F488932

General Info

Members Datasets Scaffolds Average Seq Length
1045 555 2090 325

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10350880|Ga0105237_103508801
Length 358
Sequence MPIIRFLPRLYRWQRPASRPLADRRVEFRRERGMEIFDYDNVLLLPRKCRVESRSECDPSVEFGPRRFALPVVPANMKTVIDESIAEWLAGNGFFYVMHRFDVDHVAFARRMREKNLVVSISSGVKRPDYAVIDRLASDGVGADYVTIDIAHGHAETVHRMIEHIKTKLPQAFVIAGNVATPEAVIDLENWGADATKVGVGPGKVCITKLKTGFGTGGWQLSALKWCARVATKPIIADGGIRDHGDIAKSVRFGACMVMIGSLFAGHEESPGRTVEVDGKLYKEYYGSASDFNKGEYKHVEGKRILEPIKGSLADTLREMKEDVQSSISYAGGTKLSDIRKVNYVILGGDNAGEHLLM

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
110 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
210 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
215 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
224 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
225 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
228 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
229 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
230 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
231 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
232 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
241 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
269 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
270 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
271 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
272 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
273 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
274 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
279 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
280 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
281 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
282 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
283 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
284 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
285 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
286 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
287 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
288 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
289 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
317 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
318 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
357 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
358 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
371 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
372 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
373 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
374 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
375 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
376 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
377 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
378 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
379 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
380 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
381 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
392 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
397 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
403 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
404 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
405 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
406 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
407 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
408 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
409 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
410 2547132374 Acidovorax radicis N35 Isolate Unclassified
411 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
412 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
413 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
414 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
415 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
416 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
417 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
418 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
419 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
420 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
421 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
422 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
423 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
424 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
425 2643221570 Acidovorax sp. Root568 Isolate Unclassified
426 2643221585 Pelomonas sp. Root662 Isolate Unclassified
427 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
428 2643221596 Acidovorax sp. Root70 Isolate Unclassified
429 2643221609 Acidovorax sp. Root217 Isolate Unclassified
430 2643221611 Acidovorax sp. Root219 Isolate Unclassified
431 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
432 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
433 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
434 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
435 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
436 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
437 2643221652 Acidovorax sp. Root402 Isolate Unclassified
438 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
439 2643221656 Pelomonas sp. Root405 Isolate Unclassified
440 2643221658 Variovorax sp. Root411 Isolate Unclassified
441 2643221672 Variovorax sp. Root434 Isolate Unclassified
442 2643221683 Variovorax sp. Root473 Isolate Unclassified
443 2643221717 Acidovorax sp. Root267 Isolate Unclassified
444 2643221732 Bacillus sp. Root239 Isolate Unclassified
445 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
446 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
447 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
448 2684622632 Bacillus cereus 905 Isolate Unclassified
449 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
450 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
451 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
452 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
453 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
454 2721755523 Delftia sp. HK171 Isolate Unclassified
455 2738541277 Variovorax sp. GV051 Isolate Unclassified
456 2738541295 Bacillus sp. OK085 Isolate Unclassified
457 2738541307 Variovorax sp. GV008 Isolate Unclassified
458 2738541358 Bacillus sp. OV752 Isolate Unclassified
459 2738543006 Bacillus sp. OK077 Isolate Unclassified
460 2738543012 Acidovorax sp. CF301 Isolate Unclassified
461 2738543013 Variovorax sp. BT01 Isolate Unclassified
462 2738543019 Variovorax sp. GV040 Isolate Unclassified
463 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
464 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
465 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
466 2816332133 Acidovorax radicis 2721A Isolate Unclassified
467 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
468 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
469 2818991441 Niallia circulans 3243 Isolate Rhizosphere
470 2818991446 Variovorax sp. 1180 Isolate Unclassified
471 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
472 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
473 2831864461 Roseateles noduli HZ7 Isolate Nodule
474 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
475 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
476 2842677519 Variovorax sp. R-72495 Isolate Unclassified
477 2842682962 Bacillus sp. R-72492 Isolate Unclassified
478 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
479 2842733646 Variovorax sp. R-72446 Isolate Unclassified
480 2842747753 Variovorax sp. R-72060 Isolate Unclassified
481 2849139964 Bacillus sp. R-71875 Isolate Unclassified
482 2857581216 Bacillus sp. R-71922 Isolate Unclassified
483 2860837431 Bacillus sp. WR11 Isolate Unclassified
484 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
485 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
486 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
487 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
488 2885198086 Variovorax sp. 679 Isolate Unclassified
489 2885211737 Variovorax sp. 553 Isolate Unclassified
490 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
491 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
492 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
493 2899924645 Variovorax sp. 369 Isolate Unclassified
494 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
495 2904456579 Variovorax sp. 2002 Isolate Unclassified
496 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
497 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
498 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
499 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
500 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
501 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
502 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
503 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
504 2928037797 Variovorax sp. 1126 Isolate Unclassified
505 2928044640 Variovorax sp. 1128 Isolate Unclassified
506 2928051484 Variovorax sp. 1133 Isolate Unclassified
507 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
508 2928070936 Variovorax gossypii 1167 Isolate Unclassified
509 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
510 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
511 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
512 2929004312 Priestia megaterium 1104 Isolate Unclassified
513 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
514 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
515 2929520902 Variovorax beijingensis 502 Isolate Unclassified
516 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
517 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
518 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
519 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
520 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
521 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
522 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
523 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
524 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
525 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
526 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
527 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
528 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
529 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
530 2965761152 Bacillus sp. COPE52 Isolate Unclassified
531 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
532 2969141011 Bacillus velezensis MH25 Isolate Unclassified
533 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
534 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
535 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
536 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
537 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
538 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
539 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
540 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
541 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
542 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
543 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
544 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
545 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
546 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
547 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
548 8022653035 Bacillus sp. Rc4 Isolate Unclassified
549 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
550 8023438354 Bacillus sp. BH2 Isolate Unclassified
551 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
552 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
553 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
554 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
555 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.69
Metatranscriptomes 0.86
Isolates 14.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.31
Nodule 1.24
Rhizoplane 1.82
Rhizosphere 57.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10350880 3300009545 Bacteria 1480
2 SwRhRL2b_contig_1580065 2162886007 Bacteria 1418
3 JGI25156J39149_1000006 3300002705 Bacteria 261778
4 JGI25156J39149_1000459 3300002705 Bacteria 24817
5 JGI25154J39366_1000015 3300002738 Bacteria 261778
6 JGI25154J39366_1002018 3300002738 Bacteria 5867
7 JGI25157J39369_1000021 3300002741 Bacteria 163907
8 JGI25157J39369_1000111 3300002741 Bacteria 69508
9 JGI25152J39213_1007497 3300002773 Bacteria 2819
10 JGI25159J45721_1001980 3300002987 Bacteria 8154
11 JGI25159J45721_1011608 3300002987 Bacteria 2147
12 JGI25159J45721_1016473 3300002987 Bacteria 1573
13 JGI25151J46595_10001205 3300003187 Bacteria 18532
14 JGI25151J46595_10001210 3300003187 Bacteria 18476
15 JGI25151J46595_10002472 3300003187 Bacteria 11070
16 JGI25151J46595_10002973 3300003187 Bacteria 9677
17 JGI25151J46595_10005635 3300003187 Bacteria 6439
18 JGI25151J46595_10014177 3300003187 Bacteria 3561
19 JGI25153J46596_10001901 3300003215 Bacteria 12388
20 JGI25153J46596_10011385 3300003215 Bacteria 3934
21 JGI25153J46596_10012295 3300003215 Bacteria 3707
22 rootH1_10001155 3300003316 Bacteria 241584
23 JGI25160J50197_1000045 3300003354 Bacteria 142992
24 JGI25161J50226_1000008 3300003374 Bacteria 239245
25 Ga0006562J51391_1119627 3300003578 Bacteria 1620
26 Ga0055538_1000081 3300003751 Bacteria 85159
27 Ga0055533_1000033 3300003756 Bacteria 265716
28 Ga0055525_1000011 3300003759 Bacteria 503124
29 Ga0055525_1001213 3300003759 Bacteria 5686
30 Ga0055535_1000076 3300003761 Bacteria 111203
31 Ga0055535_1001037 3300003761 Bacteria 17524
32 Ga0055542_1000009 3300003762 Bacteria 416550
33 Ga0055529_1000860 3300003763 Bacteria 17524
34 Ga0055526_1001951 3300003771 Bacteria 14259
35 Ga0055526_1002081 3300003771 Bacteria 13745
36 Ga0055526_1006798 3300003771 Bacteria 6106
37 Ga0055526_1006804 3300003771 Bacteria 6104
38 Ga0055537_1000011 3300003773 Bacteria 137556
39 Ga0055537_1000182 3300003773 Bacteria 46822
40 Ga0055537_1006595 3300003773 Bacteria 2917
41 Ga0055537_1014005 3300003773 Bacteria 1475
42 Ga0055524_1000126 3300003775 Bacteria 89985
43 Ga0055524_1000679 3300003775 Bacteria 23825
44 Ga0055536_1001326 3300003781 Bacteria 15163
45 Ga0055534_1000020 3300003784 Bacteria 137562
46 Ga0055534_1000333 3300003784 Bacteria 30812
47 Ga0055534_1001522 3300003784 Bacteria 9059
48 Ga0055534_1002053 3300003784 Bacteria 7284
49 Ga0055528_1000349 3300003790 Bacteria 37978
50 Ga0055528_1000606 3300003790 Bacteria 26938
51 Ga0055528_1029631 3300003790 Bacteria 1475
52 Ga0055530_10000302 3300003791 Bacteria 44821
53 Ga0055530_10002526 3300003791 Bacteria 11666
54 Ga0055530_10023526 3300003791 Bacteria 1767
55 Ga0055540_1000015 3300003792 Bacteria 232986
56 Ga0055540_1000021 3300003792 Bacteria 208733
57 Ga0055540_1004986 3300003792 Bacteria 5778
58 Ga0055531_10000214 3300003794 Bacteria 63569
59 Ga0055531_10000806 3300003794 Bacteria 25957
60 Ga0055531_10001001 3300003794 Bacteria 22450
61 Ga0055531_10005410 3300003794 Bacteria 7483
62 Ga0055531_10014723 3300003794 Bacteria 3503
63 Ga0055543_1003659 3300004625 Bacteria 4428
64 Ga0065165_1000024 3300005262 Bacteria 247672
65 Ga0065165_1000401 3300005262 Bacteria 69929
66 Ga0065165_1002995 3300005262 Bacteria 12808
67 Ga0065714_10006124 3300005288 Bacteria 4330
68 Ga0065704_10091410 3300005289 Bacteria 2719
69 Ga0065707_10094865 3300005295 Bacteria 3443
70 Ga0070658_10067093 3300005327 Bacteria 2931
71 Ga0070658_10198158 3300005327 Bacteria 1694
72 Ga0070676_10028928 3300005328 Bacteria 3148
73 Ga0070683_100132995 3300005329 Bacteria 2354
74 Ga0070683_100222390 3300005329 Bacteria 1794
75 Ga0070690_100000001 3300005330 Bacteria 208233
76 Ga0070690_100239269 3300005330 Bacteria 1279
77 Ga0070670_100000817 3300005331 Bacteria 24262
78 Ga0070670_100008148 3300005331 Bacteria 8921
79 Ga0070670_100191077 3300005331 Bacteria 1778
80 Ga0068869_100001842 3300005334 Bacteria 12742
81 Ga0068869_100040874 3300005334 Bacteria 3317
82 Ga0068869_100065284 3300005334 Bacteria 2679
83 Ga0068869_100169308 3300005334 Bacteria 1706
84 Ga0070666_10000960 3300005335 Bacteria 17591
85 Ga0070666_10027413 3300005335 Bacteria 3731
86 Ga0070666_10043775 3300005335 Bacteria 2998
87 Ga0070666_10170599 3300005335 Bacteria 1524
88 Ga0068868_100146116 3300005338 Bacteria 1944
89 Ga0068868_100235894 3300005338 Bacteria 1536
90 Ga0070660_100039575 3300005339 Bacteria 3584
91 Ga0070660_100211467 3300005339 Bacteria 1575
92 Ga0070689_100057022 3300005340 Bacteria 3031
93 Ga0070661_100000841 3300005344 Bacteria 22033
94 Ga0070661_100014722 3300005344 Bacteria 5516
95 Ga0070661_100031906 3300005344 Bacteria 3811
96 Ga0070669_100001800 3300005353 Bacteria 15415
97 Ga0070669_100079404 3300005353 Bacteria 2440
98 Ga0070669_100102649 3300005353 Bacteria 2159
99 Ga0070675_100003281 3300005354 Bacteria 12273
100 Ga0070675_100039314 3300005354 Bacteria 3860
101 Ga0070675_100152123 3300005354 Bacteria 1984
102 Ga0070671_100009321 3300005355 Bacteria 7882
103 Ga0070671_100030602 3300005355 Bacteria 4442
104 Ga0070671_100052804 3300005355 Bacteria 3379
105 Ga0070671_100056286 3300005355 Bacteria 3272
106 Ga0070674_100031822 3300005356 Bacteria 3499
107 Ga0070673_100001009 3300005364 Bacteria 15963
108 Ga0070673_100015685 3300005364 Bacteria 5330
109 Ga0070673_100243891 3300005364 Bacteria 1563
110 Ga0070659_100048151 3300005366 Bacteria 3347
111 Ga0070667_100004040 3300005367 Bacteria 12405
112 Ga0070667_100096269 3300005367 Bacteria 2553
113 Ga0070701_10225999 3300005438 Bacteria 1119
114 Ga0070700_100016951 3300005441 Bacteria 4158
115 Ga0070700_100180279 3300005441 Bacteria 1469
116 Ga0070663_100016943 3300005455 Bacteria 4743
117 Ga0070678_100076096 3300005456 Bacteria 2527
118 Ga0070678_100109989 3300005456 Bacteria 2154
119 Ga0070678_100141178 3300005456 Bacteria 1928
120 Ga0070662_100014126 3300005457 Bacteria 5327
121 Ga0070662_100022340 3300005457 Bacteria 4331
122 Ga0070662_100120722 3300005457 Bacteria 2008
123 Ga0070662_100212838 3300005457 Bacteria 1539
124 Ga0068867_100000042 3300005459 Bacteria 77140
125 Ga0068867_100002918 3300005459 Bacteria 12053
126 Ga0068867_100011005 3300005459 Bacteria 6378
127 Ga0070679_100013117 3300005530 Bacteria 7936
128 Ga0070679_100100557 3300005530 Bacteria 2877
129 Ga0068853_100045063 3300005539 Bacteria 3777
130 Ga0068853_100130668 3300005539 Bacteria 2248
131 Ga0068853_100240939 3300005539 Bacteria 1657
132 Ga0070672_100040398 3300005543 Bacteria 3579
133 Ga0070693_100022693 3300005547 Bacteria 3341
134 Ga0070665_100077997 3300005548 Bacteria 3319
135 Ga0068855_100019714 3300005563 Bacteria 8099
136 Ga0068855_100215341 3300005563 Bacteria 2156
137 Ga0070664_100004757 3300005564 Bacteria 10889
138 Ga0070664_100021332 3300005564 Bacteria 5337
139 Ga0070664_100048175 3300005564 Bacteria 3601
140 Ga0068857_100005113 3300005577 Bacteria 11156
141 Ga0068857_100027288 3300005577 Bacteria 5036
142 Ga0068857_100160194 3300005577 Bacteria 2042
143 Ga0068856_100000887 3300005614 Bacteria 32039
144 Ga0068856_100040639 3300005614 Bacteria 4569
145 Ga0068852_100048105 3300005616 Bacteria 3643
146 Ga0068852_100409994 3300005616 Bacteria 1335
147 Ga0068859_100060433 3300005617 Bacteria 3818
148 Ga0068859_100410178 3300005617 Bacteria 1451
149 Ga0068864_100077885 3300005618 Bacteria 2900
150 Ga0068866_10004706 3300005718 Bacteria 5600
151 Ga0068866_10006851 3300005718 Bacteria 4757
152 Ga0068861_100034068 3300005719 Bacteria 3763
153 Ga0068861_100055999 3300005719 Bacteria 3008
154 Ga0068861_100126537 3300005719 Bacteria 2068
155 Ga0068851_10010700 3300005834 Bacteria 4287
156 Ga0068851_10015161 3300005834 Bacteria 3668
157 Ga0068863_100003799 3300005841 Bacteria 14929
158 Ga0068863_100005986 3300005841 Bacteria 11929
159 Ga0068863_100024555 3300005841 Bacteria 5748
160 Ga0068863_100047981 3300005841 Bacteria 4049
161 Ga0068863_100192258 3300005841 Bacteria 1961
162 Ga0068858_100002240 3300005842 Bacteria 19545
163 Ga0068858_100080940 3300005842 Bacteria 3018
164 Ga0068860_100000445 3300005843 Bacteria 52236
165 Ga0068860_100002076 3300005843 Bacteria 21118
166 Ga0068860_100065526 3300005843 Bacteria 3450
167 Ga0068860_100067929 3300005843 Bacteria 3386
168 Ga0068860_100295299 3300005843 Bacteria 1586
169 Ga0068862_100007146 3300005844 Bacteria 9269
170 Ga0068862_100011076 3300005844 Bacteria 7449
171 Ga0068862_100014506 3300005844 Bacteria 6540
172 Ga0068862_100086014 3300005844 Bacteria 2733
173 Ga0075365_10003947 3300006038 Bacteria 7769
174 Ga0075365_10139939 3300006038 Bacteria 1679
175 Ga0075368_10029585 3300006042 Bacteria 2118
176 Ga0075363_100056785 3300006048 Bacteria 2099
177 Ga0075363_100112167 3300006048 Bacteria 1516
178 Ga0075364_10009007 3300006051 Bacteria 5978
179 Ga0075364_10052613 3300006051 Bacteria 2661
180 Ga0075364_10118772 3300006051 Bacteria 1769
181 Ga0075432_10014637 3300006058 Bacteria 2671
182 Ga0075362_10012738 3300006177 Bacteria 3348
183 Ga0075362_10015848 3300006177 Bacteria 3074
184 Ga0075362_10017053 3300006177 Bacteria 2986
185 Ga0075362_10022087 3300006177 Bacteria 2677
186 Ga0075362_10022308 3300006177 Bacteria 2666
187 Ga0075362_10058021 3300006177 Bacteria 1745
188 Ga0075367_10025655 3300006178 Bacteria 3335
189 Ga0075367_10031585 3300006178 Bacteria 3041
190 Ga0075367_10052150 3300006178 Bacteria 2420
191 Ga0075366_10000957 3300006195 Bacteria 14080
192 Ga0075366_10009371 3300006195 Bacteria 5464
193 Ga0075366_10029346 3300006195 Bacteria 3232
194 Ga0075366_10100892 3300006195 Bacteria 1732
195 Ga0075366_10129032 3300006195 Bacteria 1525
196 Ga0097621_100099784 3300006237 Bacteria 2441
197 Ga0075370_10001441 3300006353 Bacteria 10331
198 Ga0075370_10002460 3300006353 Bacteria 8589
199 Ga0075370_10013167 3300006353 Bacteria 4390
200 Ga0075370_10014047 3300006353 Bacteria 4264
201 Ga0075370_10017503 3300006353 Bacteria 3873
202 Ga0075370_10018231 3300006353 Bacteria 3806
203 Ga0075370_10020298 3300006353 Bacteria 3629
204 Ga0075370_10024531 3300006353 Bacteria 3332
205 Ga0075370_10037798 3300006353 Bacteria 2715
206 Ga0075370_10042989 3300006353 Bacteria 2553
207 Ga0075370_10074579 3300006353 Bacteria 1944
208 Ga0068871_100008651 3300006358 Bacteria 7321
209 Ga0068871_100241727 3300006358 Bacteria 1570
210 Ga0075434_100199179 3300006871 Bacteria 2022
211 Ga0075429_100002300 3300006880 Bacteria 16033
212 Ga0068865_100009443 3300006881 Bacteria 6050
213 Ga0068865_100061485 3300006881 Bacteria 2633
214 Ga0097620_100060433 3300006931 Bacteria 3818
215 Ga0097620_100410188 3300006931 Bacteria 1451
216 Ga0099823_1004429 3300006944 Bacteria 13727
217 Ga0079104_1000002 3300006946 Bacteria 514469
218 Ga0079104_1000219 3300006946 Bacteria 79928
219 Ga0079104_1006351 3300006946 Bacteria 4497
220 Ga0099826_10014173 3300006948 Bacteria 6023
221 Ga0099826_10059971 3300006948 Bacteria 2483
222 Ga0105251_10039728 3300009011 Bacteria 2297
223 Ga0105251_10054066 3300009011 Bacteria 1908
224 Ga0105244_10001082 3300009036 Bacteria 22683
225 Ga0105244_10003649 3300009036 Bacteria 10898
226 Ga0105244_10025820 3300009036 Bacteria 3186
227 Ga0105244_10058078 3300009036 Bacteria 1954
228 Ga0105244_10100473 3300009036 Bacteria 1415
229 Ga0105250_10006394 3300009092 Bacteria 5151
230 Ga0105250_10030203 3300009092 Bacteria 2179
231 Ga0105240_10001398 3300009093 Bacteria 41467
232 Ga0105240_10046752 3300009093 Bacteria 5481
233 Ga0105240_10066173 3300009093 Bacteria 4484
234 Ga0105240_10107763 3300009093 Bacteria 3377
235 Ga0105245_10034537 3300009098 Bacteria 4486
236 Ga0105245_10037603 3300009098 Bacteria 4304
237 Ga0114129_10124503 3300009147 Bacteria 3545
238 Ga0105243_10000764 3300009148 Bacteria 30869
239 Ga0105243_10002340 3300009148 Bacteria 15858
240 Ga0105243_10019402 3300009148 Bacteria 5156
241 Ga0105243_10042088 3300009148 Bacteria 3575
242 Ga0105243_10076032 3300009148 Bacteria 2727
243 Ga0105241_10223183 3300009174 Bacteria 1585
244 Ga0105242_10031307 3300009176 Bacteria 4247
245 Ga0105242_10489811 3300009176 Bacteria 1167
246 Ga0105248_10012566 3300009177 Bacteria 9340
247 Ga0105248_10078489 3300009177 Bacteria 3711
248 Ga0105248_10197133 3300009177 Bacteria 2269
249 Ga0105237_10001780 3300009545 Bacteria 27851
250 Ga0105237_10015735 3300009545 Bacteria 7865
251 Ga0105237_10059850 3300009545 Bacteria 3810
252 Ga0105238_10019971 3300009551 Bacteria 6820
253 Ga0105249_10005956 3300009553 Bacteria 10564
254 Ga0105249_10017447 3300009553 Bacteria 6372
255 Ga0105239_10000615 3300010375 Bacteria 50705
256 Ga0105239_10086938 3300010375 Bacteria 3446
257 Ga0105239_10686654 3300010375 Bacteria 1170
258 Ga0105246_10115286 3300011119 Bacteria 1981
259 Ga0105246_10156605 3300011119 Bacteria 1731
260 Ga0157319_1000001 3300012497 Bacteria 423237
261 Ga0157326_1003246 3300012513 Bacteria 1715
262 Ga0157373_10025052 3300013100 Bacteria 4319
263 Ga0157373_10041688 3300013100 Bacteria 3283
264 Ga0157373_10085976 3300013100 Bacteria 2216
265 Ga0157371_10087103 3300013102 Bacteria 2212
266 Ga0157369_10028743 3300013105 Bacteria 6149
267 Ga0157369_10189277 3300013105 Bacteria 2163
268 Ga0157374_10255240 3300013296 Bacteria 1726
269 Ga0157378_10016387 3300013297 Bacteria 6488
270 Ga0157378_10062020 3300013297 Bacteria 3338
271 Ga0163162_10042974 3300013306 Bacteria 4524
272 Ga0163162_10131923 3300013306 Bacteria 2607
273 Ga0157372_10036343 3300013307 Bacteria 5429
274 Ga0157372_10090635 3300013307 Bacteria 3476
275 Ga0157375_10023030 3300013308 Bacteria 5741
276 Ga0157375_10082234 3300013308 Bacteria 3262
277 Ga0157380_10180912 3300014326 Bacteria 1852
278 Ga0182008_10002167 3300014497 Bacteria 12496
279 Ga0182008_10007602 3300014497 Bacteria 5975
280 Ga0182008_10056271 3300014497 Bacteria 1944
281 Ga0157377_10000038 3300014745 Bacteria 113777
282 Ga0157379_10024536 3300014968 Bacteria 5352
283 Ga0157379_10070395 3300014968 Bacteria 3129
284 Ga0157379_10121929 3300014968 Bacteria 2346
285 Ga0157379_10185718 3300014968 Bacteria 1879
286 Ga0157376_10001082 3300014969 Bacteria 17860
287 Ga0157376_10282151 3300014969 Bacteria 1565
288 Ga0182006_1006774 3300015261 Bacteria 5291
289 Ga0182007_10000224 3300015262 Bacteria 38000
290 Ga0182007_10001945 3300015262 Bacteria 10695
291 Ga0183362_10001 3300015683 Bacteria 2046624
292 Ga0163161_10000042 3300017792 Bacteria 135368
293 Ga0163161_10004047 3300017792 Bacteria 10254
294 Ga0163161_10067035 3300017792 Bacteria 2621
295 Ga0163161_10082182 3300017792 Bacteria 2373
296 Ga0213872_10000003 3300021361 Bacteria 366948
297 Ga0213872_10000124 3300021361 Bacteria 72197
298 Ga0213872_10000345 3300021361 Bacteria 39156
299 Ga0213872_10020060 3300021361 Bacteria 3079
300 Ga0213872_10035580 3300021361 Bacteria 2277
301 Ga0209435_100010 3300025206 Bacteria 475373
302 Ga0209436_109065 3300025208 Bacteria 1926
303 Ga0209784_100044 3300025224 Bacteria 206858
304 Ga0209674_100064 3300025226 Bacteria 265769
305 Ga0209672_100728 3300025228 Bacteria 16203
306 Ga0209672_106441 3300025228 Bacteria 1906
307 Ga0209147_100457 3300025229 Bacteria 25391
308 Ga0209147_102577 3300025229 Bacteria 4339
309 Ga0209147_102702 3300025229 Bacteria 4068
310 Ga0209563_100005 3300025230 Bacteria 1774893
311 Ga0209563_100126 3300025230 Bacteria 113122
312 Ga0207427_100197 3300025231 Bacteria 57629
313 Ga0209258_100009 3300025242 Bacteria 996276
314 Ga0209258_100736 3300025242 Bacteria 21300
315 Ga0209258_100787 3300025242 Bacteria 19150
316 Ga0207425_1000135 3300025245 Bacteria 66450
317 Ga0207425_1000821 3300025245 Bacteria 15532
318 Ga0209646_1000001 3300025246 Bacteria 3092932
319 Ga0209646_1000060 3300025246 Bacteria 256386
320 Ga0209026_1000001 3300025250 Bacteria 1228671
321 Ga0209026_1000049 3300025250 Bacteria 255273
322 Ga0209677_100411 3300025253 Bacteria 25661
323 Ga0209677_101222 3300025253 Bacteria 11674
324 Ga0209148_1000007 3300025254 Bacteria 1592273
325 Ga0209148_1004733 3300025254 Bacteria 3270
326 Ga0209759_1000001 3300025256 Bacteria 2799452
327 Ga0209759_1000069 3300025256 Bacteria 182437
328 Ga0209759_1001428 3300025256 Bacteria 13546
329 Ga0209129_1000013 3300025258 Bacteria 524874
330 Ga0209129_1000043 3300025258 Bacteria 298978
331 Ga0209129_1004720 3300025258 Bacteria 5169
332 Ga0209565_1000028 3300025263 Bacteria 348536
333 Ga0209565_1000058 3300025263 Bacteria 194126
334 Ga0209565_1000197 3300025263 Bacteria 71850
335 Ga0209565_1000433 3300025263 Bacteria 33703
336 Ga0209565_1008528 3300025263 Bacteria 2671
337 Ga0209455_1001719 3300025272 Bacteria 9364
338 Ga0209673_1000035 3300025273 Bacteria 328411
339 Ga0209673_1000053 3300025273 Bacteria 279449
340 Ga0209673_1000279 3300025273 Bacteria 96141
341 Ga0209673_1000316 3300025273 Bacteria 89031
342 Ga0209673_1000780 3300025273 Bacteria 42650
343 Ga0209673_1004689 3300025273 Bacteria 7208
344 Ga0209673_1013804 3300025273 Bacteria 3168
345 Ga0209673_1014652 3300025273 Bacteria 3024
346 Ga0209673_1028079 3300025273 Bacteria 1819
347 Ga0209130_1000112 3300025284 Bacteria 131607
348 Ga0209130_1000158 3300025284 Bacteria 101323
349 Ga0209130_1000186 3300025284 Bacteria 87096
350 Ga0209130_1000363 3300025284 Bacteria 51603
351 Ga0209130_1000701 3300025284 Bacteria 30005
352 Ga0209130_1003550 3300025284 Bacteria 6531
353 Ga0209130_1005803 3300025284 Bacteria 4177
354 Ga0209675_1000010 3300025291 Bacteria 541927
355 Ga0209675_1000130 3300025291 Bacteria 102667
356 Ga0209675_1000153 3300025291 Bacteria 90298
357 Ga0209675_1000871 3300025291 Bacteria 19422
358 Ga0209675_1001471 3300025291 Bacteria 13541
359 Ga0209675_1004539 3300025291 Bacteria 6136
360 Ga0209675_1011067 3300025291 Bacteria 3018
361 Ga0209676_1000069 3300025292 Bacteria 312462
362 Ga0209676_1000108 3300025292 Bacteria 221168
363 Ga0209676_1007541 3300025292 Bacteria 5071
364 Ga0209676_1007556 3300025292 Bacteria 5064
365 Ga0209025_1000103 3300025294 Bacteria 228054
366 Ga0209025_1000129 3300025294 Bacteria 198847
367 Ga0209025_1000169 3300025294 Bacteria 161428
368 Ga0209025_1000331 3300025294 Bacteria 104721
369 Ga0209025_1000565 3300025294 Bacteria 67929
370 Ga0209025_1001427 3300025294 Bacteria 31558
371 Ga0209025_1001602 3300025294 Bacteria 28432
372 Ga0209025_1001700 3300025294 Bacteria 26836
373 Ga0209025_1001921 3300025294 Bacteria 24097
374 Ga0209025_1002074 3300025294 Bacteria 22759
375 Ga0209025_1002962 3300025294 Bacteria 16868
376 Ga0209025_1011956 3300025294 Bacteria 5638
377 Ga0209025_1014326 3300025294 Bacteria 4889
378 Ga0209025_1023954 3300025294 Bacteria 3170
379 Ga0209025_1025018 3300025294 Bacteria 3056
380 Ga0209564_1000005 3300025295 Bacteria 1147192
381 Ga0209564_1000014 3300025295 Bacteria 621501
382 Ga0209564_1000171 3300025295 Bacteria 155716
383 Ga0209564_1000880 3300025295 Bacteria 39770
384 Ga0209564_1001709 3300025295 Bacteria 20691
385 Ga0209564_1002454 3300025295 Bacteria 14592
386 Ga0209564_1003455 3300025295 Bacteria 10789
387 Ga0209758_1000067 3300025297 Bacteria 288575
388 Ga0209758_1000307 3300025297 Bacteria 95192
389 Ga0209758_1000492 3300025297 Bacteria 64511
390 Ga0209050_1000002 3300025298 Bacteria 1792849
391 Ga0209050_1000023 3300025298 Bacteria 537172
392 Ga0209050_1000493 3300025298 Bacteria 67885
393 Ga0209050_1000543 3300025298 Bacteria 62404
394 Ga0209050_1001273 3300025298 Bacteria 28958
395 Ga0209050_1001396 3300025298 Bacteria 26194
396 Ga0209050_1003837 3300025298 Bacteria 10711
397 Ga0209050_1010459 3300025298 Bacteria 4571
398 Ga0209050_1010869 3300025298 Bacteria 4415
399 Ga0209256_1000003 3300025299 Bacteria 1661127
400 Ga0209256_1000077 3300025299 Bacteria 230410
401 Ga0209256_1000092 3300025299 Bacteria 210547
402 Ga0209256_1000121 3300025299 Bacteria 167299
403 Ga0209256_1008919 3300025299 Bacteria 4519
404 Ga0207426_1000101 3300025302 Bacteria 262096
405 Ga0207426_1000129 3300025302 Bacteria 210930
406 Ga0207426_1000153 3300025302 Bacteria 182839
407 Ga0209051_1000002 3300025303 Bacteria 1631846
408 Ga0209051_1000017 3300025303 Bacteria 537172
409 Ga0209051_1000020 3300025303 Bacteria 508628
410 Ga0209051_1000101 3300025303 Bacteria 163793
411 Ga0209051_1000145 3300025303 Bacteria 134807
412 Ga0209051_1000289 3300025303 Bacteria 80415
413 Ga0209051_1000317 3300025303 Bacteria 73057
414 Ga0209051_1001499 3300025303 Bacteria 19509
415 Ga0209051_1001699 3300025303 Bacteria 17625
416 Ga0209051_1003391 3300025303 Bacteria 10457
417 Ga0209051_1009607 3300025303 Bacteria 4967
418 Ga0209051_1010293 3300025303 Bacteria 4743
419 Ga0209051_1013144 3300025303 Bacteria 3957
420 Ga0209051_1040416 3300025303 Bacteria 1672
421 Ga0209051_1040988 3300025303 Bacteria 1653
422 Ga0209257_1000002 3300025304 Bacteria 1767052
423 Ga0209257_1000017 3300025304 Bacteria 866287
424 Ga0209257_1000039 3300025304 Bacteria 591694
425 Ga0209257_1000041 3300025304 Bacteria 537172
426 Ga0209257_1000189 3300025304 Bacteria 153917
427 Ga0209257_1000724 3300025304 Bacteria 50361
428 Ga0209257_1007414 3300025304 Bacteria 6628
429 Ga0209257_1010393 3300025304 Bacteria 4718
430 Ga0209257_1020459 3300025304 Bacteria 2446
431 Ga0207656_10019425 3300025321 Bacteria 2688
432 Ga0207696_1000786 3300025711 Bacteria 20827
433 Ga0207696_1010395 3300025711 Bacteria 3411
434 Ga0207655_1000332 3300025728 Bacteria 69117
435 Ga0207655_1000839 3300025728 Bacteria 33048
436 Ga0207655_1005345 3300025728 Bacteria 8775
437 Ga0207655_1062474 3300025728 Bacteria 1432
438 Ga0207713_1001629 3300025735 Bacteria 17507
439 Ga0207713_1041575 3300025735 Bacteria 1916
440 Ga0207682_10044711 3300025893 Bacteria 1816
441 Ga0207688_10084072 3300025901 Bacteria 1821
442 Ga0207680_10129006 3300025903 Bacteria 1664
443 Ga0207645_10001485 3300025907 Bacteria 19163
444 Ga0207643_10097243 3300025908 Bacteria 1723
445 Ga0207705_10319175 3300025909 Bacteria 1193
446 Ga0207707_10156440 3300025912 Bacteria 1994
447 Ga0207695_10006362 3300025913 Bacteria 15366
448 Ga0207695_10047697 3300025913 Bacteria 4530
449 Ga0207695_10050611 3300025913 Bacteria 4368
450 Ga0207695_10076864 3300025913 Bacteria 3393
451 Ga0207695_10191782 3300025913 Bacteria 1961
452 Ga0207671_10003233 3300025914 Bacteria 16389
453 Ga0207671_10068376 3300025914 Bacteria 2647
454 Ga0207671_10099948 3300025914 Bacteria 2196
455 Ga0207657_10048467 3300025919 Bacteria 3709
456 Ga0207657_10080477 3300025919 Bacteria 2738
457 Ga0207657_10234846 3300025919 Bacteria 1466
458 Ga0207649_10001402 3300025920 Bacteria 14262
459 Ga0207649_10070952 3300025920 Bacteria 2223
460 Ga0207652_10050248 3300025921 Bacteria 3572
461 Ga0207681_10002051 3300025923 Bacteria 12932
462 Ga0207681_10013357 3300025923 Bacteria 5081
463 Ga0207694_10022432 3300025924 Bacteria 4788
464 Ga0207694_10063968 3300025924 Bacteria 2866
465 Ga0207650_10000998 3300025925 Bacteria 21269
466 Ga0207650_10003908 3300025925 Bacteria 10189
467 Ga0207650_10035789 3300025925 Bacteria 3608
468 Ga0207659_10000691 3300025926 Bacteria 20035
469 Ga0207659_10009045 3300025926 Bacteria 6212
470 Ga0207659_10028640 3300025926 Bacteria 3787
471 Ga0207687_10030425 3300025927 Bacteria 3640
472 Ga0207644_10001362 3300025931 Bacteria 15719
473 Ga0207644_10008153 3300025931 Bacteria 6864
474 Ga0207644_10051638 3300025931 Bacteria 2952
475 Ga0207644_10057212 3300025931 Bacteria 2815
476 Ga0207690_10003313 3300025932 Bacteria 9634
477 Ga0207706_10001466 3300025933 Bacteria 23574
478 Ga0207686_10003386 3300025934 Bacteria 8563
479 Ga0207686_10003857 3300025934 Bacteria 8038
480 Ga0207709_10000015 3300025935 Bacteria 493221
481 Ga0207709_10000094 3300025935 Bacteria 137959
482 Ga0207709_10000624 3300025935 Bacteria 29013
483 Ga0207709_10024260 3300025935 Bacteria 3461
484 Ga0207709_10032850 3300025935 Bacteria 3042
485 Ga0207669_10007676 3300025937 Bacteria 5011
486 Ga0207669_10039443 3300025937 Bacteria 2729
487 Ga0207704_10003582 3300025938 Bacteria 7053
488 Ga0207691_10001243 3300025940 Bacteria 25438
489 Ga0207691_10003923 3300025940 Bacteria 14453
490 Ga0207691_10049651 3300025940 Bacteria 3844
491 Ga0207691_10067971 3300025940 Bacteria 3220
492 Ga0207711_10009786 3300025941 Bacteria 7972
493 Ga0207711_10095074 3300025941 Bacteria 2627
494 Ga0207689_10002717 3300025942 Bacteria 16359
495 Ga0207689_10062542 3300025942 Bacteria 3061
496 Ga0207689_10069421 3300025942 Bacteria 2895
497 Ga0207689_10079042 3300025942 Bacteria 2703
498 Ga0207689_10209853 3300025942 Bacteria 1609
499 Ga0207661_10098649 3300025944 Bacteria 2448
500 Ga0207679_10000154 3300025945 Bacteria 56628
501 Ga0207679_10010502 3300025945 Bacteria 5965
502 Ga0207679_10022828 3300025945 Bacteria 4266
503 Ga0207679_10109532 3300025945 Bacteria 2177
504 Ga0207667_10001779 3300025949 Bacteria 27124
505 Ga0207667_10116275 3300025949 Bacteria 2756
506 Ga0207651_10008151 3300025960 Bacteria 5638
507 Ga0207651_10009585 3300025960 Bacteria 5314
508 Ga0207712_10067616 3300025961 Bacteria 2558
509 Ga0207640_10002657 3300025981 Bacteria 9569
510 Ga0207640_10037293 3300025981 Bacteria 3057
511 Ga0207640_10110641 3300025981 Bacteria 1946
512 Ga0207658_10001089 3300025986 Bacteria 21924
513 Ga0207677_10037875 3300026023 Bacteria 3156
514 Ga0207677_10197584 3300026023 Bacteria 1596
515 Ga0207703_10000996 3300026035 Bacteria 27254
516 Ga0207703_10015852 3300026035 Bacteria 5879
517 Ga0207703_10091690 3300026035 Bacteria 2556
518 Ga0207639_10124298 3300026041 Bacteria 2125
519 Ga0207639_10262296 3300026041 Bacteria 1512
520 Ga0207678_10043499 3300026067 Bacteria 3886
521 Ga0207708_10031570 3300026075 Bacteria 4021
522 Ga0207702_10002045 3300026078 Bacteria 19536
523 Ga0207702_10042164 3300026078 Bacteria 3828
524 Ga0207702_10127564 3300026078 Bacteria 2286
525 Ga0207702_10421650 3300026078 Bacteria 1291
526 Ga0207641_10006465 3300026088 Bacteria 9874
527 Ga0207641_10017869 3300026088 Bacteria 5809
528 Ga0207641_10021132 3300026088 Bacteria 5349
529 Ga0207648_10000118 3300026089 Bacteria 77144
530 Ga0207648_10002634 3300026089 Bacteria 19183
531 Ga0207648_10023876 3300026089 Bacteria 5467
532 Ga0207676_10067016 3300026095 Bacteria 2866
533 Ga0207674_10011982 3300026116 Bacteria 9718
534 Ga0207674_10361083 3300026116 Bacteria 1404
535 Ga0207675_100003340 3300026118 Bacteria 15701
536 Ga0207683_10008780 3300026121 Bacteria 8628
537 Ga0207683_10145851 3300026121 Bacteria 2134
538 Ga0207683_10147642 3300026121 Bacteria 2121
539 Ga0209281_1000007 3300027111 Bacteria 938265
540 Ga0209281_1000074 3300027111 Bacteria 267848
541 Ga0209389_1009108 3300027296 Bacteria 8868
542 Ga0209371_1002772 3300027312 Bacteria 9380
543 Ga0209968_1013863 3300027526 Bacteria 1267
544 Ga0209970_1000481 3300027614 Bacteria 6815
545 Ga0209282_1019606 3300027666 Bacteria 4291
546 Ga0209971_1004935 3300027682 Bacteria 3171
547 Ga0209974_10000606 3300027876 Bacteria 12060
548 Ga0209974_10027573 3300027876 Bacteria 1880
549 Ga0207428_10078731 3300027907 Bacteria 2579
550 Ga0268265_10010636 3300028380 Bacteria 6214
551 Ga0268265_10012706 3300028380 Bacteria 5714
552 Ga0268265_10017251 3300028380 Bacteria 4979
553 Ga0268264_10001857 3300028381 Bacteria 19207
554 Ga0268264_10005310 3300028381 Bacteria 10907
555 Ga0268264_10044567 3300028381 Bacteria 3680
556 Ga0268264_10234389 3300028381 Bacteria 1697
557 Ga0265336_10000123 3300028666 Bacteria 57956
558 Ga0307517_10010725 3300028786 Bacteria 12781
559 Ga0307515_10000165 3300028794 Bacteria 162589
560 Ga0307515_10000188 3300028794 Bacteria 151439
561 Ga0307515_10000433 3300028794 Bacteria 100295
562 Ga0307515_10000529 3300028794 Bacteria 90388
563 Ga0307515_10000708 3300028794 Bacteria 76903
564 Ga0307515_10013631 3300028794 Bacteria 15155
565 Ga0307515_10029938 3300028794 Bacteria 9173
566 Ga0307515_10045432 3300028794 Bacteria 6749
567 Ga0307515_10095097 3300028794 Bacteria 3672
568 Ga0307515_10132505 3300028794 Bacteria 2734
569 Ga0265324_10000849 3300029957 Bacteria 19632
570 Ga0237817_10077 3300030083 Bacteria 30107
571 Ga0237817_10171 3300030083 Bacteria 18540
572 Ga0268256_1004899 3300030500 Bacteria 5404
573 Ga0307512_10103250 3300030522 Bacteria 1919
574 Ga0307512_10104209 3300030522 Bacteria 1904
575 Ga0316177_1007744 3300030731 Bacteria 3940
576 Ga0316178_1003672 3300030735 Bacteria 3342
577 Ga0316180_1085302 3300030736 Bacteria 4717
578 Ga0316182_1158565 3300030745 Bacteria 7228
579 Ga0316182_1235587 3300030745 Bacteria 2862
580 Ga0265330_10000022 3300031235 Bacteria 154198
581 Ga0265330_10033981 3300031235 Bacteria 2279
582 Ga0265332_10000001 3300031238 Bacteria 863783
583 Ga0265332_10000009 3300031238 Bacteria 295760
584 Ga0265328_10038040 3300031239 Bacteria 1776
585 Ga0265325_10005268 3300031241 Bacteria 8023
586 Ga0265340_10017633 3300031247 Bacteria 3693
587 Ga0265327_10000144 3300031251 Bacteria 156779
588 Ga0265327_10000748 3300031251 Bacteria 50556
589 Ga0265327_10044788 3300031251 Bacteria 2356
590 Ga0307513_10000004 3300031456 Bacteria 558931
591 Ga0307513_10000015 3300031456 Bacteria 296183
592 Ga0307513_10001902 3300031456 Bacteria 29673
593 Ga0307513_10017436 3300031456 Bacteria 8610
594 Ga0307513_10086145 3300031456 Bacteria 3222
595 Ga0307513_10144504 3300031456 Bacteria 2299
596 Ga0307513_10188330 3300031456 Bacteria 1918
597 Ga0307509_10000234 3300031507 Bacteria 89398
598 Ga0307509_10016663 3300031507 Bacteria 8493
599 Ga0307509_10052970 3300031507 Bacteria 4330
600 Ga0307408_100000038 3300031548 Bacteria 183170
601 Ga0307408_100000186 3300031548 Bacteria 68520
602 Ga0307408_100029978 3300031548 Bacteria 3775
603 Ga0307408_100245641 3300031548 Bacteria 1473
604 Ga0307508_10000169 3300031616 Bacteria 78769
605 Ga0307508_10024742 3300031616 Bacteria 5448
606 Ga0307508_10041698 3300031616 Bacteria 4118
607 Ga0307508_10266202 3300031616 Bacteria 1308
608 Ga0307514_10000593 3300031649 Bacteria 67957
609 Ga0307514_10001826 3300031649 Bacteria 23651
610 Ga0307514_10006926 3300031649 Bacteria 9810
611 Ga0307514_10031222 3300031649 Bacteria 4273
612 Ga0265314_10000013 3300031711 Bacteria 403405
613 Ga0265314_10015884 3300031711 Bacteria 5962
614 Ga0307516_10000311 3300031730 Bacteria 63197
615 Ga0307516_10000326 3300031730 Bacteria 61941
616 Ga0307516_10000383 3300031730 Bacteria 57684
617 Ga0307516_10005389 3300031730 Bacteria 15354
618 Ga0307516_10022276 3300031730 Bacteria 6509
619 Ga0307516_10048465 3300031730 Bacteria 4180
620 Ga0307516_10078447 3300031730 Bacteria 3149
621 Ga0307516_10127328 3300031730 Bacteria 2330
622 Ga0307405_10017087 3300031731 Bacteria 3973
623 Ga0307405_10029162 3300031731 Bacteria 3222
624 Ga0307405_10039214 3300031731 Bacteria 2861
625 Ga0307413_10003540 3300031824 Bacteria 6599
626 Ga0307406_10000307 3300031901 Bacteria 28564
627 Ga0307406_10002267 3300031901 Bacteria 10459
628 Ga0307406_10025888 3300031901 Bacteria 3516
629 Ga0307412_10039553 3300031911 Bacteria 3045
630 Ga0307412_10191510 3300031911 Bacteria 1546
631 Ga0307412_10300690 3300031911 Bacteria 1268
632 Ga0307409_100004774 3300031995 Bacteria 7683
633 Ga0307409_100303905 3300031995 Bacteria 1485
634 Ga0307416_100021134 3300032002 Bacteria 4665
635 Ga0307416_100078423 3300032002 Bacteria 2779
636 Ga0307416_100110997 3300032002 Bacteria 2416
637 Ga0307416_100164022 3300032002 Bacteria 2058
638 Ga0307414_10015572 3300032004 Bacteria 4592
639 Ga0307414_10042397 3300032004 Bacteria 3092
640 Ga0307414_10304646 3300032004 Bacteria 1349
641 Ga0307411_10000111 3300032005 Bacteria 25501
642 Ga0307415_100024889 3300032126 Bacteria 3747
643 Ga0307510_10022531 3300033180 Bacteria 7314
644 Ga0373939_0000439 3300035114 Bacteria 10493
645 Ga0373962_0037542 3300035242 Bacteria 1353
646 Ga0373931_0000156 3300035691 Bacteria 29608
647 Ga0373931_0004247 3300035691 Bacteria 6520
648 Ga0373931_0007769 3300035691 Bacteria 5065
649 Ga0373931_0013119 3300035691 Bacteria 4030
650 Ga0373927_0144804 3300035695 Bacteria 1555
651 Ga0373937_0477715 3300036401 Bacteria 1184
652 Ga0373925_0017066 3300037068 Bacteria 5255
653 Ga0395899_0023736 3300037312 Bacteria 4641
654 Ga0395899_0188051 3300037312 Bacteria 1446
655 Ga0395900_0040451 3300037418 Bacteria 4804
656 Ga0395900_0087908 3300037418 Bacteria 3194
657 Ga0395900_0112800 3300037418 Bacteria 2791
658 Ga0395898_0020979 3300037466 Bacteria 6627
659 Ga0395898_0031440 3300037466 Bacteria 5303
660 Ga0395905_0003898 3300037471 Bacteria 15735
661 Ga0395905_0004659 3300037471 Bacteria 14178
662 Ga0395905_0008552 3300037471 Bacteria 10093
663 Ga0395905_0012259 3300037471 Bacteria 8256
664 Ga0395905_0016114 3300037471 Bacteria 7105
665 Ga0395905_0046111 3300037471 Bacteria 4087
666 Ga0395905_0063329 3300037471 Bacteria 3460
667 Ga0395905_0065569 3300037471 Bacteria 3400
668 Ga0395905_0082794 3300037471 Bacteria 3006
669 Ga0395905_0146776 3300037471 Bacteria 2219
670 Ga0395905_0576500 3300037471 Bacteria 1026
671 Ga0395901_0026393 3300038443 Bacteria 5963
672 Ga0395901_0050648 3300038443 Bacteria 4313
673 Ga0395901_0055400 3300038443 Bacteria 4124
674 Ga0395901_0057541 3300038443 Bacteria 4043
675 Ga0395901_0152491 3300038443 Bacteria 2428
676 Ga0237819_00068 3300038705 Bacteria 37484
677 Ga0237819_00076 3300038705 Bacteria 35000
678 Ga0436365_1712709 3300039437 Bacteria 2577
679 Ga0436361_0003822 3300039447 Bacteria 65675
680 Ga0436361_0240287 3300039447 Bacteria 3791
681 Ga0436361_0331966 3300039447 Bacteria 2502
682 Ga0436361_0446182 3300039447 Bacteria 4675
683 Ga0436361_0469035 3300039447 Bacteria 1207
684 Ga0436361_0507512 3300039447 Bacteria 63188
685 Ga0436361_0638016 3300039447 Bacteria 61418
686 Ga0436361_0935151 3300039447 Bacteria 15517
687 Ga0436361_1027804 3300039447 Bacteria 1906
688 Ga0436363_1160320 3300039450 Bacteria 2018
689 Ga0439436_0021673 3300041404 Bacteria 1907
690 Ga0439436_0028540 3300041404 Bacteria 1628
691 Ga0451791_0900922 3300041451 Bacteria 2259
692 Ga0451798_0270784 3300041458 Bacteria 3680
693 Ga0439431_0007581 3300041997 Bacteria 2423
694 Ga0439441_010140 3300042001 Bacteria 1574
695 Ga0439442_001748 3300042002 Bacteria 4255
696 Ga0439432_014795 3300042006 Bacteria 2638
697 Ga0439449_0000925 3300042007 Bacteria 11443
698 Ga0439449_0001348 3300042007 Bacteria 9624
699 Ga0439449_0005886 3300042007 Bacteria 4684
700 Ga0439449_0010084 3300042007 Bacteria 3574
701 Ga0439455_0002074 3300042012 Bacteria 3563
702 Ga0439462_0001961 3300042015 Bacteria 4706
703 Ga0450911_000262 3300042115 Bacteria 19706
704 Ga0450917_000106 3300042120 Bacteria 5139
705 Ga0450919_001427 3300042121 Bacteria 3113
706 Ga0450923_031413 3300042125 Bacteria 1084
707 Ga0450891_000348 3300042129 Bacteria 4794
708 Ga0450892_001061 3300042130 Bacteria 2880
709 Ga0450889_000227 3300042144 Bacteria 6253
710 Ga0439446_0011662 3300042156 Bacteria 2390
711 Ga0439434_0012501 3300042435 Bacteria 2512
712 Ga0439464_0016046 3300042439 Bacteria 2024
713 Ga0450918_000085 3300042531 Bacteria 19659
714 Ga0450918_000183 3300042531 Bacteria 13907
715 Ga0451577_0002278 3300042876 Bacteria 23215
716 Ga0451577_0006522 3300042876 Bacteria 11616
717 Ga0451577_0045705 3300042876 Bacteria 3919
718 Ga0451577_0079617 3300042876 Bacteria 2921
719 Ga0466969_0003908 3300044656 Bacteria 7913
720 Ga0453683_0002100 3300044673 Bacteria 15910
721 Ga0453683_0180145 3300044673 Bacteria 1340
722 Ga0466965_0002600 3300044683 Bacteria 7723
723 Ga0466965_0011676 3300044683 Bacteria 4119
724 Ga0466966_0008842 3300044684 Bacteria 6669
725 Ga0466966_0027763 3300044684 Bacteria 3690
726 Ga0466961_0060306 3300044693 Bacteria 2412
727 Ga0466961_0062041 3300044693 Bacteria 2375
728 Ga0466961_0069966 3300044693 Bacteria 2227
729 Ga0453684_0000126 3300044712 Bacteria 336395
730 Ga0453684_0009747 3300044712 Bacteria 16684
731 Ga0453684_0018443 3300044712 Bacteria 10709
732 Ga0466971_0026420 3300044719 Bacteria 2594
733 Ga0466968_0029370 3300044735 Bacteria 2274
734 Ga0466959_0002246 3300045049 Bacteria 12307
735 Ga0466959_0058698 3300045049 Bacteria 2802
736 Ga0466959_0133495 3300045049 Bacteria 1758
737 Ga0466959_0170150 3300045049 Bacteria 1528
738 Ga0451576_0004978 3300045051 Bacteria 16906
739 Ga0451576_0015978 3300045051 Bacteria 8298
740 Ga0451576_0065737 3300045051 Bacteria 3775
741 Ga0451576_0293504 3300045051 Bacteria 1700
742 Ga0466958_0097388 3300045836 Bacteria 1825
743 Ga0466967_0000067 3300045976 Bacteria 38325
744 Ga0495592_0000291 3300046454 Bacteria 42990
745 Ga0495590_0002435 3300046457 Bacteria 7714
746 Ga0495629_0119852 3300046459 Bacteria 1833
747 Ga0495638_0072584 3300046460 Bacteria 2103
748 Ga0495651_0153508 3300046462 Bacteria 1657
749 Ga0495650_0043026 3300046471 Bacteria 1920
750 Ga0495580_0099984 3300046472 Bacteria 2018
751 Ga0495639_0031741 3300046475 Bacteria 2353
752 Ga0495583_0000046 3300046506 Bacteria 218059
753 Ga0495606_0009260 3300046507 Bacteria 8360
754 Ga0495610_0027537 3300046512 Bacteria 3019
755 Ga0495610_0103140 3300046512 Bacteria 1274
756 Ga0495620_0068347 3300046515 Bacteria 1459
757 Ga0495630_0173022 3300046517 Bacteria 1646
758 Ga0495632_0003074 3300046519 Bacteria 12127
759 Ga0495632_0025431 3300046519 Bacteria 3131
760 Ga0495637_0004233 3300046520 Bacteria 7455
761 Ga0495663_0055994 3300046525 Bacteria 1231
762 Ga0495598_0061989 3300046537 Bacteria 1156
763 Ga0495609_0038685 3300046538 Bacteria 2150
764 Ga0495597_0000505 3300046542 Bacteria 32423
765 Ga0495597_0008931 3300046542 Bacteria 4998
766 Ga0495656_0000062 3300046615 Bacteria 49355
767 Ga0495668_0016624 3300046616 Bacteria 4277
768 Ga0495668_0094149 3300046616 Bacteria 1640
769 Ga0495625_0000998 3300046660 Bacteria 37496
770 Ga0495625_0003113 3300046660 Bacteria 16952
771 Ga0495625_0027051 3300046660 Bacteria 4324
772 Ga0495625_0089803 3300046660 Bacteria 2126
773 Ga0495635_0065940 3300046663 Bacteria 2484
774 Ga0495658_0034450 3300046683 Bacteria 2779
775 Ga0495658_0043279 3300046683 Bacteria 2518
776 Ga0495624_0158906 3300046690 Bacteria 1381
777 Ga0495649_0000638 3300046694 Bacteria 28526
778 Ga0495649_0001852 3300046694 Bacteria 15512
779 Ga0495649_0007371 3300046694 Bacteria 6721
780 Ga0495589_0002430 3300046794 Bacteria 10474
781 Ga0495589_0018491 3300046794 Bacteria 3572
782 Ga0495660_0075984 3300046810 Bacteria 1771
783 Ga0495674_0238342 3300047319 Bacteria 1500
784 Ga0495680_0102073 3300047322 Bacteria 2136
785 Ga0495687_000367 3300047443 Bacteria 56387
786 Ga0495687_007870 3300047443 Bacteria 6198
787 Ga0495673_0087986 3300047469 Bacteria 1274
788 Ga0495684_0011547 3300047471 Bacteria 6824
789 Ga0495686_0006531 3300047472 Bacteria 8906
790 Ga0496104_0134566 3300048907 Bacteria 2375
791 Ga0496105_0046621 3300048908 Bacteria 3577
792 Ga0496105_0117351 3300048908 Bacteria 2195
793 Ga0496106_0061723 3300048909 Bacteria 2844
794 Ga0496107_0022810 3300048910 Bacteria 4425
795 Ga0496108_0187447 3300048911 Bacteria 1792
796 Ga0496109_0082637 3300048912 Bacteria 2961
797 Ga0496110_0188033 3300048913 Bacteria 1875
798 Ga0496112_0151630 3300048915 Bacteria 2285
799 Ga0496114_0068362 3300048917 Bacteria 2982
800 Ga0496114_0361889 3300048917 Bacteria 1283
801 Ga0496115_0185612 3300048918 Bacteria 1718
802 Ga0496115_0429278 3300048918 Bacteria 1070
803 Ga0496117_0003732 3300048920 Bacteria 17455
804 Ga0496118_0021517 3300048921 Bacteria 5671
805 Ga0496122_0000380 3300048925 Bacteria 95108
806 Ga0496122_0086393 3300048925 Bacteria 2159
807 Ga0496123_0000246 3300048926 Bacteria 109397
808 Ga0496123_0011348 3300048926 Bacteria 7736
809 Ga0496123_0044550 3300048926 Bacteria 3033
810 Ga0496124_0000138 3300048927 Bacteria 150311
811 Ga0496124_0020305 3300048927 Bacteria 6145
812 Ga0496124_0039963 3300048927 Bacteria 4061
813 Ga0496124_0154881 3300048927 Bacteria 1793
814 Ga0496125_0001645 3300048928 Bacteria 31482
815 Ga0496125_0018151 3300048928 Bacteria 6686
816 Ga0496126_0143507 3300048929 Bacteria 2053
817 Ga0501343_003091 3300049132 Bacteria 1214
818 Ga0501344_01832 3300049133 Bacteria 1059
819 Ga0501294_003760 3300049517 Bacteria 1430
820 Ga0501300_011242 3300049523 Bacteria 1305
821 Ga0501312_008199 3300049528 Bacteria 1352
822 Ga0501316_005454 3300049532 Bacteria 1319
823 Ga0501317_011273 3300049533 Bacteria 1083
824 Ga0501318_010120 3300049534 Bacteria 1040
825 Ga0501321_004707 3300049537 Bacteria 1317
826 Ga0501338_01197 3300049554 Bacteria 1348
827 Ga0501034_0058032 3300049571 Bacteria 3891
828 Ga0501037_0356116 3300049573 Bacteria 1009
829 Ga0501043_0000002 3300049579 Bacteria 351081
830 Ga0501046_0000008 3300049580 Bacteria 351167
831 Ga0501047_0000003 3300049581 Bacteria 508375
832 Ga0501048_0000759 3300049582 Bacteria 23664
833 Ga0501198_000014 3300049649 Bacteria 106940
834 Ga0501217_004514 3300049661 Bacteria 2865
835 Ga0501222_000008 3300049662 Bacteria 120904
836 Ga0501222_002240 3300049662 Bacteria 2688
837 Ga0501223_005225 3300049663 Bacteria 2738
838 Ga0501235_013287 3300049669 Bacteria 1812
839 Ga0501249_017024 3300049679 Bacteria 1564
840 Ga0501253_002078 3300049683 Bacteria 2197
841 Ga0501253_013029 3300049683 Bacteria 1316
842 Ga0501255_000446 3300049684 Bacteria 2811
843 Ga0501257_019542 3300049686 Bacteria 1586
844 Ga0501265_000456 3300049762 Bacteria 4293
845 Ga0501267_000947 3300049764 Bacteria 2380
846 Ga0501272_001263 3300049769 Bacteria 2372
847 Ga0501045_0001582 3300049824 Bacteria 15181
848 nmdc:mga03683_8121_c1 3300050489 Bacteria 3675
849 nmdc:mga00v17_64477_c1 3300050491 Bacteria 2257
850 nmdc:mga0k408_14769_c1 3300050493 Bacteria 4309
851 nmdc:mga0k408_1821_c2 3300050493 Bacteria 10187
852 nmdc:mga0k408_187430_c1 3300050493 Bacteria 1234
853 nmdc:mga0k408_21697_c1 3300050493 Bacteria 3610
854 nmdc:mga0k408_3379_c1 3300050493 Bacteria 8454
855 nmdc:mga0k408_34983_c1 3300050493 Bacteria 2878
856 nmdc:mga0k408_35627_c1 3300050493 Bacteria 2854
857 nmdc:mga0k408_4347_c1 3300050493 Bacteria 7526
858 nmdc:mga0k408_67800_c1 3300050493 Bacteria 2080
859 nmdc:mga0k408_76795_c1 3300050493 Bacteria 1953
860 nmdc:mga06z11_155115_c1 3300050494 Bacteria 1305
861 nmdc:mga07m45_15316_c1 3300050496 Bacteria 4094
862 nmdc:mga07m45_22441_c1 3300050496 Bacteria 3446
863 nmdc:mga07m45_26121_c1 3300050496 Bacteria 3208
864 nmdc:mga07m45_48037_c1 3300050496 Bacteria 2400
865 nmdc:mga07m45_57_c1 3300050496 Bacteria 46544
866 nmdc:mga07m45_6260_c1 3300050496 Bacteria 6009
867 nmdc:mga07m45_6359_c1 3300050496 Bacteria 5965
868 nmdc:mga07m45_99158_c1 3300050496 Bacteria 1461
869 nmdc:mga07m45_99304_c1 3300050496 Bacteria 1671
870 nmdc:mga05p37_226266_c1 3300050507 Bacteria 2255
871 nmdc:mga09592_5629_c1 3300050508 Bacteria 10213
872 nmdc:mga08y16_510299_c1 3300050511 Bacteria 1220
873 Ga0500610_0001796 3300053079 Bacteria 7554
874 Ga0500610_0003563 3300053079 Bacteria 6009
875 Ga0500635_0000005 3300053080 Bacteria 187821
876 Ga0495619_0053229 3300053085 Bacteria 2677
877 Ga0500578_0000058 3300053086 Bacteria 119650
878 Ga0500578_0130402 3300053086 Bacteria 1577
879 Ga0500651_0000107 3300053093 Bacteria 50947
880 Ga0500651_0067151 3300053093 Bacteria 2233
881 Ga0500651_0083100 3300053093 Bacteria 1982
882 Ga0500566_0000013 3300053094 Bacteria 115589
883 Ga0500652_000154 3300053131 Bacteria 26336
884 Ga0500658_0000254 3300053134 Bacteria 24883
885 Ga0500658_0000909 3300053134 Bacteria 12117
886 Ga0500658_0021924 3300053134 Bacteria 2423
887 Ga0500559_0000119 3300053136 Bacteria 62358
888 Ga0500622_0000221 3300053156 Bacteria 59833
889 Ga0500622_0002018 3300053156 Bacteria 15157
890 Ga0500636_0087652 3300053177 Bacteria 1786
891 Ga0500637_0003057 3300053178 Bacteria 7615
892 Ga0500637_0006670 3300053178 Bacteria 5710
893 Ga0500645_002285 3300053730 Bacteria 8694
894 Ga0466962_0008472 3300061719 Bacteria 4927
895 2511243922 2511231002 Bacteria 5042903
896 2511700921 2511231119 Bacteria 4019861
897 2513228176 2513020051 Bacteria 6053213
898 2540608120 2540341094 Bacteria 4061186
899 2545559116 2545555800 Bacteria 4222588
900 2548499845 2547132374 Bacteria 5530232
901 2553394226 2551306519 Bacteria 5465154
902 2563930300 2563366752 Bacteria 4961801
903 2578933570 2576861599 Bacteria 4217202
904 2587728870 2585428057 Bacteria 6737412
905 2587736470 2585428058 Bacteria 6853932
906 2587756106 2585428062 Bacteria 6842168
907 2588294653 2588253510 Bacteria 6901809
908 2599626965 2599185214 Bacteria 8209958
909 2599676211 2599185226 Bacteria 8233575
910 2599684523 2599185227 Bacteria 8246414
911 2599696516 2599185229 Bacteria 8216126
912 2600401012 2600254943 Bacteria 2613887
913 2631985224 2630968484 Bacteria 3876276
914 2643745683 2643221544 Bacteria 5886209
915 2643868086 2643221570 Bacteria 5103772
916 2643936750 2643221585 Bacteria 5812563
917 2643970519 2643221592 Bacteria 6608788
918 2643993917 2643221596 Bacteria 5006805
919 2644059650 2643221609 Bacteria 6756331
920 2644074791 2643221611 Bacteria 6820941
921 2644142744 2643221625 Bacteria 6512927
922 2644160471 2643221628 Bacteria 5745828
923 2644221576 2643221639 Bacteria 6649903
924 2644248431 2643221644 Bacteria 6865017
925 2644257659 2643221646 Bacteria 6433402
926 2644272695 2643221648 Bacteria 6521465
927 2644293697 2643221652 Bacteria 5140275
928 2644303954 2643221654 Bacteria 5273570
929 2644318649 2643221656 Bacteria 5809961
930 2644324696 2643221658 Bacteria 6064537
931 2644396559 2643221672 Bacteria 6322190
932 2644465513 2643221683 Bacteria 5749203
933 2644644829 2643221717 Bacteria 5676132
934 2644723242 2643221732 Bacteria 5756404
935 2651530541 2648501850 Bacteria 3975476
936 2672337456 2671180330 Bacteria 5521719
937 2674422145 2671180844 Bacteria 4164150
938 2685153409 2684622632 Bacteria 5380049
939 2695628882 2695420354 Bacteria 3922431
940 2698319777 2695420987 Bacteria 6152737
941 2705997329 2703719227 Bacteria 5631989
942 2717915432 2716884898 Bacteria 3928789
943 2721508569 2718218445 Bacteria 5113413
944 2722882140 2721755523 Bacteria 6430384
945 2738718940 2738541277 Bacteria 7458140
946 2738816944 2738541295 Bacteria 5730091
947 2738879981 2738541307 Bacteria 8606193
948 2739160010 2738541358 Bacteria 5932299
949 2739212576 2738543006 Bacteria 5904091
950 2739241180 2738543012 Bacteria 7115078
951 2739250021 2738543013 Bacteria 5618633
952 2739281702 2738543019 Bacteria 7459457
953 2791215963 2788500588 Bacteria 4584915
954 2808868800 2808606364 Bacteria 4465927
955 2809053250 2808606399 Bacteria 4021018
956 2816473343 2816332133 Bacteria 7249298
957 2816862133 2816332186 Bacteria 5331395
958 2817479335 2816332295 Bacteria 4352468
959 2819568927 2818991441 Bacteria 5062707
960 2819599416 2818991446 Bacteria 7757362
961 2819627632 2818991451 Bacteria 4697364
962 2831271367 2831265667 Bacteria 7184833
963 2831869504 2831864461 Bacteria 6502356
964 2838055904 2838054893 Bacteria 7451788
965 2839142655 2839138175 Bacteria 6549354
966 2842678098 2842677519 Bacteria 5615038
967 2842684956 2842682962 Bacteria 5589973
968 2842721436 2842718218 Bacteria 4560148
969 2842734437 2842733646 Bacteria 5716726
970 2842749323 2842747753 Bacteria 5578255
971 2849141515 2849139964 Bacteria 5613304
972 2857584047 2857581216 Bacteria 5522813
973 2860840911 2860837431 Bacteria 4202080
974 2877771804 2877768649 Bacteria 3957164
975 2880172646 2880169592 Bacteria 3900066
976 2881105239 2881101125 Bacteria 4590519
977 2885197982 2885192300 Bacteria 5882526
978 2885200550 2885198086 Bacteria 7212419
979 2885214667 2885211737 Bacteria 7212420
980 2886853245 2886848708 Bacteria 5632523
981 2894024158 2894023352 Bacteria 5167372
982 2897112918 2897109615 Bacteria 4009619
983 2899925844 2899924645 Bacteria 7487985
984 2904450382 2904449895 Bacteria 6927402
985 2904456795 2904456579 Bacteria 6819253
986 2904480203 2904479285 Bacteria 5073931
987 2904544352 2904541872 Bacteria 8915136
988 2904563790 2904560550 Bacteria 4029838
989 2904610046 2904606771 Bacteria 4684500
990 2916973087 2916971899 Bacteria 4250608
991 2919415937 2919414237 Bacteria 5429133
992 2919463184 2919462493 Bacteria 5817112
993 2919704343 2919704043 Bacteria 5560311
994 2928041768 2928037797 Bacteria 7273642
995 2928049332 2928044640 Bacteria 7271509
996 2928052060 2928051484 Bacteria 7773759
997 2928065260 2928064002 Bacteria 7419480
998 2928076585 2928070936 Bacteria 8062541
999 2928089292 2928084124 Bacteria 7159212
1000 2928119143 2928115317 Bacteria 6477646
1001 2928512418 2928510474 Bacteria 4815308
1002 2929004344 2929004312 Bacteria 5678476
1003 2929162077 2929160207 Bacteria 9075316
1004 2929239121 2929233124 Bacteria 5948380
1005 2929521095 2929520902 Bacteria 6765052
1006 2932423780 2932422444 Bacteria 4678430
1007 2936362864 2936361878 Bacteria 5632809
1008 2939596222 2939593269 Bacteria 4798695
1009 2939633011 2939631187 Bacteria 6118131
1010 2945913519 2945909444 Bacteria 7065066
1011 2945949114 2945945610 Bacteria 5951079
1012 2945973159 2945972063 Bacteria 6086495
1013 2945991089 2945984333 Bacteria 7358892
1014 2947432215 2947426588 Bacteria 5357194
1015 2954768476 2954767861 Bacteria 5535784
1016 2956898783 2956897341 Bacteria 5447711
1017 2960376271 2960375949 Bacteria 5361395
1018 2962294138 2962290636 Bacteria 4072939
1019 2964380129 2964375228 Bacteria 4909004
1020 2965766743 2965761152 Bacteria 5806513
1021 2969140119 2969136845 Bacteria 3923176
1022 2969144358 2969141011 Bacteria 4118468
1023 2969769121 2969765954 Bacteria 4216713
1024 2969771435 2969770375 Bacteria 4271280
1025 2971896470 2971893375 Bacteria 3929648
1026 2974322481 2974320154 Bacteria 4571377
1027 2979089105 2979083700 Bacteria 5894929
1028 2980495906 2980492589 Bacteria 4072961
1029 2990713554 2990710928 Bacteria 5002431
1030 3001896471 3001892409 Bacteria 6328293
1031 3006859660 3006858327 Bacteria 4317835
1032 3006882631 3006879489 Bacteria 4064221
1033 3006979790 3006978542 Bacteria 5328100
1034 8007371348 8007371054 Bacteria 4849201
1035 8007377494 8007375930 Bacteria 4080554
1036 8022626946 8022621104 Bacteria 5241040
1037 8022633069 8022630665 Bacteria 3886130
1038 8022655786 8022653035 Bacteria 4035078
1039 8022949168 8022948649 Bacteria 5366783
1040 8023441595 8023438354 Bacteria 5779374
1041 8051954577 8051952484 Bacteria 3926774
1042 8052175336 8052174270 Bacteria 3881265
1043 8055537187 8055531788 Bacteria 5249694
1044 8057587864 8057582654 Bacteria 5218944
1045 8057634925 8057632132 Bacteria 4726859
1046 Ga0105237_10350880
1047 SwRhRL2b_contig_1580065
1048 JGI25156J39149_1000006
1049 JGI25156J39149_1000459
1050 JGI25154J39366_1000015
1051 JGI25154J39366_1002018
1052 JGI25157J39369_1000021
1053 JGI25157J39369_1000111
1054 JGI25152J39213_1007497
1055 JGI25159J45721_1001980
1056 JGI25159J45721_1011608
1057 JGI25159J45721_1016473
1058 JGI25151J46595_10001205
1059 JGI25151J46595_10001210
1060 JGI25151J46595_10002472
1061 JGI25151J46595_10002973
1062 JGI25151J46595_10005635
1063 JGI25151J46595_10014177
1064 JGI25153J46596_10001901
1065 JGI25153J46596_10011385
1066 JGI25153J46596_10012295
1067 rootH1_10001155
1068 JGI25160J50197_1000045
1069 JGI25161J50226_1000008
1070 Ga0006562J51391_1119627
1071 Ga0055538_1000081
1072 Ga0055533_1000033
1073 Ga0055525_1000011
1074 Ga0055525_1001213
1075 Ga0055535_1000076
1076 Ga0055535_1001037
1077 Ga0055542_1000009
1078 Ga0055529_1000860
1079 Ga0055526_1001951
1080 Ga0055526_1002081
1081 Ga0055526_1006798
1082 Ga0055526_1006804
1083 Ga0055537_1000011
1084 Ga0055537_1000182
1085 Ga0055537_1006595
1086 Ga0055537_1014005
1087 Ga0055524_1000126
1088 Ga0055524_1000679
1089 Ga0055536_1001326
1090 Ga0055534_1000020
1091 Ga0055534_1000333
1092 Ga0055534_1001522
1093 Ga0055534_1002053
1094 Ga0055528_1000349
1095 Ga0055528_1000606
1096 Ga0055528_1029631
1097 Ga0055530_10000302
1098 Ga0055530_10002526
1099 Ga0055530_10023526
1100 Ga0055540_1000015
1101 Ga0055540_1000021
1102 Ga0055540_1004986
1103 Ga0055531_10000214
1104 Ga0055531_10000806
1105 Ga0055531_10001001
1106 Ga0055531_10005410
1107 Ga0055531_10014723
1108 Ga0055543_1003659
1109 Ga0065165_1000024
1110 Ga0065165_1000401
1111 Ga0065165_1002995
1112 Ga0065714_10006124
1113 Ga0065704_10091410
1114 Ga0065707_10094865
1115 Ga0070658_10067093
1116 Ga0070658_10198158
1117 Ga0070676_10028928
1118 Ga0070683_100132995
1119 Ga0070683_100222390
1120 Ga0070690_100000001
1121 Ga0070690_100239269
1122 Ga0070670_100000817
1123 Ga0070670_100008148
1124 Ga0070670_100191077
1125 Ga0068869_100001842
1126 Ga0068869_100040874
1127 Ga0068869_100065284
1128 Ga0068869_100169308
1129 Ga0070666_10000960
1130 Ga0070666_10027413
1131 Ga0070666_10043775
1132 Ga0070666_10170599
1133 Ga0068868_100146116
1134 Ga0068868_100235894
1135 Ga0070660_100039575
1136 Ga0070660_100211467
1137 Ga0070689_100057022
1138 Ga0070661_100000841
1139 Ga0070661_100014722
1140 Ga0070661_100031906
1141 Ga0070669_100001800
1142 Ga0070669_100079404
1143 Ga0070669_100102649
1144 Ga0070675_100003281
1145 Ga0070675_100039314
1146 Ga0070675_100152123
1147 Ga0070671_100009321
1148 Ga0070671_100030602
1149 Ga0070671_100052804
1150 Ga0070671_100056286
1151 Ga0070674_100031822
1152 Ga0070673_100001009
1153 Ga0070673_100015685
1154 Ga0070673_100243891
1155 Ga0070659_100048151
1156 Ga0070667_100004040
1157 Ga0070667_100096269
1158 Ga0070701_10225999
1159 Ga0070700_100016951
1160 Ga0070700_100180279
1161 Ga0070663_100016943
1162 Ga0070678_100076096
1163 Ga0070678_100109989
1164 Ga0070678_100141178
1165 Ga0070662_100014126
1166 Ga0070662_100022340
1167 Ga0070662_100120722
1168 Ga0070662_100212838
1169 Ga0068867_100000042
1170 Ga0068867_100002918
1171 Ga0068867_100011005
1172 Ga0070679_100013117
1173 Ga0070679_100100557
1174 Ga0068853_100045063
1175 Ga0068853_100130668
1176 Ga0068853_100240939
1177 Ga0070672_100040398
1178 Ga0070693_100022693
1179 Ga0070665_100077997
1180 Ga0068855_100019714
1181 Ga0068855_100215341
1182 Ga0070664_100004757
1183 Ga0070664_100021332
1184 Ga0070664_100048175
1185 Ga0068857_100005113
1186 Ga0068857_100027288
1187 Ga0068857_100160194
1188 Ga0068856_100000887
1189 Ga0068856_100040639
1190 Ga0068852_100048105
1191 Ga0068852_100409994
1192 Ga0068859_100060433
1193 Ga0068859_100410178
1194 Ga0068864_100077885
1195 Ga0068866_10004706
1196 Ga0068866_10006851
1197 Ga0068861_100034068
1198 Ga0068861_100055999
1199 Ga0068861_100126537
1200 Ga0068851_10010700
1201 Ga0068851_10015161
1202 Ga0068863_100003799
1203 Ga0068863_100005986
1204 Ga0068863_100024555
1205 Ga0068863_100047981
1206 Ga0068863_100192258
1207 Ga0068858_100002240
1208 Ga0068858_100080940
1209 Ga0068860_100000445
1210 Ga0068860_100002076
1211 Ga0068860_100065526
1212 Ga0068860_100067929
1213 Ga0068860_100295299
1214 Ga0068862_100007146
1215 Ga0068862_100011076
1216 Ga0068862_100014506
1217 Ga0068862_100086014
1218 Ga0075365_10003947
1219 Ga0075365_10139939
1220 Ga0075368_10029585
1221 Ga0075363_100056785
1222 Ga0075363_100112167
1223 Ga0075364_10009007
1224 Ga0075364_10052613
1225 Ga0075364_10118772
1226 Ga0075432_10014637
1227 Ga0075362_10012738
1228 Ga0075362_10015848
1229 Ga0075362_10017053
1230 Ga0075362_10022087
1231 Ga0075362_10022308
1232 Ga0075362_10058021
1233 Ga0075367_10025655
1234 Ga0075367_10031585
1235 Ga0075367_10052150
1236 Ga0075366_10000957
1237 Ga0075366_10009371
1238 Ga0075366_10029346
1239 Ga0075366_10100892
1240 Ga0075366_10129032
1241 Ga0097621_100099784
1242 Ga0075370_10001441
1243 Ga0075370_10002460
1244 Ga0075370_10013167
1245 Ga0075370_10014047
1246 Ga0075370_10017503
1247 Ga0075370_10018231
1248 Ga0075370_10020298
1249 Ga0075370_10024531
1250 Ga0075370_10037798
1251 Ga0075370_10042989
1252 Ga0075370_10074579
1253 Ga0068871_100008651
1254 Ga0068871_100241727
1255 Ga0075434_100199179
1256 Ga0075429_100002300
1257 Ga0068865_100009443
1258 Ga0068865_100061485
1259 Ga0097620_100060433
1260 Ga0097620_100410188
1261 Ga0099823_1004429
1262 Ga0079104_1000002
1263 Ga0079104_1000219
1264 Ga0079104_1006351
1265 Ga0099826_10014173
1266 Ga0099826_10059971
1267 Ga0105251_10039728
1268 Ga0105251_10054066
1269 Ga0105244_10001082
1270 Ga0105244_10003649
1271 Ga0105244_10025820
1272 Ga0105244_10058078
1273 Ga0105244_10100473
1274 Ga0105250_10006394
1275 Ga0105250_10030203
1276 Ga0105240_10001398
1277 Ga0105240_10046752
1278 Ga0105240_10066173
1279 Ga0105240_10107763
1280 Ga0105245_10034537
1281 Ga0105245_10037603
1282 Ga0114129_10124503
1283 Ga0105243_10000764
1284 Ga0105243_10002340
1285 Ga0105243_10019402
1286 Ga0105243_10042088
1287 Ga0105243_10076032
1288 Ga0105241_10223183
1289 Ga0105242_10031307
1290 Ga0105242_10489811
1291 Ga0105248_10012566
1292 Ga0105248_10078489
1293 Ga0105248_10197133
1294 Ga0105237_10001780
1295 Ga0105237_10015735
1296 Ga0105237_10059850
1297 Ga0105238_10019971
1298 Ga0105249_10005956
1299 Ga0105249_10017447
1300 Ga0105239_10000615
1301 Ga0105239_10086938
1302 Ga0105239_10686654
1303 Ga0105246_10115286
1304 Ga0105246_10156605
1305 Ga0157319_1000001
1306 Ga0157326_1003246
1307 Ga0157373_10025052
1308 Ga0157373_10041688
1309 Ga0157373_10085976
1310 Ga0157371_10087103
1311 Ga0157369_10028743
1312 Ga0157369_10189277
1313 Ga0157374_10255240
1314 Ga0157378_10016387
1315 Ga0157378_10062020
1316 Ga0163162_10042974
1317 Ga0163162_10131923
1318 Ga0157372_10036343
1319 Ga0157372_10090635
1320 Ga0157375_10023030
1321 Ga0157375_10082234
1322 Ga0157380_10180912
1323 Ga0182008_10002167
1324 Ga0182008_10007602
1325 Ga0182008_10056271
1326 Ga0157377_10000038
1327 Ga0157379_10024536
1328 Ga0157379_10070395
1329 Ga0157379_10121929
1330 Ga0157379_10185718
1331 Ga0157376_10001082
1332 Ga0157376_10282151
1333 Ga0182006_1006774
1334 Ga0182007_10000224
1335 Ga0182007_10001945
1336 Ga0183362_10001
1337 Ga0163161_10000042
1338 Ga0163161_10004047
1339 Ga0163161_10067035
1340 Ga0163161_10082182
1341 Ga0213872_10000003
1342 Ga0213872_10000124
1343 Ga0213872_10000345
1344 Ga0213872_10020060
1345 Ga0213872_10035580
1346 Ga0209435_100010
1347 Ga0209436_109065
1348 Ga0209784_100044
1349 Ga0209674_100064
1350 Ga0209672_100728
1351 Ga0209672_106441
1352 Ga0209147_100457
1353 Ga0209147_102577
1354 Ga0209147_102702
1355 Ga0209563_100005
1356 Ga0209563_100126
1357 Ga0207427_100197
1358 Ga0209258_100009
1359 Ga0209258_100736
1360 Ga0209258_100787
1361 Ga0207425_1000135
1362 Ga0207425_1000821
1363 Ga0209646_1000001
1364 Ga0209646_1000060
1365 Ga0209026_1000001
1366 Ga0209026_1000049
1367 Ga0209677_100411
1368 Ga0209677_101222
1369 Ga0209148_1000007
1370 Ga0209148_1004733
1371 Ga0209759_1000001
1372 Ga0209759_1000069
1373 Ga0209759_1001428
1374 Ga0209129_1000013
1375 Ga0209129_1000043
1376 Ga0209129_1004720
1377 Ga0209565_1000028
1378 Ga0209565_1000058
1379 Ga0209565_1000197
1380 Ga0209565_1000433
1381 Ga0209565_1008528
1382 Ga0209455_1001719
1383 Ga0209673_1000035
1384 Ga0209673_1000053
1385 Ga0209673_1000279
1386 Ga0209673_1000316
1387 Ga0209673_1000780
1388 Ga0209673_1004689
1389 Ga0209673_1013804
1390 Ga0209673_1014652
1391 Ga0209673_1028079
1392 Ga0209130_1000112
1393 Ga0209130_1000158
1394 Ga0209130_1000186
1395 Ga0209130_1000363
1396 Ga0209130_1000701
1397 Ga0209130_1003550
1398 Ga0209130_1005803
1399 Ga0209675_1000010
1400 Ga0209675_1000130
1401 Ga0209675_1000153
1402 Ga0209675_1000871
1403 Ga0209675_1001471
1404 Ga0209675_1004539
1405 Ga0209675_1011067
1406 Ga0209676_1000069
1407 Ga0209676_1000108
1408 Ga0209676_1007541
1409 Ga0209676_1007556
1410 Ga0209025_1000103
1411 Ga0209025_1000129
1412 Ga0209025_1000169
1413 Ga0209025_1000331
1414 Ga0209025_1000565
1415 Ga0209025_1001427
1416 Ga0209025_1001602
1417 Ga0209025_1001700
1418 Ga0209025_1001921
1419 Ga0209025_1002074
1420 Ga0209025_1002962
1421 Ga0209025_1011956
1422 Ga0209025_1014326
1423 Ga0209025_1023954
1424 Ga0209025_1025018
1425 Ga0209564_1000005
1426 Ga0209564_1000014
1427 Ga0209564_1000171
1428 Ga0209564_1000880
1429 Ga0209564_1001709
1430 Ga0209564_1002454
1431 Ga0209564_1003455
1432 Ga0209758_1000067
1433 Ga0209758_1000307
1434 Ga0209758_1000492
1435 Ga0209050_1000002
1436 Ga0209050_1000023
1437 Ga0209050_1000493
1438 Ga0209050_1000543
1439 Ga0209050_1001273
1440 Ga0209050_1001396
1441 Ga0209050_1003837
1442 Ga0209050_1010459
1443 Ga0209050_1010869
1444 Ga0209256_1000003
1445 Ga0209256_1000077
1446 Ga0209256_1000092
1447 Ga0209256_1000121
1448 Ga0209256_1008919
1449 Ga0207426_1000101
1450 Ga0207426_1000129
1451 Ga0207426_1000153
1452 Ga0209051_1000002
1453 Ga0209051_1000017
1454 Ga0209051_1000020
1455 Ga0209051_1000101
1456 Ga0209051_1000145
1457 Ga0209051_1000289
1458 Ga0209051_1000317
1459 Ga0209051_1001499
1460 Ga0209051_1001699
1461 Ga0209051_1003391
1462 Ga0209051_1009607
1463 Ga0209051_1010293
1464 Ga0209051_1013144
1465 Ga0209051_1040416
1466 Ga0209051_1040988
1467 Ga0209257_1000002
1468 Ga0209257_1000017
1469 Ga0209257_1000039
1470 Ga0209257_1000041
1471 Ga0209257_1000189
1472 Ga0209257_1000724
1473 Ga0209257_1007414
1474 Ga0209257_1010393
1475 Ga0209257_1020459
1476 Ga0207656_10019425
1477 Ga0207696_1000786
1478 Ga0207696_1010395
1479 Ga0207655_1000332
1480 Ga0207655_1000839
1481 Ga0207655_1005345
1482 Ga0207655_1062474
1483 Ga0207713_1001629
1484 Ga0207713_1041575
1485 Ga0207682_10044711
1486 Ga0207688_10084072
1487 Ga0207680_10129006
1488 Ga0207645_10001485
1489 Ga0207643_10097243
1490 Ga0207705_10319175
1491 Ga0207707_10156440
1492 Ga0207695_10006362
1493 Ga0207695_10047697
1494 Ga0207695_10050611
1495 Ga0207695_10076864
1496 Ga0207695_10191782
1497 Ga0207671_10003233
1498 Ga0207671_10068376
1499 Ga0207671_10099948
1500 Ga0207657_10048467
1501 Ga0207657_10080477
1502 Ga0207657_10234846
1503 Ga0207649_10001402
1504 Ga0207649_10070952
1505 Ga0207652_10050248
1506 Ga0207681_10002051
1507 Ga0207681_10013357
1508 Ga0207694_10022432
1509 Ga0207694_10063968
1510 Ga0207650_10000998
1511 Ga0207650_10003908
1512 Ga0207650_10035789
1513 Ga0207659_10000691
1514 Ga0207659_10009045
1515 Ga0207659_10028640
1516 Ga0207687_10030425
1517 Ga0207644_10001362
1518 Ga0207644_10008153
1519 Ga0207644_10051638
1520 Ga0207644_10057212
1521 Ga0207690_10003313
1522 Ga0207706_10001466
1523 Ga0207686_10003386
1524 Ga0207686_10003857
1525 Ga0207709_10000015
1526 Ga0207709_10000094
1527 Ga0207709_10000624
1528 Ga0207709_10024260
1529 Ga0207709_10032850
1530 Ga0207669_10007676
1531 Ga0207669_10039443
1532 Ga0207704_10003582
1533 Ga0207691_10001243
1534 Ga0207691_10003923
1535 Ga0207691_10049651
1536 Ga0207691_10067971
1537 Ga0207711_10009786
1538 Ga0207711_10095074
1539 Ga0207689_10002717
1540 Ga0207689_10062542
1541 Ga0207689_10069421
1542 Ga0207689_10079042
1543 Ga0207689_10209853
1544 Ga0207661_10098649
1545 Ga0207679_10000154
1546 Ga0207679_10010502
1547 Ga0207679_10022828
1548 Ga0207679_10109532
1549 Ga0207667_10001779
1550 Ga0207667_10116275
1551 Ga0207651_10008151
1552 Ga0207651_10009585
1553 Ga0207712_10067616
1554 Ga0207640_10002657
1555 Ga0207640_10037293
1556 Ga0207640_10110641
1557 Ga0207658_10001089
1558 Ga0207677_10037875
1559 Ga0207677_10197584
1560 Ga0207703_10000996
1561 Ga0207703_10015852
1562 Ga0207703_10091690
1563 Ga0207639_10124298
1564 Ga0207639_10262296
1565 Ga0207678_10043499
1566 Ga0207708_10031570
1567 Ga0207702_10002045
1568 Ga0207702_10042164
1569 Ga0207702_10127564
1570 Ga0207702_10421650
1571 Ga0207641_10006465
1572 Ga0207641_10017869
1573 Ga0207641_10021132
1574 Ga0207648_10000118
1575 Ga0207648_10002634
1576 Ga0207648_10023876
1577 Ga0207676_10067016
1578 Ga0207674_10011982
1579 Ga0207674_10361083
1580 Ga0207675_100003340
1581 Ga0207683_10008780
1582 Ga0207683_10145851
1583 Ga0207683_10147642
1584 Ga0209281_1000007
1585 Ga0209281_1000074
1586 Ga0209389_1009108
1587 Ga0209371_1002772
1588 Ga0209968_1013863
1589 Ga0209970_1000481
1590 Ga0209282_1019606
1591 Ga0209971_1004935
1592 Ga0209974_10000606
1593 Ga0209974_10027573
1594 Ga0207428_10078731
1595 Ga0268265_10010636
1596 Ga0268265_10012706
1597 Ga0268265_10017251
1598 Ga0268264_10001857
1599 Ga0268264_10005310
1600 Ga0268264_10044567
1601 Ga0268264_10234389
1602 Ga0265336_10000123
1603 Ga0307517_10010725
1604 Ga0307515_10000165
1605 Ga0307515_10000188
1606 Ga0307515_10000433
1607 Ga0307515_10000529
1608 Ga0307515_10000708
1609 Ga0307515_10013631
1610 Ga0307515_10029938
1611 Ga0307515_10045432
1612 Ga0307515_10095097
1613 Ga0307515_10132505
1614 Ga0265324_10000849
1615 Ga0237817_10077
1616 Ga0237817_10171
1617 Ga0268256_1004899
1618 Ga0307512_10103250
1619 Ga0307512_10104209
1620 Ga0316177_1007744
1621 Ga0316178_1003672
1622 Ga0316180_1085302
1623 Ga0316182_1158565
1624 Ga0316182_1235587
1625 Ga0265330_10000022
1626 Ga0265330_10033981
1627 Ga0265332_10000001
1628 Ga0265332_10000009
1629 Ga0265328_10038040
1630 Ga0265325_10005268
1631 Ga0265340_10017633
1632 Ga0265327_10000144
1633 Ga0265327_10000748
1634 Ga0265327_10044788
1635 Ga0307513_10000004
1636 Ga0307513_10000015
1637 Ga0307513_10001902
1638 Ga0307513_10017436
1639 Ga0307513_10086145
1640 Ga0307513_10144504
1641 Ga0307513_10188330
1642 Ga0307509_10000234
1643 Ga0307509_10016663
1644 Ga0307509_10052970
1645 Ga0307408_100000038
1646 Ga0307408_100000186
1647 Ga0307408_100029978
1648 Ga0307408_100245641
1649 Ga0307508_10000169
1650 Ga0307508_10024742
1651 Ga0307508_10041698
1652 Ga0307508_10266202
1653 Ga0307514_10000593
1654 Ga0307514_10001826
1655 Ga0307514_10006926
1656 Ga0307514_10031222
1657 Ga0265314_10000013
1658 Ga0265314_10015884
1659 Ga0307516_10000311
1660 Ga0307516_10000326
1661 Ga0307516_10000383
1662 Ga0307516_10005389
1663 Ga0307516_10022276
1664 Ga0307516_10048465
1665 Ga0307516_10078447
1666 Ga0307516_10127328
1667 Ga0307405_10017087
1668 Ga0307405_10029162
1669 Ga0307405_10039214
1670 Ga0307413_10003540
1671 Ga0307406_10000307
1672 Ga0307406_10002267
1673 Ga0307406_10025888
1674 Ga0307412_10039553
1675 Ga0307412_10191510
1676 Ga0307412_10300690
1677 Ga0307409_100004774
1678 Ga0307409_100303905
1679 Ga0307416_100021134
1680 Ga0307416_100078423
1681 Ga0307416_100110997
1682 Ga0307416_100164022
1683 Ga0307414_10015572
1684 Ga0307414_10042397
1685 Ga0307414_10304646
1686 Ga0307411_10000111
1687 Ga0307415_100024889
1688 Ga0307510_10022531
1689 Ga0373939_0000439
1690 Ga0373962_0037542
1691 Ga0373931_0000156
1692 Ga0373931_0004247
1693 Ga0373931_0007769
1694 Ga0373931_0013119
1695 Ga0373927_0144804
1696 Ga0373937_0477715
1697 Ga0373925_0017066
1698 Ga0395899_0023736
1699 Ga0395899_0188051
1700 Ga0395900_0040451
1701 Ga0395900_0087908
1702 Ga0395900_0112800
1703 Ga0395898_0020979
1704 Ga0395898_0031440
1705 Ga0395905_0003898
1706 Ga0395905_0004659
1707 Ga0395905_0008552
1708 Ga0395905_0012259
1709 Ga0395905_0016114
1710 Ga0395905_0046111
1711 Ga0395905_0063329
1712 Ga0395905_0065569
1713 Ga0395905_0082794
1714 Ga0395905_0146776
1715 Ga0395905_0576500
1716 Ga0395901_0026393
1717 Ga0395901_0050648
1718 Ga0395901_0055400
1719 Ga0395901_0057541
1720 Ga0395901_0152491
1721 Ga0237819_00068
1722 Ga0237819_00076
1723 Ga0436365_1712709
1724 Ga0436361_0003822
1725 Ga0436361_0240287
1726 Ga0436361_0331966
1727 Ga0436361_0446182
1728 Ga0436361_0469035
1729 Ga0436361_0507512
1730 Ga0436361_0638016
1731 Ga0436361_0935151
1732 Ga0436361_1027804
1733 Ga0436363_1160320
1734 Ga0439436_0021673
1735 Ga0439436_0028540
1736 Ga0451791_0900922
1737 Ga0451798_0270784
1738 Ga0439431_0007581
1739 Ga0439441_010140
1740 Ga0439442_001748
1741 Ga0439432_014795
1742 Ga0439449_0000925
1743 Ga0439449_0001348
1744 Ga0439449_0005886
1745 Ga0439449_0010084
1746 Ga0439455_0002074
1747 Ga0439462_0001961
1748 Ga0450911_000262
1749 Ga0450917_000106
1750 Ga0450919_001427
1751 Ga0450923_031413
1752 Ga0450891_000348
1753 Ga0450892_001061
1754 Ga0450889_000227
1755 Ga0439446_0011662
1756 Ga0439434_0012501
1757 Ga0439464_0016046
1758 Ga0450918_000085
1759 Ga0450918_000183
1760 Ga0451577_0002278
1761 Ga0451577_0006522
1762 Ga0451577_0045705
1763 Ga0451577_0079617
1764 Ga0466969_0003908
1765 Ga0453683_0002100
1766 Ga0453683_0180145
1767 Ga0466965_0002600
1768 Ga0466965_0011676
1769 Ga0466966_0008842
1770 Ga0466966_0027763
1771 Ga0466961_0060306
1772 Ga0466961_0062041
1773 Ga0466961_0069966
1774 Ga0453684_0000126
1775 Ga0453684_0009747
1776 Ga0453684_0018443
1777 Ga0466971_0026420
1778 Ga0466968_0029370
1779 Ga0466959_0002246
1780 Ga0466959_0058698
1781 Ga0466959_0133495
1782 Ga0466959_0170150
1783 Ga0451576_0004978
1784 Ga0451576_0015978
1785 Ga0451576_0065737
1786 Ga0451576_0293504
1787 Ga0466958_0097388
1788 Ga0466967_0000067
1789 Ga0495592_0000291
1790 Ga0495590_0002435
1791 Ga0495629_0119852
1792 Ga0495638_0072584
1793 Ga0495651_0153508
1794 Ga0495650_0043026
1795 Ga0495580_0099984
1796 Ga0495639_0031741
1797 Ga0495583_0000046
1798 Ga0495606_0009260
1799 Ga0495610_0027537
1800 Ga0495610_0103140
1801 Ga0495620_0068347
1802 Ga0495630_0173022
1803 Ga0495632_0003074
1804 Ga0495632_0025431
1805 Ga0495637_0004233
1806 Ga0495663_0055994
1807 Ga0495598_0061989
1808 Ga0495609_0038685
1809 Ga0495597_0000505
1810 Ga0495597_0008931
1811 Ga0495656_0000062
1812 Ga0495668_0016624
1813 Ga0495668_0094149
1814 Ga0495625_0000998
1815 Ga0495625_0003113
1816 Ga0495625_0027051
1817 Ga0495625_0089803
1818 Ga0495635_0065940
1819 Ga0495658_0034450
1820 Ga0495658_0043279
1821 Ga0495624_0158906
1822 Ga0495649_0000638
1823 Ga0495649_0001852
1824 Ga0495649_0007371
1825 Ga0495589_0002430
1826 Ga0495589_0018491
1827 Ga0495660_0075984
1828 Ga0495674_0238342
1829 Ga0495680_0102073
1830 Ga0495687_000367
1831 Ga0495687_007870
1832 Ga0495673_0087986
1833 Ga0495684_0011547
1834 Ga0495686_0006531
1835 Ga0496104_0134566
1836 Ga0496105_0046621
1837 Ga0496105_0117351
1838 Ga0496106_0061723
1839 Ga0496107_0022810
1840 Ga0496108_0187447
1841 Ga0496109_0082637
1842 Ga0496110_0188033
1843 Ga0496112_0151630
1844 Ga0496114_0068362
1845 Ga0496114_0361889
1846 Ga0496115_0185612
1847 Ga0496115_0429278
1848 Ga0496117_0003732
1849 Ga0496118_0021517
1850 Ga0496122_0000380
1851 Ga0496122_0086393
1852 Ga0496123_0000246
1853 Ga0496123_0011348
1854 Ga0496123_0044550
1855 Ga0496124_0000138
1856 Ga0496124_0020305
1857 Ga0496124_0039963
1858 Ga0496124_0154881
1859 Ga0496125_0001645
1860 Ga0496125_0018151
1861 Ga0496126_0143507
1862 Ga0501343_003091
1863 Ga0501344_01832
1864 Ga0501294_003760
1865 Ga0501300_011242
1866 Ga0501312_008199
1867 Ga0501316_005454
1868 Ga0501317_011273
1869 Ga0501318_010120
1870 Ga0501321_004707
1871 Ga0501338_01197
1872 Ga0501034_0058032
1873 Ga0501037_0356116
1874 Ga0501043_0000002
1875 Ga0501046_0000008
1876 Ga0501047_0000003
1877 Ga0501048_0000759
1878 Ga0501198_000014
1879 Ga0501217_004514
1880 Ga0501222_000008
1881 Ga0501222_002240
1882 Ga0501223_005225
1883 Ga0501235_013287
1884 Ga0501249_017024
1885 Ga0501253_002078
1886 Ga0501253_013029
1887 Ga0501255_000446
1888 Ga0501257_019542
1889 Ga0501265_000456
1890 Ga0501267_000947
1891 Ga0501272_001263
1892 Ga0501045_0001582
1893 nmdc:mga03683_8121_c1
1894 nmdc:mga00v17_64477_c1
1895 nmdc:mga0k408_14769_c1
1896 nmdc:mga0k408_1821_c2
1897 nmdc:mga0k408_187430_c1
1898 nmdc:mga0k408_21697_c1
1899 nmdc:mga0k408_3379_c1
1900 nmdc:mga0k408_34983_c1
1901 nmdc:mga0k408_35627_c1
1902 nmdc:mga0k408_4347_c1
1903 nmdc:mga0k408_67800_c1
1904 nmdc:mga0k408_76795_c1
1905 nmdc:mga06z11_155115_c1
1906 nmdc:mga07m45_15316_c1
1907 nmdc:mga07m45_22441_c1
1908 nmdc:mga07m45_26121_c1
1909 nmdc:mga07m45_48037_c1
1910 nmdc:mga07m45_57_c1
1911 nmdc:mga07m45_6260_c1
1912 nmdc:mga07m45_6359_c1
1913 nmdc:mga07m45_99158_c1
1914 nmdc:mga07m45_99304_c1
1915 nmdc:mga05p37_226266_c1
1916 nmdc:mga09592_5629_c1
1917 nmdc:mga08y16_510299_c1
1918 Ga0500610_0001796
1919 Ga0500610_0003563
1920 Ga0500635_0000005
1921 Ga0495619_0053229
1922 Ga0500578_0000058
1923 Ga0500578_0130402
1924 Ga0500651_0000107
1925 Ga0500651_0067151
1926 Ga0500651_0083100
1927 Ga0500566_0000013
1928 Ga0500652_000154
1929 Ga0500658_0000254
1930 Ga0500658_0000909
1931 Ga0500658_0021924
1932 Ga0500559_0000119
1933 Ga0500622_0000221
1934 Ga0500622_0002018
1935 Ga0500636_0087652
1936 Ga0500637_0003057
1937 Ga0500637_0006670
1938 Ga0500645_002285
1939 Ga0466962_0008472
1940 2511243922
1941 2511700921
1942 2513228176
1943 2540608120
1944 2545559116
1945 2548499845
1946 2553394226
1947 2563930300
1948 2578933570
1949 2587728870
1950 2587736470
1951 2587756106
1952 2588294653
1953 2599626965
1954 2599676211
1955 2599684523
1956 2599696516
1957 2600401012
1958 2631985224
1959 2643745683
1960 2643868086
1961 2643936750
1962 2643970519
1963 2643993917
1964 2644059650
1965 2644074791
1966 2644142744
1967 2644160471
1968 2644221576
1969 2644248431
1970 2644257659
1971 2644272695
1972 2644293697
1973 2644303954
1974 2644318649
1975 2644324696
1976 2644396559
1977 2644465513
1978 2644644829
1979 2644723242
1980 2651530541
1981 2672337456
1982 2674422145
1983 2685153409
1984 2695628882
1985 2698319777
1986 2705997329
1987 2717915432
1988 2721508569
1989 2722882140
1990 2738718940
1991 2738816944
1992 2738879981
1993 2739160010
1994 2739212576
1995 2739241180
1996 2739250021
1997 2739281702
1998 2791215963
1999 2808868800
2000 2809053250
2001 2816473343
2002 2816862133
2003 2817479335
2004 2819568927
2005 2819599416
2006 2819627632
2007 2831271367
2008 2831869504
2009 2838055904
2010 2839142655
2011 2842678098
2012 2842684956
2013 2842721436
2014 2842734437
2015 2842749323
2016 2849141515
2017 2857584047
2018 2860840911
2019 2877771804
2020 2880172646
2021 2881105239
2022 2885197982
2023 2885200550
2024 2885214667
2025 2886853245
2026 2894024158
2027 2897112918
2028 2899925844
2029 2904450382
2030 2904456795
2031 2904480203
2032 2904544352
2033 2904563790
2034 2904610046
2035 2916973087
2036 2919415937
2037 2919463184
2038 2919704343
2039 2928041768
2040 2928049332
2041 2928052060
2042 2928065260
2043 2928076585
2044 2928089292
2045 2928119143
2046 2928512418
2047 2929004344
2048 2929162077
2049 2929239121
2050 2929521095
2051 2932423780
2052 2936362864
2053 2939596222
2054 2939633011
2055 2945913519
2056 2945949114
2057 2945973159
2058 2945991089
2059 2947432215
2060 2954768476
2061 2956898783
2062 2960376271
2063 2962294138
2064 2964380129
2065 2965766743
2066 2969140119
2067 2969144358
2068 2969769121
2069 2969771435
2070 2971896470
2071 2974322481
2072 2979089105
2073 2980495906
2074 2990713554
2075 3001896471
2076 3006859660
2077 3006882631
2078 3006979790
2079 8007371348
2080 8007377494
2081 8022626946
2082 8022633069
2083 8022655786
2084 8022949168
2085 8023441595
2086 8051954577
2087 8052175336
2088 8055537187
2089 8057587864
2090 8057634925

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

36

353

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1y-assembly1.cif.gz_A crystal structure of guac-gmp complex from bacillus anthracis at 2.26 a resolution. 0.967 2 316
1ypf-assembly2.cif.gz_B crystal structure of guac (ba5705) from bacillus anthracis at 1.8 a resolution 0.9613 1 316
1ypf-assembly2.cif.gz_B crystal structure of guac (ba5705) from bacillus anthracis at 1.8 a resolution 0.9548 1 316
1ypf-assembly1.cif.gz_A crystal structure of guac (ba5705) from bacillus anthracis at 1.8 a resolution 0.9516 2 316
2a1y-assembly1.cif.gz_A crystal structure of guac-gmp complex from bacillus anthracis at 2.26 a resolution. 0.9479 2 316
ID Description Score Start End Superfamily
1ypfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9613 1 316 3.20.20.70
1ypfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9548 1 316 3.20.20.70
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8933 1 315 3.20.20.70
af_Q10CU7_12_484_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8855 2 313 3.20.20.70
1lrtC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8734 1 318 3.20.20.70
ID Description Score Start End GO Terms
AF-A7T3Y3-F1-model_v4 GMP reductase (EC 1.7.1.7) 1.002 1 167 GO:0016491
AF-A0A5C7W511-F1-model_v4 GMP reductase (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase) 0.9963 1 250 GO:0003920
GO:0005829
AF-T2SXB3-F1-model_v4 GMP reductase (EC 1.7.1.7) 0.9936 1 157 GO:0003920
GO:0005829
AF-A0A3D5CTI8-F1-model_v4 GMP reductase (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase) 0.9927 1 207 GO:0005829
GO:0016491
AF-A0A5C7W511-F1-model_v4 GMP reductase (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase) 0.9924 1 250 GO:0003920
GO:0005829

Map