ga0373937_0037227 3300036401 Bacteria 4434
797 Ga0373937_0051703 3300036401 Bacteria 3766
798 Ga0373937_1167659 3300036401 Bacteria 718
799 Ga0316584_0024677 3300036712 Bacteria 4403
800 Ga0316584_0121707 3300036712 Bacteria 1950
801 Ga0373925_0004526 3300037068 Bacteria 10501
802 Ga0373925_0107399 3300037068 Bacteria 2153
803 Ga0373925_0143287 3300037068 Bacteria 1872
804 Ga0373925_0205364 3300037068 Bacteria 1568
805 Ga0373925_0246977 3300037068 Bacteria 1431
806 Ga0373925_0324081 3300037068 Bacteria 1247
807 Ga0400489_37299 3300039093 Bacteria 63307
808 Ga0451853_2376905 3300041512 Bacteria 1220
809 Ga0439462_0010325 3300042015 Bacteria 2365
810 Ga0439446_0010878 3300042156 Bacteria 2459
811 Ga0439434_0033992 3300042435 Bacteria 1556
812 Ga0439435_0001998 3300042436 Bacteria 3937
813 Ga0439460_0022010 3300042461 Bacteria 1746
814 Ga0450916_004616 3300042530 Bacteria 1562
815 Ga0451577_0001213 3300042876 Bacteria 36010
816 Ga0439440_0003015 3300042993 Bacteria 3209
817 Ga0453684_0006396 3300044712 Bacteria 22426
818 Ga0453684_0104817 3300044712 Bacteria 3451
819 Ga0451576_0004289 3300045051 Bacteria 18673
820 Ga0451576_0082457 3300045051 Bacteria 3345
821 Ga0451576_0194662 3300045051 Unclassified 2117
822 Ga0451576_0675770 3300045051 Bacteria 1085
823 Ga0451576_1185863 3300045051 Bacteria 798
824 Ga0495592_0005092 3300046454 Bacteria 9680
825 Ga0495592_0039393 3300046454 Bacteria 3550
826 Ga0495592_0223442 3300046454 Bacteria 1258
827 Ga0495603_0016614 3300046455 Bacteria 4453
828 Ga0495603_0042338 3300046455 Bacteria 2722
829 Ga0495603_0319125 3300046455 Bacteria 892
830 Ga0495629_0010215 3300046459 Bacteria 6839
831 Ga0495629_0058559 3300046459 Bacteria 2694
832 Ga0495629_0132393 3300046459 Bacteria 1737
833 Ga0495651_0111619 3300046462 Bacteria 2021
834 Ga0495653_0134080 3300046463 Bacteria 1749
835 Ga0495653_0190698 3300046463 Bacteria 1399
836 Ga0495580_0037732 3300046472 Bacteria 3465
837 Ga0495580_0388141 3300046472 Bacteria 943
838 Ga0495582_0061536 3300046473 Bacteria 2073
839 Ga0495582_0200025 3300046473 Bacteria 1141
840 Ga0495639_0012511 3300046475 Bacteria 3660
841 Ga0495664_0177225 3300046477 Bacteria 1293
842 Ga0495594_0004637 3300046499 Bacteria 7079
843 Ga0495594_0014029 3300046499 Bacteria 4196
844 Ga0495608_0007525 3300046511 Bacteria 7688
845 Ga0495608_0092718 3300046511 Bacteria 1952
846 Ga0495618_0221369 3300046514 Bacteria 1194
847 Ga0495628_0197877 3300046516 Bacteria 1515
848 Ga0495630_0008326 3300046517 Bacteria 7444
849 Ga0495630_0036510 3300046517 Bacteria 3674
850 Ga0495630_0097400 3300046517 Bacteria 2225
851 Ga0495644_0037590 3300046523 Bacteria 1827
852 Ga0495642_0096140 3300046528 Bacteria 1257
853 Ga0495640_0109196 3300046533 Bacteria 1809
854 Ga0495586_0039319 3300046535 Bacteria 2543
855 Ga0495587_0116698 3300046536 Bacteria 1531
856 Ga0495587_0247391 3300046536 Bacteria 1003
857 Ga0495621_0009004 3300046539 Bacteria 3015
858 Ga0495621_0011882 3300046539 Bacteria 2706
859 Ga0495621_0026434 3300046539 Bacteria 1958
860 Ga0495645_0013479 3300046543 Bacteria 5781
861 Ga0495645_0015615 3300046543 Bacteria 5402
862 Ga0495634_0044133 3300046642 Bacteria 3019
863 Ga0495634_0045756 3300046642 Bacteria 2957
864 Ga0495634_0174840 3300046642 Bacteria 1348
865 Ga0495635_0234419 3300046663 Bacteria 1239
866 Ga0495635_0304722 3300046663 Bacteria 1068
867 Ga0495659_0048190 3300046664 Bacteria 1543
868 Ga0495588_0008824 3300046674 Bacteria 4635
869 Ga0495588_0295183 3300046674 Bacteria 854
870 Ga0495599_0024841 3300046678 Bacteria 3747
871 Ga0495599_0057269 3300046678 Bacteria 2439
872 Ga0495599_0106541 3300046678 Bacteria 1747
873 Ga0495599_0196586 3300046678 Bacteria 1240
874 Ga0495623_0060575 3300046679 Bacteria 2375
875 Ga0495647_0037525 3300046681 Bacteria 1829
876 Ga0495647_0152718 3300046681 Bacteria 991
877 Ga0495658_0076337 3300046683 Bacteria 1958
878 Ga0495658_0287906 3300046683 Bacteria 1038
879 Ga0495669_0003252 3300046684 Bacteria 6683
880 Ga0495669_0013479 3300046684 Bacteria 3484
881 Ga0495669_0017563 3300046684 Bacteria 3071
882 Ga0495669_0112128 3300046684 Bacteria 1274
883 Ga0495613_0028263 3300046689 Bacteria 4171
884 Ga0495613_0500560 3300046689 Bacteria 818
885 Ga0495649_0202299 3300046694 Bacteria 1031
886 Ga0495581_0363829 3300047315 Bacteria 844
887 Ga0495604_0037493 3300047317 Bacteria 3817
888 Ga0495604_0215550 3300047317 Bacteria 1325
889 Ga0495674_0002541 3300047319 Bacteria 17769
890 Ga0495674_0121031 3300047319 Bacteria 2211
891 Ga0495674_0417646 3300047319 Bacteria 1081
892 Ga0495676_0064474 3300047321 Bacteria 2849
893 Ga0495675_0129063 3300047444 Bacteria 1572
894 Ga0495675_0192007 3300047444 Unclassified 1246
895 Ga0495677_0051702 3300047445 Bacteria 1513
896 Ga0495684_0000483 3300047471 Bacteria 32529
897 Ga0495684_0071397 3300047471 Bacteria 2638
898 Ga0495684_0191703 3300047471 Bacteria 1511
899 Ga0496101_0004437 3300048904 Bacteria 8834
900 Ga0496104_0006222 3300048907 Bacteria 10492
901 Ga0496104_0130690 3300048907 Bacteria 2412
902 Ga0496104_0204704 3300048907 Bacteria 1885
903 Ga0496104_0333470 3300048907 Bacteria 1430
904 Ga0496105_0065877 3300048908 Bacteria 2990
905 Ga0496106_0080166 3300048909 Bacteria 2507
906 Ga0496109_0101312 3300048912 Unclassified 2673
907 Ga0496109_0107745 3300048912 Bacteria 2589
908 Ga0496110_0034737 3300048913 Bacteria 4370
909 Ga0496110_0405177 3300048913 Bacteria 1243
910 Ga0496112_0144982 3300048915 Bacteria 2343
911 Ga0496112_1029679 3300048915 Bacteria 743
912 Ga0496114_0000323 3300048917 Bacteria 35005
913 Ga0496114_0456467 3300048917 Bacteria 1131
914 Ga0501033_0037372 3300049570 Bacteria 3635
915 Ga0501034_0411366 3300049571 Bacteria 1275
916 Ga0501034_0420919 3300049571 Bacteria 1257
917 Ga0501036_0011194 3300049572 Bacteria 7423
918 Ga0501036_0162297 3300049572 Bacteria 1884
919 Ga0501036_0223668 3300049572 Bacteria 1580
920 Ga0501037_0321111 3300049573 Bacteria 1072
921 Ga0501038_0074848 3300049574 Bacteria 2864
922 Ga0501039_0052450 3300049575 Bacteria 3156
923 Ga0501039_0137610 3300049575 Bacteria 1918
924 Ga0501039_0527312 3300049575 Bacteria 927
925 Ga0501040_0026771 3300049576 Bacteria 3879
926 Ga0501040_0034146 3300049576 Bacteria 3446
927 Ga0501041_0033465 3300049577 Bacteria 3110
928 Ga0501041_0195566 3300049577 Bacteria 1267
929 Ga0501042_0007112 3300049578 Bacteria 7316
930 Ga0501042_0011481 3300049578 Bacteria 5980
931 Ga0501042_0035523 3300049578 Bacteria 3536
932 Ga0501042_0140702 3300049578 Bacteria 1740
933 Ga0501046_0017522 3300049580 Bacteria 5973
934 Ga0501046_0097362 3300049580 Bacteria 2260
935 Ga0501046_0168788 3300049580 Bacteria 1643
936 Ga0501046_0422051 3300049580 Bacteria 961
937 Ga0501067_0032662 3300049583 Bacteria 2889
938 Ga0501068_0303689 3300049584 Bacteria 1022
939 Ga0501071_0010224 3300049587 Bacteria 6280
940 Ga0501071_0025277 3300049587 Bacteria 4159
941 Ga0501072_0055149 3300049588 Bacteria 3133
942 Ga0501072_0214421 3300049588 Bacteria 1534
943 Ga0501072_0379862 3300049588 Bacteria 1121
944 Ga0501075_0011967 3300049591 Bacteria 6157
945 Ga0501075_0078357 3300049591 Bacteria 2501
946 Ga0501075_0123528 3300049591 Bacteria 1970
947 Ga0501076_0004291 3300049592 Bacteria 10106
948 Ga0501076_0336704 3300049592 Bacteria 1238
949 Ga0501249_026565 3300049679 Bacteria 1280
950 Ga0501079_0023050 3300049741 Bacteria 4779
951 Ga0501079_0084656 3300049741 Bacteria 2453
952 Ga0501079_0340037 3300049741 Bacteria 1176
953 Ga0501080_0043985 3300049742 Bacteria 4158
954 Ga0501081_0001907 3300049743 Bacteria 12936
955 Ga0501081_0007180 3300049743 Bacteria 7246
956 Ga0501081_0355403 3300049743 Bacteria 1080
957 Ga0501083_0193024 3300049744 Bacteria 1329
958 Ga0501035_0087425 3300049822 Bacteria 2747
959 Ga0501044_0100182 3300049823 Bacteria 2916
960 Ga0501045_0005841 3300049824 Bacteria 8522
961 Ga0501045_0075531 3300049824 Bacteria 2482
962 Ga0501045_0081204 3300049824 Bacteria 2390
963 Ga0501045_0104253 3300049824 Bacteria 2101
964 Ga0501045_0502184 3300049824 Bacteria 901
965 nmdc:mga03683_41612_c1 3300050489 Bacteria 1888
966 nmdc:mga00v17_41723_c1 3300050491 Bacteria 2757
967 nmdc:mga0k408_5006_c1 3300050493 Bacteria 7017
968 nmdc:mga06z11_10949_c1 3300050494 Bacteria 3889
969 nmdc:mga05p37_107236_c1 3300050507 Bacteria 3437
970 nmdc:mga05p37_168945_c1 3300050507 Bacteria 2668
971 nmdc:mga05p37_214936_c1 3300050507 Bacteria 2323
972 nmdc:mga05p37_216724_c1 3300050507 Bacteria 2312
973 nmdc:mga05p37_21703_c1 3300050507 Bacteria 7778
974 nmdc:mga05p37_220104_c1 3300050507 Bacteria 2291
975 nmdc:mga05p37_250891_c1 3300050507 Bacteria 2123
976 nmdc:mga05p37_27529_c1 3300050507 Bacteria 6921
977 nmdc:mga05p37_285361_c1 3300050507 Bacteria 1967
978 nmdc:mga05p37_50178_c1 3300050507 Bacteria 5131
979 nmdc:mga05p37_507175_c1 3300050507 Bacteria 1383
980 nmdc:mga05p37_54488_c1 3300050507 Bacteria 4920
981 nmdc:mga05p37_729_c1 3300050507 Bacteria 36493
982 nmdc:mga05p37_95715_c1 3300050507 Bacteria 3658
983 nmdc:mga09592_128695_c1 3300050508 Bacteria 2177
984 nmdc:mga09592_18264_c1 3300050508 Bacteria 5750
985 nmdc:mga09592_31693_c1 3300050508 Bacteria 4405
986 nmdc:mga09592_4217_c1 3300050508 Bacteria 11609
987 nmdc:mga09592_433009_c1 3300050508 Bacteria 1135
988 nmdc:mga09592_64647_c1 3300050508 Bacteria 3097
989 nmdc:mga0qj67_10794_c1 3300050509 Bacteria 6831
990 nmdc:mga0qj67_223700_c1 3300050509 Bacteria 1528
991 nmdc:mga0qj67_239257_c1 3300050509 Bacteria 1473
992 nmdc:mga0qj67_33079_c1 3300050509 Bacteria 4034
993 nmdc:mga06r32_117282_c1 3300050510 Bacteria 2624
994 nmdc:mga06r32_142226_c1 3300050510 Bacteria 2376
995 nmdc:mga06r32_24864_c1 3300050510 Bacteria 5566
996 nmdc:mga06r32_46173_c1 3300050510 Bacteria 4156
997 nmdc:mga06r32_670589_c1 3300050510 Bacteria 1004
998 nmdc:mga06r32_84115_c1 3300050510 Bacteria 3100
999 nmdc:mga06r32_95431_c1 3300050510 Bacteria 2911
1000 nmdc:mga08y16_10686_c1 3300050511 Bacteria 9632
1001 nmdc:mga08y16_16048_c1 3300050511 Bacteria 7874
1002 nmdc:mga08y16_2315_c1 3300050511 Bacteria 19506
1003 nmdc:mga08y16_327936_c1 3300050511 Bacteria 1575
1004 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
1005 nmdc:mga08y16_41140_c1 3300050511 Bacteria 4842
1006 nmdc:mga08y16_60376_c1 3300050511 Bacteria 3961
1007 nmdc:mga08y16_825935_c1 3300050511 Bacteria 918
1008 nmdc:mga0n895_10073_c1 3300050512 Bacteria 8319
1009 nmdc:mga0n895_148545_c1 3300050512 Unclassified 2373
1010 nmdc:mga0n895_265357_c1 3300050512 Bacteria 1742
1011 nmdc:mga0n895_391216_c1 3300050512 Bacteria 1406
1012 nmdc:mga0n895_44088_c1 3300050512 Bacteria 4350
1013 nmdc:mga0n895_46964_c1 3300050512 Bacteria 4220
1014 nmdc:mga0n895_491061_c1 3300050512 Bacteria 1238
1015 nmdc:mga0n895_8576_c1 3300050512 Bacteria 8863
1016 nmdc:mga0rr50_12374_c1 3300050513 Bacteria 5513
1017 nmdc:mga0rr50_28496_c1 3300050513 Bacteria 3927
1018 nmdc:mga0rr50_412486_c1 3300050513 Unclassified 1142
1019 nmdc:mga08x19_3138_c1 3300050514 Bacteria 9922
1020 nmdc:mga08x19_585880_c1 3300050514 Bacteria 790
1021 nmdc:mga0a205_134513_c1 3300050515 Unclassified 2373
1022 nmdc:mga0a205_198400_c1 3300050515 Bacteria 1898
1023 nmdc:mga0a205_211576_c1 3300050515 Bacteria 1827
1024 nmdc:mga0a205_44111_c1 3300050515 Bacteria 4298
1025 nmdc:mga0a205_54635_c1 3300050515 Bacteria 3856
1026 nmdc:mga0a205_85489_c1 3300050515 Bacteria 3046
1027 Ga0495595_0022962 3300053084 Bacteria 2743
1028 Ga0495619_0005642 3300053085 Bacteria 7935
1029 Ga0495619_0025745 3300053085 Bacteria 3780
1030 Ga0495619_0062239 3300053085 Bacteria 2484
1031 Ga0495619_0584314 3300053085 Bacteria 765
1032 Ga0500556_0026638 3300053104 Bacteria 1922
1033 Ga0501084_0018944 3300054114 Bacteria 5730
1034 Ga0501084_0021867 3300054114 Bacteria 5334
1035 Ga0501084_0460448 3300054114 Bacteria 1075
1036 Ga0590071_000262 3300059421 Bacteria 15367
1037 Ga0590074_002317 3300059423 Bacteria 3121
1038 Ga0590075_000379 3300059424 Bacteria 12188
1039 Ga0590077_000100 3300059426 Bacteria 22536
1040 Ga0501082_0003546 3300060353 Bacteria 13629
1041 Ga0501082_0052391 3300060353 Bacteria 3518
1042 Ga0501082_1033112 3300060353 Bacteria 719
1043 Ga0530510_0101840 3300061734 Bacteria 2100
1044 Ga0530510_0186629 3300061734 Bacteria 1539

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100392169 Ga0068862_1003921692 210
2 3300025942 Ga0207689_10806911 Ga0207689_108069111 210
3 3300005549 Ga0070704_100463186 Ga0070704_1004631862 212
4 3300009177 Ga0105248_10141080 Ga0105248_101410803 212
5 3300013308 Ga0157375_10258182 Ga0157375_102581822 212
6 3300025941 Ga0207711_10050303 Ga0207711_100503033 212
7 3300009093 Ga0105240_10040805 Ga0105240_100408053 213
8 3300025913 Ga0207695_10050891 Ga0207695_100508915 213
9 3300039093 Ga0400489_37299 Ga0400489_37299_51105_51752 214
10 3300050510 nmdc:mga06r32_142226_c1 nmdc:mga06r32_142226_c1_87_743 214
11 iso_pu_bacteria 2864997549 2865000082 214
12 3300005288 Ga0065714_10148072 Ga0065714_101480722 215
13 3300005290 Ga0065712_10067826 Ga0065712_100678267 215
14 3300005354 Ga0070675_100116245 Ga0070675_1001162453 215
15 3300005354 Ga0070675_100601786 Ga0070675_1006017861 215
16 3300005355 Ga0070671_100415539 Ga0070671_1004155392 215
17 3300005366 Ga0070659_100237563 Ga0070659_1002375632 215
18 3300005564 Ga0070664_100258174 Ga0070664_1002581742 215
19 3300005841 Ga0068863_100254071 Ga0068863_1002540712 215
20 3300013308 Ga0157375_10920887 Ga0157375_109208872 215
21 3300014326 Ga0157380_10445877 Ga0157380_104458772 215
22 3300014745 Ga0157377_10088800 Ga0157377_100888002 215
23 3300025908 Ga0207643_10133864 Ga0207643_101338642 215
24 3300025926 Ga0207659_10375867 Ga0207659_103758672 215
25 3300025931 Ga0207644_10354307 Ga0207644_103543072 215
26 3300025945 Ga0207679_10125927 Ga0207679_101259272 215
27 3300026088 Ga0207641_10372646 Ga0207641_103726462 215
28 3300035171 Ga0373946_0212753 Ga0373946_0212753_186_866 215
29 3300036712 Ga0316584_0121707 Ga0316584_0121707_1082_1732 215
30 3300037068 Ga0373925_0324081 Ga0373925_0324081_455_1135 215
31 3300050507 nmdc:mga05p37_27529_c1 nmdc:mga05p37_27529_c1_1347_2021 215
32 3300050512 nmdc:mga0n895_491061_c1 nmdc:mga0n895_491061_c1_23_697 215
33 3300003203 JGI25406J46586_10096364 JGI25406J46586_100963641 216
34 3300005445 Ga0070708_100586426 Ga0070708_1005864262 216
35 3300005458 Ga0070681_10556187 Ga0070681_105561872 216
36 3300005985 Ga0081539_10003749 Ga0081539_1000374916 216
37 3300006871 Ga0075434_100134242 Ga0075434_1001342423 216
38 3300009094 Ga0111539_10306692 Ga0111539_103066922 216
39 3300009094 Ga0111539_11013283 Ga0111539_110132832 216
40 3300009147 Ga0114129_10107673 Ga0114129_101076736 216
41 3300013308 Ga0157375_11331709 Ga0157375_113317091 216
42 3300025933 Ga0207706_10679086 Ga0207706_106790861 216
43 3300026067 Ga0207678_10541223 Ga0207678_105412231 216
44 3300027907 Ga0207428_10134591 Ga0207428_101345912 216
45 3300050507 nmdc:mga05p37_285361_c1 nmdc:mga05p37_285361_c1_797_1471 216
46 3300050507 nmdc:mga05p37_507175_c1 nmdc:mga05p37_507175_c1_234_923 216
47 3300050511 nmdc:mga08y16_327936_c1 nmdc:mga08y16_327936_c1_401_1090 216
48 3300050512 nmdc:mga0n895_265357_c1 nmdc:mga0n895_265357_c1_38_727 216
49 3300059424 Ga0590075_000379 Ga0590075_000379_9660_10343 216
50 3300031733 Ga0316577_10021421 Ga0316577_100214212 217
51 3300031733 Ga0316577_10309082 Ga0316577_103090822 217
52 3300036712 Ga0316584_0024677 Ga0316584_0024677_2976_3632 217
53 3300042461 Ga0439460_0022010 Ga0439460_0022010_484_1143 217
54 3300049578 Ga0501042_0140702 Ga0501042_0140702_169_828 217
55 3300005547 Ga0070693_100128986 Ga0070693_1001289862 218
56 3300049571 Ga0501034_0420919 Ga0501034_0420919_502_1167 218
57 3300049823 Ga0501044_0100182 Ga0501044_0100182_531_1196 218
58 3300005293 Ga0065715_10171797 Ga0065715_101717972 219
59 3300005331 Ga0070670_100190644 Ga0070670_1001906442 219
60 3300005340 Ga0070689_100069026 Ga0070689_1000690263 219
61 3300005353 Ga0070669_100085447 Ga0070669_1000854474 219
62 3300005355 Ga0070671_100079392 Ga0070671_1000793922 219
63 3300005355 Ga0070671_100497844 Ga0070671_1004978441 219
64 3300005356 Ga0070674_100360219 Ga0070674_1003602192 219
65 3300005364 Ga0070673_100048209 Ga0070673_1000482092 219
66 3300005364 Ga0070673_100170807 Ga0070673_1001708073 219
67 3300005365 Ga0070688_100147060 Ga0070688_1001470601 219
68 3300005438 Ga0070701_10173387 Ga0070701_101733872 219
69 3300005445 Ga0070708_100019170 Ga0070708_1000191703 219
70 3300005445 Ga0070708_100335527 Ga0070708_1003355272 219
71 3300005459 Ga0068867_100389828 Ga0068867_1003898282 219
72 3300005468 Ga0070707_100580317 Ga0070707_1005803172 219
73 3300005543 Ga0070672_100071567 Ga0070672_1000715673 219
74 3300005546 Ga0070696_100488051 Ga0070696_1004880512 219
75 3300005549 Ga0070704_100058059 Ga0070704_1000580593 219
76 3300005617 Ga0068859_100016051 Ga0068859_1000160515 219
77 3300005719 Ga0068861_100122823 Ga0068861_1001228233 219
78 3300006237 Ga0097621_100076538 Ga0097621_1000765383 219
79 3300006237 Ga0097621_100366294 Ga0097621_1003662941 219
80 3300006931 Ga0097620_100016051 Ga0097620_1000160516 219
81 3300007076 Ga0075435_100045790 Ga0075435_1000457904 219
82 3300009147 Ga0114129_10006412 Ga0114129_100064126 219
83 3300009553 Ga0105249_10174354 Ga0105249_101743543 219
84 3300013296 Ga0157374_10114249 Ga0157374_101142492 219
85 3300013297 Ga0157378_10005352 Ga0157378_100053529 219
86 3300014969 Ga0157376_10395389 Ga0157376_103953892 219
87 3300025922 Ga0207646_10116739 Ga0207646_101167394 219
88 3300025925 Ga0207650_10021983 Ga0207650_100219833 219
89 3300025926 Ga0207659_10466143 Ga0207659_104661431 219
90 3300025931 Ga0207644_10451593 Ga0207644_104515932 219
91 3300025933 Ga0207706_10167789 Ga0207706_101677893 219
92 3300025937 Ga0207669_10702891 Ga0207669_107028912 219
93 3300025940 Ga0207691_10169262 Ga0207691_101692622 219
94 3300025941 Ga0207711_10062770 Ga0207711_100627704 219
95 3300025942 Ga0207689_10431041 Ga0207689_104310412 219
96 3300025960 Ga0207651_10100362 Ga0207651_101003623 219
97 3300026118 Ga0207675_100208078 Ga0207675_1002080783 219
98 3300026121 Ga0207683_10192918 Ga0207683_101929184 219
99 3300028380 Ga0268265_10282924 Ga0268265_102829242 219
100 3300031733 Ga0316577_10286331 Ga0316577_102863312 219
101 3300042876 Ga0451577_0001213 Ga0451577_0001213_21998_22663 219
102 3300044712 Ga0453684_0104817 Ga0453684_0104817_2432_3097 219
103 3300046463 Ga0495653_0134080 Ga0495653_0134080_551_1216 219
104 3300046536 Ga0495587_0247391 Ga0495587_0247391_30_695 219
105 3300049570 Ga0501033_0037372 Ga0501033_0037372_957_1634 219
106 3300049572 Ga0501036_0011194 Ga0501036_0011194_2155_2832 219
107 3300049574 Ga0501038_0074848 Ga0501038_0074848_1959_2636 219
108 3300049575 Ga0501039_0052450 Ga0501039_0052450_1997_2674 219
109 3300049576 Ga0501040_0034146 Ga0501040_0034146_450_1127 219
110 3300049578 Ga0501042_0011481 Ga0501042_0011481_2952_3629 219
111 3300049580 Ga0501046_0017522 Ga0501046_0017522_4856_5533 219
112 3300049587 Ga0501071_0010224 Ga0501071_0010224_1099_1776 219
113 3300049588 Ga0501072_0214421 Ga0501072_0214421_525_1202 219
114 3300049591 Ga0501075_0123528 Ga0501075_0123528_12_689 219
115 3300049592 Ga0501076_0004291 Ga0501076_0004291_3097_3774 219
116 3300049741 Ga0501079_0023050 Ga0501079_0023050_2952_3629 219
117 3300049742 Ga0501080_0043985 Ga0501080_0043985_2661_3338 219
118 3300049743 Ga0501081_0001907 Ga0501081_0001907_2807_3484 219
119 3300049744 Ga0501083_0193024 Ga0501083_0193024_441_1118 219
120 3300049822 Ga0501035_0087425 Ga0501035_0087425_207_884 219
121 3300049824 Ga0501045_0005841 Ga0501045_0005841_1351_2028 219
122 3300050513 nmdc:mga0rr50_28496_c1 nmdc:mga0rr50_28496_c1_2053_2730 219
123 3300054114 Ga0501084_0018944 Ga0501084_0018944_4490_5167 219
124 3300060353 Ga0501082_0003546 Ga0501082_0003546_7681_8358 219
125 3300005290 Ga0065712_10140567 Ga0065712_101405672 220
126 3300005293 Ga0065715_10168068 Ga0065715_101680682 220
127 3300005295 Ga0065707_10001067 Ga0065707_100010674 220
128 3300005330 Ga0070690_100007254 Ga0070690_1000072544 220
129 3300005335 Ga0070666_10039257 Ga0070666_100392573 220
130 3300005338 Ga0068868_100007095 Ga0068868_1000070955 220
131 3300005340 Ga0070689_100235229 Ga0070689_1002352293 220
132 3300005343 Ga0070687_100043160 Ga0070687_1000431603 220
133 3300005354 Ga0070675_100096246 Ga0070675_1000962463 220
134 3300005354 Ga0070675_100149507 Ga0070675_1001495072 220
135 3300005355 Ga0070671_100229770 Ga0070671_1002297702 220
136 3300005367 Ga0070667_100091411 Ga0070667_1000914112 220
137 3300005467 Ga0070706_100615637 Ga0070706_1006156372 220
138 3300005468 Ga0070707_100386635 Ga0070707_1003866352 220
139 3300005518 Ga0070699_100011666 Ga0070699_1000116663 220
140 3300005539 Ga0068853_100061015 Ga0068853_1000610152 220
141 3300005543 Ga0070672_100085300 Ga0070672_1000853002 220
142 3300005544 Ga0070686_100001189 Ga0070686_10000118913 220
143 3300005546 Ga0070696_100462802 Ga0070696_1004628022 220
144 3300005546 Ga0070696_100491396 Ga0070696_1004913962 220
145 3300005548 Ga0070665_100053852 Ga0070665_1000538524 220
146 3300005564 Ga0070664_100030218 Ga0070664_1000302185 220
147 3300005577 Ga0068857_100796655 Ga0068857_1007966552 220
148 3300005578 Ga0068854_100008495 Ga0068854_1000084957 220
149 3300005578 Ga0068854_100482471 Ga0068854_1004824712 220
150 3300005719 Ga0068861_100654781 Ga0068861_1006547811 220
151 3300005842 Ga0068858_100004023 Ga0068858_10000402313 220
152 3300005843 Ga0068860_100126642 Ga0068860_1001266423 220
153 3300005985 Ga0081539_10040616 Ga0081539_100406162 220
154 3300006163 Ga0070715_10242795 Ga0070715_102427951 220
155 3300006237 Ga0097621_100001328 Ga0097621_1000013282 220
156 3300006237 Ga0097621_100051441 Ga0097621_1000514414 220
157 3300006237 Ga0097621_100165279 Ga0097621_1001652792 220
158 3300006358 Ga0068871_100011604 Ga0068871_1000116042 220
159 3300006847 Ga0075431_100067943 Ga0075431_1000679434 220
160 3300006871 Ga0075434_100000354 Ga0075434_10000035420 220
161 3300006871 Ga0075434_100286859 Ga0075434_1002868592 220
162 3300006880 Ga0075429_100319352 Ga0075429_1003193523 220
163 3300006914 Ga0075436_100002547 Ga0075436_1000025478 220
164 3300007076 Ga0075435_100051328 Ga0075435_1000513284 220
165 3300009093 Ga0105240_10900445 Ga0105240_109004452 220
166 3300009094 Ga0111539_10000001 Ga0111539_10000001175 220
167 3300009098 Ga0105245_10028953 Ga0105245_100289533 220
168 3300009176 Ga0105242_10026194 Ga0105242_100261943 220
169 3300009177 Ga0105248_10375900 Ga0105248_103759003 220
170 3300009177 Ga0105248_10501080 Ga0105248_105010802 220
171 3300009545 Ga0105237_10078532 Ga0105237_100785323 220
172 3300009551 Ga0105238_10011306 Ga0105238_100113066 220
173 3300013296 Ga0157374_10044119 Ga0157374_100441193 220
174 3300013296 Ga0157374_10178565 Ga0157374_101785652 220
175 3300013297 Ga0157378_10090328 Ga0157378_100903282 220
176 3300014326 Ga0157380_10022314 Ga0157380_100223144 220
177 3300014326 Ga0157380_10193850 Ga0157380_101938501 220
178 3300025321 Ga0207656_10112031 Ga0207656_101120312 220
179 3300025900 Ga0207710_10128300 Ga0207710_101283002 220
180 3300025903 Ga0207680_10053799 Ga0207680_100537993 220
181 3300025903 Ga0207680_10145582 Ga0207680_101455822 220
182 3300025910 Ga0207684_10740599 Ga0207684_107405991 220
183 3300025911 Ga0207654_10095968 Ga0207654_100959681 220
184 3300025914 Ga0207671_10064312 Ga0207671_100643123 220
185 3300025918 Ga0207662_10049434 Ga0207662_100494343 220
186 3300025922 Ga0207646_10243206 Ga0207646_102432062 220
187 3300025924 Ga0207694_10006176 Ga0207694_100061767 220
188 3300025926 Ga0207659_10061761 Ga0207659_100617613 220
189 3300025926 Ga0207659_10337437 Ga0207659_103374372 220
190 3300025931 Ga0207644_10114335 Ga0207644_101143352 220
191 3300025933 Ga0207706_10174387 Ga0207706_101743872 220
192 3300025934 Ga0207686_10157511 Ga0207686_101575112 220
193 3300025940 Ga0207691_10397580 Ga0207691_103975802 220
194 3300025940 Ga0207691_10862468 Ga0207691_108624681 220
195 3300025941 Ga0207711_10057699 Ga0207711_100576992 220
196 3300025941 Ga0207711_10922425 Ga0207711_109224251 220
197 3300025981 Ga0207640_10038454 Ga0207640_100384543 220
198 3300025981 Ga0207640_10340913 Ga0207640_103409132 220
199 3300025986 Ga0207658_10060962 Ga0207658_100609622 220
200 3300026023 Ga0207677_10160010 Ga0207677_101600102 220
201 3300026035 Ga0207703_10046137 Ga0207703_100461374 220
202 3300026041 Ga0207639_10097959 Ga0207639_100979592 220
203 3300026118 Ga0207675_100453401 Ga0207675_1004534012 220
204 3300026118 Ga0207675_101003419 Ga0207675_1010034192 220
205 3300027907 Ga0207428_10000002 Ga0207428_10000002187 220
206 3300028379 Ga0268266_10011683 Ga0268266_100116837 220
207 3300031548 Ga0307408_100018869 Ga0307408_1000188694 220
208 3300031852 Ga0307410_10155592 Ga0307410_101555922 220
209 3300032126 Ga0307415_100162838 Ga0307415_1001628381 220
210 3300034816 Ga0373930_0000481 Ga0373930_0000481_262_942 220
211 3300034817 Ga0373948_0000587 Ga0373948_0000587_2779_3459 220
212 3300034818 Ga0373950_0004065 Ga0373950_0004065_25_705 220
213 3300034819 Ga0373958_0000404 Ga0373958_0000404_3142_3822 220
214 3300034820 Ga0373959_0002640 Ga0373959_0002640_188_868 220
215 3300034957 Ga0373938_0003896 Ga0373938_0003896_295_975 220
216 3300035084 Ga0373928_0014015 Ga0373928_0014015_437_1117 220
217 3300035085 Ga0373929_0000196 Ga0373929_0000196_5873_6553 220
218 3300035088 Ga0373940_0014005 Ga0373940_0014005_495_1175 220
219 3300035090 Ga0373949_0007247 Ga0373949_0007247_1099_1779 220
220 3300035091 Ga0373951_0000268 Ga0373951_0000268_3528_4208 220
221 3300035092 Ga0373952_0002993 Ga0373952_0002993_918_1598 220
222 3300035112 Ga0373932_0000829 Ga0373932_0000829_4459_5139 220
223 3300035112 Ga0373932_0110799 Ga0373932_0110799_127_798 220
224 3300035114 Ga0373939_0000363 Ga0373939_0000363_8123_8803 220
225 3300035115 Ga0373941_0004028 Ga0373941_0004028_2525_3205 220
226 3300035115 Ga0373941_0113985 Ga0373941_0113985_140_814 220
227 3300035119 Ga0373956_0263122 Ga0373956_0263122_132_806 220
228 3300035121 Ga0373960_0000784 Ga0373960_0000784_5568_6248 220
229 3300035207 Ga0373942_0000106 Ga0373942_0000106_16512_17192 220
230 3300035241 Ga0373961_0001445 Ga0373961_0001445_5168_5848 220
231 3300035242 Ga0373962_0000782 Ga0373962_0000782_2919_3599 220
232 3300035691 Ga0373931_0002897 Ga0373931_0002897_4043_4723 220
233 3300041512 Ga0451853_2376905 Ga0451853_2376905_390_1052 220
234 3300046472 Ga0495580_0037732 Ga0495580_0037732_1801_2475 220
235 3300046475 Ga0495639_0012511 Ga0495639_0012511_1855_2529 220
236 3300046684 Ga0495669_0017563 Ga0495669_0017563_1812_2507 220
237 3300049572 Ga0501036_0223668 Ga0501036_0223668_206_883 220
238 3300049580 Ga0501046_0168788 Ga0501046_0168788_914_1591 220
239 3300049588 Ga0501072_0379862 Ga0501072_0379862_382_1050 220
240 3300049591 Ga0501075_0078357 Ga0501075_0078357_159_836 220
241 3300049592 Ga0501076_0336704 Ga0501076_0336704_85_762 220
242 3300049679 Ga0501249_026565 Ga0501249_026565_144_818 220
243 3300049743 Ga0501081_0355403 Ga0501081_0355403_340_1008 220
244 3300049824 Ga0501045_0104253 Ga0501045_0104253_278_955 220
245 3300049824 Ga0501045_0502184 Ga0501045_0502184_68_751 220
246 3300050510 nmdc:mga06r32_46173_c1 nmdc:mga06r32_46173_c1_2606_3286 220
247 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_203575_204255 220
248 3300050512 nmdc:mga0n895_8576_c1 nmdc:mga0n895_8576_c1_7557_8228 220
249 3300050514 nmdc:mga08x19_3138_c1 nmdc:mga08x19_3138_c1_5787_6488 220
250 3300061734 Ga0530510_0186629 Ga0530510_0186629_679_1356 220
251 3300005290 Ga0065712_10075828 Ga0065712_100758283 221
252 3300005295 Ga0065707_10037066 Ga0065707_100370662 221
253 3300005295 Ga0065707_10271034 Ga0065707_102710342 221
254 3300005327 Ga0070658_10261910 Ga0070658_102619102 221
255 3300005329 Ga0070683_100143130 Ga0070683_1001431303 221
256 3300005330 Ga0070690_100001946 Ga0070690_1000019468 221
257 3300005331 Ga0070670_100000685 Ga0070670_10000068510 221
258 3300005333 Ga0070677_10022596 Ga0070677_100225963 221
259 3300005335 Ga0070666_10001117 Ga0070666_1000111713 221
260 3300005335 Ga0070666_10066402 Ga0070666_100664023 221
261 3300005335 Ga0070666_10267088 Ga0070666_102670882 221
262 3300005336 Ga0070680_100096219 Ga0070680_1000962192 221
263 3300005338 Ga0068868_100002612 Ga0068868_1000026122 221
264 3300005338 Ga0068868_100199368 Ga0068868_1001993682 221
265 3300005338 Ga0068868_100509064 Ga0068868_1005090642 221
266 3300005339 Ga0070660_100013279 Ga0070660_1000132793 221
267 3300005339 Ga0070660_100618897 Ga0070660_1006188972 221
268 3300005340 Ga0070689_100036443 Ga0070689_1000364432 221
269 3300005340 Ga0070689_100085426 Ga0070689_1000854263 221
270 3300005343 Ga0070687_100364237 Ga0070687_1003642372 221
271 3300005344 Ga0070661_100016239 Ga0070661_1000162394 221
272 3300005344 Ga0070661_100062768 Ga0070661_1000627683 221
273 3300005353 Ga0070669_100037262 Ga0070669_1000372625 221
274 3300005353 Ga0070669_100084340 Ga0070669_1000843403 221
275 3300005353 Ga0070669_100763896 Ga0070669_1007638961 221
276 3300005354 Ga0070675_100000152 Ga0070675_10000015225 221
277 3300005354 Ga0070675_100000255 Ga0070675_10000025525 221
278 3300005354 Ga0070675_100008820 Ga0070675_1000088201 221
279 3300005354 Ga0070675_100037825 Ga0070675_1000378253 221
280 3300005354 Ga0070675_100049117 Ga0070675_1000491174 221
281 3300005354 Ga0070675_100117749 Ga0070675_1001177492 221
282 3300005355 Ga0070671_100008711 Ga0070671_1000087116 221
283 3300005355 Ga0070671_100021093 Ga0070671_1000210933 221
284 3300005355 Ga0070671_100031711 Ga0070671_1000317113 221
285 3300005356 Ga0070674_100812647 Ga0070674_1008126471 221
286 3300005364 Ga0070673_100008704 Ga0070673_1000087044 221
287 3300005364 Ga0070673_100018346 Ga0070673_1000183462 221
288 3300005364 Ga0070673_100101451 Ga0070673_1001014512 221
289 3300005364 Ga0070673_100149540 Ga0070673_1001495402 221
290 3300005365 Ga0070688_100006958 Ga0070688_1000069584 221
291 3300005365 Ga0070688_100030712 Ga0070688_1000307124 221
292 3300005365 Ga0070688_100297033 Ga0070688_1002970332 221
293 3300005366 Ga0070659_100076707 Ga0070659_1000767073 221
294 3300005366 Ga0070659_100270130 Ga0070659_1002701302 221
295 3300005367 Ga0070667_100000993 Ga0070667_10000099323 221
296 3300005367 Ga0070667_100002300 Ga0070667_1000023008 221
297 3300005367 Ga0070667_100098217 Ga0070667_1000982173 221
298 3300005435 Ga0070714_100057997 Ga0070714_1000579973 221
299 3300005436 Ga0070713_100040062 Ga0070713_1000400625 221
300 3300005436 Ga0070713_100061623 Ga0070713_1000616233 221
301 3300005438 Ga0070701_10224615 Ga0070701_102246152 221
302 3300005440 Ga0070705_100012816 Ga0070705_1000128164 221
303 3300005456 Ga0070678_100121064 Ga0070678_1001210641 221
304 3300005457 Ga0070662_100122339 Ga0070662_1001223392 221
305 3300005458 Ga0070681_10617054 Ga0070681_106170542 221
306 3300005466 Ga0070685_10006788 Ga0070685_100067884 221
307 3300005466 Ga0070685_10211161 Ga0070685_102111612 221
308 3300005468 Ga0070707_100044730 Ga0070707_1000447303 221
309 3300005471 Ga0070698_100049965 Ga0070698_1000499655 221
310 3300005471 Ga0070698_100114096 Ga0070698_1001140963 221
311 3300005471 Ga0070698_100183276 Ga0070698_1001832762 221
312 3300005471 Ga0070698_100436305 Ga0070698_1004363051 221
313 3300005518 Ga0070699_100042953 Ga0070699_1000429533 221
314 3300005518 Ga0070699_100264633 Ga0070699_1002646331 221
315 3300005518 Ga0070699_100500241 Ga0070699_1005002412 221
316 3300005535 Ga0070684_100068779 Ga0070684_1000687793 221
317 3300005543 Ga0070672_100001564 Ga0070672_10000156414 221
318 3300005543 Ga0070672_100011176 Ga0070672_1000111765 221
319 3300005543 Ga0070672_100013605 Ga0070672_1000136055 221
320 3300005543 Ga0070672_100096931 Ga0070672_1000969312 221
321 3300005543 Ga0070672_100227565 Ga0070672_1002275652 221
322 3300005546 Ga0070696_100022198 Ga0070696_1000221985 221
323 3300005546 Ga0070696_100119898 Ga0070696_1001198983 221
324 3300005546 Ga0070696_100336470 Ga0070696_1003364701 221
325 3300005546 Ga0070696_100398739 Ga0070696_1003987391 221
326 3300005548 Ga0070665_100624446 Ga0070665_1006244462 221
327 3300005549 Ga0070704_100024158 Ga0070704_1000241582 221
328 3300005564 Ga0070664_100000144 Ga0070664_1000001442 221
329 3300005577 Ga0068857_100208450 Ga0068857_1002084503 221
330 3300005578 Ga0068854_100142935 Ga0068854_1001429352 221
331 3300005615 Ga0070702_100096962 Ga0070702_1000969622 221
332 3300005617 Ga0068859_100003201 Ga0068859_1000032013 221
333 3300005617 Ga0068859_100098441 Ga0068859_1000984413 221
334 3300005617 Ga0068859_100763379 Ga0068859_1007633792 221
335 3300005618 Ga0068864_100000486 Ga0068864_10000048620 221
336 3300005618 Ga0068864_100031124 Ga0068864_1000311244 221
337 3300005618 Ga0068864_100067028 Ga0068864_1000670282 221
338 3300005618 Ga0068864_100696762 Ga0068864_1006967622 221
339 3300005718 Ga0068866_10096320 Ga0068866_100963203 221
340 3300005719 Ga0068861_100098464 Ga0068861_1000984643 221
341 3300005719 Ga0068861_100300161 Ga0068861_1003001613 221
342 3300005834 Ga0068851_10188600 Ga0068851_101886002 221
343 3300005840 Ga0068870_10274638 Ga0068870_102746382 221
344 3300005840 Ga0068870_10385982 Ga0068870_103859821 221
345 3300005841 Ga0068863_100000526 Ga0068863_10000052631 221
346 3300005841 Ga0068863_100001664 Ga0068863_10000166415 221
347 3300005841 Ga0068863_100005682 Ga0068863_1000056823 221
348 3300005841 Ga0068863_100129493 Ga0068863_1001294933 221
349 3300005841 Ga0068863_100448879 Ga0068863_1004488792 221
350 3300005842 Ga0068858_100004203 Ga0068858_1000042036 221
351 3300005842 Ga0068858_100004339 Ga0068858_10000433911 221
352 3300005842 Ga0068858_100032481 Ga0068858_1000324815 221
353 3300005842 Ga0068858_100062381 Ga0068858_1000623812 221
354 3300005842 Ga0068858_100084694 Ga0068858_1000846942 221
355 3300005842 Ga0068858_100594024 Ga0068858_1005940242 221
356 3300005842 Ga0068858_100709378 Ga0068858_1007093782 221
357 3300005842 Ga0068858_100726785 Ga0068858_1007267852 221
358 3300005842 Ga0068858_100830690 Ga0068858_1008306902 221
359 3300005843 Ga0068860_100001145 Ga0068860_1000011455 221
360 3300005843 Ga0068860_100164750 Ga0068860_1001647502 221
361 3300005843 Ga0068860_100327563 Ga0068860_1003275632 221
362 3300005843 Ga0068860_100620517 Ga0068860_1006205172 221
363 3300005844 Ga0068862_100066537 Ga0068862_1000665373 221
364 3300005844 Ga0068862_100098609 Ga0068862_1000986093 221
365 3300005844 Ga0068862_100156512 Ga0068862_1001565123 221
366 3300005937 Ga0081455_10091618 Ga0081455_100916183 221
367 3300005985 Ga0081539_10008963 Ga0081539_100089637 221
368 3300006051 Ga0075364_10012103 Ga0075364_100121033 221
369 3300006163 Ga0070715_10088888 Ga0070715_100888883 221
370 3300006177 Ga0075362_10008592 Ga0075362_100085922 221
371 3300006178 Ga0075367_10010532 Ga0075367_100105322 221
372 3300006195 Ga0075366_10028979 Ga0075366_100289795 221
373 3300006237 Ga0097621_100035558 Ga0097621_1000355584 221
374 3300006237 Ga0097621_100040059 Ga0097621_1000400593 221
375 3300006358 Ga0068871_100030699 Ga0068871_1000306994 221
376 3300006358 Ga0068871_100058626 Ga0068871_1000586263 221
377 3300006358 Ga0068871_100105634 Ga0068871_1001056342 221
378 3300006844 Ga0075428_100245407 Ga0075428_1002454073 221
379 3300006844 Ga0075428_100330676 Ga0075428_1003306762 221
380 3300006847 Ga0075431_100087851 Ga0075431_1000878512 221
381 3300006847 Ga0075431_100402317 Ga0075431_1004023173 221
382 3300006852 Ga0075433_10037646 Ga0075433_100376462 221
383 3300006852 Ga0075433_10109080 Ga0075433_101090803 221
384 3300006852 Ga0075433_10167879 Ga0075433_101678792 221
385 3300006871 Ga0075434_100000656 Ga0075434_10000065629 221
386 3300006871 Ga0075434_100031766 Ga0075434_1000317662 221
387 3300006871 Ga0075434_100404071 Ga0075434_1004040713 221
388 3300006880 Ga0075429_100210682 Ga0075429_1002106823 221
389 3300006880 Ga0075429_100219405 Ga0075429_1002194052 221
390 3300006881 Ga0068865_100033009 Ga0068865_1000330093 221
391 3300006914 Ga0075436_100086196 Ga0075436_1000861962 221
392 3300006914 Ga0075436_100400939 Ga0075436_1004009391 221
393 3300006931 Ga0097620_100003201 Ga0097620_1000032013 221
394 3300006931 Ga0097620_100098445 Ga0097620_1000984453 221
395 3300006931 Ga0097620_100331062 Ga0097620_1003310621 221
396 3300006931 Ga0097620_100763328 Ga0097620_1007633282 221
397 3300007076 Ga0075435_100000424 Ga0075435_10000042414 221
398 3300007076 Ga0075435_100009726 Ga0075435_1000097265 221
399 3300009093 Ga0105240_10013771 Ga0105240_100137718 221
400 3300009093 Ga0105240_10274018 Ga0105240_102740182 221
401 3300009093 Ga0105240_10291447 Ga0105240_102914472 221
402 3300009094 Ga0111539_10041877 Ga0111539_100418773 221
403 3300009094 Ga0111539_10190067 Ga0111539_101900672 221
404 3300009098 Ga0105245_10361590 Ga0105245_103615902 221
405 3300009101 Ga0105247_10303567 Ga0105247_103035671 221
406 3300009147 Ga0114129_10016354 Ga0114129_100163547 221
407 3300009147 Ga0114129_10020769 Ga0114129_1002076911 221
408 3300009147 Ga0114129_10039435 Ga0114129_100394352 221
409 3300009147 Ga0114129_10051285 Ga0114129_100512855 221
410 3300009147 Ga0114129_10156387 Ga0114129_101563872 221
411 3300009147 Ga0114129_10824749 Ga0114129_108247492 221
412 3300009174 Ga0105241_10779841 Ga0105241_107798412 221
413 3300009174 Ga0105241_10947578 Ga0105241_109475781 221
414 3300009176 Ga0105242_10029457 Ga0105242_100294574 221
415 3300009176 Ga0105242_10302379 Ga0105242_103023793 221
416 3300009176 Ga0105242_11144506 Ga0105242_111445061 221
417 3300009177 Ga0105248_10000236 Ga0105248_1000023610 221
418 3300009177 Ga0105248_10001572 Ga0105248_1000157220 221
419 3300009177 Ga0105248_10013439 Ga0105248_100134397 221
420 3300009177 Ga0105248_10084092 Ga0105248_100840922 221
421 3300009177 Ga0105248_10120857 Ga0105248_101208572 221
422 3300009177 Ga0105248_10153342 Ga0105248_101533423 221
423 3300009177 Ga0105248_10207491 Ga0105248_102074913 221
424 3300009177 Ga0105248_10336047 Ga0105248_103360472 221
425 3300009177 Ga0105248_10443087 Ga0105248_104430872 221
426 3300009177 Ga0105248_10737840 Ga0105248_107378402 221
427 3300009551 Ga0105238_10154211 Ga0105238_101542113 221
428 3300009551 Ga0105238_10327984 Ga0105238_103279842 221
429 3300013296 Ga0157374_10028374 Ga0157374_100283744 221
430 3300013296 Ga0157374_10467337 Ga0157374_104673372 221
431 3300013297 Ga0157378_10027081 Ga0157378_100270814 221
432 3300013297 Ga0157378_10098116 Ga0157378_100981163 221
433 3300013297 Ga0157378_10405649 Ga0157378_104056491 221
434 3300013297 Ga0157378_10648580 Ga0157378_106485802 221
435 3300013306 Ga0163162_10003813 Ga0163162_100038137 221
436 3300013306 Ga0163162_10006551 Ga0163162_100065518 221
437 3300013306 Ga0163162_10592216 Ga0163162_105922162 221
438 3300013308 Ga0157375_10000523 Ga0157375_100005234 221
439 3300013308 Ga0157375_10000607 Ga0157375_1000060722 221
440 3300013308 Ga0157375_10237545 Ga0157375_102375452 221
441 3300013308 Ga0157375_10248564 Ga0157375_102485643 221
442 3300013308 Ga0157375_10326539 Ga0157375_103265392 221
443 3300013308 Ga0157375_10621484 Ga0157375_106214842 221
444 3300013308 Ga0157375_10758953 Ga0157375_107589532 221
445 3300014325 Ga0163163_10003203 Ga0163163_1000320318 221
446 3300014325 Ga0163163_10003739 Ga0163163_100037393 221
447 3300014325 Ga0163163_10037345 Ga0163163_100373453 221
448 3300014325 Ga0163163_10152621 Ga0163163_101526212 221
449 3300014325 Ga0163163_10233150 Ga0163163_102331502 221
450 3300014326 Ga0157380_10089553 Ga0157380_100895532 221
451 3300014745 Ga0157377_10347620 Ga0157377_103476202 221
452 3300014745 Ga0157377_10362294 Ga0157377_103622942 221
453 3300014968 Ga0157379_10000308 Ga0157379_1000030810 221
454 3300014968 Ga0157379_10003703 Ga0157379_100037037 221
455 3300014968 Ga0157379_10017731 Ga0157379_100177314 221
456 3300014968 Ga0157379_10115724 Ga0157379_101157242 221
457 3300014969 Ga0157376_10067745 Ga0157376_100677453 221
458 3300014969 Ga0157376_10095257 Ga0157376_100952573 221
459 3300014969 Ga0157376_10150761 Ga0157376_101507613 221
460 3300014969 Ga0157376_10197185 Ga0157376_101971853 221
461 3300014969 Ga0157376_10785521 Ga0157376_107855212 221
462 3300017792 Ga0163161_10018189 Ga0163161_100181894 221
463 3300017792 Ga0163161_10219905 Ga0163161_102199052 221
464 3300025900 Ga0207710_10038119 Ga0207710_100381193 221
465 3300025900 Ga0207710_10193850 Ga0207710_101938501 221
466 3300025903 Ga0207680_10040615 Ga0207680_100406153 221
467 3300025903 Ga0207680_10186226 Ga0207680_101862262 221
468 3300025903 Ga0207680_10359799 Ga0207680_103597992 221
469 3300025908 Ga0207643_10086223 Ga0207643_100862232 221
470 3300025908 Ga0207643_10096580 Ga0207643_100965802 221
471 3300025910 Ga0207684_10094890 Ga0207684_100948903 221
472 3300025913 Ga0207695_10094527 Ga0207695_100945273 221
473 3300025913 Ga0207695_10736730 Ga0207695_107367302 221
474 3300025917 Ga0207660_10116877 Ga0207660_101168772 221
475 3300025917 Ga0207660_10590019 Ga0207660_105900192 221
476 3300025918 Ga0207662_10161644 Ga0207662_101616443 221
477 3300025919 Ga0207657_10009210 Ga0207657_100092106 221
478 3300025919 Ga0207657_10525046 Ga0207657_105250462 221
479 3300025920 Ga0207649_10176585 Ga0207649_101765852 221
480 3300025920 Ga0207649_10185555 Ga0207649_101855552 221
481 3300025920 Ga0207649_10201308 Ga0207649_102013082 221
482 3300025922 Ga0207646_10470276 Ga0207646_104702762 221
483 3300025923 Ga0207681_10084850 Ga0207681_100848503 221
484 3300025923 Ga0207681_10310001 Ga0207681_103100012 221
485 3300025923 Ga0207681_10629340 Ga0207681_106293402 221
486 3300025923 Ga0207681_10642738 Ga0207681_106427381 221
487 3300025924 Ga0207694_10238565 Ga0207694_102385652 221
488 3300025925 Ga0207650_10001879 Ga0207650_1000187912 221
489 3300025925 Ga0207650_10858264 Ga0207650_108582641 221
490 3300025926 Ga0207659_10000405 Ga0207659_1000040520 221
491 3300025926 Ga0207659_10001940 Ga0207659_100019406 221
492 3300025926 Ga0207659_10015544 Ga0207659_100155445 221
493 3300025926 Ga0207659_10030594 Ga0207659_100305944 221
494 3300025926 Ga0207659_10235518 Ga0207659_102355182 221
495 3300025926 Ga0207659_10764982 Ga0207659_107649822 221
496 3300025927 Ga0207687_10016186 Ga0207687_100161863 221
497 3300025927 Ga0207687_10390028 Ga0207687_103900282 221
498 3300025928 Ga0207700_10054752 Ga0207700_100547523 221
499 3300025929 Ga0207664_10025522 Ga0207664_100255225 221
500 3300025931 Ga0207644_10080511 Ga0207644_100805112 221
501 3300025933 Ga0207706_10044668 Ga0207706_100446683 221
502 3300025934 Ga0207686_10332757 Ga0207686_103327572 221
503 3300025935 Ga0207709_10023026 Ga0207709_100230265 221
504 3300025935 Ga0207709_10355629 Ga0207709_103556292 221
505 3300025936 Ga0207670_10011480 Ga0207670_100114802 221
506 3300025936 Ga0207670_10150444 Ga0207670_101504442 221
507 3300025936 Ga0207670_10167523 Ga0207670_101675232 221
508 3300025936 Ga0207670_10554196 Ga0207670_105541962 221
509 3300025937 Ga0207669_10058891 Ga0207669_100588913 221
510 3300025937 Ga0207669_10290875 Ga0207669_102908752 221
511 3300025937 Ga0207669_10715961 Ga0207669_107159611 221
512 3300025938 Ga0207704_10055270 Ga0207704_100552702 221
513 3300025940 Ga0207691_10024181 Ga0207691_100241815 221
514 3300025940 Ga0207691_10031394 Ga0207691_100313944 221
515 3300025940 Ga0207691_10032956 Ga0207691_100329562 221
516 3300025940 Ga0207691_10112521 Ga0207691_101125212 221
517 3300025940 Ga0207691_10377575 Ga0207691_103775752 221
518 3300025941 Ga0207711_10000601 Ga0207711_100006019 221
519 3300025941 Ga0207711_10006548 Ga0207711_100065482 221
520 3300025941 Ga0207711_10050135 Ga0207711_100501355 221
521 3300025941 Ga0207711_10142017 Ga0207711_101420173 221
522 3300025941 Ga0207711_10169291 Ga0207711_101692912 221
523 3300025941 Ga0207711_10209838 Ga0207711_102098382 221
524 3300025941 Ga0207711_10628863 Ga0207711_106288632 221
525 3300025941 Ga0207711_10649855 Ga0207711_106498552 221
526 3300025941 Ga0207711_10756446 Ga0207711_107564461 221
527 3300025941 Ga0207711_10810795 Ga0207711_108107951 221
528 3300025944 Ga0207661_10037371 Ga0207661_100373713 221
529 3300025949 Ga0207667_10095180 Ga0207667_100951804 221
530 3300025960 Ga0207651_10020655 Ga0207651_100206554 221
531 3300025960 Ga0207651_10107245 Ga0207651_101072452 221
532 3300025960 Ga0207651_10108365 Ga0207651_101083653 221
533 3300025960 Ga0207651_10158497 Ga0207651_101584972 221
534 3300025960 Ga0207651_10610293 Ga0207651_106102932 221
535 3300025960 Ga0207651_10674730 Ga0207651_106747302 221
536 3300025961 Ga0207712_10517049 Ga0207712_105170492 221
537 3300025972 Ga0207668_10057438 Ga0207668_100574383 221
538 3300025972 Ga0207668_10192356 Ga0207668_101923562 221
539 3300025972 Ga0207668_10327593 Ga0207668_103275932 221
540 3300025981 Ga0207640_10719134 Ga0207640_107191341 221
541 3300025986 Ga0207658_10021141 Ga0207658_100211413 221
542 3300025986 Ga0207658_10549681 Ga0207658_105496811 221
543 3300026023 Ga0207677_10008442 Ga0207677_100084422 221
544 3300026023 Ga0207677_10172137 Ga0207677_101721373 221
545 3300026023 Ga0207677_10219283 Ga0207677_102192832 221
546 3300026023 Ga0207677_10591460 Ga0207677_105914602 221
547 3300026035 Ga0207703_10005935 Ga0207703_100059355 221
548 3300026035 Ga0207703_10019346 Ga0207703_100193464 221
549 3300026035 Ga0207703_10047676 Ga0207703_100476765 221
550 3300026035 Ga0207703_10059758 Ga0207703_100597584 221
551 3300026035 Ga0207703_10127719 Ga0207703_101277192 221
552 3300026035 Ga0207703_10151641 Ga0207703_101516413 221
553 3300026035 Ga0207703_10174423 Ga0207703_101744232 221
554 3300026035 Ga0207703_10678756 Ga0207703_106787562 221
555 3300026075 Ga0207708_10095294 Ga0207708_100952943 221
556 3300026088 Ga0207641_10000618 Ga0207641_1000061834 221
557 3300026088 Ga0207641_10000931 Ga0207641_1000093123 221
558 3300026088 Ga0207641_10048663 Ga0207641_100486634 221
559 3300026089 Ga0207648_10075748 Ga0207648_100757483 221
560 3300026089 Ga0207648_10111132 Ga0207648_101111323 221
561 3300026095 Ga0207676_10026350 Ga0207676_100263504 221
562 3300026095 Ga0207676_10073794 Ga0207676_100737943 221
563 3300026095 Ga0207676_11084643 Ga0207676_110846432 221
564 3300026118 Ga0207675_100021398 Ga0207675_1000213987 221
565 3300026118 Ga0207675_100374348 Ga0207675_1003743482 221
566 3300026121 Ga0207683_10133515 Ga0207683_101335152 221
567 3300026121 Ga0207683_10165640 Ga0207683_101656403 221
568 3300026121 Ga0207683_10946113 Ga0207683_109461131 221
569 3300027907 Ga0207428_10028634 Ga0207428_100286343 221
570 3300027907 Ga0207428_10136105 Ga0207428_101361052 221
571 3300028380 Ga0268265_10025651 Ga0268265_100256514 221
572 3300028380 Ga0268265_10531489 Ga0268265_105314891 221
573 3300028380 Ga0268265_10843172 Ga0268265_108431721 221
574 3300028381 Ga0268264_10128079 Ga0268264_101280793 221
575 3300028381 Ga0268264_10179759 Ga0268264_101797593 221
576 3300028381 Ga0268264_10625134 Ga0268264_106251342 221
577 3300031548 Ga0307408_100586644 Ga0307408_1005866442 221
578 3300031711 Ga0265314_10025458 Ga0265314_100254585 221
579 3300031711 Ga0265314_10097387 Ga0265314_100973872 221
580 3300031731 Ga0307405_10766623 Ga0307405_107666232 221
581 3300031903 Ga0307407_10424409 Ga0307407_104244092 221
582 3300032002 Ga0307416_100796024 Ga0307416_1007960242 221
583 3300035085 Ga0373929_0056283 Ga0373929_0056283_67_753 221
584 3300035086 Ga0373934_0085491 Ga0373934_0085491_548_1219 221
585 3300035089 Ga0373944_0033627 Ga0373944_0033627_418_1098 221
586 3300035112 Ga0373932_0171155 Ga0373932_0171155_36_731 221
587 3300035113 Ga0373936_0020241 Ga0373936_0020241_676_1359 221
588 3300035116 Ga0373945_0075372 Ga0373945_0075372_184_870 221
589 3300035118 Ga0373954_0079879 Ga0373954_0079879_819_1502 221
590 3300035119 Ga0373956_0027069 Ga0373956_0027069_829_1500 221
591 3300035119 Ga0373956_0075663 Ga0373956_0075663_59_742 221
592 3300035170 Ga0373943_0010594 Ga0373943_0010594_36_719 221
593 3300035170 Ga0373943_0143166 Ga0373943_0143166_289_975 221
594 3300035171 Ga0373946_0014905 Ga0373946_0014905_454_1137 221
595 3300035172 Ga0373955_0069320 Ga0373955_0069320_249_935 221
596 3300035172 Ga0373955_0145717 Ga0373955_0145717_180_863 221
597 3300035241 Ga0373961_0033559 Ga0373961_0033559_15_701 221
598 3300035410 Ga0373924_0010465 Ga0373924_0010465_2424_3107 221
599 3300035410 Ga0373924_0105760 Ga0373924_0105760_505_1176 221
600 3300035692 Ga0373935_0058187 Ga0373935_0058187_1316_1999 221
601 3300035692 Ga0373935_0075145 Ga0373935_0075145_338_1018 221
602 3300035695 Ga0373927_0384829 Ga0373927_0384829_100_786 221
603 3300035724 Ga0373933_0161036 Ga0373933_0161036_574_1257 221
604 3300035725 Ga0373947_0145276 Ga0373947_0145276_81_767 221
605 3300036401 Ga0373937_0018052 Ga0373937_0018052_2688_3359 221
606 3300036401 Ga0373937_0037227 Ga0373937_0037227_923_1606 221
607 3300036401 Ga0373937_0051703 Ga0373937_0051703_2355_3041 221
608 3300036401 Ga0373937_1167659 Ga0373937_1167659_24_704 221
609 3300037068 Ga0373925_0004526 Ga0373925_0004526_6222_6905 221
610 3300037068 Ga0373925_0107399 Ga0373925_0107399_722_1405 221
611 3300037068 Ga0373925_0143287 Ga0373925_0143287_581_1261 221
612 3300037068 Ga0373925_0205364 Ga0373925_0205364_816_1502 221
613 3300037068 Ga0373925_0246977 Ga0373925_0246977_264_950 221
614 3300042015 Ga0439462_0010325 Ga0439462_0010325_366_1040 221
615 3300042156 Ga0439446_0010878 Ga0439446_0010878_1527_2201 221
616 3300045051 Ga0451576_0082457 Ga0451576_0082457_2017_2706 221
617 3300045051 Ga0451576_1185863 Ga0451576_1185863_38_721 221
618 3300046454 Ga0495592_0005092 Ga0495592_0005092_661_1344 221
619 3300046454 Ga0495592_0039393 Ga0495592_0039393_1117_1800 221
620 3300046454 Ga0495592_0223442 Ga0495592_0223442_91_762 221
621 3300046455 Ga0495603_0319125 Ga0495603_0319125_151_837 221
622 3300046459 Ga0495629_0058559 Ga0495629_0058559_720_1397 221
623 3300046459 Ga0495629_0132393 Ga0495629_0132393_713_1399 221
624 3300046462 Ga0495651_0111619 Ga0495651_0111619_467_1153 221
625 3300046463 Ga0495653_0190698 Ga0495653_0190698_357_1028 221
626 3300046472 Ga0495580_0388141 Ga0495580_0388141_205_888 221
627 3300046473 Ga0495582_0061536 Ga0495582_0061536_814_1491 221
628 3300046477 Ga0495664_0177225 Ga0495664_0177225_154_840 221
629 3300046511 Ga0495608_0007525 Ga0495608_0007525_966_1649 221
630 3300046511 Ga0495608_0092718 Ga0495608_0092718_309_995 221
631 3300046514 Ga0495618_0221369 Ga0495618_0221369_481_1152 221
632 3300046516 Ga0495628_0197877 Ga0495628_0197877_76_747 221
633 3300046517 Ga0495630_0008326 Ga0495630_0008326_4176_4859 221
634 3300046517 Ga0495630_0036510 Ga0495630_0036510_1306_1992 221
635 3300046517 Ga0495630_0097400 Ga0495630_0097400_1165_1845 221
636 3300046533 Ga0495640_0109196 Ga0495640_0109196_837_1523 221
637 3300046535 Ga0495586_0039319 Ga0495586_0039319_795_1478 221
638 3300046536 Ga0495587_0116698 Ga0495587_0116698_266_949 221
639 3300046539 Ga0495621_0009004 Ga0495621_0009004_2143_2814 221
640 3300046543 Ga0495645_0013479 Ga0495645_0013479_2336_3007 221
641 3300046543 Ga0495645_0015615 Ga0495645_0015615_2841_3524 221
642 3300046642 Ga0495634_0044133 Ga0495634_0044133_1602_2285 221
643 3300046642 Ga0495634_0045756 Ga0495634_0045756_1729_2412 221
644 3300046642 Ga0495634_0174840 Ga0495634_0174840_238_924 221
645 3300046663 Ga0495635_0234419 Ga0495635_0234419_253_936 221
646 3300046663 Ga0495635_0304722 Ga0495635_0304722_99_785 221
647 3300046678 Ga0495599_0024841 Ga0495599_0024841_963_1646 221
648 3300046678 Ga0495599_0057269 Ga0495599_0057269_1408_2091 221
649 3300046678 Ga0495599_0106541 Ga0495599_0106541_1014_1700 221
650 3300046678 Ga0495599_0196586 Ga0495599_0196586_102_788 221
651 3300046679 Ga0495623_0060575 Ga0495623_0060575_809_1492 221
652 3300046681 Ga0495647_0037525 Ga0495647_0037525_392_1078 221
653 3300046681 Ga0495647_0152718 Ga0495647_0152718_138_821 221
654 3300046683 Ga0495658_0076337 Ga0495658_0076337_497_1174 221
655 3300046683 Ga0495658_0287906 Ga0495658_0287906_239_916 221
656 3300046684 Ga0495669_0003252 Ga0495669_0003252_5772_6455 221
657 3300046684 Ga0495669_0112128 Ga0495669_0112128_586_1257 221
658 3300046689 Ga0495613_0028263 Ga0495613_0028263_3433_4116 221
659 3300046689 Ga0495613_0500560 Ga0495613_0500560_66_746 221
660 3300046694 Ga0495649_0202299 Ga0495649_0202299_151_831 221
661 3300047317 Ga0495604_0037493 Ga0495604_0037493_2539_3225 221
662 3300047317 Ga0495604_0215550 Ga0495604_0215550_63_734 221
663 3300047319 Ga0495674_0002541 Ga0495674_0002541_9640_10323 221
664 3300047319 Ga0495674_0121031 Ga0495674_0121031_593_1264 221
665 3300047319 Ga0495674_0417646 Ga0495674_0417646_381_1064 221
666 3300047444 Ga0495675_0129063 Ga0495675_0129063_27_710 221
667 3300047444 Ga0495675_0192007 Ga0495675_0192007_53_736 221
668 3300047471 Ga0495684_0000483 Ga0495684_0000483_24096_24779 221
669 3300047471 Ga0495684_0071397 Ga0495684_0071397_745_1416 221
670 3300047471 Ga0495684_0191703 Ga0495684_0191703_750_1433 221
671 3300048904 Ga0496101_0004437 Ga0496101_0004437_2075_2758 221
672 3300048907 Ga0496104_0006222 Ga0496104_0006222_8358_9041 221
673 3300048907 Ga0496104_0130690 Ga0496104_0130690_928_1602 221
674 3300048907 Ga0496104_0204704 Ga0496104_0204704_399_1082 221
675 3300048907 Ga0496104_0333470 Ga0496104_0333470_487_1164 221
676 3300048908 Ga0496105_0065877 Ga0496105_0065877_1247_1930 221
677 3300048909 Ga0496106_0080166 Ga0496106_0080166_214_900 221
678 3300048912 Ga0496109_0107745 Ga0496109_0107745_1747_2433 221
679 3300048913 Ga0496110_0034737 Ga0496110_0034737_3436_4122 221
680 3300048913 Ga0496110_0405177 Ga0496110_0405177_397_1080 221
681 3300048915 Ga0496112_0144982 Ga0496112_0144982_859_1548 221
682 3300048915 Ga0496112_1029679 Ga0496112_1029679_27_713 221
683 3300048917 Ga0496114_0000323 Ga0496114_0000323_24466_25149 221
684 3300048917 Ga0496114_0456467 Ga0496114_0456467_375_1058 221
685 3300049571 Ga0501034_0411366 Ga0501034_0411366_11_697 221
686 3300049577 Ga0501041_0195566 Ga0501041_0195566_125_796 221
687 3300049584 Ga0501068_0303689 Ga0501068_0303689_174_863 221
688 3300049741 Ga0501079_0340037 Ga0501079_0340037_59_733 221
689 3300050489 nmdc:mga03683_41612_c1 nmdc:mga03683_41612_c1_1011_1694 221
690 3300050491 nmdc:mga00v17_41723_c1 nmdc:mga00v17_41723_c1_685_1368 221
691 3300050493 nmdc:mga0k408_5006_c1 nmdc:mga0k408_5006_c1_3628_4311 221
692 3300050494 nmdc:mga06z11_10949_c1 nmdc:mga06z11_10949_c1_2481_3164 221
693 3300050507 nmdc:mga05p37_107236_c1 nmdc:mga05p37_107236_c1_224_910 221
694 3300050507 nmdc:mga05p37_214936_c1 nmdc:mga05p37_214936_c1_660_1355 221
695 3300050507 nmdc:mga05p37_216724_c1 nmdc:mga05p37_216724_c1_846_1526 221
696 3300050507 nmdc:mga05p37_21703_c1 nmdc:mga05p37_21703_c1_891_1577 221
697 3300050507 nmdc:mga05p37_220104_c1 nmdc:mga05p37_220104_c1_414_1097 221
698 3300050507 nmdc:mga05p37_250891_c1 nmdc:mga05p37_250891_c1_419_1105 221
699 3300050507 nmdc:mga05p37_54488_c1 nmdc:mga05p37_54488_c1_892_1575 221
700 3300050507 nmdc:mga05p37_95715_c1 nmdc:mga05p37_95715_c1_238_921 221
701 3300050508 nmdc:mga09592_128695_c1 nmdc:mga09592_128695_c1_619_1296 221
702 3300050510 nmdc:mga06r32_84115_c1 nmdc:mga06r32_84115_c1_2045_2731 221
703 3300050511 nmdc:mga08y16_2315_c1 nmdc:mga08y16_2315_c1_17116_17799 221
704 3300050511 nmdc:mga08y16_825935_c1 nmdc:mga08y16_825935_c1_168_854 221
705 3300050512 nmdc:mga0n895_10073_c1 nmdc:mga0n895_10073_c1_6822_7505 221
706 3300050512 nmdc:mga0n895_391216_c1 nmdc:mga0n895_391216_c1_597_1283 221
707 3300050512 nmdc:mga0n895_46964_c1 nmdc:mga0n895_46964_c1_415_1110 221
708 3300050513 nmdc:mga0rr50_12374_c1 nmdc:mga0rr50_12374_c1_2245_2934 221
709 3300050514 nmdc:mga08x19_585880_c1 nmdc:mga08x19_585880_c1_23_712 221
710 3300050515 nmdc:mga0a205_198400_c1 nmdc:mga0a205_198400_c1_554_1249 221
711 3300050515 nmdc:mga0a205_211576_c1 nmdc:mga0a205_211576_c1_415_1092 221
712 3300050515 nmdc:mga0a205_54635_c1 nmdc:mga0a205_54635_c1_522_1205 221
713 3300050515 nmdc:mga0a205_85489_c1 nmdc:mga0a205_85489_c1_318_1004 221
714 3300053085 Ga0495619_0005642 Ga0495619_0005642_5698_6381 221
715 3300053085 Ga0495619_0025745 Ga0495619_0025745_2207_2878 221
716 3300053085 Ga0495619_0062239 Ga0495619_0062239_1207_1893 221
717 3300053085 Ga0495619_0584314 Ga0495619_0584314_48_728 221
718 3300053104 Ga0500556_0026638 Ga0500556_0026638_441_1130 221
719 3300054114 Ga0501084_0460448 Ga0501084_0460448_298_984 221
720 3300060353 Ga0501082_1033112 Ga0501082_1033112_27_701 221
721 3300005295 Ga0065707_10247017 Ga0065707_102470172 222
722 3300005331 Ga0070670_100221775 Ga0070670_1002217752 222
723 3300005354 Ga0070675_100088378 Ga0070675_1000883784 222
724 3300005365 Ga0070688_100230898 Ga0070688_1002308981 222
725 3300005444 Ga0070694_100178088 Ga0070694_1001780881 222
726 3300005577 Ga0068857_100089334 Ga0068857_1000893342 222
727 3300005844 Ga0068862_100378337 Ga0068862_1003783372 222
728 3300006844 Ga0075428_100005405 Ga0075428_1000054055 222
729 3300006852 Ga0075433_10147317 Ga0075433_101473173 222
730 3300006871 Ga0075434_100013008 Ga0075434_1000130088 222
731 3300006880 Ga0075429_100067883 Ga0075429_1000678833 222
732 3300009094 Ga0111539_10082243 Ga0111539_100822432 222
733 3300009147 Ga0114129_10014262 Ga0114129_100142628 222
734 3300009147 Ga0114129_10061382 Ga0114129_100613822 222
735 3300013297 Ga0157378_10085486 Ga0157378_100854864 222
736 3300013308 Ga0157375_10341652 Ga0157375_103416523 222
737 3300025926 Ga0207659_10038417 Ga0207659_100384173 222
738 3300025942 Ga0207689_10105182 Ga0207689_101051823 222
739 3300035691 Ga0373931_0280311 Ga0373931_0280311_148_834 222
740 3300045051 Ga0451576_0675770 Ga0451576_0675770_30_716 222
741 3300046455 Ga0495603_0016614 Ga0495603_0016614_2016_2705 222
742 3300046455 Ga0495603_0042338 Ga0495603_0042338_1545_2222 222
743 3300046459 Ga0495629_0010215 Ga0495629_0010215_2187_2876 222
744 3300046473 Ga0495582_0200025 Ga0495582_0200025_180_857 222
745 3300046499 Ga0495594_0004637 Ga0495594_0004637_3618_4295 222
746 3300046499 Ga0495594_0014029 Ga0495594_0014029_899_1588 222
747 3300046523 Ga0495644_0037590 Ga0495644_0037590_863_1549 222
748 3300046528 Ga0495642_0096140 Ga0495642_0096140_150_836 222
749 3300046539 Ga0495621_0026434 Ga0495621_0026434_871_1557 222
750 3300046664 Ga0495659_0048190 Ga0495659_0048190_547_1233 222
751 3300046674 Ga0495588_0008824 Ga0495588_0008824_830_1507 222
752 3300046674 Ga0495588_0295183 Ga0495588_0295183_108_794 222
753 3300046684 Ga0495669_0013479 Ga0495669_0013479_2014_2700 222
754 3300047315 Ga0495581_0363829 Ga0495581_0363829_27_716 222
755 3300047321 Ga0495676_0064474 Ga0495676_0064474_279_968 222
756 3300047445 Ga0495677_0051702 Ga0495677_0051702_460_1146 222
757 3300049573 Ga0501037_0321111 Ga0501037_0321111_353_1057 222
758 3300049575 Ga0501039_0527312 Ga0501039_0527312_61_729 222
759 3300049578 Ga0501042_0035523 Ga0501042_0035523_1505_2209 222
760 3300049580 Ga0501046_0422051 Ga0501046_0422051_142_846 222
761 3300049583 Ga0501067_0032662 Ga0501067_0032662_2158_2844 222
762 3300049587 Ga0501071_0025277 Ga0501071_0025277_1580_2284 222
763 3300049824 Ga0501045_0075531 Ga0501045_0075531_247_951 222
764 3300050507 nmdc:mga05p37_50178_c1 nmdc:mga05p37_50178_c1_4244_4930 222
765 3300050507 nmdc:mga05p37_729_c1 nmdc:mga05p37_729_c1_11238_11924 222
766 3300050508 nmdc:mga09592_64647_c1 nmdc:mga09592_64647_c1_821_1507 222
767 3300050512 nmdc:mga0n895_44088_c1 nmdc:mga0n895_44088_c1_793_1479 222
768 3300050515 nmdc:mga0a205_44111_c1 nmdc:mga0a205_44111_c1_2159_2845 222
769 3300053084 Ga0495595_0022962 Ga0495595_0022962_2031_2717 222
770 3300059421 Ga0590071_000262 Ga0590071_000262_6690_7373 222
771 3300059423 Ga0590074_002317 Ga0590074_002317_296_979 222
772 3300059426 Ga0590077_000100 Ga0590077_000100_14606_15289 222
773 3300005343 Ga0070687_100043478 Ga0070687_1000434784 223
774 3300006175 Ga0070712_100177525 Ga0070712_1001775252 223
775 3300025915 Ga0207693_10141578 Ga0207693_101415783 223
776 3300032002 Ga0307416_100926214 Ga0307416_1009262142 223
777 3300044712 Ga0453684_0006396 Ga0453684_0006396_4606_5361 223
778 3300045051 Ga0451576_0004289 Ga0451576_0004289_14385_15140 223
779 3300005331 Ga0070670_100451704 Ga0070670_1004517042 224
780 3300005367 Ga0070667_100270639 Ga0070667_1002706392 224
781 3300009177 Ga0105248_10023875 Ga0105248_100238758 224
782 3300014325 Ga0163163_10010757 Ga0163163_100107578 224
783 3300025986 Ga0207658_10328460 Ga0207658_103284602 224
784 3300005288 Ga0065714_10016598 Ga0065714_100165983 225
785 3300005293 Ga0065715_10092637 Ga0065715_100926373 225
786 3300005330 Ga0070690_100060755 Ga0070690_1000607553 225
787 3300005331 Ga0070670_100052051 Ga0070670_1000520512 225
788 3300005335 Ga0070666_10441666 Ga0070666_104416661 225
789 3300005336 Ga0070680_100083699 Ga0070680_1000836994 225
790 3300005340 Ga0070689_100017529 Ga0070689_1000175294 225
791 3300005343 Ga0070687_100018229 Ga0070687_1000182294 225
792 3300005344 Ga0070661_100226572 Ga0070661_1002265722 225
793 3300005347 Ga0070668_100038946 Ga0070668_1000389465 225
794 3300005347 Ga0070668_100301093 Ga0070668_1003010932 225
795 3300005354 Ga0070675_100021490 Ga0070675_1000214906 225
796 3300005356 Ga0070674_100800288 Ga0070674_1008002881 225
797 3300005364 Ga0070673_100003445 Ga0070673_1000034459 225
798 3300005364 Ga0070673_100187414 Ga0070673_1001874142 225
799 3300005365 Ga0070688_100165312 Ga0070688_1001653122 225
800 3300005438 Ga0070701_10009450 Ga0070701_100094506 225
801 3300005455 Ga0070663_100645124 Ga0070663_1006451241 225
802 3300005543 Ga0070672_100010401 Ga0070672_1000104014 225
803 3300005543 Ga0070672_100022168 Ga0070672_1000221682 225
804 3300005544 Ga0070686_100046799 Ga0070686_1000467994 225
805 3300005549 Ga0070704_100324958 Ga0070704_1003249582 225
806 3300005564 Ga0070664_100004803 Ga0070664_10000480315 225
807 3300005577 Ga0068857_100076900 Ga0068857_1000769003 225
808 3300005617 Ga0068859_100025103 Ga0068859_1000251032 225
809 3300005618 Ga0068864_100029816 Ga0068864_1000298162 225
810 3300005719 Ga0068861_100620563 Ga0068861_1006205631 225
811 3300005841 Ga0068863_100246010 Ga0068863_1002460103 225
812 3300005842 Ga0068858_100128931 Ga0068858_1001289312 225
813 3300005985 Ga0081539_10083995 Ga0081539_100839952 225
814 3300006844 Ga0075428_100003630 Ga0075428_10000363011 225
815 3300006847 Ga0075431_100052971 Ga0075431_1000529715 225
816 3300006880 Ga0075429_100033446 Ga0075429_1000334464 225
817 3300006931 Ga0097620_100025103 Ga0097620_1000251032 225
818 3300009094 Ga0111539_10006812 Ga0111539_100068127 225
819 3300009553 Ga0105249_10121430 Ga0105249_101214303 225
820 3300013308 Ga0157375_10133588 Ga0157375_101335883 225
821 3300013308 Ga0157375_10227177 Ga0157375_102271772 225
822 3300014325 Ga0163163_10005951 Ga0163163_100059517 225
823 3300025918 Ga0207662_10043190 Ga0207662_100431902 225
824 3300025920 Ga0207649_10233012 Ga0207649_102330122 225
825 3300025923 Ga0207681_10053906 Ga0207681_100539063 225
826 3300025923 Ga0207681_10220250 Ga0207681_102202502 225
827 3300025925 Ga0207650_10032843 Ga0207650_100328435 225
828 3300025926 Ga0207659_10000879 Ga0207659_1000087912 225
829 3300025926 Ga0207659_10043655 Ga0207659_100436552 225
830 3300025937 Ga0207669_10478815 Ga0207669_104788152 225
831 3300025940 Ga0207691_10003124 Ga0207691_1000312410 225
832 3300025940 Ga0207691_10027787 Ga0207691_100277873 225
833 3300025945 Ga0207679_10701809 Ga0207679_107018092 225
834 3300025960 Ga0207651_10000566 Ga0207651_1000056612 225
835 3300025960 Ga0207651_10004402 Ga0207651_100044029 225
836 3300025961 Ga0207712_10593420 Ga0207712_105934202 225
837 3300025972 Ga0207668_10348069 Ga0207668_103480691 225
838 3300026035 Ga0207703_10089187 Ga0207703_100891873 225
839 3300026095 Ga0207676_10010580 Ga0207676_100105806 225
840 3300026116 Ga0207674_10357320 Ga0207674_103573202 225
841 3300026118 Ga0207675_100337815 Ga0207675_1003378152 225
842 3300026121 Ga0207683_10713402 Ga0207683_107134022 225
843 3300028380 Ga0268265_10904431 Ga0268265_109044312 225
844 3300028380 Ga0268265_10973554 Ga0268265_109735541 225
845 3300042435 Ga0439434_0033992 Ga0439434_0033992_113_811 225
846 3300042436 Ga0439435_0001998 Ga0439435_0001998_1729_2418 225
847 3300042530 Ga0450916_004616 Ga0450916_004616_842_1531 225
848 3300046539 Ga0495621_0011882 Ga0495621_0011882_854_1543 225
849 3300050508 nmdc:mga09592_31693_c1 nmdc:mga09592_31693_c1_1502_2191 225
850 3300050509 nmdc:mga0qj67_33079_c1 nmdc:mga0qj67_33079_c1_666_1355 225
851 3300050510 nmdc:mga06r32_95431_c1 nmdc:mga06r32_95431_c1_189_878 225
852 3300050511 nmdc:mga08y16_10686_c1 nmdc:mga08y16_10686_c1_5153_5842 225
853 3300001977 JGI24746J21847_1002904 JGI24746J21847_10029044 226
854 3300005290 Ga0065712_10254537 Ga0065712_102545371 226
855 3300005293 Ga0065715_10008301 Ga0065715_100083014 226
856 3300005328 Ga0070676_10023420 Ga0070676_100234202 226
857 3300005330 Ga0070690_100000943 Ga0070690_10000094311 226
858 3300005331 Ga0070670_100013235 Ga0070670_1000132359 226
859 3300005331 Ga0070670_100362902 Ga0070670_1003629022 226
860 3300005333 Ga0070677_10042130 Ga0070677_100421303 226
861 3300005334 Ga0068869_100007243 Ga0068869_1000072432 226
862 3300005334 Ga0068869_100260137 Ga0068869_1002601372 226
863 3300005335 Ga0070666_10007711 Ga0070666_100077117 226
864 3300005337 Ga0070682_100239653 Ga0070682_1002396532 226
865 3300005338 Ga0068868_100031591 Ga0068868_1000315913 226
866 3300005340 Ga0070689_100037769 Ga0070689_1000377694 226
867 3300005343 Ga0070687_100006731 Ga0070687_1000067313 226
868 3300005353 Ga0070669_100000985 Ga0070669_1000009857 226
869 3300005353 Ga0070669_100235214 Ga0070669_1002352142 226
870 3300005353 Ga0070669_100306722 Ga0070669_1003067222 226
871 3300005355 Ga0070671_100065589 Ga0070671_1000655894 226
872 3300005355 Ga0070671_100145702 Ga0070671_1001457023 226
873 3300005356 Ga0070674_100000190 Ga0070674_10000019018 226
874 3300005356 Ga0070674_100160095 Ga0070674_1001600953 226
875 3300005356 Ga0070674_100619684 Ga0070674_1006196841 226
876 3300005364 Ga0070673_100003602 Ga0070673_1000036022 226
877 3300005364 Ga0070673_100065517 Ga0070673_1000655174 226
878 3300005365 Ga0070688_100121019 Ga0070688_1001210192 226
879 3300005367 Ga0070667_100013074 Ga0070667_1000130741 226
880 3300005367 Ga0070667_100367528 Ga0070667_1003675282 226
881 3300005438 Ga0070701_10098892 Ga0070701_100988922 226
882 3300005441 Ga0070700_100073372 Ga0070700_1000733722 226
883 3300005455 Ga0070663_100089689 Ga0070663_1000896892 226
884 3300005456 Ga0070678_100048372 Ga0070678_1000483724 226
885 3300005457 Ga0070662_100079620 Ga0070662_1000796203 226
886 3300005459 Ga0068867_100078107 Ga0068867_1000781074 226
887 3300005466 Ga0070685_10012576 Ga0070685_100125763 226
888 3300005543 Ga0070672_100001431 Ga0070672_1000014317 226
889 3300005544 Ga0070686_100008639 Ga0070686_1000086394 226
890 3300005548 Ga0070665_100025393 Ga0070665_1000253937 226
891 3300005564 Ga0070664_100002638 Ga0070664_1000026384 226
892 3300005615 Ga0070702_100080525 Ga0070702_1000805252 226
893 3300005615 Ga0070702_100353747 Ga0070702_1003537471 226
894 3300005616 Ga0068852_100091207 Ga0068852_1000912073 226
895 3300005617 Ga0068859_100018494 Ga0068859_1000184947 226
896 3300005617 Ga0068859_100062510 Ga0068859_1000625102 226
897 3300005618 Ga0068864_100083484 Ga0068864_1000834843 226
898 3300005618 Ga0068864_100708844 Ga0068864_1007088441 226
899 3300005719 Ga0068861_100058288 Ga0068861_1000582884 226
900 3300005840 Ga0068870_10004169 Ga0068870_100041693 226
901 3300005840 Ga0068870_10032396 Ga0068870_100323963 226
902 3300005840 Ga0068870_10087975 Ga0068870_100879752 226
903 3300005841 Ga0068863_100032658 Ga0068863_1000326582 226
904 3300005842 Ga0068858_100072713 Ga0068858_1000727134 226
905 3300005843 Ga0068860_100003450 Ga0068860_10000345016 226
906 3300005844 Ga0068862_100002759 Ga0068862_1000027597 226
907 3300005844 Ga0068862_100220673 Ga0068862_1002206732 226
908 3300006058 Ga0075432_10073402 Ga0075432_100734022 226
909 3300006237 Ga0097621_100028961 Ga0097621_1000289612 226
910 3300006844 Ga0075428_100008496 Ga0075428_1000084967 226
911 3300006844 Ga0075428_100209540 Ga0075428_1002095403 226
912 3300006844 Ga0075428_100418309 Ga0075428_1004183092 226
913 3300006846 Ga0075430_100010732 Ga0075430_1000107324 226
914 3300006846 Ga0075430_100054986 Ga0075430_1000549862 226
915 3300006846 Ga0075430_100064364 Ga0075430_1000643641 226
916 3300006846 Ga0075430_100121177 Ga0075430_1001211773 226
917 3300006847 Ga0075431_100000524 Ga0075431_1000005243 226
918 3300006847 Ga0075431_100003017 Ga0075431_1000030177 226
919 3300006847 Ga0075431_100223912 Ga0075431_1002239123 226
920 3300006847 Ga0075431_100595534 Ga0075431_1005955342 226
921 3300006852 Ga0075433_10002292 Ga0075433_100022928 226
922 3300006852 Ga0075433_10444371 Ga0075433_104443712 226
923 3300006871 Ga0075434_100066260 Ga0075434_1000662602 226
924 3300006880 Ga0075429_100004361 Ga0075429_1000043617 226
925 3300006880 Ga0075429_100077293 Ga0075429_1000772932 226
926 3300006881 Ga0068865_100108538 Ga0068865_1001085382 226
927 3300006931 Ga0097620_100018493 Ga0097620_1000184937 226
928 3300006931 Ga0097620_100062512 Ga0097620_1000625122 226
929 3300007076 Ga0075435_100028075 Ga0075435_1000280757 226
930 3300009094 Ga0111539_10014033 Ga0111539_100140337 226
931 3300009094 Ga0111539_10026148 Ga0111539_100261488 226
932 3300009098 Ga0105245_10266303 Ga0105245_102663033 226
933 3300009147 Ga0114129_10150493 Ga0114129_101504933 226
934 3300009147 Ga0114129_10205768 Ga0114129_102057683 226
935 3300009177 Ga0105248_10093447 Ga0105248_100934474 226
936 3300009553 Ga0105249_10000849 Ga0105249_1000084931 226
937 3300009553 Ga0105249_10290333 Ga0105249_102903332 226
938 3300012508 Ga0157315_1000725 Ga0157315_10007252 226
939 3300013296 Ga0157374_10417870 Ga0157374_104178702 226
940 3300013306 Ga0163162_10003531 Ga0163162_1000353113 226
941 3300013308 Ga0157375_10017168 Ga0157375_100171682 226
942 3300013308 Ga0157375_10247886 Ga0157375_102478862 226
943 3300014326 Ga0157380_10011572 Ga0157380_100115727 226
944 3300014326 Ga0157380_10065871 Ga0157380_100658714 226
945 3300014745 Ga0157377_10026948 Ga0157377_100269483 226
946 3300014968 Ga0157379_10015640 Ga0157379_100156402 226
947 3300014969 Ga0157376_10093766 Ga0157376_100937662 226
948 3300017792 Ga0163161_10036888 Ga0163161_100368886 226
949 3300025271 Ga0207666_1004394 Ga0207666_10043942 226
950 3300025315 Ga0207697_10000700 Ga0207697_1000070027 226
951 3300025315 Ga0207697_10083824 Ga0207697_100838242 226
952 3300025893 Ga0207682_10039016 Ga0207682_100390163 226
953 3300025893 Ga0207682_10052244 Ga0207682_100522443 226
954 3300025899 Ga0207642_10042787 Ga0207642_100427872 226
955 3300025901 Ga0207688_10003374 Ga0207688_100033743 226
956 3300025901 Ga0207688_10245298 Ga0207688_102452982 226
957 3300025903 Ga0207680_10101912 Ga0207680_101019122 226
958 3300025907 Ga0207645_10002538 Ga0207645_1000253820 226
959 3300025907 Ga0207645_10007582 Ga0207645_1000758210 226
960 3300025907 Ga0207645_10093439 Ga0207645_100934392 226
961 3300025908 Ga0207643_10000138 Ga0207643_1000013842 226
962 3300025908 Ga0207643_10046925 Ga0207643_100469253 226
963 3300025918 Ga0207662_10000720 Ga0207662_100007208 226
964 3300025923 Ga0207681_10017757 Ga0207681_100177576 226
965 3300025923 Ga0207681_10032854 Ga0207681_100328542 226
966 3300025923 Ga0207681_10625381 Ga0207681_106253811 226
967 3300025925 Ga0207650_10115220 Ga0207650_101152202 226
968 3300025925 Ga0207650_10128287 Ga0207650_101282872 226
969 3300025926 Ga0207659_10163026 Ga0207659_101630261 226
970 3300025927 Ga0207687_10407674 Ga0207687_104076742 226
971 3300025931 Ga0207644_10065981 Ga0207644_100659813 226
972 3300025931 Ga0207644_10213517 Ga0207644_102135171 226
973 3300025932 Ga0207690_10069614 Ga0207690_100696143 226
974 3300025933 Ga0207706_10002156 Ga0207706_100021563 226
975 3300025933 Ga0207706_10133245 Ga0207706_101332452 226
976 3300025936 Ga0207670_10203027 Ga0207670_102030272 226
977 3300025937 Ga0207669_10002409 Ga0207669_100024094 226
978 3300025937 Ga0207669_10140963 Ga0207669_101409633 226
979 3300025940 Ga0207691_10002649 Ga0207691_100026492 226
980 3300025940 Ga0207691_10022103 Ga0207691_100221039 226
981 3300025941 Ga0207711_10103059 Ga0207711_101030592 226
982 3300025942 Ga0207689_10001347 Ga0207689_1000134728 226
983 3300025942 Ga0207689_10027935 Ga0207689_100279353 226
984 3300025945 Ga0207679_10013926 Ga0207679_100139264 226
985 3300025961 Ga0207712_10010563 Ga0207712_100105634 226
986 3300025986 Ga0207658_10205005 Ga0207658_102050051 226
987 3300026035 Ga0207703_10068184 Ga0207703_100681842 226
988 3300026067 Ga0207678_10132000 Ga0207678_101320003 226
989 3300026075 Ga0207708_10023190 Ga0207708_100231903 226
990 3300026075 Ga0207708_10092791 Ga0207708_100927912 226
991 3300026075 Ga0207708_10094470 Ga0207708_100944702 226
992 3300026088 Ga0207641_10074265 Ga0207641_100742652 226
993 3300026089 Ga0207648_10018013 Ga0207648_100180131 226
994 3300026089 Ga0207648_10050677 Ga0207648_100506773 226
995 3300026095 Ga0207676_10079332 Ga0207676_100793322 226
996 3300026095 Ga0207676_10332440 Ga0207676_103324402 226
997 3300026118 Ga0207675_100003041 Ga0207675_1000030419 226
998 3300026118 Ga0207675_100012703 Ga0207675_1000127039 226
999 3300026118 Ga0207675_100711786 Ga0207675_1007117862 226
1000 3300026121 Ga0207683_10080305 Ga0207683_100803054 226
1001 3300026121 Ga0207683_10606406 Ga0207683_106064062 226
1002 3300026142 Ga0207698_10270431 Ga0207698_102704312 226
1003 3300027907 Ga0207428_10000498 Ga0207428_1000049825 226
1004 3300027907 Ga0207428_10004323 Ga0207428_1000432310 226
1005 3300027907 Ga0207428_10006675 Ga0207428_100066757 226
1006 3300028379 Ga0268266_10105558 Ga0268266_101055582 226
1007 3300028380 Ga0268265_10002782 Ga0268265_1000278211 226
1008 3300028380 Ga0268265_10172505 Ga0268265_101725052 226
1009 3300028381 Ga0268264_10324845 Ga0268264_103248452 226
1010 3300034819 Ga0373958_0002235 Ga0373958_0002235_1207_1887 226
1011 3300035090 Ga0373949_0006475 Ga0373949_0006475_887_1567 226
1012 3300035691 Ga0373931_0070323 Ga0373931_0070323_926_1606 226
1013 3300042993 Ga0439440_0003015 Ga0439440_0003015_1609_2289 226
1014 3300045051 Ga0451576_0194662 Ga0451576_0194662_197_877 226
1015 3300048912 Ga0496109_0101312 Ga0496109_0101312_387_1067 226
1016 3300049572 Ga0501036_0162297 Ga0501036_0162297_1055_1747 226
1017 3300049575 Ga0501039_0137610 Ga0501039_0137610_184_876 226
1018 3300049576 Ga0501040_0026771 Ga0501040_0026771_2446_3138 226
1019 3300049577 Ga0501041_0033465 Ga0501041_0033465_1151_1843 226
1020 3300049578 Ga0501042_0007112 Ga0501042_0007112_2588_3280 226
1021 3300049580 Ga0501046_0097362 Ga0501046_0097362_869_1561 226
1022 3300049588 Ga0501072_0055149 Ga0501072_0055149_1289_1981 226
1023 3300049591 Ga0501075_0011967 Ga0501075_0011967_5447_6139 226
1024 3300049741 Ga0501079_0084656 Ga0501079_0084656_384_1076 226
1025 3300049743 Ga0501081_0007180 Ga0501081_0007180_1114_1806 226
1026 3300049824 Ga0501045_0081204 Ga0501045_0081204_895_1587 226
1027 3300050507 nmdc:mga05p37_168945_c1 nmdc:mga05p37_168945_c1_897_1577 226
1028 3300050508 nmdc:mga09592_18264_c1 nmdc:mga09592_18264_c1_4301_4981 226
1029 3300050508 nmdc:mga09592_4217_c1 nmdc:mga09592_4217_c1_5190_5870 226
1030 3300050508 nmdc:mga09592_433009_c1 nmdc:mga09592_433009_c1_111_797 226
1031 3300050509 nmdc:mga0qj67_10794_c1 nmdc:mga0qj67_10794_c1_1284_1964 226
1032 3300050509 nmdc:mga0qj67_223700_c1 nmdc:mga0qj67_223700_c1_817_1509 226
1033 3300050509 nmdc:mga0qj67_239257_c1 nmdc:mga0qj67_239257_c1_473_1153 226
1034 3300050510 nmdc:mga06r32_117282_c1 nmdc:mga06r32_117282_c1_1420_2100 226
1035 3300050510 nmdc:mga06r32_24864_c1 nmdc:mga06r32_24864_c1_855_1541 226
1036 3300050510 nmdc:mga06r32_670589_c1 nmdc:mga06r32_670589_c1_72_764 226
1037 3300050511 nmdc:mga08y16_16048_c1 nmdc:mga08y16_16048_c1_2424_3116 226
1038 3300050511 nmdc:mga08y16_41140_c1 nmdc:mga08y16_41140_c1_565_1257 226
1039 3300050511 nmdc:mga08y16_60376_c1 nmdc:mga08y16_60376_c1_458_1138 226
1040 3300050512 nmdc:mga0n895_148545_c1 nmdc:mga0n895_148545_c1_859_1539 226
1041 3300050513 nmdc:mga0rr50_412486_c1 nmdc:mga0rr50_412486_c1_377_1057 226
1042 3300050515 nmdc:mga0a205_134513_c1 nmdc:mga0a205_134513_c1_1444_2124 226
1043 3300054114 Ga0501084_0021867 Ga0501084_0021867_3242_3934 226
1044 3300060353 Ga0501082_0052391 Ga0501082_0052391_1753_2445 226
1045 3300061734 Ga0530510_0101840 Ga0530510_0101840_285_977 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

41

238

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9637 6 219
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9609 6 222
1tqj-assembly1.cif.gz_D crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9561 5 219
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9551 5 219
1tqj-assembly1.cif.gz_F crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9541 5 219
ID Description Score Start End Superfamily
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9669 6 222 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.964 5 219 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9635 5 221 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9561 5 219 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9539 6 222 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q7NBK9-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9875 5 222 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A3B8RQ74-F1-model_v4 Ribulose-phosphate 3-epimerase 0.985 54 223 GO:0005975
GO:0016857
AF-G2LHA7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9819 3 222 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1F2VLA7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9814 5 226 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7Y4UCZ2-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9813 6 191 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.89 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map