F488932
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1045 | 555 | 2090 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10350880|Ga0105237_103508801 |
| Length | 358 |
| Sequence | MPIIRFLPRLYRWQRPASRPLADRRVEFRRERGMEIFDYDNVLLLPRKCRVESRSECDPSVEFGPRRFALPVVPANMKTVIDESIAEWLAGNGFFYVMHRFDVDHVAFARRMREKNLVVSISSGVKRPDYAVIDRLASDGVGADYVTIDIAHGHAETVHRMIEHIKTKLPQAFVIAGNVATPEAVIDLENWGADATKVGVGPGKVCITKLKTGFGTGGWQLSALKWCARVATKPIIADGGIRDHGDIAKSVRFGACMVMIGSLFAGHEESPGRTVEVDGKLYKEYYGSASDFNKGEYKHVEGKRILEPIKGSLADTLREMKEDVQSSISYAGGTKLSDIRKVNYVILGGDNAGEHLLM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 110 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 225 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 227 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 228 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 229 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 230 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 249 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 250 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 253 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 269 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 270 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 273 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 274 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 277 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 278 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 279 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 280 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 281 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 282 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 283 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 284 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 285 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 286 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 287 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 288 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 289 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 292 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 293 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 348 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 357 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 358 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 371 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 372 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 373 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 377 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 378 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 379 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 380 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 381 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 382 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 396 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 401 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 403 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 404 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 405 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 406 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 407 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 408 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 409 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 410 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 411 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 412 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 413 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 414 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 415 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 416 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 417 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 418 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 419 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 420 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 421 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 422 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 423 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 424 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 425 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 426 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 427 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 428 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 429 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 430 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 431 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 432 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 433 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 434 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 435 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 436 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 437 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 438 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 439 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 440 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 441 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 442 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 443 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 444 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 445 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 446 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 447 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 448 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 449 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 450 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 451 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 452 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 453 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 454 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 455 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 456 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 457 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 458 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 459 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 460 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 461 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 462 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 463 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 464 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 465 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 466 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 467 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 468 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 469 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 470 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 471 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 472 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 473 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 474 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 475 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 476 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 477 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 478 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 479 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 480 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 481 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 482 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 483 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 484 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 485 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 486 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 487 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 488 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 489 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 490 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 491 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 492 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 493 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 494 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 495 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 496 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 497 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 498 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 499 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 500 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 501 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 502 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 503 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 504 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 505 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 506 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 507 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 508 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 509 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 510 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 511 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 512 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 513 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 514 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 515 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 516 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 517 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 518 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 519 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 520 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 521 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 522 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 523 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 524 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 525 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 526 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 527 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 528 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 529 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 530 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 531 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 532 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 533 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 534 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 535 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 536 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 537 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 538 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 539 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 540 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 541 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 542 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 543 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 544 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
| 545 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 546 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 547 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 548 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 549 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 550 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 551 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 552 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 553 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 554 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 555 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.69 |
| Metatranscriptomes | 0.86 |
| Isolates | 14.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.31 |
| Nodule | 1.24 |
| Rhizoplane | 1.82 |
| Rhizosphere | 57.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105237_10350880 | 3300009545 | Bacteria | 1480 |
| 2 | SwRhRL2b_contig_1580065 | 2162886007 | Bacteria | 1418 |
| 3 | JGI25156J39149_1000006 | 3300002705 | Bacteria | 261778 |
| 4 | JGI25156J39149_1000459 | 3300002705 | Bacteria | 24817 |
| 5 | JGI25154J39366_1000015 | 3300002738 | Bacteria | 261778 |
| 6 | JGI25154J39366_1002018 | 3300002738 | Bacteria | 5867 |
| 7 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 8 | JGI25157J39369_1000111 | 3300002741 | Bacteria | 69508 |
| 9 | JGI25152J39213_1007497 | 3300002773 | Bacteria | 2819 |
| 10 | JGI25159J45721_1001980 | 3300002987 | Bacteria | 8154 |
| 11 | JGI25159J45721_1011608 | 3300002987 | Bacteria | 2147 |
| 12 | JGI25159J45721_1016473 | 3300002987 | Bacteria | 1573 |
| 13 | JGI25151J46595_10001205 | 3300003187 | Bacteria | 18532 |
| 14 | JGI25151J46595_10001210 | 3300003187 | Bacteria | 18476 |
| 15 | JGI25151J46595_10002472 | 3300003187 | Bacteria | 11070 |
| 16 | JGI25151J46595_10002973 | 3300003187 | Bacteria | 9677 |
| 17 | JGI25151J46595_10005635 | 3300003187 | Bacteria | 6439 |
| 18 | JGI25151J46595_10014177 | 3300003187 | Bacteria | 3561 |
| 19 | JGI25153J46596_10001901 | 3300003215 | Bacteria | 12388 |
| 20 | JGI25153J46596_10011385 | 3300003215 | Bacteria | 3934 |
| 21 | JGI25153J46596_10012295 | 3300003215 | Bacteria | 3707 |
| 22 | rootH1_10001155 | 3300003316 | Bacteria | 241584 |
| 23 | JGI25160J50197_1000045 | 3300003354 | Bacteria | 142992 |
| 24 | JGI25161J50226_1000008 | 3300003374 | Bacteria | 239245 |
| 25 | Ga0006562J51391_1119627 | 3300003578 | Bacteria | 1620 |
| 26 | Ga0055538_1000081 | 3300003751 | Bacteria | 85159 |
| 27 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 28 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 29 | Ga0055525_1001213 | 3300003759 | Bacteria | 5686 |
| 30 | Ga0055535_1000076 | 3300003761 | Bacteria | 111203 |
| 31 | Ga0055535_1001037 | 3300003761 | Bacteria | 17524 |
| 32 | Ga0055542_1000009 | 3300003762 | Bacteria | 416550 |
| 33 | Ga0055529_1000860 | 3300003763 | Bacteria | 17524 |
| 34 | Ga0055526_1001951 | 3300003771 | Bacteria | 14259 |
| 35 | Ga0055526_1002081 | 3300003771 | Bacteria | 13745 |
| 36 | Ga0055526_1006798 | 3300003771 | Bacteria | 6106 |
| 37 | Ga0055526_1006804 | 3300003771 | Bacteria | 6104 |
| 38 | Ga0055537_1000011 | 3300003773 | Bacteria | 137556 |
| 39 | Ga0055537_1000182 | 3300003773 | Bacteria | 46822 |
| 40 | Ga0055537_1006595 | 3300003773 | Bacteria | 2917 |
| 41 | Ga0055537_1014005 | 3300003773 | Bacteria | 1475 |
| 42 | Ga0055524_1000126 | 3300003775 | Bacteria | 89985 |
| 43 | Ga0055524_1000679 | 3300003775 | Bacteria | 23825 |
| 44 | Ga0055536_1001326 | 3300003781 | Bacteria | 15163 |
| 45 | Ga0055534_1000020 | 3300003784 | Bacteria | 137562 |
| 46 | Ga0055534_1000333 | 3300003784 | Bacteria | 30812 |
| 47 | Ga0055534_1001522 | 3300003784 | Bacteria | 9059 |
| 48 | Ga0055534_1002053 | 3300003784 | Bacteria | 7284 |
| 49 | Ga0055528_1000349 | 3300003790 | Bacteria | 37978 |
| 50 | Ga0055528_1000606 | 3300003790 | Bacteria | 26938 |
| 51 | Ga0055528_1029631 | 3300003790 | Bacteria | 1475 |
| 52 | Ga0055530_10000302 | 3300003791 | Bacteria | 44821 |
| 53 | Ga0055530_10002526 | 3300003791 | Bacteria | 11666 |
| 54 | Ga0055530_10023526 | 3300003791 | Bacteria | 1767 |
| 55 | Ga0055540_1000015 | 3300003792 | Bacteria | 232986 |
| 56 | Ga0055540_1000021 | 3300003792 | Bacteria | 208733 |
| 57 | Ga0055540_1004986 | 3300003792 | Bacteria | 5778 |
| 58 | Ga0055531_10000214 | 3300003794 | Bacteria | 63569 |
| 59 | Ga0055531_10000806 | 3300003794 | Bacteria | 25957 |
| 60 | Ga0055531_10001001 | 3300003794 | Bacteria | 22450 |
| 61 | Ga0055531_10005410 | 3300003794 | Bacteria | 7483 |
| 62 | Ga0055531_10014723 | 3300003794 | Bacteria | 3503 |
| 63 | Ga0055543_1003659 | 3300004625 | Bacteria | 4428 |
| 64 | Ga0065165_1000024 | 3300005262 | Bacteria | 247672 |
| 65 | Ga0065165_1000401 | 3300005262 | Bacteria | 69929 |
| 66 | Ga0065165_1002995 | 3300005262 | Bacteria | 12808 |
| 67 | Ga0065714_10006124 | 3300005288 | Bacteria | 4330 |
| 68 | Ga0065704_10091410 | 3300005289 | Bacteria | 2719 |
| 69 | Ga0065707_10094865 | 3300005295 | Bacteria | 3443 |
| 70 | Ga0070658_10067093 | 3300005327 | Bacteria | 2931 |
| 71 | Ga0070658_10198158 | 3300005327 | Bacteria | 1694 |
| 72 | Ga0070676_10028928 | 3300005328 | Bacteria | 3148 |
| 73 | Ga0070683_100132995 | 3300005329 | Bacteria | 2354 |
| 74 | Ga0070683_100222390 | 3300005329 | Bacteria | 1794 |
| 75 | Ga0070690_100000001 | 3300005330 | Bacteria | 208233 |
| 76 | Ga0070690_100239269 | 3300005330 | Bacteria | 1279 |
| 77 | Ga0070670_100000817 | 3300005331 | Bacteria | 24262 |
| 78 | Ga0070670_100008148 | 3300005331 | Bacteria | 8921 |
| 79 | Ga0070670_100191077 | 3300005331 | Bacteria | 1778 |
| 80 | Ga0068869_100001842 | 3300005334 | Bacteria | 12742 |
| 81 | Ga0068869_100040874 | 3300005334 | Bacteria | 3317 |
| 82 | Ga0068869_100065284 | 3300005334 | Bacteria | 2679 |
| 83 | Ga0068869_100169308 | 3300005334 | Bacteria | 1706 |
| 84 | Ga0070666_10000960 | 3300005335 | Bacteria | 17591 |
| 85 | Ga0070666_10027413 | 3300005335 | Bacteria | 3731 |
| 86 | Ga0070666_10043775 | 3300005335 | Bacteria | 2998 |
| 87 | Ga0070666_10170599 | 3300005335 | Bacteria | 1524 |
| 88 | Ga0068868_100146116 | 3300005338 | Bacteria | 1944 |
| 89 | Ga0068868_100235894 | 3300005338 | Bacteria | 1536 |
| 90 | Ga0070660_100039575 | 3300005339 | Bacteria | 3584 |
| 91 | Ga0070660_100211467 | 3300005339 | Bacteria | 1575 |
| 92 | Ga0070689_100057022 | 3300005340 | Bacteria | 3031 |
| 93 | Ga0070661_100000841 | 3300005344 | Bacteria | 22033 |
| 94 | Ga0070661_100014722 | 3300005344 | Bacteria | 5516 |
| 95 | Ga0070661_100031906 | 3300005344 | Bacteria | 3811 |
| 96 | Ga0070669_100001800 | 3300005353 | Bacteria | 15415 |
| 97 | Ga0070669_100079404 | 3300005353 | Bacteria | 2440 |
| 98 | Ga0070669_100102649 | 3300005353 | Bacteria | 2159 |
| 99 | Ga0070675_100003281 | 3300005354 | Bacteria | 12273 |
| 100 | Ga0070675_100039314 | 3300005354 | Bacteria | 3860 |
| 101 | Ga0070675_100152123 | 3300005354 | Bacteria | 1984 |
| 102 | Ga0070671_100009321 | 3300005355 | Bacteria | 7882 |
| 103 | Ga0070671_100030602 | 3300005355 | Bacteria | 4442 |
| 104 | Ga0070671_100052804 | 3300005355 | Bacteria | 3379 |
| 105 | Ga0070671_100056286 | 3300005355 | Bacteria | 3272 |
| 106 | Ga0070674_100031822 | 3300005356 | Bacteria | 3499 |
| 107 | Ga0070673_100001009 | 3300005364 | Bacteria | 15963 |
| 108 | Ga0070673_100015685 | 3300005364 | Bacteria | 5330 |
| 109 | Ga0070673_100243891 | 3300005364 | Bacteria | 1563 |
| 110 | Ga0070659_100048151 | 3300005366 | Bacteria | 3347 |
| 111 | Ga0070667_100004040 | 3300005367 | Bacteria | 12405 |
| 112 | Ga0070667_100096269 | 3300005367 | Bacteria | 2553 |
| 113 | Ga0070701_10225999 | 3300005438 | Bacteria | 1119 |
| 114 | Ga0070700_100016951 | 3300005441 | Bacteria | 4158 |
| 115 | Ga0070700_100180279 | 3300005441 | Bacteria | 1469 |
| 116 | Ga0070663_100016943 | 3300005455 | Bacteria | 4743 |
| 117 | Ga0070678_100076096 | 3300005456 | Bacteria | 2527 |
| 118 | Ga0070678_100109989 | 3300005456 | Bacteria | 2154 |
| 119 | Ga0070678_100141178 | 3300005456 | Bacteria | 1928 |
| 120 | Ga0070662_100014126 | 3300005457 | Bacteria | 5327 |
| 121 | Ga0070662_100022340 | 3300005457 | Bacteria | 4331 |
| 122 | Ga0070662_100120722 | 3300005457 | Bacteria | 2008 |
| 123 | Ga0070662_100212838 | 3300005457 | Bacteria | 1539 |
| 124 | Ga0068867_100000042 | 3300005459 | Bacteria | 77140 |
| 125 | Ga0068867_100002918 | 3300005459 | Bacteria | 12053 |
| 126 | Ga0068867_100011005 | 3300005459 | Bacteria | 6378 |
| 127 | Ga0070679_100013117 | 3300005530 | Bacteria | 7936 |
| 128 | Ga0070679_100100557 | 3300005530 | Bacteria | 2877 |
| 129 | Ga0068853_100045063 | 3300005539 | Bacteria | 3777 |
| 130 | Ga0068853_100130668 | 3300005539 | Bacteria | 2248 |
| 131 | Ga0068853_100240939 | 3300005539 | Bacteria | 1657 |
| 132 | Ga0070672_100040398 | 3300005543 | Bacteria | 3579 |
| 133 | Ga0070693_100022693 | 3300005547 | Bacteria | 3341 |
| 134 | Ga0070665_100077997 | 3300005548 | Bacteria | 3319 |
| 135 | Ga0068855_100019714 | 3300005563 | Bacteria | 8099 |
| 136 | Ga0068855_100215341 | 3300005563 | Bacteria | 2156 |
| 137 | Ga0070664_100004757 | 3300005564 | Bacteria | 10889 |
| 138 | Ga0070664_100021332 | 3300005564 | Bacteria | 5337 |
| 139 | Ga0070664_100048175 | 3300005564 | Bacteria | 3601 |
| 140 | Ga0068857_100005113 | 3300005577 | Bacteria | 11156 |
| 141 | Ga0068857_100027288 | 3300005577 | Bacteria | 5036 |
| 142 | Ga0068857_100160194 | 3300005577 | Bacteria | 2042 |
| 143 | Ga0068856_100000887 | 3300005614 | Bacteria | 32039 |
| 144 | Ga0068856_100040639 | 3300005614 | Bacteria | 4569 |
| 145 | Ga0068852_100048105 | 3300005616 | Bacteria | 3643 |
| 146 | Ga0068852_100409994 | 3300005616 | Bacteria | 1335 |
| 147 | Ga0068859_100060433 | 3300005617 | Bacteria | 3818 |
| 148 | Ga0068859_100410178 | 3300005617 | Bacteria | 1451 |
| 149 | Ga0068864_100077885 | 3300005618 | Bacteria | 2900 |
| 150 | Ga0068866_10004706 | 3300005718 | Bacteria | 5600 |
| 151 | Ga0068866_10006851 | 3300005718 | Bacteria | 4757 |
| 152 | Ga0068861_100034068 | 3300005719 | Bacteria | 3763 |
| 153 | Ga0068861_100055999 | 3300005719 | Bacteria | 3008 |
| 154 | Ga0068861_100126537 | 3300005719 | Bacteria | 2068 |
| 155 | Ga0068851_10010700 | 3300005834 | Bacteria | 4287 |
| 156 | Ga0068851_10015161 | 3300005834 | Bacteria | 3668 |
| 157 | Ga0068863_100003799 | 3300005841 | Bacteria | 14929 |
| 158 | Ga0068863_100005986 | 3300005841 | Bacteria | 11929 |
| 159 | Ga0068863_100024555 | 3300005841 | Bacteria | 5748 |
| 160 | Ga0068863_100047981 | 3300005841 | Bacteria | 4049 |
| 161 | Ga0068863_100192258 | 3300005841 | Bacteria | 1961 |
| 162 | Ga0068858_100002240 | 3300005842 | Bacteria | 19545 |
| 163 | Ga0068858_100080940 | 3300005842 | Bacteria | 3018 |
| 164 | Ga0068860_100000445 | 3300005843 | Bacteria | 52236 |
| 165 | Ga0068860_100002076 | 3300005843 | Bacteria | 21118 |
| 166 | Ga0068860_100065526 | 3300005843 | Bacteria | 3450 |
| 167 | Ga0068860_100067929 | 3300005843 | Bacteria | 3386 |
| 168 | Ga0068860_100295299 | 3300005843 | Bacteria | 1586 |
| 169 | Ga0068862_100007146 | 3300005844 | Bacteria | 9269 |
| 170 | Ga0068862_100011076 | 3300005844 | Bacteria | 7449 |
| 171 | Ga0068862_100014506 | 3300005844 | Bacteria | 6540 |
| 172 | Ga0068862_100086014 | 3300005844 | Bacteria | 2733 |
| 173 | Ga0075365_10003947 | 3300006038 | Bacteria | 7769 |
| 174 | Ga0075365_10139939 | 3300006038 | Bacteria | 1679 |
| 175 | Ga0075368_10029585 | 3300006042 | Bacteria | 2118 |
| 176 | Ga0075363_100056785 | 3300006048 | Bacteria | 2099 |
| 177 | Ga0075363_100112167 | 3300006048 | Bacteria | 1516 |
| 178 | Ga0075364_10009007 | 3300006051 | Bacteria | 5978 |
| 179 | Ga0075364_10052613 | 3300006051 | Bacteria | 2661 |
| 180 | Ga0075364_10118772 | 3300006051 | Bacteria | 1769 |
| 181 | Ga0075432_10014637 | 3300006058 | Bacteria | 2671 |
| 182 | Ga0075362_10012738 | 3300006177 | Bacteria | 3348 |
| 183 | Ga0075362_10015848 | 3300006177 | Bacteria | 3074 |
| 184 | Ga0075362_10017053 | 3300006177 | Bacteria | 2986 |
| 185 | Ga0075362_10022087 | 3300006177 | Bacteria | 2677 |
| 186 | Ga0075362_10022308 | 3300006177 | Bacteria | 2666 |
| 187 | Ga0075362_10058021 | 3300006177 | Bacteria | 1745 |
| 188 | Ga0075367_10025655 | 3300006178 | Bacteria | 3335 |
| 189 | Ga0075367_10031585 | 3300006178 | Bacteria | 3041 |
| 190 | Ga0075367_10052150 | 3300006178 | Bacteria | 2420 |
| 191 | Ga0075366_10000957 | 3300006195 | Bacteria | 14080 |
| 192 | Ga0075366_10009371 | 3300006195 | Bacteria | 5464 |
| 193 | Ga0075366_10029346 | 3300006195 | Bacteria | 3232 |
| 194 | Ga0075366_10100892 | 3300006195 | Bacteria | 1732 |
| 195 | Ga0075366_10129032 | 3300006195 | Bacteria | 1525 |
| 196 | Ga0097621_100099784 | 3300006237 | Bacteria | 2441 |
| 197 | Ga0075370_10001441 | 3300006353 | Bacteria | 10331 |
| 198 | Ga0075370_10002460 | 3300006353 | Bacteria | 8589 |
| 199 | Ga0075370_10013167 | 3300006353 | Bacteria | 4390 |
| 200 | Ga0075370_10014047 | 3300006353 | Bacteria | 4264 |
| 201 | Ga0075370_10017503 | 3300006353 | Bacteria | 3873 |
| 202 | Ga0075370_10018231 | 3300006353 | Bacteria | 3806 |
| 203 | Ga0075370_10020298 | 3300006353 | Bacteria | 3629 |
| 204 | Ga0075370_10024531 | 3300006353 | Bacteria | 3332 |
| 205 | Ga0075370_10037798 | 3300006353 | Bacteria | 2715 |
| 206 | Ga0075370_10042989 | 3300006353 | Bacteria | 2553 |
| 207 | Ga0075370_10074579 | 3300006353 | Bacteria | 1944 |
| 208 | Ga0068871_100008651 | 3300006358 | Bacteria | 7321 |
| 209 | Ga0068871_100241727 | 3300006358 | Bacteria | 1570 |
| 210 | Ga0075434_100199179 | 3300006871 | Bacteria | 2022 |
| 211 | Ga0075429_100002300 | 3300006880 | Bacteria | 16033 |
| 212 | Ga0068865_100009443 | 3300006881 | Bacteria | 6050 |
| 213 | Ga0068865_100061485 | 3300006881 | Bacteria | 2633 |
| 214 | Ga0097620_100060433 | 3300006931 | Bacteria | 3818 |
| 215 | Ga0097620_100410188 | 3300006931 | Bacteria | 1451 |
| 216 | Ga0099823_1004429 | 3300006944 | Bacteria | 13727 |
| 217 | Ga0079104_1000002 | 3300006946 | Bacteria | 514469 |
| 218 | Ga0079104_1000219 | 3300006946 | Bacteria | 79928 |
| 219 | Ga0079104_1006351 | 3300006946 | Bacteria | 4497 |
| 220 | Ga0099826_10014173 | 3300006948 | Bacteria | 6023 |
| 221 | Ga0099826_10059971 | 3300006948 | Bacteria | 2483 |
| 222 | Ga0105251_10039728 | 3300009011 | Bacteria | 2297 |
| 223 | Ga0105251_10054066 | 3300009011 | Bacteria | 1908 |
| 224 | Ga0105244_10001082 | 3300009036 | Bacteria | 22683 |
| 225 | Ga0105244_10003649 | 3300009036 | Bacteria | 10898 |
| 226 | Ga0105244_10025820 | 3300009036 | Bacteria | 3186 |
| 227 | Ga0105244_10058078 | 3300009036 | Bacteria | 1954 |
| 228 | Ga0105244_10100473 | 3300009036 | Bacteria | 1415 |
| 229 | Ga0105250_10006394 | 3300009092 | Bacteria | 5151 |
| 230 | Ga0105250_10030203 | 3300009092 | Bacteria | 2179 |
| 231 | Ga0105240_10001398 | 3300009093 | Bacteria | 41467 |
| 232 | Ga0105240_10046752 | 3300009093 | Bacteria | 5481 |
| 233 | Ga0105240_10066173 | 3300009093 | Bacteria | 4484 |
| 234 | Ga0105240_10107763 | 3300009093 | Bacteria | 3377 |
| 235 | Ga0105245_10034537 | 3300009098 | Bacteria | 4486 |
| 236 | Ga0105245_10037603 | 3300009098 | Bacteria | 4304 |
| 237 | Ga0114129_10124503 | 3300009147 | Bacteria | 3545 |
| 238 | Ga0105243_10000764 | 3300009148 | Bacteria | 30869 |
| 239 | Ga0105243_10002340 | 3300009148 | Bacteria | 15858 |
| 240 | Ga0105243_10019402 | 3300009148 | Bacteria | 5156 |
| 241 | Ga0105243_10042088 | 3300009148 | Bacteria | 3575 |
| 242 | Ga0105243_10076032 | 3300009148 | Bacteria | 2727 |
| 243 | Ga0105241_10223183 | 3300009174 | Bacteria | 1585 |
| 244 | Ga0105242_10031307 | 3300009176 | Bacteria | 4247 |
| 245 | Ga0105242_10489811 | 3300009176 | Bacteria | 1167 |
| 246 | Ga0105248_10012566 | 3300009177 | Bacteria | 9340 |
| 247 | Ga0105248_10078489 | 3300009177 | Bacteria | 3711 |
| 248 | Ga0105248_10197133 | 3300009177 | Bacteria | 2269 |
| 249 | Ga0105237_10001780 | 3300009545 | Bacteria | 27851 |
| 250 | Ga0105237_10015735 | 3300009545 | Bacteria | 7865 |
| 251 | Ga0105237_10059850 | 3300009545 | Bacteria | 3810 |
| 252 | Ga0105238_10019971 | 3300009551 | Bacteria | 6820 |
| 253 | Ga0105249_10005956 | 3300009553 | Bacteria | 10564 |
| 254 | Ga0105249_10017447 | 3300009553 | Bacteria | 6372 |
| 255 | Ga0105239_10000615 | 3300010375 | Bacteria | 50705 |
| 256 | Ga0105239_10086938 | 3300010375 | Bacteria | 3446 |
| 257 | Ga0105239_10686654 | 3300010375 | Bacteria | 1170 |
| 258 | Ga0105246_10115286 | 3300011119 | Bacteria | 1981 |
| 259 | Ga0105246_10156605 | 3300011119 | Bacteria | 1731 |
| 260 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 261 | Ga0157326_1003246 | 3300012513 | Bacteria | 1715 |
| 262 | Ga0157373_10025052 | 3300013100 | Bacteria | 4319 |
| 263 | Ga0157373_10041688 | 3300013100 | Bacteria | 3283 |
| 264 | Ga0157373_10085976 | 3300013100 | Bacteria | 2216 |
| 265 | Ga0157371_10087103 | 3300013102 | Bacteria | 2212 |
| 266 | Ga0157369_10028743 | 3300013105 | Bacteria | 6149 |
| 267 | Ga0157369_10189277 | 3300013105 | Bacteria | 2163 |
| 268 | Ga0157374_10255240 | 3300013296 | Bacteria | 1726 |
| 269 | Ga0157378_10016387 | 3300013297 | Bacteria | 6488 |
| 270 | Ga0157378_10062020 | 3300013297 | Bacteria | 3338 |
| 271 | Ga0163162_10042974 | 3300013306 | Bacteria | 4524 |
| 272 | Ga0163162_10131923 | 3300013306 | Bacteria | 2607 |
| 273 | Ga0157372_10036343 | 3300013307 | Bacteria | 5429 |
| 274 | Ga0157372_10090635 | 3300013307 | Bacteria | 3476 |
| 275 | Ga0157375_10023030 | 3300013308 | Bacteria | 5741 |
| 276 | Ga0157375_10082234 | 3300013308 | Bacteria | 3262 |
| 277 | Ga0157380_10180912 | 3300014326 | Bacteria | 1852 |
| 278 | Ga0182008_10002167 | 3300014497 | Bacteria | 12496 |
| 279 | Ga0182008_10007602 | 3300014497 | Bacteria | 5975 |
| 280 | Ga0182008_10056271 | 3300014497 | Bacteria | 1944 |
| 281 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 282 | Ga0157379_10024536 | 3300014968 | Bacteria | 5352 |
| 283 | Ga0157379_10070395 | 3300014968 | Bacteria | 3129 |
| 284 | Ga0157379_10121929 | 3300014968 | Bacteria | 2346 |
| 285 | Ga0157379_10185718 | 3300014968 | Bacteria | 1879 |
| 286 | Ga0157376_10001082 | 3300014969 | Bacteria | 17860 |
| 287 | Ga0157376_10282151 | 3300014969 | Bacteria | 1565 |
| 288 | Ga0182006_1006774 | 3300015261 | Bacteria | 5291 |
| 289 | Ga0182007_10000224 | 3300015262 | Bacteria | 38000 |
| 290 | Ga0182007_10001945 | 3300015262 | Bacteria | 10695 |
| 291 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 292 | Ga0163161_10000042 | 3300017792 | Bacteria | 135368 |
| 293 | Ga0163161_10004047 | 3300017792 | Bacteria | 10254 |
| 294 | Ga0163161_10067035 | 3300017792 | Bacteria | 2621 |
| 295 | Ga0163161_10082182 | 3300017792 | Bacteria | 2373 |
| 296 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 297 | Ga0213872_10000124 | 3300021361 | Bacteria | 72197 |
| 298 | Ga0213872_10000345 | 3300021361 | Bacteria | 39156 |
| 299 | Ga0213872_10020060 | 3300021361 | Bacteria | 3079 |
| 300 | Ga0213872_10035580 | 3300021361 | Bacteria | 2277 |
| 301 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 302 | Ga0209436_109065 | 3300025208 | Bacteria | 1926 |
| 303 | Ga0209784_100044 | 3300025224 | Bacteria | 206858 |
| 304 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 305 | Ga0209672_100728 | 3300025228 | Bacteria | 16203 |
| 306 | Ga0209672_106441 | 3300025228 | Bacteria | 1906 |
| 307 | Ga0209147_100457 | 3300025229 | Bacteria | 25391 |
| 308 | Ga0209147_102577 | 3300025229 | Bacteria | 4339 |
| 309 | Ga0209147_102702 | 3300025229 | Bacteria | 4068 |
| 310 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 311 | Ga0209563_100126 | 3300025230 | Bacteria | 113122 |
| 312 | Ga0207427_100197 | 3300025231 | Bacteria | 57629 |
| 313 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 314 | Ga0209258_100736 | 3300025242 | Bacteria | 21300 |
| 315 | Ga0209258_100787 | 3300025242 | Bacteria | 19150 |
| 316 | Ga0207425_1000135 | 3300025245 | Bacteria | 66450 |
| 317 | Ga0207425_1000821 | 3300025245 | Bacteria | 15532 |
| 318 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 319 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 320 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 321 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 322 | Ga0209677_100411 | 3300025253 | Bacteria | 25661 |
| 323 | Ga0209677_101222 | 3300025253 | Bacteria | 11674 |
| 324 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 325 | Ga0209148_1004733 | 3300025254 | Bacteria | 3270 |
| 326 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 327 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 328 | Ga0209759_1001428 | 3300025256 | Bacteria | 13546 |
| 329 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 330 | Ga0209129_1000043 | 3300025258 | Bacteria | 298978 |
| 331 | Ga0209129_1004720 | 3300025258 | Bacteria | 5169 |
| 332 | Ga0209565_1000028 | 3300025263 | Bacteria | 348536 |
| 333 | Ga0209565_1000058 | 3300025263 | Bacteria | 194126 |
| 334 | Ga0209565_1000197 | 3300025263 | Bacteria | 71850 |
| 335 | Ga0209565_1000433 | 3300025263 | Bacteria | 33703 |
| 336 | Ga0209565_1008528 | 3300025263 | Bacteria | 2671 |
| 337 | Ga0209455_1001719 | 3300025272 | Bacteria | 9364 |
| 338 | Ga0209673_1000035 | 3300025273 | Bacteria | 328411 |
| 339 | Ga0209673_1000053 | 3300025273 | Bacteria | 279449 |
| 340 | Ga0209673_1000279 | 3300025273 | Bacteria | 96141 |
| 341 | Ga0209673_1000316 | 3300025273 | Bacteria | 89031 |
| 342 | Ga0209673_1000780 | 3300025273 | Bacteria | 42650 |
| 343 | Ga0209673_1004689 | 3300025273 | Bacteria | 7208 |
| 344 | Ga0209673_1013804 | 3300025273 | Bacteria | 3168 |
| 345 | Ga0209673_1014652 | 3300025273 | Bacteria | 3024 |
| 346 | Ga0209673_1028079 | 3300025273 | Bacteria | 1819 |
| 347 | Ga0209130_1000112 | 3300025284 | Bacteria | 131607 |
| 348 | Ga0209130_1000158 | 3300025284 | Bacteria | 101323 |
| 349 | Ga0209130_1000186 | 3300025284 | Bacteria | 87096 |
| 350 | Ga0209130_1000363 | 3300025284 | Bacteria | 51603 |
| 351 | Ga0209130_1000701 | 3300025284 | Bacteria | 30005 |
| 352 | Ga0209130_1003550 | 3300025284 | Bacteria | 6531 |
| 353 | Ga0209130_1005803 | 3300025284 | Bacteria | 4177 |
| 354 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 355 | Ga0209675_1000130 | 3300025291 | Bacteria | 102667 |
| 356 | Ga0209675_1000153 | 3300025291 | Bacteria | 90298 |
| 357 | Ga0209675_1000871 | 3300025291 | Bacteria | 19422 |
| 358 | Ga0209675_1001471 | 3300025291 | Bacteria | 13541 |
| 359 | Ga0209675_1004539 | 3300025291 | Bacteria | 6136 |
| 360 | Ga0209675_1011067 | 3300025291 | Bacteria | 3018 |
| 361 | Ga0209676_1000069 | 3300025292 | Bacteria | 312462 |
| 362 | Ga0209676_1000108 | 3300025292 | Bacteria | 221168 |
| 363 | Ga0209676_1007541 | 3300025292 | Bacteria | 5071 |
| 364 | Ga0209676_1007556 | 3300025292 | Bacteria | 5064 |
| 365 | Ga0209025_1000103 | 3300025294 | Bacteria | 228054 |
| 366 | Ga0209025_1000129 | 3300025294 | Bacteria | 198847 |
| 367 | Ga0209025_1000169 | 3300025294 | Bacteria | 161428 |
| 368 | Ga0209025_1000331 | 3300025294 | Bacteria | 104721 |
| 369 | Ga0209025_1000565 | 3300025294 | Bacteria | 67929 |
| 370 | Ga0209025_1001427 | 3300025294 | Bacteria | 31558 |
| 371 | Ga0209025_1001602 | 3300025294 | Bacteria | 28432 |
| 372 | Ga0209025_1001700 | 3300025294 | Bacteria | 26836 |
| 373 | Ga0209025_1001921 | 3300025294 | Bacteria | 24097 |
| 374 | Ga0209025_1002074 | 3300025294 | Bacteria | 22759 |
| 375 | Ga0209025_1002962 | 3300025294 | Bacteria | 16868 |
| 376 | Ga0209025_1011956 | 3300025294 | Bacteria | 5638 |
| 377 | Ga0209025_1014326 | 3300025294 | Bacteria | 4889 |
| 378 | Ga0209025_1023954 | 3300025294 | Bacteria | 3170 |
| 379 | Ga0209025_1025018 | 3300025294 | Bacteria | 3056 |
| 380 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 381 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 382 | Ga0209564_1000171 | 3300025295 | Bacteria | 155716 |
| 383 | Ga0209564_1000880 | 3300025295 | Bacteria | 39770 |
| 384 | Ga0209564_1001709 | 3300025295 | Bacteria | 20691 |
| 385 | Ga0209564_1002454 | 3300025295 | Bacteria | 14592 |
| 386 | Ga0209564_1003455 | 3300025295 | Bacteria | 10789 |
| 387 | Ga0209758_1000067 | 3300025297 | Bacteria | 288575 |
| 388 | Ga0209758_1000307 | 3300025297 | Bacteria | 95192 |
| 389 | Ga0209758_1000492 | 3300025297 | Bacteria | 64511 |
| 390 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 391 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 392 | Ga0209050_1000493 | 3300025298 | Bacteria | 67885 |
| 393 | Ga0209050_1000543 | 3300025298 | Bacteria | 62404 |
| 394 | Ga0209050_1001273 | 3300025298 | Bacteria | 28958 |
| 395 | Ga0209050_1001396 | 3300025298 | Bacteria | 26194 |
| 396 | Ga0209050_1003837 | 3300025298 | Bacteria | 10711 |
| 397 | Ga0209050_1010459 | 3300025298 | Bacteria | 4571 |
| 398 | Ga0209050_1010869 | 3300025298 | Bacteria | 4415 |
| 399 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 400 | Ga0209256_1000077 | 3300025299 | Bacteria | 230410 |
| 401 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 402 | Ga0209256_1000121 | 3300025299 | Bacteria | 167299 |
| 403 | Ga0209256_1008919 | 3300025299 | Bacteria | 4519 |
| 404 | Ga0207426_1000101 | 3300025302 | Bacteria | 262096 |
| 405 | Ga0207426_1000129 | 3300025302 | Bacteria | 210930 |
| 406 | Ga0207426_1000153 | 3300025302 | Bacteria | 182839 |
| 407 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 408 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 409 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 410 | Ga0209051_1000101 | 3300025303 | Bacteria | 163793 |
| 411 | Ga0209051_1000145 | 3300025303 | Bacteria | 134807 |
| 412 | Ga0209051_1000289 | 3300025303 | Bacteria | 80415 |
| 413 | Ga0209051_1000317 | 3300025303 | Bacteria | 73057 |
| 414 | Ga0209051_1001499 | 3300025303 | Bacteria | 19509 |
| 415 | Ga0209051_1001699 | 3300025303 | Bacteria | 17625 |
| 416 | Ga0209051_1003391 | 3300025303 | Bacteria | 10457 |
| 417 | Ga0209051_1009607 | 3300025303 | Bacteria | 4967 |
| 418 | Ga0209051_1010293 | 3300025303 | Bacteria | 4743 |
| 419 | Ga0209051_1013144 | 3300025303 | Bacteria | 3957 |
| 420 | Ga0209051_1040416 | 3300025303 | Bacteria | 1672 |
| 421 | Ga0209051_1040988 | 3300025303 | Bacteria | 1653 |
| 422 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 423 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 424 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 425 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 426 | Ga0209257_1000189 | 3300025304 | Bacteria | 153917 |
| 427 | Ga0209257_1000724 | 3300025304 | Bacteria | 50361 |
| 428 | Ga0209257_1007414 | 3300025304 | Bacteria | 6628 |
| 429 | Ga0209257_1010393 | 3300025304 | Bacteria | 4718 |
| 430 | Ga0209257_1020459 | 3300025304 | Bacteria | 2446 |
| 431 | Ga0207656_10019425 | 3300025321 | Bacteria | 2688 |
| 432 | Ga0207696_1000786 | 3300025711 | Bacteria | 20827 |
| 433 | Ga0207696_1010395 | 3300025711 | Bacteria | 3411 |
| 434 | Ga0207655_1000332 | 3300025728 | Bacteria | 69117 |
| 435 | Ga0207655_1000839 | 3300025728 | Bacteria | 33048 |
| 436 | Ga0207655_1005345 | 3300025728 | Bacteria | 8775 |
| 437 | Ga0207655_1062474 | 3300025728 | Bacteria | 1432 |
| 438 | Ga0207713_1001629 | 3300025735 | Bacteria | 17507 |
| 439 | Ga0207713_1041575 | 3300025735 | Bacteria | 1916 |
| 440 | Ga0207682_10044711 | 3300025893 | Bacteria | 1816 |
| 441 | Ga0207688_10084072 | 3300025901 | Bacteria | 1821 |
| 442 | Ga0207680_10129006 | 3300025903 | Bacteria | 1664 |
| 443 | Ga0207645_10001485 | 3300025907 | Bacteria | 19163 |
| 444 | Ga0207643_10097243 | 3300025908 | Bacteria | 1723 |
| 445 | Ga0207705_10319175 | 3300025909 | Bacteria | 1193 |
| 446 | Ga0207707_10156440 | 3300025912 | Bacteria | 1994 |
| 447 | Ga0207695_10006362 | 3300025913 | Bacteria | 15366 |
| 448 | Ga0207695_10047697 | 3300025913 | Bacteria | 4530 |
| 449 | Ga0207695_10050611 | 3300025913 | Bacteria | 4368 |
| 450 | Ga0207695_10076864 | 3300025913 | Bacteria | 3393 |
| 451 | Ga0207695_10191782 | 3300025913 | Bacteria | 1961 |
| 452 | Ga0207671_10003233 | 3300025914 | Bacteria | 16389 |
| 453 | Ga0207671_10068376 | 3300025914 | Bacteria | 2647 |
| 454 | Ga0207671_10099948 | 3300025914 | Bacteria | 2196 |
| 455 | Ga0207657_10048467 | 3300025919 | Bacteria | 3709 |
| 456 | Ga0207657_10080477 | 3300025919 | Bacteria | 2738 |
| 457 | Ga0207657_10234846 | 3300025919 | Bacteria | 1466 |
| 458 | Ga0207649_10001402 | 3300025920 | Bacteria | 14262 |
| 459 | Ga0207649_10070952 | 3300025920 | Bacteria | 2223 |
| 460 | Ga0207652_10050248 | 3300025921 | Bacteria | 3572 |
| 461 | Ga0207681_10002051 | 3300025923 | Bacteria | 12932 |
| 462 | Ga0207681_10013357 | 3300025923 | Bacteria | 5081 |
| 463 | Ga0207694_10022432 | 3300025924 | Bacteria | 4788 |
| 464 | Ga0207694_10063968 | 3300025924 | Bacteria | 2866 |
| 465 | Ga0207650_10000998 | 3300025925 | Bacteria | 21269 |
| 466 | Ga0207650_10003908 | 3300025925 | Bacteria | 10189 |
| 467 | Ga0207650_10035789 | 3300025925 | Bacteria | 3608 |
| 468 | Ga0207659_10000691 | 3300025926 | Bacteria | 20035 |
| 469 | Ga0207659_10009045 | 3300025926 | Bacteria | 6212 |
| 470 | Ga0207659_10028640 | 3300025926 | Bacteria | 3787 |
| 471 | Ga0207687_10030425 | 3300025927 | Bacteria | 3640 |
| 472 | Ga0207644_10001362 | 3300025931 | Bacteria | 15719 |
| 473 | Ga0207644_10008153 | 3300025931 | Bacteria | 6864 |
| 474 | Ga0207644_10051638 | 3300025931 | Bacteria | 2952 |
| 475 | Ga0207644_10057212 | 3300025931 | Bacteria | 2815 |
| 476 | Ga0207690_10003313 | 3300025932 | Bacteria | 9634 |
| 477 | Ga0207706_10001466 | 3300025933 | Bacteria | 23574 |
| 478 | Ga0207686_10003386 | 3300025934 | Bacteria | 8563 |
| 479 | Ga0207686_10003857 | 3300025934 | Bacteria | 8038 |
| 480 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 481 | Ga0207709_10000094 | 3300025935 | Bacteria | 137959 |
| 482 | Ga0207709_10000624 | 3300025935 | Bacteria | 29013 |
| 483 | Ga0207709_10024260 | 3300025935 | Bacteria | 3461 |
| 484 | Ga0207709_10032850 | 3300025935 | Bacteria | 3042 |
| 485 | Ga0207669_10007676 | 3300025937 | Bacteria | 5011 |
| 486 | Ga0207669_10039443 | 3300025937 | Bacteria | 2729 |
| 487 | Ga0207704_10003582 | 3300025938 | Bacteria | 7053 |
| 488 | Ga0207691_10001243 | 3300025940 | Bacteria | 25438 |
| 489 | Ga0207691_10003923 | 3300025940 | Bacteria | 14453 |
| 490 | Ga0207691_10049651 | 3300025940 | Bacteria | 3844 |
| 491 | Ga0207691_10067971 | 3300025940 | Bacteria | 3220 |
| 492 | Ga0207711_10009786 | 3300025941 | Bacteria | 7972 |
| 493 | Ga0207711_10095074 | 3300025941 | Bacteria | 2627 |
| 494 | Ga0207689_10002717 | 3300025942 | Bacteria | 16359 |
| 495 | Ga0207689_10062542 | 3300025942 | Bacteria | 3061 |
| 496 | Ga0207689_10069421 | 3300025942 | Bacteria | 2895 |
| 497 | Ga0207689_10079042 | 3300025942 | Bacteria | 2703 |
| 498 | Ga0207689_10209853 | 3300025942 | Bacteria | 1609 |
| 499 | Ga0207661_10098649 | 3300025944 | Bacteria | 2448 |
| 500 | Ga0207679_10000154 | 3300025945 | Bacteria | 56628 |
| 501 | Ga0207679_10010502 | 3300025945 | Bacteria | 5965 |
| 502 | Ga0207679_10022828 | 3300025945 | Bacteria | 4266 |
| 503 | Ga0207679_10109532 | 3300025945 | Bacteria | 2177 |
| 504 | Ga0207667_10001779 | 3300025949 | Bacteria | 27124 |
| 505 | Ga0207667_10116275 | 3300025949 | Bacteria | 2756 |
| 506 | Ga0207651_10008151 | 3300025960 | Bacteria | 5638 |
| 507 | Ga0207651_10009585 | 3300025960 | Bacteria | 5314 |
| 508 | Ga0207712_10067616 | 3300025961 | Bacteria | 2558 |
| 509 | Ga0207640_10002657 | 3300025981 | Bacteria | 9569 |
| 510 | Ga0207640_10037293 | 3300025981 | Bacteria | 3057 |
| 511 | Ga0207640_10110641 | 3300025981 | Bacteria | 1946 |
| 512 | Ga0207658_10001089 | 3300025986 | Bacteria | 21924 |
| 513 | Ga0207677_10037875 | 3300026023 | Bacteria | 3156 |
| 514 | Ga0207677_10197584 | 3300026023 | Bacteria | 1596 |
| 515 | Ga0207703_10000996 | 3300026035 | Bacteria | 27254 |
| 516 | Ga0207703_10015852 | 3300026035 | Bacteria | 5879 |
| 517 | Ga0207703_10091690 | 3300026035 | Bacteria | 2556 |
| 518 | Ga0207639_10124298 | 3300026041 | Bacteria | 2125 |
| 519 | Ga0207639_10262296 | 3300026041 | Bacteria | 1512 |
| 520 | Ga0207678_10043499 | 3300026067 | Bacteria | 3886 |
| 521 | Ga0207708_10031570 | 3300026075 | Bacteria | 4021 |
| 522 | Ga0207702_10002045 | 3300026078 | Bacteria | 19536 |
| 523 | Ga0207702_10042164 | 3300026078 | Bacteria | 3828 |
| 524 | Ga0207702_10127564 | 3300026078 | Bacteria | 2286 |
| 525 | Ga0207702_10421650 | 3300026078 | Bacteria | 1291 |
| 526 | Ga0207641_10006465 | 3300026088 | Bacteria | 9874 |
| 527 | Ga0207641_10017869 | 3300026088 | Bacteria | 5809 |
| 528 | Ga0207641_10021132 | 3300026088 | Bacteria | 5349 |
| 529 | Ga0207648_10000118 | 3300026089 | Bacteria | 77144 |
| 530 | Ga0207648_10002634 | 3300026089 | Bacteria | 19183 |
| 531 | Ga0207648_10023876 | 3300026089 | Bacteria | 5467 |
| 532 | Ga0207676_10067016 | 3300026095 | Bacteria | 2866 |
| 533 | Ga0207674_10011982 | 3300026116 | Bacteria | 9718 |
| 534 | Ga0207674_10361083 | 3300026116 | Bacteria | 1404 |
| 535 | Ga0207675_100003340 | 3300026118 | Bacteria | 15701 |
| 536 | Ga0207683_10008780 | 3300026121 | Bacteria | 8628 |
| 537 | Ga0207683_10145851 | 3300026121 | Bacteria | 2134 |
| 538 | Ga0207683_10147642 | 3300026121 | Bacteria | 2121 |
| 539 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 540 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 541 | Ga0209389_1009108 | 3300027296 | Bacteria | 8868 |
| 542 | Ga0209371_1002772 | 3300027312 | Bacteria | 9380 |
| 543 | Ga0209968_1013863 | 3300027526 | Bacteria | 1267 |
| 544 | Ga0209970_1000481 | 3300027614 | Bacteria | 6815 |
| 545 | Ga0209282_1019606 | 3300027666 | Bacteria | 4291 |
| 546 | Ga0209971_1004935 | 3300027682 | Bacteria | 3171 |
| 547 | Ga0209974_10000606 | 3300027876 | Bacteria | 12060 |
| 548 | Ga0209974_10027573 | 3300027876 | Bacteria | 1880 |
| 549 | Ga0207428_10078731 | 3300027907 | Bacteria | 2579 |
| 550 | Ga0268265_10010636 | 3300028380 | Bacteria | 6214 |
| 551 | Ga0268265_10012706 | 3300028380 | Bacteria | 5714 |
| 552 | Ga0268265_10017251 | 3300028380 | Bacteria | 4979 |
| 553 | Ga0268264_10001857 | 3300028381 | Bacteria | 19207 |
| 554 | Ga0268264_10005310 | 3300028381 | Bacteria | 10907 |
| 555 | Ga0268264_10044567 | 3300028381 | Bacteria | 3680 |
| 556 | Ga0268264_10234389 | 3300028381 | Bacteria | 1697 |
| 557 | Ga0265336_10000123 | 3300028666 | Bacteria | 57956 |
| 558 | Ga0307517_10010725 | 3300028786 | Bacteria | 12781 |
| 559 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 560 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 561 | Ga0307515_10000433 | 3300028794 | Bacteria | 100295 |
| 562 | Ga0307515_10000529 | 3300028794 | Bacteria | 90388 |
| 563 | Ga0307515_10000708 | 3300028794 | Bacteria | 76903 |
| 564 | Ga0307515_10013631 | 3300028794 | Bacteria | 15155 |
| 565 | Ga0307515_10029938 | 3300028794 | Bacteria | 9173 |
| 566 | Ga0307515_10045432 | 3300028794 | Bacteria | 6749 |
| 567 | Ga0307515_10095097 | 3300028794 | Bacteria | 3672 |
| 568 | Ga0307515_10132505 | 3300028794 | Bacteria | 2734 |
| 569 | Ga0265324_10000849 | 3300029957 | Bacteria | 19632 |
| 570 | Ga0237817_10077 | 3300030083 | Bacteria | 30107 |
| 571 | Ga0237817_10171 | 3300030083 | Bacteria | 18540 |
| 572 | Ga0268256_1004899 | 3300030500 | Bacteria | 5404 |
| 573 | Ga0307512_10103250 | 3300030522 | Bacteria | 1919 |
| 574 | Ga0307512_10104209 | 3300030522 | Bacteria | 1904 |
| 575 | Ga0316177_1007744 | 3300030731 | Bacteria | 3940 |
| 576 | Ga0316178_1003672 | 3300030735 | Bacteria | 3342 |
| 577 | Ga0316180_1085302 | 3300030736 | Bacteria | 4717 |
| 578 | Ga0316182_1158565 | 3300030745 | Bacteria | 7228 |
| 579 | Ga0316182_1235587 | 3300030745 | Bacteria | 2862 |
| 580 | Ga0265330_10000022 | 3300031235 | Bacteria | 154198 |
| 581 | Ga0265330_10033981 | 3300031235 | Bacteria | 2279 |
| 582 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 583 | Ga0265332_10000009 | 3300031238 | Bacteria | 295760 |
| 584 | Ga0265328_10038040 | 3300031239 | Bacteria | 1776 |
| 585 | Ga0265325_10005268 | 3300031241 | Bacteria | 8023 |
| 586 | Ga0265340_10017633 | 3300031247 | Bacteria | 3693 |
| 587 | Ga0265327_10000144 | 3300031251 | Bacteria | 156779 |
| 588 | Ga0265327_10000748 | 3300031251 | Bacteria | 50556 |
| 589 | Ga0265327_10044788 | 3300031251 | Bacteria | 2356 |
| 590 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 591 | Ga0307513_10000015 | 3300031456 | Bacteria | 296183 |
| 592 | Ga0307513_10001902 | 3300031456 | Bacteria | 29673 |
| 593 | Ga0307513_10017436 | 3300031456 | Bacteria | 8610 |
| 594 | Ga0307513_10086145 | 3300031456 | Bacteria | 3222 |
| 595 | Ga0307513_10144504 | 3300031456 | Bacteria | 2299 |
| 596 | Ga0307513_10188330 | 3300031456 | Bacteria | 1918 |
| 597 | Ga0307509_10000234 | 3300031507 | Bacteria | 89398 |
| 598 | Ga0307509_10016663 | 3300031507 | Bacteria | 8493 |
| 599 | Ga0307509_10052970 | 3300031507 | Bacteria | 4330 |
| 600 | Ga0307408_100000038 | 3300031548 | Bacteria | 183170 |
| 601 | Ga0307408_100000186 | 3300031548 | Bacteria | 68520 |
| 602 | Ga0307408_100029978 | 3300031548 | Bacteria | 3775 |
| 603 | Ga0307408_100245641 | 3300031548 | Bacteria | 1473 |
| 604 | Ga0307508_10000169 | 3300031616 | Bacteria | 78769 |
| 605 | Ga0307508_10024742 | 3300031616 | Bacteria | 5448 |
| 606 | Ga0307508_10041698 | 3300031616 | Bacteria | 4118 |
| 607 | Ga0307508_10266202 | 3300031616 | Bacteria | 1308 |
| 608 | Ga0307514_10000593 | 3300031649 | Bacteria | 67957 |
| 609 | Ga0307514_10001826 | 3300031649 | Bacteria | 23651 |
| 610 | Ga0307514_10006926 | 3300031649 | Bacteria | 9810 |
| 611 | Ga0307514_10031222 | 3300031649 | Bacteria | 4273 |
| 612 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 613 | Ga0265314_10015884 | 3300031711 | Bacteria | 5962 |
| 614 | Ga0307516_10000311 | 3300031730 | Bacteria | 63197 |
| 615 | Ga0307516_10000326 | 3300031730 | Bacteria | 61941 |
| 616 | Ga0307516_10000383 | 3300031730 | Bacteria | 57684 |
| 617 | Ga0307516_10005389 | 3300031730 | Bacteria | 15354 |
| 618 | Ga0307516_10022276 | 3300031730 | Bacteria | 6509 |
| 619 | Ga0307516_10048465 | 3300031730 | Bacteria | 4180 |
| 620 | Ga0307516_10078447 | 3300031730 | Bacteria | 3149 |
| 621 | Ga0307516_10127328 | 3300031730 | Bacteria | 2330 |
| 622 | Ga0307405_10017087 | 3300031731 | Bacteria | 3973 |
| 623 | Ga0307405_10029162 | 3300031731 | Bacteria | 3222 |
| 624 | Ga0307405_10039214 | 3300031731 | Bacteria | 2861 |
| 625 | Ga0307413_10003540 | 3300031824 | Bacteria | 6599 |
| 626 | Ga0307406_10000307 | 3300031901 | Bacteria | 28564 |
| 627 | Ga0307406_10002267 | 3300031901 | Bacteria | 10459 |
| 628 | Ga0307406_10025888 | 3300031901 | Bacteria | 3516 |
| 629 | Ga0307412_10039553 | 3300031911 | Bacteria | 3045 |
| 630 | Ga0307412_10191510 | 3300031911 | Bacteria | 1546 |
| 631 | Ga0307412_10300690 | 3300031911 | Bacteria | 1268 |
| 632 | Ga0307409_100004774 | 3300031995 | Bacteria | 7683 |
| 633 | Ga0307409_100303905 | 3300031995 | Bacteria | 1485 |
| 634 | Ga0307416_100021134 | 3300032002 | Bacteria | 4665 |
| 635 | Ga0307416_100078423 | 3300032002 | Bacteria | 2779 |
| 636 | Ga0307416_100110997 | 3300032002 | Bacteria | 2416 |
| 637 | Ga0307416_100164022 | 3300032002 | Bacteria | 2058 |
| 638 | Ga0307414_10015572 | 3300032004 | Bacteria | 4592 |
| 639 | Ga0307414_10042397 | 3300032004 | Bacteria | 3092 |
| 640 | Ga0307414_10304646 | 3300032004 | Bacteria | 1349 |
| 641 | Ga0307411_10000111 | 3300032005 | Bacteria | 25501 |
| 642 | Ga0307415_100024889 | 3300032126 | Bacteria | 3747 |
| 643 | Ga0307510_10022531 | 3300033180 | Bacteria | 7314 |
| 644 | Ga0373939_0000439 | 3300035114 | Bacteria | 10493 |
| 645 | Ga0373962_0037542 | 3300035242 | Bacteria | 1353 |
| 646 | Ga0373931_0000156 | 3300035691 | Bacteria | 29608 |
| 647 | Ga0373931_0004247 | 3300035691 | Bacteria | 6520 |
| 648 | Ga0373931_0007769 | 3300035691 | Bacteria | 5065 |
| 649 | Ga0373931_0013119 | 3300035691 | Bacteria | 4030 |
| 650 | Ga0373927_0144804 | 3300035695 | Bacteria | 1555 |
| 651 | Ga0373937_0477715 | 3300036401 | Bacteria | 1184 |
| 652 | Ga0373925_0017066 | 3300037068 | Bacteria | 5255 |
| 653 | Ga0395899_0023736 | 3300037312 | Bacteria | 4641 |
| 654 | Ga0395899_0188051 | 3300037312 | Bacteria | 1446 |
| 655 | Ga0395900_0040451 | 3300037418 | Bacteria | 4804 |
| 656 | Ga0395900_0087908 | 3300037418 | Bacteria | 3194 |
| 657 | Ga0395900_0112800 | 3300037418 | Bacteria | 2791 |
| 658 | Ga0395898_0020979 | 3300037466 | Bacteria | 6627 |
| 659 | Ga0395898_0031440 | 3300037466 | Bacteria | 5303 |
| 660 | Ga0395905_0003898 | 3300037471 | Bacteria | 15735 |
| 661 | Ga0395905_0004659 | 3300037471 | Bacteria | 14178 |
| 662 | Ga0395905_0008552 | 3300037471 | Bacteria | 10093 |
| 663 | Ga0395905_0012259 | 3300037471 | Bacteria | 8256 |
| 664 | Ga0395905_0016114 | 3300037471 | Bacteria | 7105 |
| 665 | Ga0395905_0046111 | 3300037471 | Bacteria | 4087 |
| 666 | Ga0395905_0063329 | 3300037471 | Bacteria | 3460 |
| 667 | Ga0395905_0065569 | 3300037471 | Bacteria | 3400 |
| 668 | Ga0395905_0082794 | 3300037471 | Bacteria | 3006 |
| 669 | Ga0395905_0146776 | 3300037471 | Bacteria | 2219 |
| 670 | Ga0395905_0576500 | 3300037471 | Bacteria | 1026 |
| 671 | Ga0395901_0026393 | 3300038443 | Bacteria | 5963 |
| 672 | Ga0395901_0050648 | 3300038443 | Bacteria | 4313 |
| 673 | Ga0395901_0055400 | 3300038443 | Bacteria | 4124 |
| 674 | Ga0395901_0057541 | 3300038443 | Bacteria | 4043 |
| 675 | Ga0395901_0152491 | 3300038443 | Bacteria | 2428 |
| 676 | Ga0237819_00068 | 3300038705 | Bacteria | 37484 |
| 677 | Ga0237819_00076 | 3300038705 | Bacteria | 35000 |
| 678 | Ga0436365_1712709 | 3300039437 | Bacteria | 2577 |
| 679 | Ga0436361_0003822 | 3300039447 | Bacteria | 65675 |
| 680 | Ga0436361_0240287 | 3300039447 | Bacteria | 3791 |
| 681 | Ga0436361_0331966 | 3300039447 | Bacteria | 2502 |
| 682 | Ga0436361_0446182 | 3300039447 | Bacteria | 4675 |
| 683 | Ga0436361_0469035 | 3300039447 | Bacteria | 1207 |
| 684 | Ga0436361_0507512 | 3300039447 | Bacteria | 63188 |
| 685 | Ga0436361_0638016 | 3300039447 | Bacteria | 61418 |
| 686 | Ga0436361_0935151 | 3300039447 | Bacteria | 15517 |
| 687 | Ga0436361_1027804 | 3300039447 | Bacteria | 1906 |
| 688 | Ga0436363_1160320 | 3300039450 | Bacteria | 2018 |
| 689 | Ga0439436_0021673 | 3300041404 | Bacteria | 1907 |
| 690 | Ga0439436_0028540 | 3300041404 | Bacteria | 1628 |
| 691 | Ga0451791_0900922 | 3300041451 | Bacteria | 2259 |
| 692 | Ga0451798_0270784 | 3300041458 | Bacteria | 3680 |
| 693 | Ga0439431_0007581 | 3300041997 | Bacteria | 2423 |
| 694 | Ga0439441_010140 | 3300042001 | Bacteria | 1574 |
| 695 | Ga0439442_001748 | 3300042002 | Bacteria | 4255 |
| 696 | Ga0439432_014795 | 3300042006 | Bacteria | 2638 |
| 697 | Ga0439449_0000925 | 3300042007 | Bacteria | 11443 |
| 698 | Ga0439449_0001348 | 3300042007 | Bacteria | 9624 |
| 699 | Ga0439449_0005886 | 3300042007 | Bacteria | 4684 |
| 700 | Ga0439449_0010084 | 3300042007 | Bacteria | 3574 |
| 701 | Ga0439455_0002074 | 3300042012 | Bacteria | 3563 |
| 702 | Ga0439462_0001961 | 3300042015 | Bacteria | 4706 |
| 703 | Ga0450911_000262 | 3300042115 | Bacteria | 19706 |
| 704 | Ga0450917_000106 | 3300042120 | Bacteria | 5139 |
| 705 | Ga0450919_001427 | 3300042121 | Bacteria | 3113 |
| 706 | Ga0450923_031413 | 3300042125 | Bacteria | 1084 |
| 707 | Ga0450891_000348 | 3300042129 | Bacteria | 4794 |
| 708 | Ga0450892_001061 | 3300042130 | Bacteria | 2880 |
| 709 | Ga0450889_000227 | 3300042144 | Bacteria | 6253 |
| 710 | Ga0439446_0011662 | 3300042156 | Bacteria | 2390 |
| 711 | Ga0439434_0012501 | 3300042435 | Bacteria | 2512 |
| 712 | Ga0439464_0016046 | 3300042439 | Bacteria | 2024 |
| 713 | Ga0450918_000085 | 3300042531 | Bacteria | 19659 |
| 714 | Ga0450918_000183 | 3300042531 | Bacteria | 13907 |
| 715 | Ga0451577_0002278 | 3300042876 | Bacteria | 23215 |
| 716 | Ga0451577_0006522 | 3300042876 | Bacteria | 11616 |
| 717 | Ga0451577_0045705 | 3300042876 | Bacteria | 3919 |
| 718 | Ga0451577_0079617 | 3300042876 | Bacteria | 2921 |
| 719 | Ga0466969_0003908 | 3300044656 | Bacteria | 7913 |
| 720 | Ga0453683_0002100 | 3300044673 | Bacteria | 15910 |
| 721 | Ga0453683_0180145 | 3300044673 | Bacteria | 1340 |
| 722 | Ga0466965_0002600 | 3300044683 | Bacteria | 7723 |
| 723 | Ga0466965_0011676 | 3300044683 | Bacteria | 4119 |
| 724 | Ga0466966_0008842 | 3300044684 | Bacteria | 6669 |
| 725 | Ga0466966_0027763 | 3300044684 | Bacteria | 3690 |
| 726 | Ga0466961_0060306 | 3300044693 | Bacteria | 2412 |
| 727 | Ga0466961_0062041 | 3300044693 | Bacteria | 2375 |
| 728 | Ga0466961_0069966 | 3300044693 | Bacteria | 2227 |
| 729 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 730 | Ga0453684_0009747 | 3300044712 | Bacteria | 16684 |
| 731 | Ga0453684_0018443 | 3300044712 | Bacteria | 10709 |
| 732 | Ga0466971_0026420 | 3300044719 | Bacteria | 2594 |
| 733 | Ga0466968_0029370 | 3300044735 | Bacteria | 2274 |
| 734 | Ga0466959_0002246 | 3300045049 | Bacteria | 12307 |
| 735 | Ga0466959_0058698 | 3300045049 | Bacteria | 2802 |
| 736 | Ga0466959_0133495 | 3300045049 | Bacteria | 1758 |
| 737 | Ga0466959_0170150 | 3300045049 | Bacteria | 1528 |
| 738 | Ga0451576_0004978 | 3300045051 | Bacteria | 16906 |
| 739 | Ga0451576_0015978 | 3300045051 | Bacteria | 8298 |
| 740 | Ga0451576_0065737 | 3300045051 | Bacteria | 3775 |
| 741 | Ga0451576_0293504 | 3300045051 | Bacteria | 1700 |
| 742 | Ga0466958_0097388 | 3300045836 | Bacteria | 1825 |
| 743 | Ga0466967_0000067 | 3300045976 | Bacteria | 38325 |
| 744 | Ga0495592_0000291 | 3300046454 | Bacteria | 42990 |
| 745 | Ga0495590_0002435 | 3300046457 | Bacteria | 7714 |
| 746 | Ga0495629_0119852 | 3300046459 | Bacteria | 1833 |
| 747 | Ga0495638_0072584 | 3300046460 | Bacteria | 2103 |
| 748 | Ga0495651_0153508 | 3300046462 | Bacteria | 1657 |
| 749 | Ga0495650_0043026 | 3300046471 | Bacteria | 1920 |
| 750 | Ga0495580_0099984 | 3300046472 | Bacteria | 2018 |
| 751 | Ga0495639_0031741 | 3300046475 | Bacteria | 2353 |
| 752 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 753 | Ga0495606_0009260 | 3300046507 | Bacteria | 8360 |
| 754 | Ga0495610_0027537 | 3300046512 | Bacteria | 3019 |
| 755 | Ga0495610_0103140 | 3300046512 | Bacteria | 1274 |
| 756 | Ga0495620_0068347 | 3300046515 | Bacteria | 1459 |
| 757 | Ga0495630_0173022 | 3300046517 | Bacteria | 1646 |
| 758 | Ga0495632_0003074 | 3300046519 | Bacteria | 12127 |
| 759 | Ga0495632_0025431 | 3300046519 | Bacteria | 3131 |
| 760 | Ga0495637_0004233 | 3300046520 | Bacteria | 7455 |
| 761 | Ga0495663_0055994 | 3300046525 | Bacteria | 1231 |
| 762 | Ga0495598_0061989 | 3300046537 | Bacteria | 1156 |
| 763 | Ga0495609_0038685 | 3300046538 | Bacteria | 2150 |
| 764 | Ga0495597_0000505 | 3300046542 | Bacteria | 32423 |
| 765 | Ga0495597_0008931 | 3300046542 | Bacteria | 4998 |
| 766 | Ga0495656_0000062 | 3300046615 | Bacteria | 49355 |
| 767 | Ga0495668_0016624 | 3300046616 | Bacteria | 4277 |
| 768 | Ga0495668_0094149 | 3300046616 | Bacteria | 1640 |
| 769 | Ga0495625_0000998 | 3300046660 | Bacteria | 37496 |
| 770 | Ga0495625_0003113 | 3300046660 | Bacteria | 16952 |
| 771 | Ga0495625_0027051 | 3300046660 | Bacteria | 4324 |
| 772 | Ga0495625_0089803 | 3300046660 | Bacteria | 2126 |
| 773 | Ga0495635_0065940 | 3300046663 | Bacteria | 2484 |
| 774 | Ga0495658_0034450 | 3300046683 | Bacteria | 2779 |
| 775 | Ga0495658_0043279 | 3300046683 | Bacteria | 2518 |
| 776 | Ga0495624_0158906 | 3300046690 | Bacteria | 1381 |
| 777 | Ga0495649_0000638 | 3300046694 | Bacteria | 28526 |
| 778 | Ga0495649_0001852 | 3300046694 | Bacteria | 15512 |
| 779 | Ga0495649_0007371 | 3300046694 | Bacteria | 6721 |
| 780 | Ga0495589_0002430 | 3300046794 | Bacteria | 10474 |
| 781 | Ga0495589_0018491 | 3300046794 | Bacteria | 3572 |
| 782 | Ga0495660_0075984 | 3300046810 | Bacteria | 1771 |
| 783 | Ga0495674_0238342 | 3300047319 | Bacteria | 1500 |
| 784 | Ga0495680_0102073 | 3300047322 | Bacteria | 2136 |
| 785 | Ga0495687_000367 | 3300047443 | Bacteria | 56387 |
| 786 | Ga0495687_007870 | 3300047443 | Bacteria | 6198 |
| 787 | Ga0495673_0087986 | 3300047469 | Bacteria | 1274 |
| 788 | Ga0495684_0011547 | 3300047471 | Bacteria | 6824 |
| 789 | Ga0495686_0006531 | 3300047472 | Bacteria | 8906 |
| 790 | Ga0496104_0134566 | 3300048907 | Bacteria | 2375 |
| 791 | Ga0496105_0046621 | 3300048908 | Bacteria | 3577 |
| 792 | Ga0496105_0117351 | 3300048908 | Bacteria | 2195 |
| 793 | Ga0496106_0061723 | 3300048909 | Bacteria | 2844 |
| 794 | Ga0496107_0022810 | 3300048910 | Bacteria | 4425 |
| 795 | Ga0496108_0187447 | 3300048911 | Bacteria | 1792 |
| 796 | Ga0496109_0082637 | 3300048912 | Bacteria | 2961 |
| 797 | Ga0496110_0188033 | 3300048913 | Bacteria | 1875 |
| 798 | Ga0496112_0151630 | 3300048915 | Bacteria | 2285 |
| 799 | Ga0496114_0068362 | 3300048917 | Bacteria | 2982 |
| 800 | Ga0496114_0361889 | 3300048917 | Bacteria | 1283 |
| 801 | Ga0496115_0185612 | 3300048918 | Bacteria | 1718 |
| 802 | Ga0496115_0429278 | 3300048918 | Bacteria | 1070 |
| 803 | Ga0496117_0003732 | 3300048920 | Bacteria | 17455 |
| 804 | Ga0496118_0021517 | 3300048921 | Bacteria | 5671 |
| 805 | Ga0496122_0000380 | 3300048925 | Bacteria | 95108 |
| 806 | Ga0496122_0086393 | 3300048925 | Bacteria | 2159 |
| 807 | Ga0496123_0000246 | 3300048926 | Bacteria | 109397 |
| 808 | Ga0496123_0011348 | 3300048926 | Bacteria | 7736 |
| 809 | Ga0496123_0044550 | 3300048926 | Bacteria | 3033 |
| 810 | Ga0496124_0000138 | 3300048927 | Bacteria | 150311 |
| 811 | Ga0496124_0020305 | 3300048927 | Bacteria | 6145 |
| 812 | Ga0496124_0039963 | 3300048927 | Bacteria | 4061 |
| 813 | Ga0496124_0154881 | 3300048927 | Bacteria | 1793 |
| 814 | Ga0496125_0001645 | 3300048928 | Bacteria | 31482 |
| 815 | Ga0496125_0018151 | 3300048928 | Bacteria | 6686 |
| 816 | Ga0496126_0143507 | 3300048929 | Bacteria | 2053 |
| 817 | Ga0501343_003091 | 3300049132 | Bacteria | 1214 |
| 818 | Ga0501344_01832 | 3300049133 | Bacteria | 1059 |
| 819 | Ga0501294_003760 | 3300049517 | Bacteria | 1430 |
| 820 | Ga0501300_011242 | 3300049523 | Bacteria | 1305 |
| 821 | Ga0501312_008199 | 3300049528 | Bacteria | 1352 |
| 822 | Ga0501316_005454 | 3300049532 | Bacteria | 1319 |
| 823 | Ga0501317_011273 | 3300049533 | Bacteria | 1083 |
| 824 | Ga0501318_010120 | 3300049534 | Bacteria | 1040 |
| 825 | Ga0501321_004707 | 3300049537 | Bacteria | 1317 |
| 826 | Ga0501338_01197 | 3300049554 | Bacteria | 1348 |
| 827 | Ga0501034_0058032 | 3300049571 | Bacteria | 3891 |
| 828 | Ga0501037_0356116 | 3300049573 | Bacteria | 1009 |
| 829 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 830 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 831 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 832 | Ga0501048_0000759 | 3300049582 | Bacteria | 23664 |
| 833 | Ga0501198_000014 | 3300049649 | Bacteria | 106940 |
| 834 | Ga0501217_004514 | 3300049661 | Bacteria | 2865 |
| 835 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 836 | Ga0501222_002240 | 3300049662 | Bacteria | 2688 |
| 837 | Ga0501223_005225 | 3300049663 | Bacteria | 2738 |
| 838 | Ga0501235_013287 | 3300049669 | Bacteria | 1812 |
| 839 | Ga0501249_017024 | 3300049679 | Bacteria | 1564 |
| 840 | Ga0501253_002078 | 3300049683 | Bacteria | 2197 |
| 841 | Ga0501253_013029 | 3300049683 | Bacteria | 1316 |
| 842 | Ga0501255_000446 | 3300049684 | Bacteria | 2811 |
| 843 | Ga0501257_019542 | 3300049686 | Bacteria | 1586 |
| 844 | Ga0501265_000456 | 3300049762 | Bacteria | 4293 |
| 845 | Ga0501267_000947 | 3300049764 | Bacteria | 2380 |
| 846 | Ga0501272_001263 | 3300049769 | Bacteria | 2372 |
| 847 | Ga0501045_0001582 | 3300049824 | Bacteria | 15181 |
| 848 | nmdc:mga03683_8121_c1 | 3300050489 | Bacteria | 3675 |
| 849 | nmdc:mga00v17_64477_c1 | 3300050491 | Bacteria | 2257 |
| 850 | nmdc:mga0k408_14769_c1 | 3300050493 | Bacteria | 4309 |
| 851 | nmdc:mga0k408_1821_c2 | 3300050493 | Bacteria | 10187 |
| 852 | nmdc:mga0k408_187430_c1 | 3300050493 | Bacteria | 1234 |
| 853 | nmdc:mga0k408_21697_c1 | 3300050493 | Bacteria | 3610 |
| 854 | nmdc:mga0k408_3379_c1 | 3300050493 | Bacteria | 8454 |
| 855 | nmdc:mga0k408_34983_c1 | 3300050493 | Bacteria | 2878 |
| 856 | nmdc:mga0k408_35627_c1 | 3300050493 | Bacteria | 2854 |
| 857 | nmdc:mga0k408_4347_c1 | 3300050493 | Bacteria | 7526 |
| 858 | nmdc:mga0k408_67800_c1 | 3300050493 | Bacteria | 2080 |
| 859 | nmdc:mga0k408_76795_c1 | 3300050493 | Bacteria | 1953 |
| 860 | nmdc:mga06z11_155115_c1 | 3300050494 | Bacteria | 1305 |
| 861 | nmdc:mga07m45_15316_c1 | 3300050496 | Bacteria | 4094 |
| 862 | nmdc:mga07m45_22441_c1 | 3300050496 | Bacteria | 3446 |
| 863 | nmdc:mga07m45_26121_c1 | 3300050496 | Bacteria | 3208 |
| 864 | nmdc:mga07m45_48037_c1 | 3300050496 | Bacteria | 2400 |
| 865 | nmdc:mga07m45_57_c1 | 3300050496 | Bacteria | 46544 |
| 866 | nmdc:mga07m45_6260_c1 | 3300050496 | Bacteria | 6009 |
| 867 | nmdc:mga07m45_6359_c1 | 3300050496 | Bacteria | 5965 |
| 868 | nmdc:mga07m45_99158_c1 | 3300050496 | Bacteria | 1461 |
| 869 | nmdc:mga07m45_99304_c1 | 3300050496 | Bacteria | 1671 |
| 870 | nmdc:mga05p37_226266_c1 | 3300050507 | Bacteria | 2255 |
| 871 | nmdc:mga09592_5629_c1 | 3300050508 | Bacteria | 10213 |
| 872 | nmdc:mga08y16_510299_c1 | 3300050511 | Bacteria | 1220 |
| 873 | Ga0500610_0001796 | 3300053079 | Bacteria | 7554 |
| 874 | Ga0500610_0003563 | 3300053079 | Bacteria | 6009 |
| 875 | Ga0500635_0000005 | 3300053080 | Bacteria | 187821 |
| 876 | Ga0495619_0053229 | 3300053085 | Bacteria | 2677 |
| 877 | Ga0500578_0000058 | 3300053086 | Bacteria | 119650 |
| 878 | Ga0500578_0130402 | 3300053086 | Bacteria | 1577 |
| 879 | Ga0500651_0000107 | 3300053093 | Bacteria | 50947 |
| 880 | Ga0500651_0067151 | 3300053093 | Bacteria | 2233 |
| 881 | Ga0500651_0083100 | 3300053093 | Bacteria | 1982 |
| 882 | Ga0500566_0000013 | 3300053094 | Bacteria | 115589 |
| 883 | Ga0500652_000154 | 3300053131 | Bacteria | 26336 |
| 884 | Ga0500658_0000254 | 3300053134 | Bacteria | 24883 |
| 885 | Ga0500658_0000909 | 3300053134 | Bacteria | 12117 |
| 886 | Ga0500658_0021924 | 3300053134 | Bacteria | 2423 |
| 887 | Ga0500559_0000119 | 3300053136 | Bacteria | 62358 |
| 888 | Ga0500622_0000221 | 3300053156 | Bacteria | 59833 |
| 889 | Ga0500622_0002018 | 3300053156 | Bacteria | 15157 |
| 890 | Ga0500636_0087652 | 3300053177 | Bacteria | 1786 |
| 891 | Ga0500637_0003057 | 3300053178 | Bacteria | 7615 |
| 892 | Ga0500637_0006670 | 3300053178 | Bacteria | 5710 |
| 893 | Ga0500645_002285 | 3300053730 | Bacteria | 8694 |
| 894 | Ga0466962_0008472 | 3300061719 | Bacteria | 4927 |
| 895 | 2511243922 | 2511231002 | Bacteria | 5042903 |
| 896 | 2511700921 | 2511231119 | Bacteria | 4019861 |
| 897 | 2513228176 | 2513020051 | Bacteria | 6053213 |
| 898 | 2540608120 | 2540341094 | Bacteria | 4061186 |
| 899 | 2545559116 | 2545555800 | Bacteria | 4222588 |
| 900 | 2548499845 | 2547132374 | Bacteria | 5530232 |
| 901 | 2553394226 | 2551306519 | Bacteria | 5465154 |
| 902 | 2563930300 | 2563366752 | Bacteria | 4961801 |
| 903 | 2578933570 | 2576861599 | Bacteria | 4217202 |
| 904 | 2587728870 | 2585428057 | Bacteria | 6737412 |
| 905 | 2587736470 | 2585428058 | Bacteria | 6853932 |
| 906 | 2587756106 | 2585428062 | Bacteria | 6842168 |
| 907 | 2588294653 | 2588253510 | Bacteria | 6901809 |
| 908 | 2599626965 | 2599185214 | Bacteria | 8209958 |
| 909 | 2599676211 | 2599185226 | Bacteria | 8233575 |
| 910 | 2599684523 | 2599185227 | Bacteria | 8246414 |
| 911 | 2599696516 | 2599185229 | Bacteria | 8216126 |
| 912 | 2600401012 | 2600254943 | Bacteria | 2613887 |
| 913 | 2631985224 | 2630968484 | Bacteria | 3876276 |
| 914 | 2643745683 | 2643221544 | Bacteria | 5886209 |
| 915 | 2643868086 | 2643221570 | Bacteria | 5103772 |
| 916 | 2643936750 | 2643221585 | Bacteria | 5812563 |
| 917 | 2643970519 | 2643221592 | Bacteria | 6608788 |
| 918 | 2643993917 | 2643221596 | Bacteria | 5006805 |
| 919 | 2644059650 | 2643221609 | Bacteria | 6756331 |
| 920 | 2644074791 | 2643221611 | Bacteria | 6820941 |
| 921 | 2644142744 | 2643221625 | Bacteria | 6512927 |
| 922 | 2644160471 | 2643221628 | Bacteria | 5745828 |
| 923 | 2644221576 | 2643221639 | Bacteria | 6649903 |
| 924 | 2644248431 | 2643221644 | Bacteria | 6865017 |
| 925 | 2644257659 | 2643221646 | Bacteria | 6433402 |
| 926 | 2644272695 | 2643221648 | Bacteria | 6521465 |
| 927 | 2644293697 | 2643221652 | Bacteria | 5140275 |
| 928 | 2644303954 | 2643221654 | Bacteria | 5273570 |
| 929 | 2644318649 | 2643221656 | Bacteria | 5809961 |
| 930 | 2644324696 | 2643221658 | Bacteria | 6064537 |
| 931 | 2644396559 | 2643221672 | Bacteria | 6322190 |
| 932 | 2644465513 | 2643221683 | Bacteria | 5749203 |
| 933 | 2644644829 | 2643221717 | Bacteria | 5676132 |
| 934 | 2644723242 | 2643221732 | Bacteria | 5756404 |
| 935 | 2651530541 | 2648501850 | Bacteria | 3975476 |
| 936 | 2672337456 | 2671180330 | Bacteria | 5521719 |
| 937 | 2674422145 | 2671180844 | Bacteria | 4164150 |
| 938 | 2685153409 | 2684622632 | Bacteria | 5380049 |
| 939 | 2695628882 | 2695420354 | Bacteria | 3922431 |
| 940 | 2698319777 | 2695420987 | Bacteria | 6152737 |
| 941 | 2705997329 | 2703719227 | Bacteria | 5631989 |
| 942 | 2717915432 | 2716884898 | Bacteria | 3928789 |
| 943 | 2721508569 | 2718218445 | Bacteria | 5113413 |
| 944 | 2722882140 | 2721755523 | Bacteria | 6430384 |
| 945 | 2738718940 | 2738541277 | Bacteria | 7458140 |
| 946 | 2738816944 | 2738541295 | Bacteria | 5730091 |
| 947 | 2738879981 | 2738541307 | Bacteria | 8606193 |
| 948 | 2739160010 | 2738541358 | Bacteria | 5932299 |
| 949 | 2739212576 | 2738543006 | Bacteria | 5904091 |
| 950 | 2739241180 | 2738543012 | Bacteria | 7115078 |
| 951 | 2739250021 | 2738543013 | Bacteria | 5618633 |
| 952 | 2739281702 | 2738543019 | Bacteria | 7459457 |
| 953 | 2791215963 | 2788500588 | Bacteria | 4584915 |
| 954 | 2808868800 | 2808606364 | Bacteria | 4465927 |
| 955 | 2809053250 | 2808606399 | Bacteria | 4021018 |
| 956 | 2816473343 | 2816332133 | Bacteria | 7249298 |
| 957 | 2816862133 | 2816332186 | Bacteria | 5331395 |
| 958 | 2817479335 | 2816332295 | Bacteria | 4352468 |
| 959 | 2819568927 | 2818991441 | Bacteria | 5062707 |
| 960 | 2819599416 | 2818991446 | Bacteria | 7757362 |
| 961 | 2819627632 | 2818991451 | Bacteria | 4697364 |
| 962 | 2831271367 | 2831265667 | Bacteria | 7184833 |
| 963 | 2831869504 | 2831864461 | Bacteria | 6502356 |
| 964 | 2838055904 | 2838054893 | Bacteria | 7451788 |
| 965 | 2839142655 | 2839138175 | Bacteria | 6549354 |
| 966 | 2842678098 | 2842677519 | Bacteria | 5615038 |
| 967 | 2842684956 | 2842682962 | Bacteria | 5589973 |
| 968 | 2842721436 | 2842718218 | Bacteria | 4560148 |
| 969 | 2842734437 | 2842733646 | Bacteria | 5716726 |
| 970 | 2842749323 | 2842747753 | Bacteria | 5578255 |
| 971 | 2849141515 | 2849139964 | Bacteria | 5613304 |
| 972 | 2857584047 | 2857581216 | Bacteria | 5522813 |
| 973 | 2860840911 | 2860837431 | Bacteria | 4202080 |
| 974 | 2877771804 | 2877768649 | Bacteria | 3957164 |
| 975 | 2880172646 | 2880169592 | Bacteria | 3900066 |
| 976 | 2881105239 | 2881101125 | Bacteria | 4590519 |
| 977 | 2885197982 | 2885192300 | Bacteria | 5882526 |
| 978 | 2885200550 | 2885198086 | Bacteria | 7212419 |
| 979 | 2885214667 | 2885211737 | Bacteria | 7212420 |
| 980 | 2886853245 | 2886848708 | Bacteria | 5632523 |
| 981 | 2894024158 | 2894023352 | Bacteria | 5167372 |
| 982 | 2897112918 | 2897109615 | Bacteria | 4009619 |
| 983 | 2899925844 | 2899924645 | Bacteria | 7487985 |
| 984 | 2904450382 | 2904449895 | Bacteria | 6927402 |
| 985 | 2904456795 | 2904456579 | Bacteria | 6819253 |
| 986 | 2904480203 | 2904479285 | Bacteria | 5073931 |
| 987 | 2904544352 | 2904541872 | Bacteria | 8915136 |
| 988 | 2904563790 | 2904560550 | Bacteria | 4029838 |
| 989 | 2904610046 | 2904606771 | Bacteria | 4684500 |
| 990 | 2916973087 | 2916971899 | Bacteria | 4250608 |
| 991 | 2919415937 | 2919414237 | Bacteria | 5429133 |
| 992 | 2919463184 | 2919462493 | Bacteria | 5817112 |
| 993 | 2919704343 | 2919704043 | Bacteria | 5560311 |
| 994 | 2928041768 | 2928037797 | Bacteria | 7273642 |
| 995 | 2928049332 | 2928044640 | Bacteria | 7271509 |
| 996 | 2928052060 | 2928051484 | Bacteria | 7773759 |
| 997 | 2928065260 | 2928064002 | Bacteria | 7419480 |
| 998 | 2928076585 | 2928070936 | Bacteria | 8062541 |
| 999 | 2928089292 | 2928084124 | Bacteria | 7159212 |
| 1000 | 2928119143 | 2928115317 | Bacteria | 6477646 |
| 1001 | 2928512418 | 2928510474 | Bacteria | 4815308 |
| 1002 | 2929004344 | 2929004312 | Bacteria | 5678476 |
| 1003 | 2929162077 | 2929160207 | Bacteria | 9075316 |
| 1004 | 2929239121 | 2929233124 | Bacteria | 5948380 |
| 1005 | 2929521095 | 2929520902 | Bacteria | 6765052 |
| 1006 | 2932423780 | 2932422444 | Bacteria | 4678430 |
| 1007 | 2936362864 | 2936361878 | Bacteria | 5632809 |
| 1008 | 2939596222 | 2939593269 | Bacteria | 4798695 |
| 1009 | 2939633011 | 2939631187 | Bacteria | 6118131 |
| 1010 | 2945913519 | 2945909444 | Bacteria | 7065066 |
| 1011 | 2945949114 | 2945945610 | Bacteria | 5951079 |
| 1012 | 2945973159 | 2945972063 | Bacteria | 6086495 |
| 1013 | 2945991089 | 2945984333 | Bacteria | 7358892 |
| 1014 | 2947432215 | 2947426588 | Bacteria | 5357194 |
| 1015 | 2954768476 | 2954767861 | Bacteria | 5535784 |
| 1016 | 2956898783 | 2956897341 | Bacteria | 5447711 |
| 1017 | 2960376271 | 2960375949 | Bacteria | 5361395 |
| 1018 | 2962294138 | 2962290636 | Bacteria | 4072939 |
| 1019 | 2964380129 | 2964375228 | Bacteria | 4909004 |
| 1020 | 2965766743 | 2965761152 | Bacteria | 5806513 |
| 1021 | 2969140119 | 2969136845 | Bacteria | 3923176 |
| 1022 | 2969144358 | 2969141011 | Bacteria | 4118468 |
| 1023 | 2969769121 | 2969765954 | Bacteria | 4216713 |
| 1024 | 2969771435 | 2969770375 | Bacteria | 4271280 |
| 1025 | 2971896470 | 2971893375 | Bacteria | 3929648 |
| 1026 | 2974322481 | 2974320154 | Bacteria | 4571377 |
| 1027 | 2979089105 | 2979083700 | Bacteria | 5894929 |
| 1028 | 2980495906 | 2980492589 | Bacteria | 4072961 |
| 1029 | 2990713554 | 2990710928 | Bacteria | 5002431 |
| 1030 | 3001896471 | 3001892409 | Bacteria | 6328293 |
| 1031 | 3006859660 | 3006858327 | Bacteria | 4317835 |
| 1032 | 3006882631 | 3006879489 | Bacteria | 4064221 |
| 1033 | 3006979790 | 3006978542 | Bacteria | 5328100 |
| 1034 | 8007371348 | 8007371054 | Bacteria | 4849201 |
| 1035 | 8007377494 | 8007375930 | Bacteria | 4080554 |
| 1036 | 8022626946 | 8022621104 | Bacteria | 5241040 |
| 1037 | 8022633069 | 8022630665 | Bacteria | 3886130 |
| 1038 | 8022655786 | 8022653035 | Bacteria | 4035078 |
| 1039 | 8022949168 | 8022948649 | Bacteria | 5366783 |
| 1040 | 8023441595 | 8023438354 | Bacteria | 5779374 |
| 1041 | 8051954577 | 8051952484 | Bacteria | 3926774 |
| 1042 | 8052175336 | 8052174270 | Bacteria | 3881265 |
| 1043 | 8055537187 | 8055531788 | Bacteria | 5249694 |
| 1044 | 8057587864 | 8057582654 | Bacteria | 5218944 |
| 1045 | 8057634925 | 8057632132 | Bacteria | 4726859 |
| 1046 | Ga0105237_10350880 | |||
| 1047 | SwRhRL2b_contig_1580065 | |||
| 1048 | JGI25156J39149_1000006 | |||
| 1049 | JGI25156J39149_1000459 | |||
| 1050 | JGI25154J39366_1000015 | |||
| 1051 | JGI25154J39366_1002018 | |||
| 1052 | JGI25157J39369_1000021 | |||
| 1053 | JGI25157J39369_1000111 | |||
| 1054 | JGI25152J39213_1007497 | |||
| 1055 | JGI25159J45721_1001980 | |||
| 1056 | JGI25159J45721_1011608 | |||
| 1057 | JGI25159J45721_1016473 | |||
| 1058 | JGI25151J46595_10001205 | |||
| 1059 | JGI25151J46595_10001210 | |||
| 1060 | JGI25151J46595_10002472 | |||
| 1061 | JGI25151J46595_10002973 | |||
| 1062 | JGI25151J46595_10005635 | |||
| 1063 | JGI25151J46595_10014177 | |||
| 1064 | JGI25153J46596_10001901 | |||
| 1065 | JGI25153J46596_10011385 | |||
| 1066 | JGI25153J46596_10012295 | |||
| 1067 | rootH1_10001155 | |||
| 1068 | JGI25160J50197_1000045 | |||
| 1069 | JGI25161J50226_1000008 | |||
| 1070 | Ga0006562J51391_1119627 | |||
| 1071 | Ga0055538_1000081 | |||
| 1072 | Ga0055533_1000033 | |||
| 1073 | Ga0055525_1000011 | |||
| 1074 | Ga0055525_1001213 | |||
| 1075 | Ga0055535_1000076 | |||
| 1076 | Ga0055535_1001037 | |||
| 1077 | Ga0055542_1000009 | |||
| 1078 | Ga0055529_1000860 | |||
| 1079 | Ga0055526_1001951 | |||
| 1080 | Ga0055526_1002081 | |||
| 1081 | Ga0055526_1006798 | |||
| 1082 | Ga0055526_1006804 | |||
| 1083 | Ga0055537_1000011 | |||
| 1084 | Ga0055537_1000182 | |||
| 1085 | Ga0055537_1006595 | |||
| 1086 | Ga0055537_1014005 | |||
| 1087 | Ga0055524_1000126 | |||
| 1088 | Ga0055524_1000679 | |||
| 1089 | Ga0055536_1001326 | |||
| 1090 | Ga0055534_1000020 | |||
| 1091 | Ga0055534_1000333 | |||
| 1092 | Ga0055534_1001522 | |||
| 1093 | Ga0055534_1002053 | |||
| 1094 | Ga0055528_1000349 | |||
| 1095 | Ga0055528_1000606 | |||
| 1096 | Ga0055528_1029631 | |||
| 1097 | Ga0055530_10000302 | |||
| 1098 | Ga0055530_10002526 | |||
| 1099 | Ga0055530_10023526 | |||
| 1100 | Ga0055540_1000015 | |||
| 1101 | Ga0055540_1000021 | |||
| 1102 | Ga0055540_1004986 | |||
| 1103 | Ga0055531_10000214 | |||
| 1104 | Ga0055531_10000806 | |||
| 1105 | Ga0055531_10001001 | |||
| 1106 | Ga0055531_10005410 | |||
| 1107 | Ga0055531_10014723 | |||
| 1108 | Ga0055543_1003659 | |||
| 1109 | Ga0065165_1000024 | |||
| 1110 | Ga0065165_1000401 | |||
| 1111 | Ga0065165_1002995 | |||
| 1112 | Ga0065714_10006124 | |||
| 1113 | Ga0065704_10091410 | |||
| 1114 | Ga0065707_10094865 | |||
| 1115 | Ga0070658_10067093 | |||
| 1116 | Ga0070658_10198158 | |||
| 1117 | Ga0070676_10028928 | |||
| 1118 | Ga0070683_100132995 | |||
| 1119 | Ga0070683_100222390 | |||
| 1120 | Ga0070690_100000001 | |||
| 1121 | Ga0070690_100239269 | |||
| 1122 | Ga0070670_100000817 | |||
| 1123 | Ga0070670_100008148 | |||
| 1124 | Ga0070670_100191077 | |||
| 1125 | Ga0068869_100001842 | |||
| 1126 | Ga0068869_100040874 | |||
| 1127 | Ga0068869_100065284 | |||
| 1128 | Ga0068869_100169308 | |||
| 1129 | Ga0070666_10000960 | |||
| 1130 | Ga0070666_10027413 | |||
| 1131 | Ga0070666_10043775 | |||
| 1132 | Ga0070666_10170599 | |||
| 1133 | Ga0068868_100146116 | |||
| 1134 | Ga0068868_100235894 | |||
| 1135 | Ga0070660_100039575 | |||
| 1136 | Ga0070660_100211467 | |||
| 1137 | Ga0070689_100057022 | |||
| 1138 | Ga0070661_100000841 | |||
| 1139 | Ga0070661_100014722 | |||
| 1140 | Ga0070661_100031906 | |||
| 1141 | Ga0070669_100001800 | |||
| 1142 | Ga0070669_100079404 | |||
| 1143 | Ga0070669_100102649 | |||
| 1144 | Ga0070675_100003281 | |||
| 1145 | Ga0070675_100039314 | |||
| 1146 | Ga0070675_100152123 | |||
| 1147 | Ga0070671_100009321 | |||
| 1148 | Ga0070671_100030602 | |||
| 1149 | Ga0070671_100052804 | |||
| 1150 | Ga0070671_100056286 | |||
| 1151 | Ga0070674_100031822 | |||
| 1152 | Ga0070673_100001009 | |||
| 1153 | Ga0070673_100015685 | |||
| 1154 | Ga0070673_100243891 | |||
| 1155 | Ga0070659_100048151 | |||
| 1156 | Ga0070667_100004040 | |||
| 1157 | Ga0070667_100096269 | |||
| 1158 | Ga0070701_10225999 | |||
| 1159 | Ga0070700_100016951 | |||
| 1160 | Ga0070700_100180279 | |||
| 1161 | Ga0070663_100016943 | |||
| 1162 | Ga0070678_100076096 | |||
| 1163 | Ga0070678_100109989 | |||
| 1164 | Ga0070678_100141178 | |||
| 1165 | Ga0070662_100014126 | |||
| 1166 | Ga0070662_100022340 | |||
| 1167 | Ga0070662_100120722 | |||
| 1168 | Ga0070662_100212838 | |||
| 1169 | Ga0068867_100000042 | |||
| 1170 | Ga0068867_100002918 | |||
| 1171 | Ga0068867_100011005 | |||
| 1172 | Ga0070679_100013117 | |||
| 1173 | Ga0070679_100100557 | |||
| 1174 | Ga0068853_100045063 | |||
| 1175 | Ga0068853_100130668 | |||
| 1176 | Ga0068853_100240939 | |||
| 1177 | Ga0070672_100040398 | |||
| 1178 | Ga0070693_100022693 | |||
| 1179 | Ga0070665_100077997 | |||
| 1180 | Ga0068855_100019714 | |||
| 1181 | Ga0068855_100215341 | |||
| 1182 | Ga0070664_100004757 | |||
| 1183 | Ga0070664_100021332 | |||
| 1184 | Ga0070664_100048175 | |||
| 1185 | Ga0068857_100005113 | |||
| 1186 | Ga0068857_100027288 | |||
| 1187 | Ga0068857_100160194 | |||
| 1188 | Ga0068856_100000887 | |||
| 1189 | Ga0068856_100040639 | |||
| 1190 | Ga0068852_100048105 | |||
| 1191 | Ga0068852_100409994 | |||
| 1192 | Ga0068859_100060433 | |||
| 1193 | Ga0068859_100410178 | |||
| 1194 | Ga0068864_100077885 | |||
| 1195 | Ga0068866_10004706 | |||
| 1196 | Ga0068866_10006851 | |||
| 1197 | Ga0068861_100034068 | |||
| 1198 | Ga0068861_100055999 | |||
| 1199 | Ga0068861_100126537 | |||
| 1200 | Ga0068851_10010700 | |||
| 1201 | Ga0068851_10015161 | |||
| 1202 | Ga0068863_100003799 | |||
| 1203 | Ga0068863_100005986 | |||
| 1204 | Ga0068863_100024555 | |||
| 1205 | Ga0068863_100047981 | |||
| 1206 | Ga0068863_100192258 | |||
| 1207 | Ga0068858_100002240 | |||
| 1208 | Ga0068858_100080940 | |||
| 1209 | Ga0068860_100000445 | |||
| 1210 | Ga0068860_100002076 | |||
| 1211 | Ga0068860_100065526 | |||
| 1212 | Ga0068860_100067929 | |||
| 1213 | Ga0068860_100295299 | |||
| 1214 | Ga0068862_100007146 | |||
| 1215 | Ga0068862_100011076 | |||
| 1216 | Ga0068862_100014506 | |||
| 1217 | Ga0068862_100086014 | |||
| 1218 | Ga0075365_10003947 | |||
| 1219 | Ga0075365_10139939 | |||
| 1220 | Ga0075368_10029585 | |||
| 1221 | Ga0075363_100056785 | |||
| 1222 | Ga0075363_100112167 | |||
| 1223 | Ga0075364_10009007 | |||
| 1224 | Ga0075364_10052613 | |||
| 1225 | Ga0075364_10118772 | |||
| 1226 | Ga0075432_10014637 | |||
| 1227 | Ga0075362_10012738 | |||
| 1228 | Ga0075362_10015848 | |||
| 1229 | Ga0075362_10017053 | |||
| 1230 | Ga0075362_10022087 | |||
| 1231 | Ga0075362_10022308 | |||
| 1232 | Ga0075362_10058021 | |||
| 1233 | Ga0075367_10025655 | |||
| 1234 | Ga0075367_10031585 | |||
| 1235 | Ga0075367_10052150 | |||
| 1236 | Ga0075366_10000957 | |||
| 1237 | Ga0075366_10009371 | |||
| 1238 | Ga0075366_10029346 | |||
| 1239 | Ga0075366_10100892 | |||
| 1240 | Ga0075366_10129032 | |||
| 1241 | Ga0097621_100099784 | |||
| 1242 | Ga0075370_10001441 | |||
| 1243 | Ga0075370_10002460 | |||
| 1244 | Ga0075370_10013167 | |||
| 1245 | Ga0075370_10014047 | |||
| 1246 | Ga0075370_10017503 | |||
| 1247 | Ga0075370_10018231 | |||
| 1248 | Ga0075370_10020298 | |||
| 1249 | Ga0075370_10024531 | |||
| 1250 | Ga0075370_10037798 | |||
| 1251 | Ga0075370_10042989 | |||
| 1252 | Ga0075370_10074579 | |||
| 1253 | Ga0068871_100008651 | |||
| 1254 | Ga0068871_100241727 | |||
| 1255 | Ga0075434_100199179 | |||
| 1256 | Ga0075429_100002300 | |||
| 1257 | Ga0068865_100009443 | |||
| 1258 | Ga0068865_100061485 | |||
| 1259 | Ga0097620_100060433 | |||
| 1260 | Ga0097620_100410188 | |||
| 1261 | Ga0099823_1004429 | |||
| 1262 | Ga0079104_1000002 | |||
| 1263 | Ga0079104_1000219 | |||
| 1264 | Ga0079104_1006351 | |||
| 1265 | Ga0099826_10014173 | |||
| 1266 | Ga0099826_10059971 | |||
| 1267 | Ga0105251_10039728 | |||
| 1268 | Ga0105251_10054066 | |||
| 1269 | Ga0105244_10001082 | |||
| 1270 | Ga0105244_10003649 | |||
| 1271 | Ga0105244_10025820 | |||
| 1272 | Ga0105244_10058078 | |||
| 1273 | Ga0105244_10100473 | |||
| 1274 | Ga0105250_10006394 | |||
| 1275 | Ga0105250_10030203 | |||
| 1276 | Ga0105240_10001398 | |||
| 1277 | Ga0105240_10046752 | |||
| 1278 | Ga0105240_10066173 | |||
| 1279 | Ga0105240_10107763 | |||
| 1280 | Ga0105245_10034537 | |||
| 1281 | Ga0105245_10037603 | |||
| 1282 | Ga0114129_10124503 | |||
| 1283 | Ga0105243_10000764 | |||
| 1284 | Ga0105243_10002340 | |||
| 1285 | Ga0105243_10019402 | |||
| 1286 | Ga0105243_10042088 | |||
| 1287 | Ga0105243_10076032 | |||
| 1288 | Ga0105241_10223183 | |||
| 1289 | Ga0105242_10031307 | |||
| 1290 | Ga0105242_10489811 | |||
| 1291 | Ga0105248_10012566 | |||
| 1292 | Ga0105248_10078489 | |||
| 1293 | Ga0105248_10197133 | |||
| 1294 | Ga0105237_10001780 | |||
| 1295 | Ga0105237_10015735 | |||
| 1296 | Ga0105237_10059850 | |||
| 1297 | Ga0105238_10019971 | |||
| 1298 | Ga0105249_10005956 | |||
| 1299 | Ga0105249_10017447 | |||
| 1300 | Ga0105239_10000615 | |||
| 1301 | Ga0105239_10086938 | |||
| 1302 | Ga0105239_10686654 | |||
| 1303 | Ga0105246_10115286 | |||
| 1304 | Ga0105246_10156605 | |||
| 1305 | Ga0157319_1000001 | |||
| 1306 | Ga0157326_1003246 | |||
| 1307 | Ga0157373_10025052 | |||
| 1308 | Ga0157373_10041688 | |||
| 1309 | Ga0157373_10085976 | |||
| 1310 | Ga0157371_10087103 | |||
| 1311 | Ga0157369_10028743 | |||
| 1312 | Ga0157369_10189277 | |||
| 1313 | Ga0157374_10255240 | |||
| 1314 | Ga0157378_10016387 | |||
| 1315 | Ga0157378_10062020 | |||
| 1316 | Ga0163162_10042974 | |||
| 1317 | Ga0163162_10131923 | |||
| 1318 | Ga0157372_10036343 | |||
| 1319 | Ga0157372_10090635 | |||
| 1320 | Ga0157375_10023030 | |||
| 1321 | Ga0157375_10082234 | |||
| 1322 | Ga0157380_10180912 | |||
| 1323 | Ga0182008_10002167 | |||
| 1324 | Ga0182008_10007602 | |||
| 1325 | Ga0182008_10056271 | |||
| 1326 | Ga0157377_10000038 | |||
| 1327 | Ga0157379_10024536 | |||
| 1328 | Ga0157379_10070395 | |||
| 1329 | Ga0157379_10121929 | |||
| 1330 | Ga0157379_10185718 | |||
| 1331 | Ga0157376_10001082 | |||
| 1332 | Ga0157376_10282151 | |||
| 1333 | Ga0182006_1006774 | |||
| 1334 | Ga0182007_10000224 | |||
| 1335 | Ga0182007_10001945 | |||
| 1336 | Ga0183362_10001 | |||
| 1337 | Ga0163161_10000042 | |||
| 1338 | Ga0163161_10004047 | |||
| 1339 | Ga0163161_10067035 | |||
| 1340 | Ga0163161_10082182 | |||
| 1341 | Ga0213872_10000003 | |||
| 1342 | Ga0213872_10000124 | |||
| 1343 | Ga0213872_10000345 | |||
| 1344 | Ga0213872_10020060 | |||
| 1345 | Ga0213872_10035580 | |||
| 1346 | Ga0209435_100010 | |||
| 1347 | Ga0209436_109065 | |||
| 1348 | Ga0209784_100044 | |||
| 1349 | Ga0209674_100064 | |||
| 1350 | Ga0209672_100728 | |||
| 1351 | Ga0209672_106441 | |||
| 1352 | Ga0209147_100457 | |||
| 1353 | Ga0209147_102577 | |||
| 1354 | Ga0209147_102702 | |||
| 1355 | Ga0209563_100005 | |||
| 1356 | Ga0209563_100126 | |||
| 1357 | Ga0207427_100197 | |||
| 1358 | Ga0209258_100009 | |||
| 1359 | Ga0209258_100736 | |||
| 1360 | Ga0209258_100787 | |||
| 1361 | Ga0207425_1000135 | |||
| 1362 | Ga0207425_1000821 | |||
| 1363 | Ga0209646_1000001 | |||
| 1364 | Ga0209646_1000060 | |||
| 1365 | Ga0209026_1000001 | |||
| 1366 | Ga0209026_1000049 | |||
| 1367 | Ga0209677_100411 | |||
| 1368 | Ga0209677_101222 | |||
| 1369 | Ga0209148_1000007 | |||
| 1370 | Ga0209148_1004733 | |||
| 1371 | Ga0209759_1000001 | |||
| 1372 | Ga0209759_1000069 | |||
| 1373 | Ga0209759_1001428 | |||
| 1374 | Ga0209129_1000013 | |||
| 1375 | Ga0209129_1000043 | |||
| 1376 | Ga0209129_1004720 | |||
| 1377 | Ga0209565_1000028 | |||
| 1378 | Ga0209565_1000058 | |||
| 1379 | Ga0209565_1000197 | |||
| 1380 | Ga0209565_1000433 | |||
| 1381 | Ga0209565_1008528 | |||
| 1382 | Ga0209455_1001719 | |||
| 1383 | Ga0209673_1000035 | |||
| 1384 | Ga0209673_1000053 | |||
| 1385 | Ga0209673_1000279 | |||
| 1386 | Ga0209673_1000316 | |||
| 1387 | Ga0209673_1000780 | |||
| 1388 | Ga0209673_1004689 | |||
| 1389 | Ga0209673_1013804 | |||
| 1390 | Ga0209673_1014652 | |||
| 1391 | Ga0209673_1028079 | |||
| 1392 | Ga0209130_1000112 | |||
| 1393 | Ga0209130_1000158 | |||
| 1394 | Ga0209130_1000186 | |||
| 1395 | Ga0209130_1000363 | |||
| 1396 | Ga0209130_1000701 | |||
| 1397 | Ga0209130_1003550 | |||
| 1398 | Ga0209130_1005803 | |||
| 1399 | Ga0209675_1000010 | |||
| 1400 | Ga0209675_1000130 | |||
| 1401 | Ga0209675_1000153 | |||
| 1402 | Ga0209675_1000871 | |||
| 1403 | Ga0209675_1001471 | |||
| 1404 | Ga0209675_1004539 | |||
| 1405 | Ga0209675_1011067 | |||
| 1406 | Ga0209676_1000069 | |||
| 1407 | Ga0209676_1000108 | |||
| 1408 | Ga0209676_1007541 | |||
| 1409 | Ga0209676_1007556 | |||
| 1410 | Ga0209025_1000103 | |||
| 1411 | Ga0209025_1000129 | |||
| 1412 | Ga0209025_1000169 | |||
| 1413 | Ga0209025_1000331 | |||
| 1414 | Ga0209025_1000565 | |||
| 1415 | Ga0209025_1001427 | |||
| 1416 | Ga0209025_1001602 | |||
| 1417 | Ga0209025_1001700 | |||
| 1418 | Ga0209025_1001921 | |||
| 1419 | Ga0209025_1002074 | |||
| 1420 | Ga0209025_1002962 | |||
| 1421 | Ga0209025_1011956 | |||
| 1422 | Ga0209025_1014326 | |||
| 1423 | Ga0209025_1023954 | |||
| 1424 | Ga0209025_1025018 | |||
| 1425 | Ga0209564_1000005 | |||
| 1426 | Ga0209564_1000014 | |||
| 1427 | Ga0209564_1000171 | |||
| 1428 | Ga0209564_1000880 | |||
| 1429 | Ga0209564_1001709 | |||
| 1430 | Ga0209564_1002454 | |||
| 1431 | Ga0209564_1003455 | |||
| 1432 | Ga0209758_1000067 | |||
| 1433 | Ga0209758_1000307 | |||
| 1434 | Ga0209758_1000492 | |||
| 1435 | Ga0209050_1000002 | |||
| 1436 | Ga0209050_1000023 | |||
| 1437 | Ga0209050_1000493 | |||
| 1438 | Ga0209050_1000543 | |||
| 1439 | Ga0209050_1001273 | |||
| 1440 | Ga0209050_1001396 | |||
| 1441 | Ga0209050_1003837 | |||
| 1442 | Ga0209050_1010459 | |||
| 1443 | Ga0209050_1010869 | |||
| 1444 | Ga0209256_1000003 | |||
| 1445 | Ga0209256_1000077 | |||
| 1446 | Ga0209256_1000092 | |||
| 1447 | Ga0209256_1000121 | |||
| 1448 | Ga0209256_1008919 | |||
| 1449 | Ga0207426_1000101 | |||
| 1450 | Ga0207426_1000129 | |||
| 1451 | Ga0207426_1000153 | |||
| 1452 | Ga0209051_1000002 | |||
| 1453 | Ga0209051_1000017 | |||
| 1454 | Ga0209051_1000020 | |||
| 1455 | Ga0209051_1000101 | |||
| 1456 | Ga0209051_1000145 | |||
| 1457 | Ga0209051_1000289 | |||
| 1458 | Ga0209051_1000317 | |||
| 1459 | Ga0209051_1001499 | |||
| 1460 | Ga0209051_1001699 | |||
| 1461 | Ga0209051_1003391 | |||
| 1462 | Ga0209051_1009607 | |||
| 1463 | Ga0209051_1010293 | |||
| 1464 | Ga0209051_1013144 | |||
| 1465 | Ga0209051_1040416 | |||
| 1466 | Ga0209051_1040988 | |||
| 1467 | Ga0209257_1000002 | |||
| 1468 | Ga0209257_1000017 | |||
| 1469 | Ga0209257_1000039 | |||
| 1470 | Ga0209257_1000041 | |||
| 1471 | Ga0209257_1000189 | |||
| 1472 | Ga0209257_1000724 | |||
| 1473 | Ga0209257_1007414 | |||
| 1474 | Ga0209257_1010393 | |||
| 1475 | Ga0209257_1020459 | |||
| 1476 | Ga0207656_10019425 | |||
| 1477 | Ga0207696_1000786 | |||
| 1478 | Ga0207696_1010395 | |||
| 1479 | Ga0207655_1000332 | |||
| 1480 | Ga0207655_1000839 | |||
| 1481 | Ga0207655_1005345 | |||
| 1482 | Ga0207655_1062474 | |||
| 1483 | Ga0207713_1001629 | |||
| 1484 | Ga0207713_1041575 | |||
| 1485 | Ga0207682_10044711 | |||
| 1486 | Ga0207688_10084072 | |||
| 1487 | Ga0207680_10129006 | |||
| 1488 | Ga0207645_10001485 | |||
| 1489 | Ga0207643_10097243 | |||
| 1490 | Ga0207705_10319175 | |||
| 1491 | Ga0207707_10156440 | |||
| 1492 | Ga0207695_10006362 | |||
| 1493 | Ga0207695_10047697 | |||
| 1494 | Ga0207695_10050611 | |||
| 1495 | Ga0207695_10076864 | |||
| 1496 | Ga0207695_10191782 | |||
| 1497 | Ga0207671_10003233 | |||
| 1498 | Ga0207671_10068376 | |||
| 1499 | Ga0207671_10099948 | |||
| 1500 | Ga0207657_10048467 | |||
| 1501 | Ga0207657_10080477 | |||
| 1502 | Ga0207657_10234846 | |||
| 1503 | Ga0207649_10001402 | |||
| 1504 | Ga0207649_10070952 | |||
| 1505 | Ga0207652_10050248 | |||
| 1506 | Ga0207681_10002051 | |||
| 1507 | Ga0207681_10013357 | |||
| 1508 | Ga0207694_10022432 | |||
| 1509 | Ga0207694_10063968 | |||
| 1510 | Ga0207650_10000998 | |||
| 1511 | Ga0207650_10003908 | |||
| 1512 | Ga0207650_10035789 | |||
| 1513 | Ga0207659_10000691 | |||
| 1514 | Ga0207659_10009045 | |||
| 1515 | Ga0207659_10028640 | |||
| 1516 | Ga0207687_10030425 | |||
| 1517 | Ga0207644_10001362 | |||
| 1518 | Ga0207644_10008153 | |||
| 1519 | Ga0207644_10051638 | |||
| 1520 | Ga0207644_10057212 | |||
| 1521 | Ga0207690_10003313 | |||
| 1522 | Ga0207706_10001466 | |||
| 1523 | Ga0207686_10003386 | |||
| 1524 | Ga0207686_10003857 | |||
| 1525 | Ga0207709_10000015 | |||
| 1526 | Ga0207709_10000094 | |||
| 1527 | Ga0207709_10000624 | |||
| 1528 | Ga0207709_10024260 | |||
| 1529 | Ga0207709_10032850 | |||
| 1530 | Ga0207669_10007676 | |||
| 1531 | Ga0207669_10039443 | |||
| 1532 | Ga0207704_10003582 | |||
| 1533 | Ga0207691_10001243 | |||
| 1534 | Ga0207691_10003923 | |||
| 1535 | Ga0207691_10049651 | |||
| 1536 | Ga0207691_10067971 | |||
| 1537 | Ga0207711_10009786 | |||
| 1538 | Ga0207711_10095074 | |||
| 1539 | Ga0207689_10002717 | |||
| 1540 | Ga0207689_10062542 | |||
| 1541 | Ga0207689_10069421 | |||
| 1542 | Ga0207689_10079042 | |||
| 1543 | Ga0207689_10209853 | |||
| 1544 | Ga0207661_10098649 | |||
| 1545 | Ga0207679_10000154 | |||
| 1546 | Ga0207679_10010502 | |||
| 1547 | Ga0207679_10022828 | |||
| 1548 | Ga0207679_10109532 | |||
| 1549 | Ga0207667_10001779 | |||
| 1550 | Ga0207667_10116275 | |||
| 1551 | Ga0207651_10008151 | |||
| 1552 | Ga0207651_10009585 | |||
| 1553 | Ga0207712_10067616 | |||
| 1554 | Ga0207640_10002657 | |||
| 1555 | Ga0207640_10037293 | |||
| 1556 | Ga0207640_10110641 | |||
| 1557 | Ga0207658_10001089 | |||
| 1558 | Ga0207677_10037875 | |||
| 1559 | Ga0207677_10197584 | |||
| 1560 | Ga0207703_10000996 | |||
| 1561 | Ga0207703_10015852 | |||
| 1562 | Ga0207703_10091690 | |||
| 1563 | Ga0207639_10124298 | |||
| 1564 | Ga0207639_10262296 | |||
| 1565 | Ga0207678_10043499 | |||
| 1566 | Ga0207708_10031570 | |||
| 1567 | Ga0207702_10002045 | |||
| 1568 | Ga0207702_10042164 | |||
| 1569 | Ga0207702_10127564 | |||
| 1570 | Ga0207702_10421650 | |||
| 1571 | Ga0207641_10006465 | |||
| 1572 | Ga0207641_10017869 | |||
| 1573 | Ga0207641_10021132 | |||
| 1574 | Ga0207648_10000118 | |||
| 1575 | Ga0207648_10002634 | |||
| 1576 | Ga0207648_10023876 | |||
| 1577 | Ga0207676_10067016 | |||
| 1578 | Ga0207674_10011982 | |||
| 1579 | Ga0207674_10361083 | |||
| 1580 | Ga0207675_100003340 | |||
| 1581 | Ga0207683_10008780 | |||
| 1582 | Ga0207683_10145851 | |||
| 1583 | Ga0207683_10147642 | |||
| 1584 | Ga0209281_1000007 | |||
| 1585 | Ga0209281_1000074 | |||
| 1586 | Ga0209389_1009108 | |||
| 1587 | Ga0209371_1002772 | |||
| 1588 | Ga0209968_1013863 | |||
| 1589 | Ga0209970_1000481 | |||
| 1590 | Ga0209282_1019606 | |||
| 1591 | Ga0209971_1004935 | |||
| 1592 | Ga0209974_10000606 | |||
| 1593 | Ga0209974_10027573 | |||
| 1594 | Ga0207428_10078731 | |||
| 1595 | Ga0268265_10010636 | |||
| 1596 | Ga0268265_10012706 | |||
| 1597 | Ga0268265_10017251 | |||
| 1598 | Ga0268264_10001857 | |||
| 1599 | Ga0268264_10005310 | |||
| 1600 | Ga0268264_10044567 | |||
| 1601 | Ga0268264_10234389 | |||
| 1602 | Ga0265336_10000123 | |||
| 1603 | Ga0307517_10010725 | |||
| 1604 | Ga0307515_10000165 | |||
| 1605 | Ga0307515_10000188 | |||
| 1606 | Ga0307515_10000433 | |||
| 1607 | Ga0307515_10000529 | |||
| 1608 | Ga0307515_10000708 | |||
| 1609 | Ga0307515_10013631 | |||
| 1610 | Ga0307515_10029938 | |||
| 1611 | Ga0307515_10045432 | |||
| 1612 | Ga0307515_10095097 | |||
| 1613 | Ga0307515_10132505 | |||
| 1614 | Ga0265324_10000849 | |||
| 1615 | Ga0237817_10077 | |||
| 1616 | Ga0237817_10171 | |||
| 1617 | Ga0268256_1004899 | |||
| 1618 | Ga0307512_10103250 | |||
| 1619 | Ga0307512_10104209 | |||
| 1620 | Ga0316177_1007744 | |||
| 1621 | Ga0316178_1003672 | |||
| 1622 | Ga0316180_1085302 | |||
| 1623 | Ga0316182_1158565 | |||
| 1624 | Ga0316182_1235587 | |||
| 1625 | Ga0265330_10000022 | |||
| 1626 | Ga0265330_10033981 | |||
| 1627 | Ga0265332_10000001 | |||
| 1628 | Ga0265332_10000009 | |||
| 1629 | Ga0265328_10038040 | |||
| 1630 | Ga0265325_10005268 | |||
| 1631 | Ga0265340_10017633 | |||
| 1632 | Ga0265327_10000144 | |||
| 1633 | Ga0265327_10000748 | |||
| 1634 | Ga0265327_10044788 | |||
| 1635 | Ga0307513_10000004 | |||
| 1636 | Ga0307513_10000015 | |||
| 1637 | Ga0307513_10001902 | |||
| 1638 | Ga0307513_10017436 | |||
| 1639 | Ga0307513_10086145 | |||
| 1640 | Ga0307513_10144504 | |||
| 1641 | Ga0307513_10188330 | |||
| 1642 | Ga0307509_10000234 | |||
| 1643 | Ga0307509_10016663 | |||
| 1644 | Ga0307509_10052970 | |||
| 1645 | Ga0307408_100000038 | |||
| 1646 | Ga0307408_100000186 | |||
| 1647 | Ga0307408_100029978 | |||
| 1648 | Ga0307408_100245641 | |||
| 1649 | Ga0307508_10000169 | |||
| 1650 | Ga0307508_10024742 | |||
| 1651 | Ga0307508_10041698 | |||
| 1652 | Ga0307508_10266202 | |||
| 1653 | Ga0307514_10000593 | |||
| 1654 | Ga0307514_10001826 | |||
| 1655 | Ga0307514_10006926 | |||
| 1656 | Ga0307514_10031222 | |||
| 1657 | Ga0265314_10000013 | |||
| 1658 | Ga0265314_10015884 | |||
| 1659 | Ga0307516_10000311 | |||
| 1660 | Ga0307516_10000326 | |||
| 1661 | Ga0307516_10000383 | |||
| 1662 | Ga0307516_10005389 | |||
| 1663 | Ga0307516_10022276 | |||
| 1664 | Ga0307516_10048465 | |||
| 1665 | Ga0307516_10078447 | |||
| 1666 | Ga0307516_10127328 | |||
| 1667 | Ga0307405_10017087 | |||
| 1668 | Ga0307405_10029162 | |||
| 1669 | Ga0307405_10039214 | |||
| 1670 | Ga0307413_10003540 | |||
| 1671 | Ga0307406_10000307 | |||
| 1672 | Ga0307406_10002267 | |||
| 1673 | Ga0307406_10025888 | |||
| 1674 | Ga0307412_10039553 | |||
| 1675 | Ga0307412_10191510 | |||
| 1676 | Ga0307412_10300690 | |||
| 1677 | Ga0307409_100004774 | |||
| 1678 | Ga0307409_100303905 | |||
| 1679 | Ga0307416_100021134 | |||
| 1680 | Ga0307416_100078423 | |||
| 1681 | Ga0307416_100110997 | |||
| 1682 | Ga0307416_100164022 | |||
| 1683 | Ga0307414_10015572 | |||
| 1684 | Ga0307414_10042397 | |||
| 1685 | Ga0307414_10304646 | |||
| 1686 | Ga0307411_10000111 | |||
| 1687 | Ga0307415_100024889 | |||
| 1688 | Ga0307510_10022531 | |||
| 1689 | Ga0373939_0000439 | |||
| 1690 | Ga0373962_0037542 | |||
| 1691 | Ga0373931_0000156 | |||
| 1692 | Ga0373931_0004247 | |||
| 1693 | Ga0373931_0007769 | |||
| 1694 | Ga0373931_0013119 | |||
| 1695 | Ga0373927_0144804 | |||
| 1696 | Ga0373937_0477715 | |||
| 1697 | Ga0373925_0017066 | |||
| 1698 | Ga0395899_0023736 | |||
| 1699 | Ga0395899_0188051 | |||
| 1700 | Ga0395900_0040451 | |||
| 1701 | Ga0395900_0087908 | |||
| 1702 | Ga0395900_0112800 | |||
| 1703 | Ga0395898_0020979 | |||
| 1704 | Ga0395898_0031440 | |||
| 1705 | Ga0395905_0003898 | |||
| 1706 | Ga0395905_0004659 | |||
| 1707 | Ga0395905_0008552 | |||
| 1708 | Ga0395905_0012259 | |||
| 1709 | Ga0395905_0016114 | |||
| 1710 | Ga0395905_0046111 | |||
| 1711 | Ga0395905_0063329 | |||
| 1712 | Ga0395905_0065569 | |||
| 1713 | Ga0395905_0082794 | |||
| 1714 | Ga0395905_0146776 | |||
| 1715 | Ga0395905_0576500 | |||
| 1716 | Ga0395901_0026393 | |||
| 1717 | Ga0395901_0050648 | |||
| 1718 | Ga0395901_0055400 | |||
| 1719 | Ga0395901_0057541 | |||
| 1720 | Ga0395901_0152491 | |||
| 1721 | Ga0237819_00068 | |||
| 1722 | Ga0237819_00076 | |||
| 1723 | Ga0436365_1712709 | |||
| 1724 | Ga0436361_0003822 | |||
| 1725 | Ga0436361_0240287 | |||
| 1726 | Ga0436361_0331966 | |||
| 1727 | Ga0436361_0446182 | |||
| 1728 | Ga0436361_0469035 | |||
| 1729 | Ga0436361_0507512 | |||
| 1730 | Ga0436361_0638016 | |||
| 1731 | Ga0436361_0935151 | |||
| 1732 | Ga0436361_1027804 | |||
| 1733 | Ga0436363_1160320 | |||
| 1734 | Ga0439436_0021673 | |||
| 1735 | Ga0439436_0028540 | |||
| 1736 | Ga0451791_0900922 | |||
| 1737 | Ga0451798_0270784 | |||
| 1738 | Ga0439431_0007581 | |||
| 1739 | Ga0439441_010140 | |||
| 1740 | Ga0439442_001748 | |||
| 1741 | Ga0439432_014795 | |||
| 1742 | Ga0439449_0000925 | |||
| 1743 | Ga0439449_0001348 | |||
| 1744 | Ga0439449_0005886 | |||
| 1745 | Ga0439449_0010084 | |||
| 1746 | Ga0439455_0002074 | |||
| 1747 | Ga0439462_0001961 | |||
| 1748 | Ga0450911_000262 | |||
| 1749 | Ga0450917_000106 | |||
| 1750 | Ga0450919_001427 | |||
| 1751 | Ga0450923_031413 | |||
| 1752 | Ga0450891_000348 | |||
| 1753 | Ga0450892_001061 | |||
| 1754 | Ga0450889_000227 | |||
| 1755 | Ga0439446_0011662 | |||
| 1756 | Ga0439434_0012501 | |||
| 1757 | Ga0439464_0016046 | |||
| 1758 | Ga0450918_000085 | |||
| 1759 | Ga0450918_000183 | |||
| 1760 | Ga0451577_0002278 | |||
| 1761 | Ga0451577_0006522 | |||
| 1762 | Ga0451577_0045705 | |||
| 1763 | Ga0451577_0079617 | |||
| 1764 | Ga0466969_0003908 | |||
| 1765 | Ga0453683_0002100 | |||
| 1766 | Ga0453683_0180145 | |||
| 1767 | Ga0466965_0002600 | |||
| 1768 | Ga0466965_0011676 | |||
| 1769 | Ga0466966_0008842 | |||
| 1770 | Ga0466966_0027763 | |||
| 1771 | Ga0466961_0060306 | |||
| 1772 | Ga0466961_0062041 | |||
| 1773 | Ga0466961_0069966 | |||
| 1774 | Ga0453684_0000126 | |||
| 1775 | Ga0453684_0009747 | |||
| 1776 | Ga0453684_0018443 | |||
| 1777 | Ga0466971_0026420 | |||
| 1778 | Ga0466968_0029370 | |||
| 1779 | Ga0466959_0002246 | |||
| 1780 | Ga0466959_0058698 | |||
| 1781 | Ga0466959_0133495 | |||
| 1782 | Ga0466959_0170150 | |||
| 1783 | Ga0451576_0004978 | |||
| 1784 | Ga0451576_0015978 | |||
| 1785 | Ga0451576_0065737 | |||
| 1786 | Ga0451576_0293504 | |||
| 1787 | Ga0466958_0097388 | |||
| 1788 | Ga0466967_0000067 | |||
| 1789 | Ga0495592_0000291 | |||
| 1790 | Ga0495590_0002435 | |||
| 1791 | Ga0495629_0119852 | |||
| 1792 | Ga0495638_0072584 | |||
| 1793 | Ga0495651_0153508 | |||
| 1794 | Ga0495650_0043026 | |||
| 1795 | Ga0495580_0099984 | |||
| 1796 | Ga0495639_0031741 | |||
| 1797 | Ga0495583_0000046 | |||
| 1798 | Ga0495606_0009260 | |||
| 1799 | Ga0495610_0027537 | |||
| 1800 | Ga0495610_0103140 | |||
| 1801 | Ga0495620_0068347 | |||
| 1802 | Ga0495630_0173022 | |||
| 1803 | Ga0495632_0003074 | |||
| 1804 | Ga0495632_0025431 | |||
| 1805 | Ga0495637_0004233 | |||
| 1806 | Ga0495663_0055994 | |||
| 1807 | Ga0495598_0061989 | |||
| 1808 | Ga0495609_0038685 | |||
| 1809 | Ga0495597_0000505 | |||
| 1810 | Ga0495597_0008931 | |||
| 1811 | Ga0495656_0000062 | |||
| 1812 | Ga0495668_0016624 | |||
| 1813 | Ga0495668_0094149 | |||
| 1814 | Ga0495625_0000998 | |||
| 1815 | Ga0495625_0003113 | |||
| 1816 | Ga0495625_0027051 | |||
| 1817 | Ga0495625_0089803 | |||
| 1818 | Ga0495635_0065940 | |||
| 1819 | Ga0495658_0034450 | |||
| 1820 | Ga0495658_0043279 | |||
| 1821 | Ga0495624_0158906 | |||
| 1822 | Ga0495649_0000638 | |||
| 1823 | Ga0495649_0001852 | |||
| 1824 | Ga0495649_0007371 | |||
| 1825 | Ga0495589_0002430 | |||
| 1826 | Ga0495589_0018491 | |||
| 1827 | Ga0495660_0075984 | |||
| 1828 | Ga0495674_0238342 | |||
| 1829 | Ga0495680_0102073 | |||
| 1830 | Ga0495687_000367 | |||
| 1831 | Ga0495687_007870 | |||
| 1832 | Ga0495673_0087986 | |||
| 1833 | Ga0495684_0011547 | |||
| 1834 | Ga0495686_0006531 | |||
| 1835 | Ga0496104_0134566 | |||
| 1836 | Ga0496105_0046621 | |||
| 1837 | Ga0496105_0117351 | |||
| 1838 | Ga0496106_0061723 | |||
| 1839 | Ga0496107_0022810 | |||
| 1840 | Ga0496108_0187447 | |||
| 1841 | Ga0496109_0082637 | |||
| 1842 | Ga0496110_0188033 | |||
| 1843 | Ga0496112_0151630 | |||
| 1844 | Ga0496114_0068362 | |||
| 1845 | Ga0496114_0361889 | |||
| 1846 | Ga0496115_0185612 | |||
| 1847 | Ga0496115_0429278 | |||
| 1848 | Ga0496117_0003732 | |||
| 1849 | Ga0496118_0021517 | |||
| 1850 | Ga0496122_0000380 | |||
| 1851 | Ga0496122_0086393 | |||
| 1852 | Ga0496123_0000246 | |||
| 1853 | Ga0496123_0011348 | |||
| 1854 | Ga0496123_0044550 | |||
| 1855 | Ga0496124_0000138 | |||
| 1856 | Ga0496124_0020305 | |||
| 1857 | Ga0496124_0039963 | |||
| 1858 | Ga0496124_0154881 | |||
| 1859 | Ga0496125_0001645 | |||
| 1860 | Ga0496125_0018151 | |||
| 1861 | Ga0496126_0143507 | |||
| 1862 | Ga0501343_003091 | |||
| 1863 | Ga0501344_01832 | |||
| 1864 | Ga0501294_003760 | |||
| 1865 | Ga0501300_011242 | |||
| 1866 | Ga0501312_008199 | |||
| 1867 | Ga0501316_005454 | |||
| 1868 | Ga0501317_011273 | |||
| 1869 | Ga0501318_010120 | |||
| 1870 | Ga0501321_004707 | |||
| 1871 | Ga0501338_01197 | |||
| 1872 | Ga0501034_0058032 | |||
| 1873 | Ga0501037_0356116 | |||
| 1874 | Ga0501043_0000002 | |||
| 1875 | Ga0501046_0000008 | |||
| 1876 | Ga0501047_0000003 | |||
| 1877 | Ga0501048_0000759 | |||
| 1878 | Ga0501198_000014 | |||
| 1879 | Ga0501217_004514 | |||
| 1880 | Ga0501222_000008 | |||
| 1881 | Ga0501222_002240 | |||
| 1882 | Ga0501223_005225 | |||
| 1883 | Ga0501235_013287 | |||
| 1884 | Ga0501249_017024 | |||
| 1885 | Ga0501253_002078 | |||
| 1886 | Ga0501253_013029 | |||
| 1887 | Ga0501255_000446 | |||
| 1888 | Ga0501257_019542 | |||
| 1889 | Ga0501265_000456 | |||
| 1890 | Ga0501267_000947 | |||
| 1891 | Ga0501272_001263 | |||
| 1892 | Ga0501045_0001582 | |||
| 1893 | nmdc:mga03683_8121_c1 | |||
| 1894 | nmdc:mga00v17_64477_c1 | |||
| 1895 | nmdc:mga0k408_14769_c1 | |||
| 1896 | nmdc:mga0k408_1821_c2 | |||
| 1897 | nmdc:mga0k408_187430_c1 | |||
| 1898 | nmdc:mga0k408_21697_c1 | |||
| 1899 | nmdc:mga0k408_3379_c1 | |||
| 1900 | nmdc:mga0k408_34983_c1 | |||
| 1901 | nmdc:mga0k408_35627_c1 | |||
| 1902 | nmdc:mga0k408_4347_c1 | |||
| 1903 | nmdc:mga0k408_67800_c1 | |||
| 1904 | nmdc:mga0k408_76795_c1 | |||
| 1905 | nmdc:mga06z11_155115_c1 | |||
| 1906 | nmdc:mga07m45_15316_c1 | |||
| 1907 | nmdc:mga07m45_22441_c1 | |||
| 1908 | nmdc:mga07m45_26121_c1 | |||
| 1909 | nmdc:mga07m45_48037_c1 | |||
| 1910 | nmdc:mga07m45_57_c1 | |||
| 1911 | nmdc:mga07m45_6260_c1 | |||
| 1912 | nmdc:mga07m45_6359_c1 | |||
| 1913 | nmdc:mga07m45_99158_c1 | |||
| 1914 | nmdc:mga07m45_99304_c1 | |||
| 1915 | nmdc:mga05p37_226266_c1 | |||
| 1916 | nmdc:mga09592_5629_c1 | |||
| 1917 | nmdc:mga08y16_510299_c1 | |||
| 1918 | Ga0500610_0001796 | |||
| 1919 | Ga0500610_0003563 | |||
| 1920 | Ga0500635_0000005 | |||
| 1921 | Ga0495619_0053229 | |||
| 1922 | Ga0500578_0000058 | |||
| 1923 | Ga0500578_0130402 | |||
| 1924 | Ga0500651_0000107 | |||
| 1925 | Ga0500651_0067151 | |||
| 1926 | Ga0500651_0083100 | |||
| 1927 | Ga0500566_0000013 | |||
| 1928 | Ga0500652_000154 | |||
| 1929 | Ga0500658_0000254 | |||
| 1930 | Ga0500658_0000909 | |||
| 1931 | Ga0500658_0021924 | |||
| 1932 | Ga0500559_0000119 | |||
| 1933 | Ga0500622_0000221 | |||
| 1934 | Ga0500622_0002018 | |||
| 1935 | Ga0500636_0087652 | |||
| 1936 | Ga0500637_0003057 | |||
| 1937 | Ga0500637_0006670 | |||
| 1938 | Ga0500645_002285 | |||
| 1939 | Ga0466962_0008472 | |||
| 1940 | 2511243922 | |||
| 1941 | 2511700921 | |||
| 1942 | 2513228176 | |||
| 1943 | 2540608120 | |||
| 1944 | 2545559116 | |||
| 1945 | 2548499845 | |||
| 1946 | 2553394226 | |||
| 1947 | 2563930300 | |||
| 1948 | 2578933570 | |||
| 1949 | 2587728870 | |||
| 1950 | 2587736470 | |||
| 1951 | 2587756106 | |||
| 1952 | 2588294653 | |||
| 1953 | 2599626965 | |||
| 1954 | 2599676211 | |||
| 1955 | 2599684523 | |||
| 1956 | 2599696516 | |||
| 1957 | 2600401012 | |||
| 1958 | 2631985224 | |||
| 1959 | 2643745683 | |||
| 1960 | 2643868086 | |||
| 1961 | 2643936750 | |||
| 1962 | 2643970519 | |||
| 1963 | 2643993917 | |||
| 1964 | 2644059650 | |||
| 1965 | 2644074791 | |||
| 1966 | 2644142744 | |||
| 1967 | 2644160471 | |||
| 1968 | 2644221576 | |||
| 1969 | 2644248431 | |||
| 1970 | 2644257659 | |||
| 1971 | 2644272695 | |||
| 1972 | 2644293697 | |||
| 1973 | 2644303954 | |||
| 1974 | 2644318649 | |||
| 1975 | 2644324696 | |||
| 1976 | 2644396559 | |||
| 1977 | 2644465513 | |||
| 1978 | 2644644829 | |||
| 1979 | 2644723242 | |||
| 1980 | 2651530541 | |||
| 1981 | 2672337456 | |||
| 1982 | 2674422145 | |||
| 1983 | 2685153409 | |||
| 1984 | 2695628882 | |||
| 1985 | 2698319777 | |||
| 1986 | 2705997329 | |||
| 1987 | 2717915432 | |||
| 1988 | 2721508569 | |||
| 1989 | 2722882140 | |||
| 1990 | 2738718940 | |||
| 1991 | 2738816944 | |||
| 1992 | 2738879981 | |||
| 1993 | 2739160010 | |||
| 1994 | 2739212576 | |||
| 1995 | 2739241180 | |||
| 1996 | 2739250021 | |||
| 1997 | 2739281702 | |||
| 1998 | 2791215963 | |||
| 1999 | 2808868800 | |||
| 2000 | 2809053250 | |||
| 2001 | 2816473343 | |||
| 2002 | 2816862133 | |||
| 2003 | 2817479335 | |||
| 2004 | 2819568927 | |||
| 2005 | 2819599416 | |||
| 2006 | 2819627632 | |||
| 2007 | 2831271367 | |||
| 2008 | 2831869504 | |||
| 2009 | 2838055904 | |||
| 2010 | 2839142655 | |||
| 2011 | 2842678098 | |||
| 2012 | 2842684956 | |||
| 2013 | 2842721436 | |||
| 2014 | 2842734437 | |||
| 2015 | 2842749323 | |||
| 2016 | 2849141515 | |||
| 2017 | 2857584047 | |||
| 2018 | 2860840911 | |||
| 2019 | 2877771804 | |||
| 2020 | 2880172646 | |||
| 2021 | 2881105239 | |||
| 2022 | 2885197982 | |||
| 2023 | 2885200550 | |||
| 2024 | 2885214667 | |||
| 2025 | 2886853245 | |||
| 2026 | 2894024158 | |||
| 2027 | 2897112918 | |||
| 2028 | 2899925844 | |||
| 2029 | 2904450382 | |||
| 2030 | 2904456795 | |||
| 2031 | 2904480203 | |||
| 2032 | 2904544352 | |||
| 2033 | 2904563790 | |||
| 2034 | 2904610046 | |||
| 2035 | 2916973087 | |||
| 2036 | 2919415937 | |||
| 2037 | 2919463184 | |||
| 2038 | 2919704343 | |||
| 2039 | 2928041768 | |||
| 2040 | 2928049332 | |||
| 2041 | 2928052060 | |||
| 2042 | 2928065260 | |||
| 2043 | 2928076585 | |||
| 2044 | 2928089292 | |||
| 2045 | 2928119143 | |||
| 2046 | 2928512418 | |||
| 2047 | 2929004344 | |||
| 2048 | 2929162077 | |||
| 2049 | 2929239121 | |||
| 2050 | 2929521095 | |||
| 2051 | 2932423780 | |||
| 2052 | 2936362864 | |||
| 2053 | 2939596222 | |||
| 2054 | 2939633011 | |||
| 2055 | 2945913519 | |||
| 2056 | 2945949114 | |||
| 2057 | 2945973159 | |||
| 2058 | 2945991089 | |||
| 2059 | 2947432215 | |||
| 2060 | 2954768476 | |||
| 2061 | 2956898783 | |||
| 2062 | 2960376271 | |||
| 2063 | 2962294138 | |||
| 2064 | 2964380129 | |||
| 2065 | 2965766743 | |||
| 2066 | 2969140119 | |||
| 2067 | 2969144358 | |||
| 2068 | 2969769121 | |||
| 2069 | 2969771435 | |||
| 2070 | 2971896470 | |||
| 2071 | 2974322481 | |||
| 2072 | 2979089105 | |||
| 2073 | 2980495906 | |||
| 2074 | 2990713554 | |||
| 2075 | 3001896471 | |||
| 2076 | 3006859660 | |||
| 2077 | 3006882631 | |||
| 2078 | 3006979790 | |||
| 2079 | 8007371348 | |||
| 2080 | 8007377494 | |||
| 2081 | 8022626946 | |||
| 2082 | 8022633069 | |||
| 2083 | 8022655786 | |||
| 2084 | 8022949168 | |||
| 2085 | 8023441595 | |||
| 2086 | 8051954577 | |||
| 2087 | 8052175336 | |||
| 2088 | 8055537187 | |||
| 2089 | 8057587864 | |||
| 2090 | 8057634925 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a1y-assembly1.cif.gz_A | crystal structure of guac-gmp complex from bacillus anthracis at 2.26 a resolution. | 0.967 | 2 | 316 |
| 1ypf-assembly2.cif.gz_B | crystal structure of guac (ba5705) from bacillus anthracis at 1.8 a resolution | 0.9613 | 1 | 316 |
| 1ypf-assembly2.cif.gz_B | crystal structure of guac (ba5705) from bacillus anthracis at 1.8 a resolution | 0.9548 | 1 | 316 |
| 1ypf-assembly1.cif.gz_A | crystal structure of guac (ba5705) from bacillus anthracis at 1.8 a resolution | 0.9516 | 2 | 316 |
| 2a1y-assembly1.cif.gz_A | crystal structure of guac-gmp complex from bacillus anthracis at 2.26 a resolution. | 0.9479 | 2 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ypfB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9613 | 1 | 316 | 3.20.20.70 |
| 1ypfB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9548 | 1 | 316 | 3.20.20.70 |
| 4qq3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8933 | 1 | 315 | 3.20.20.70 |
| af_Q10CU7_12_484_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8855 | 2 | 313 | 3.20.20.70 |
| 1lrtC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8734 | 1 | 318 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A7T3Y3-F1-model_v4 | GMP reductase (EC 1.7.1.7) | 1.002 | 1 | 167 |
GO:0016491
|
| AF-A0A5C7W511-F1-model_v4 | GMP reductase (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase) | 0.9963 | 1 | 250 |
GO:0003920
GO:0005829 |
| AF-T2SXB3-F1-model_v4 | GMP reductase (EC 1.7.1.7) | 0.9936 | 1 | 157 |
GO:0003920
GO:0005829 |
| AF-A0A3D5CTI8-F1-model_v4 | GMP reductase (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase) | 0.9927 | 1 | 207 |
GO:0005829
GO:0016491 |
| AF-A0A5C7W511-F1-model_v4 | GMP reductase (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase) | 0.9924 | 1 | 250 |
GO:0003920
GO:0005829 |