F488937
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1045 | 421 | 2090 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300035691|Ga0373931_0018229|Ga0373931_0018229_1174_1674 |
| Length | 166 |
| Sequence | LADVCETAAAMRACLPDGGALIGLDLGTKTIGTAFCDAGWRFASPGKTLPRAKFTADKAQIAALIAERGIRGIVIGLPRNMDGSEGPRAQSSRAYARNLADLGLPILLWDERLSTASAEAALIAQDFSRAKRAERIDAAAAAVILQAAIDALAGGSLPPPLPVGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 246 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 247 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 250 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 251 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 252 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 355 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 399 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 401 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 402 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 403 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 406 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 407 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 413 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 414 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 415 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 416 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 417 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 418 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 419 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 420 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 421 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 0.29 |
| Isolates | 0.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.97 |
| Nodule | 0.77 |
| Rhizoplane | 9.86 |
| Rhizosphere | 84.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373931_0018229 | 3300035691 | Bacteria | 3489 |
| 2 | JGI24743J22301_10008276 | 3300001991 | Bacteria | 1822 |
| 3 | JGI24738J21930_10019599 | 3300002075 | Bacteria | 1409 |
| 4 | JGI24749J21850_1006996 | 3300002076 | Bacteria | 1569 |
| 5 | JGI24744J21845_10004065 | 3300002077 | Bacteria | 3019 |
| 6 | Ga0070676_10010132 | 3300005328 | Bacteria | 5108 |
| 7 | Ga0070676_10291147 | 3300005328 | Bacteria | 1104 |
| 8 | Ga0070676_10429614 | 3300005328 | Bacteria | 925 |
| 9 | Ga0070683_100131163 | 3300005329 | Bacteria | 2372 |
| 10 | Ga0070683_100967627 | 3300005329 | Bacteria | 817 |
| 11 | Ga0070690_100389593 | 3300005330 | Bacteria | 1021 |
| 12 | Ga0070670_100037129 | 3300005331 | Bacteria | 4192 |
| 13 | Ga0070670_100042266 | 3300005331 | Bacteria | 3918 |
| 14 | Ga0070670_100227088 | 3300005331 | Bacteria | 1624 |
| 15 | Ga0070677_10028923 | 3300005333 | Bacteria | 2098 |
| 16 | Ga0070677_10158320 | 3300005333 | Bacteria | 1060 |
| 17 | Ga0068869_100159485 | 3300005334 | Bacteria | 1755 |
| 18 | Ga0068869_100315353 | 3300005334 | Bacteria | 1267 |
| 19 | Ga0068869_100632026 | 3300005334 | Bacteria | 907 |
| 20 | Ga0070666_10290282 | 3300005335 | Bacteria | 1164 |
| 21 | Ga0070680_100766078 | 3300005336 | Bacteria | 831 |
| 22 | Ga0070682_100033503 | 3300005337 | Bacteria | 3121 |
| 23 | Ga0070682_100188686 | 3300005337 | Bacteria | 1446 |
| 24 | Ga0068868_100012463 | 3300005338 | Bacteria | 6217 |
| 25 | Ga0070660_100781287 | 3300005339 | Bacteria | 803 |
| 26 | Ga0070660_100824709 | 3300005339 | Bacteria | 781 |
| 27 | Ga0070691_10051500 | 3300005341 | Bacteria | 1966 |
| 28 | Ga0070691_10537231 | 3300005341 | Bacteria | 681 |
| 29 | Ga0070687_100045602 | 3300005343 | Bacteria | 2240 |
| 30 | Ga0070661_100091301 | 3300005344 | Bacteria | 2256 |
| 31 | Ga0070661_100362261 | 3300005344 | Bacteria | 1140 |
| 32 | Ga0070692_10126546 | 3300005345 | Bacteria | 1431 |
| 33 | Ga0070668_100038849 | 3300005347 | Bacteria | 3640 |
| 34 | Ga0070669_100249268 | 3300005353 | Bacteria | 1413 |
| 35 | Ga0070669_100612272 | 3300005353 | Bacteria | 913 |
| 36 | Ga0070675_100022532 | 3300005354 | Bacteria | 5034 |
| 37 | Ga0070675_100062394 | 3300005354 | Bacteria | 3079 |
| 38 | Ga0070675_100143937 | 3300005354 | Bacteria | 2039 |
| 39 | Ga0070671_100004705 | 3300005355 | Bacteria | 10843 |
| 40 | Ga0070671_100073249 | 3300005355 | Bacteria | 2861 |
| 41 | Ga0070671_100178442 | 3300005355 | Bacteria | 1798 |
| 42 | Ga0070671_100367032 | 3300005355 | Bacteria | 1229 |
| 43 | Ga0070674_100044314 | 3300005356 | Bacteria | 3032 |
| 44 | Ga0070674_100522119 | 3300005356 | Bacteria | 992 |
| 45 | Ga0070673_100002526 | 3300005364 | Bacteria | 11177 |
| 46 | Ga0070673_100050752 | 3300005364 | Bacteria | 3245 |
| 47 | Ga0070673_100234311 | 3300005364 | Bacteria | 1593 |
| 48 | Ga0070673_100592428 | 3300005364 | Bacteria | 1010 |
| 49 | Ga0070688_100006700 | 3300005365 | Bacteria | 6173 |
| 50 | Ga0070688_100070757 | 3300005365 | Bacteria | 2231 |
| 51 | Ga0070688_100082373 | 3300005365 | Bacteria | 2085 |
| 52 | Ga0070659_100097485 | 3300005366 | Bacteria | 2363 |
| 53 | Ga0070659_100146881 | 3300005366 | Bacteria | 1922 |
| 54 | Ga0070659_100854114 | 3300005366 | Bacteria | 794 |
| 55 | Ga0070667_100024089 | 3300005367 | Bacteria | 5055 |
| 56 | Ga0070667_100110865 | 3300005367 | Bacteria | 2379 |
| 57 | Ga0070667_100153625 | 3300005367 | Bacteria | 2024 |
| 58 | Ga0070667_100237790 | 3300005367 | Bacteria | 1625 |
| 59 | Ga0070709_10015893 | 3300005434 | Bacteria | 4286 |
| 60 | Ga0070709_10178416 | 3300005434 | Bacteria | 1490 |
| 61 | Ga0070709_10296512 | 3300005434 | Bacteria | 1180 |
| 62 | Ga0070714_100009596 | 3300005435 | Bacteria | 7616 |
| 63 | Ga0070714_100177361 | 3300005435 | Bacteria | 1937 |
| 64 | Ga0070714_100293369 | 3300005435 | Bacteria | 1514 |
| 65 | Ga0070714_100299854 | 3300005435 | Bacteria | 1498 |
| 66 | Ga0070714_100344895 | 3300005435 | Bacteria | 1397 |
| 67 | Ga0070714_100369128 | 3300005435 | Bacteria | 1351 |
| 68 | Ga0070714_101981411 | 3300005435 | Bacteria | 568 |
| 69 | Ga0070713_100023207 | 3300005436 | Bacteria | 4810 |
| 70 | Ga0070713_100140693 | 3300005436 | Bacteria | 2137 |
| 71 | Ga0070713_100321661 | 3300005436 | Bacteria | 1429 |
| 72 | Ga0070713_100354639 | 3300005436 | Bacteria | 1361 |
| 73 | Ga0070713_100887828 | 3300005436 | Bacteria | 857 |
| 74 | Ga0070710_10078341 | 3300005437 | Bacteria | 1923 |
| 75 | Ga0070710_10101699 | 3300005437 | Bacteria | 1712 |
| 76 | Ga0070710_10305534 | 3300005437 | Bacteria | 1039 |
| 77 | Ga0070711_100012744 | 3300005439 | Bacteria | 5263 |
| 78 | Ga0070711_100017205 | 3300005439 | Bacteria | 4601 |
| 79 | Ga0070711_101237268 | 3300005439 | Bacteria | 646 |
| 80 | Ga0070705_100206195 | 3300005440 | Bacteria | 1352 |
| 81 | Ga0070705_100850929 | 3300005440 | Bacteria | 730 |
| 82 | Ga0070700_100005809 | 3300005441 | Bacteria | 6550 |
| 83 | Ga0070700_100245461 | 3300005441 | Bacteria | 1282 |
| 84 | Ga0070694_100227859 | 3300005444 | Bacteria | 1401 |
| 85 | Ga0070694_100540643 | 3300005444 | Bacteria | 932 |
| 86 | Ga0070708_100157482 | 3300005445 | Bacteria | 2115 |
| 87 | Ga0070663_100006837 | 3300005455 | Bacteria | 6899 |
| 88 | Ga0070663_100054252 | 3300005455 | Bacteria | 2864 |
| 89 | Ga0070678_100052084 | 3300005456 | Bacteria | 2970 |
| 90 | Ga0070662_100084961 | 3300005457 | Bacteria | 2365 |
| 91 | Ga0070681_10070822 | 3300005458 | Bacteria | 3451 |
| 92 | Ga0070681_10283925 | 3300005458 | Bacteria | 1566 |
| 93 | Ga0070681_11342958 | 3300005458 | Bacteria | 638 |
| 94 | Ga0068867_100030007 | 3300005459 | Bacteria | 3921 |
| 95 | Ga0068867_100423799 | 3300005459 | Bacteria | 1128 |
| 96 | Ga0068867_100597886 | 3300005459 | Bacteria | 962 |
| 97 | Ga0070685_10027871 | 3300005466 | Bacteria | 3125 |
| 98 | Ga0070685_10048090 | 3300005466 | Bacteria | 2455 |
| 99 | Ga0070685_10266737 | 3300005466 | Bacteria | 1141 |
| 100 | Ga0070699_100003079 | 3300005518 | Bacteria | 14781 |
| 101 | Ga0070699_100234482 | 3300005518 | Bacteria | 1637 |
| 102 | Ga0070699_100925136 | 3300005518 | Unclassified | 799 |
| 103 | Ga0070679_100149645 | 3300005530 | Bacteria | 2312 |
| 104 | Ga0070679_100168669 | 3300005530 | Bacteria | 2162 |
| 105 | Ga0070679_100170013 | 3300005530 | Bacteria | 2153 |
| 106 | Ga0070684_100056674 | 3300005535 | Bacteria | 3420 |
| 107 | Ga0070684_100358743 | 3300005535 | Bacteria | 1341 |
| 108 | Ga0070697_100070139 | 3300005536 | Bacteria | 2872 |
| 109 | Ga0070697_100407141 | 3300005536 | Bacteria | 1181 |
| 110 | Ga0070697_100866467 | 3300005536 | Bacteria | 800 |
| 111 | Ga0068853_100146317 | 3300005539 | Bacteria | 2124 |
| 112 | Ga0068853_100359634 | 3300005539 | Bacteria | 1356 |
| 113 | Ga0070672_100009171 | 3300005543 | Bacteria | 6809 |
| 114 | Ga0070672_100255893 | 3300005543 | Bacteria | 1475 |
| 115 | Ga0070672_100607621 | 3300005543 | Bacteria | 953 |
| 116 | Ga0070686_100006640 | 3300005544 | Bacteria | 6440 |
| 117 | Ga0070696_100211866 | 3300005546 | Bacteria | 1451 |
| 118 | Ga0070693_100014227 | 3300005547 | Bacteria | 4072 |
| 119 | Ga0070693_100136974 | 3300005547 | Bacteria | 1537 |
| 120 | Ga0070693_100629846 | 3300005547 | Bacteria | 778 |
| 121 | Ga0070665_100001012 | 3300005548 | Bacteria | 35432 |
| 122 | Ga0070665_100041199 | 3300005548 | Bacteria | 4641 |
| 123 | Ga0070665_100159902 | 3300005548 | Bacteria | 2254 |
| 124 | Ga0070665_100345792 | 3300005548 | Bacteria | 1492 |
| 125 | Ga0070704_100080614 | 3300005549 | Bacteria | 2394 |
| 126 | Ga0070704_101388150 | 3300005549 | Bacteria | 644 |
| 127 | Ga0068855_100020534 | 3300005563 | Bacteria | 7921 |
| 128 | Ga0068855_100294745 | 3300005563 | Bacteria | 1797 |
| 129 | Ga0070664_100021847 | 3300005564 | Bacteria | 5275 |
| 130 | Ga0070664_100026102 | 3300005564 | Bacteria | 4843 |
| 131 | Ga0070664_100484077 | 3300005564 | Bacteria | 1139 |
| 132 | Ga0070664_100639084 | 3300005564 | Bacteria | 988 |
| 133 | Ga0068857_100944999 | 3300005577 | Bacteria | 828 |
| 134 | Ga0068854_100096451 | 3300005578 | Bacteria | 2209 |
| 135 | Ga0068856_100061140 | 3300005614 | Bacteria | 3721 |
| 136 | Ga0068856_100167666 | 3300005614 | Bacteria | 2207 |
| 137 | Ga0068856_100924022 | 3300005614 | Bacteria | 891 |
| 138 | Ga0070702_100006284 | 3300005615 | Bacteria | 5612 |
| 139 | Ga0070702_100252240 | 3300005615 | Bacteria | 1197 |
| 140 | Ga0070702_100376660 | 3300005615 | Bacteria | 1008 |
| 141 | Ga0068852_100561637 | 3300005616 | Bacteria | 1142 |
| 142 | Ga0068852_101107232 | 3300005616 | Bacteria | 812 |
| 143 | Ga0068859_100058887 | 3300005617 | Bacteria | 3870 |
| 144 | Ga0068859_100761932 | 3300005617 | Bacteria | 1057 |
| 145 | Ga0068864_100017542 | 3300005618 | Bacteria | 5969 |
| 146 | Ga0068866_10014866 | 3300005718 | Bacteria | 3446 |
| 147 | Ga0068866_10515177 | 3300005718 | Bacteria | 794 |
| 148 | Ga0068861_100091690 | 3300005719 | Bacteria | 2399 |
| 149 | Ga0068861_100680651 | 3300005719 | Bacteria | 954 |
| 150 | Ga0068861_100862000 | 3300005719 | Bacteria | 855 |
| 151 | Ga0068851_10010488 | 3300005834 | Bacteria | 4328 |
| 152 | Ga0068870_10002049 | 3300005840 | Bacteria | 8335 |
| 153 | Ga0068863_100006984 | 3300005841 | Bacteria | 11070 |
| 154 | Ga0068863_100053205 | 3300005841 | Bacteria | 3836 |
| 155 | Ga0068863_100367288 | 3300005841 | Bacteria | 1404 |
| 156 | Ga0068858_100010895 | 3300005842 | Bacteria | 8594 |
| 157 | Ga0068858_100037711 | 3300005842 | Bacteria | 4483 |
| 158 | Ga0068858_100232082 | 3300005842 | Bacteria | 1750 |
| 159 | Ga0068858_100379127 | 3300005842 | Bacteria | 1357 |
| 160 | Ga0068858_100625273 | 3300005842 | Bacteria | 1045 |
| 161 | Ga0068860_100017523 | 3300005843 | Bacteria | 6979 |
| 162 | Ga0068860_100159329 | 3300005843 | Bacteria | 2176 |
| 163 | Ga0068862_100023431 | 3300005844 | Bacteria | 5173 |
| 164 | Ga0068862_100177245 | 3300005844 | Bacteria | 1911 |
| 165 | Ga0068862_100238086 | 3300005844 | Bacteria | 1654 |
| 166 | Ga0068862_100422025 | 3300005844 | Bacteria | 1252 |
| 167 | Ga0081455_10007792 | 3300005937 | Bacteria | 11218 |
| 168 | Ga0081455_10011777 | 3300005937 | Bacteria | 8759 |
| 169 | Ga0081455_10035563 | 3300005937 | Bacteria | 4449 |
| 170 | Ga0081455_10040696 | 3300005937 | Bacteria | 4096 |
| 171 | Ga0081455_10138379 | 3300005937 | Bacteria | 1894 |
| 172 | Ga0081538_10182823 | 3300005981 | Bacteria | 894 |
| 173 | Ga0081540_1059256 | 3300005983 | Bacteria | 1839 |
| 174 | Ga0070717_10088050 | 3300006028 | Bacteria | 2616 |
| 175 | Ga0075365_10101064 | 3300006038 | Bacteria | 1974 |
| 176 | Ga0075365_10132703 | 3300006038 | Bacteria | 1724 |
| 177 | Ga0075363_100279944 | 3300006048 | Bacteria | 965 |
| 178 | Ga0075363_100856405 | 3300006048 | Bacteria | 555 |
| 179 | Ga0075364_10075165 | 3300006051 | Bacteria | 2229 |
| 180 | Ga0075364_10479698 | 3300006051 | Bacteria | 850 |
| 181 | Ga0075432_10022951 | 3300006058 | Bacteria | 2136 |
| 182 | Ga0070715_10012023 | 3300006163 | Bacteria | 3134 |
| 183 | Ga0070715_10040408 | 3300006163 | Bacteria | 1950 |
| 184 | Ga0070715_10100872 | 3300006163 | Bacteria | 1346 |
| 185 | Ga0070716_100003890 | 3300006173 | Bacteria | 7086 |
| 186 | Ga0070716_100317349 | 3300006173 | Bacteria | 1090 |
| 187 | Ga0070716_100382337 | 3300006173 | Bacteria | 1006 |
| 188 | Ga0070716_100816999 | 3300006173 | Bacteria | 723 |
| 189 | Ga0070712_100051478 | 3300006175 | Bacteria | 2869 |
| 190 | Ga0070712_100212919 | 3300006175 | Bacteria | 1525 |
| 191 | Ga0070712_100427677 | 3300006175 | Bacteria | 1098 |
| 192 | Ga0097621_100016816 | 3300006237 | Bacteria | 5543 |
| 193 | Ga0097621_100047030 | 3300006237 | Bacteria | 3494 |
| 194 | Ga0097621_100379283 | 3300006237 | Bacteria | 1263 |
| 195 | Ga0075370_10000017 | 3300006353 | Bacteria | 60451 |
| 196 | Ga0068871_100130362 | 3300006358 | Bacteria | 2132 |
| 197 | Ga0068871_100277060 | 3300006358 | Bacteria | 1466 |
| 198 | Ga0075428_100023649 | 3300006844 | Bacteria | 6802 |
| 199 | Ga0075428_100049682 | 3300006844 | Bacteria | 4602 |
| 200 | Ga0075430_100000289 | 3300006846 | Bacteria | 35411 |
| 201 | Ga0075430_100048214 | 3300006846 | Bacteria | 3596 |
| 202 | Ga0075431_100004032 | 3300006847 | Bacteria | 14306 |
| 203 | Ga0075431_100020240 | 3300006847 | Bacteria | 6797 |
| 204 | Ga0075431_100151933 | 3300006847 | Bacteria | 2384 |
| 205 | Ga0075431_100357206 | 3300006847 | Bacteria | 1468 |
| 206 | Ga0075431_101091588 | 3300006847 | Bacteria | 763 |
| 207 | Ga0075433_10000876 | 3300006852 | Bacteria | 21135 |
| 208 | Ga0075433_10646888 | 3300006852 | Bacteria | 927 |
| 209 | Ga0075433_10996756 | 3300006852 | Bacteria | 730 |
| 210 | Ga0075434_100013982 | 3300006871 | Bacteria | 7660 |
| 211 | Ga0075434_100027434 | 3300006871 | Bacteria | 5590 |
| 212 | Ga0075434_100036362 | 3300006871 | Bacteria | 4871 |
| 213 | Ga0075434_100074539 | 3300006871 | Bacteria | 3387 |
| 214 | Ga0075434_100102896 | 3300006871 | Bacteria | 2864 |
| 215 | Ga0075434_100113080 | 3300006871 | Bacteria | 2727 |
| 216 | Ga0075434_100204758 | 3300006871 | Bacteria | 1993 |
| 217 | Ga0075434_100332520 | 3300006871 | Bacteria | 1540 |
| 218 | Ga0075434_100849002 | 3300006871 | Bacteria | 929 |
| 219 | Ga0075434_100927960 | 3300006871 | Bacteria | 885 |
| 220 | Ga0075434_100944093 | 3300006871 | Bacteria | 877 |
| 221 | Ga0075429_100154082 | 3300006880 | Bacteria | 2012 |
| 222 | Ga0075429_100482051 | 3300006880 | Bacteria | 1087 |
| 223 | Ga0068865_100023750 | 3300006881 | Bacteria | 4018 |
| 224 | Ga0068865_100487407 | 3300006881 | Bacteria | 1026 |
| 225 | Ga0075436_100010397 | 3300006914 | Bacteria | 6377 |
| 226 | Ga0075436_100238138 | 3300006914 | Bacteria | 1294 |
| 227 | Ga0075436_100256686 | 3300006914 | Bacteria | 1246 |
| 228 | Ga0075436_100391327 | 3300006914 | Bacteria | 1006 |
| 229 | Ga0075436_100456722 | 3300006914 | Bacteria | 931 |
| 230 | Ga0097620_100058887 | 3300006931 | Bacteria | 3870 |
| 231 | Ga0097620_100761864 | 3300006931 | Bacteria | 1057 |
| 232 | Ga0075435_100100270 | 3300007076 | Bacteria | 2399 |
| 233 | Ga0075435_100137595 | 3300007076 | Bacteria | 2047 |
| 234 | Ga0075435_100293400 | 3300007076 | Bacteria | 1390 |
| 235 | Ga0075435_100362343 | 3300007076 | Bacteria | 1244 |
| 236 | Ga0075435_100443986 | 3300007076 | Bacteria | 1118 |
| 237 | Ga0075435_100780540 | 3300007076 | Bacteria | 832 |
| 238 | Ga0099795_10000155 | 3300007788 | Bacteria | 11496 |
| 239 | Ga0099795_10033267 | 3300007788 | Bacteria | 1789 |
| 240 | Ga0099795_10051080 | 3300007788 | Bacteria | 1506 |
| 241 | Ga0105251_10076460 | 3300009011 | Bacteria | 1553 |
| 242 | Ga0111539_10042647 | 3300009094 | Bacteria | 5446 |
| 243 | Ga0111539_10047277 | 3300009094 | Bacteria | 5143 |
| 244 | Ga0111539_10399377 | 3300009094 | Bacteria | 1601 |
| 245 | Ga0111539_10696421 | 3300009094 | Bacteria | 1183 |
| 246 | Ga0105245_10053832 | 3300009098 | Bacteria | 3613 |
| 247 | Ga0105245_10226194 | 3300009098 | Bacteria | 1807 |
| 248 | Ga0105247_10005284 | 3300009101 | Bacteria | 8149 |
| 249 | Ga0105247_10167490 | 3300009101 | Bacteria | 1459 |
| 250 | Ga0105247_10237174 | 3300009101 | Bacteria | 1241 |
| 251 | Ga0114129_10011626 | 3300009147 | Bacteria | 12531 |
| 252 | Ga0114129_10058921 | 3300009147 | Bacteria | 5370 |
| 253 | Ga0114129_10277458 | 3300009147 | Bacteria | 2240 |
| 254 | Ga0114129_10640221 | 3300009147 | Bacteria | 1373 |
| 255 | Ga0105243_10013566 | 3300009148 | Bacteria | 6165 |
| 256 | Ga0105243_10026897 | 3300009148 | Bacteria | 4406 |
| 257 | Ga0105243_10347844 | 3300009148 | Bacteria | 1360 |
| 258 | Ga0105242_10034745 | 3300009176 | Bacteria | 4042 |
| 259 | Ga0105242_10073375 | 3300009176 | Bacteria | 2845 |
| 260 | Ga0105242_10080181 | 3300009176 | Bacteria | 2728 |
| 261 | Ga0105248_10108918 | 3300009177 | Bacteria | 3124 |
| 262 | Ga0105248_10225559 | 3300009177 | Bacteria | 2109 |
| 263 | Ga0105248_10509852 | 3300009177 | Bacteria | 1356 |
| 264 | Ga0105248_12579743 | 3300009177 | Bacteria | 579 |
| 265 | Ga0105237_10110797 | 3300009545 | Bacteria | 2737 |
| 266 | Ga0105237_10175679 | 3300009545 | Bacteria | 2142 |
| 267 | Ga0105237_10559044 | 3300009545 | Bacteria | 1151 |
| 268 | Ga0105237_10852574 | 3300009545 | Bacteria | 918 |
| 269 | Ga0105238_10031494 | 3300009551 | Bacteria | 5400 |
| 270 | Ga0105238_10081506 | 3300009551 | Bacteria | 3225 |
| 271 | Ga0105238_10434345 | 3300009551 | Bacteria | 1309 |
| 272 | Ga0105238_10838665 | 3300009551 | Bacteria | 936 |
| 273 | Ga0105238_11048765 | 3300009551 | Bacteria | 837 |
| 274 | Ga0105249_10027648 | 3300009553 | Bacteria | 5118 |
| 275 | Ga0105249_10216203 | 3300009553 | Bacteria | 1884 |
| 276 | Ga0105249_10421967 | 3300009553 | Bacteria | 1368 |
| 277 | Ga0105249_11207701 | 3300009553 | Bacteria | 827 |
| 278 | Ga0099796_10002365 | 3300010159 | Bacteria | 4124 |
| 279 | Ga0099796_10025873 | 3300010159 | Bacteria | 1858 |
| 280 | Ga0105239_10030786 | 3300010375 | Bacteria | 5902 |
| 281 | Ga0105239_10258088 | 3300010375 | Bacteria | 1958 |
| 282 | Ga0105239_10370290 | 3300010375 | Bacteria | 1619 |
| 283 | Ga0105239_10570004 | 3300010375 | Bacteria | 1290 |
| 284 | Ga0105239_10992767 | 3300010375 | Bacteria | 965 |
| 285 | Ga0105246_10006998 | 3300011119 | Bacteria | 6900 |
| 286 | Ga0105246_10029073 | 3300011119 | Bacteria | 3636 |
| 287 | Ga0157373_10177262 | 3300013100 | Bacteria | 1500 |
| 288 | Ga0157373_10200317 | 3300013100 | Bacteria | 1407 |
| 289 | Ga0157373_10643183 | 3300013100 | Bacteria | 774 |
| 290 | Ga0157369_10973475 | 3300013105 | Bacteria | 869 |
| 291 | Ga0157369_11768110 | 3300013105 | Bacteria | 628 |
| 292 | Ga0157369_11782306 | 3300013105 | Bacteria | 625 |
| 293 | Ga0157374_10014492 | 3300013296 | Bacteria | 6899 |
| 294 | Ga0157374_10687904 | 3300013296 | Bacteria | 1035 |
| 295 | Ga0157374_11002208 | 3300013296 | Bacteria | 854 |
| 296 | Ga0157378_10137966 | 3300013297 | Bacteria | 2262 |
| 297 | Ga0157378_10169708 | 3300013297 | Bacteria | 2045 |
| 298 | Ga0163162_10118520 | 3300013306 | Bacteria | 2749 |
| 299 | Ga0163162_10280976 | 3300013306 | Bacteria | 1797 |
| 300 | Ga0163162_11303424 | 3300013306 | Bacteria | 825 |
| 301 | Ga0157375_10054029 | 3300013308 | Bacteria | 3955 |
| 302 | Ga0157375_10689284 | 3300013308 | Bacteria | 1176 |
| 303 | Ga0157375_10891826 | 3300013308 | Bacteria | 1034 |
| 304 | Ga0157375_10903499 | 3300013308 | Bacteria | 1027 |
| 305 | Ga0157375_11436196 | 3300013308 | Bacteria | 813 |
| 306 | Ga0163163_10029928 | 3300014325 | Bacteria | 5241 |
| 307 | Ga0163163_12460805 | 3300014325 | Bacteria | 579 |
| 308 | Ga0157380_10009560 | 3300014326 | Bacteria | 6958 |
| 309 | Ga0157380_10497722 | 3300014326 | Bacteria | 1183 |
| 310 | Ga0157380_10816146 | 3300014326 | Bacteria | 951 |
| 311 | Ga0157377_10051394 | 3300014745 | Bacteria | 2324 |
| 312 | Ga0157377_10313230 | 3300014745 | Bacteria | 1040 |
| 313 | Ga0157379_10010012 | 3300014968 | Bacteria | 8260 |
| 314 | Ga0157379_10060131 | 3300014968 | Bacteria | 3396 |
| 315 | Ga0157379_10205956 | 3300014968 | Bacteria | 1779 |
| 316 | Ga0157376_10081801 | 3300014969 | Bacteria | 2773 |
| 317 | Ga0157376_10408983 | 3300014969 | Bacteria | 1314 |
| 318 | Ga0157376_10429451 | 3300014969 | Bacteria | 1284 |
| 319 | Ga0157376_12677839 | 3300014969 | Bacteria | 538 |
| 320 | Ga0163161_10570926 | 3300017792 | Bacteria | 929 |
| 321 | Ga0206353_10336957 | 3300020082 | Bacteria | 1290 |
| 322 | Ga0213876_10021103 | 3300021384 | Bacteria | 3444 |
| 323 | Ga0213876_10075402 | 3300021384 | Bacteria | 1781 |
| 324 | Ga0224572_1041045 | 3300024225 | Bacteria | 871 |
| 325 | Ga0207682_10004304 | 3300025893 | Bacteria | 5984 |
| 326 | Ga0207692_10065548 | 3300025898 | Bacteria | 1895 |
| 327 | Ga0207692_10157997 | 3300025898 | Bacteria | 1304 |
| 328 | Ga0207642_10002862 | 3300025899 | Bacteria | 5389 |
| 329 | Ga0207710_10005081 | 3300025900 | Bacteria | 5693 |
| 330 | Ga0207710_10145822 | 3300025900 | Bacteria | 1146 |
| 331 | Ga0207688_10003853 | 3300025901 | Bacteria | 8180 |
| 332 | Ga0207680_10259597 | 3300025903 | Bacteria | 1202 |
| 333 | Ga0207680_10840478 | 3300025903 | Bacteria | 658 |
| 334 | Ga0207685_10023444 | 3300025905 | Bacteria | 2101 |
| 335 | Ga0207685_10023701 | 3300025905 | Bacteria | 2093 |
| 336 | Ga0207685_10080031 | 3300025905 | Bacteria | 1350 |
| 337 | Ga0207699_10103961 | 3300025906 | Bacteria | 1808 |
| 338 | Ga0207699_10212433 | 3300025906 | Bacteria | 1316 |
| 339 | Ga0207699_10281460 | 3300025906 | Bacteria | 1156 |
| 340 | Ga0207699_10797379 | 3300025906 | Bacteria | 694 |
| 341 | Ga0207645_10008911 | 3300025907 | Bacteria | 6968 |
| 342 | Ga0207645_10034810 | 3300025907 | Bacteria | 3236 |
| 343 | Ga0207645_10095104 | 3300025907 | Bacteria | 1918 |
| 344 | Ga0207643_10075441 | 3300025908 | Bacteria | 1946 |
| 345 | Ga0207705_10047756 | 3300025909 | Bacteria | 3078 |
| 346 | Ga0207684_10135277 | 3300025910 | Bacteria | 2116 |
| 347 | Ga0207654_10161477 | 3300025911 | Bacteria | 1448 |
| 348 | Ga0207671_10121561 | 3300025914 | Bacteria | 1996 |
| 349 | Ga0207693_10008314 | 3300025915 | Bacteria | 8494 |
| 350 | Ga0207693_10032860 | 3300025915 | Bacteria | 4095 |
| 351 | Ga0207693_10041720 | 3300025915 | Bacteria | 3612 |
| 352 | Ga0207693_10072476 | 3300025915 | Bacteria | 2697 |
| 353 | Ga0207693_10074112 | 3300025915 | Bacteria | 2666 |
| 354 | Ga0207693_10086221 | 3300025915 | Bacteria | 2460 |
| 355 | Ga0207693_10253141 | 3300025915 | Bacteria | 1382 |
| 356 | Ga0207663_10012783 | 3300025916 | Bacteria | 4546 |
| 357 | Ga0207663_10166074 | 3300025916 | Bacteria | 1563 |
| 358 | Ga0207663_10206571 | 3300025916 | Bacteria | 1420 |
| 359 | Ga0207663_10514316 | 3300025916 | Bacteria | 931 |
| 360 | Ga0207660_10111165 | 3300025917 | Bacteria | 2062 |
| 361 | Ga0207660_10351218 | 3300025917 | Bacteria | 1182 |
| 362 | Ga0207662_10000693 | 3300025918 | Bacteria | 15368 |
| 363 | Ga0207662_10141972 | 3300025918 | Bacteria | 1522 |
| 364 | Ga0207662_10146129 | 3300025918 | Bacteria | 1501 |
| 365 | Ga0207662_10744687 | 3300025918 | Bacteria | 689 |
| 366 | Ga0207657_10016020 | 3300025919 | Bacteria | 7235 |
| 367 | Ga0207657_10026642 | 3300025919 | Bacteria | 5306 |
| 368 | Ga0207657_10251515 | 3300025919 | Bacteria | 1408 |
| 369 | Ga0207657_10704699 | 3300025919 | Bacteria | 784 |
| 370 | Ga0207657_10987596 | 3300025919 | Bacteria | 646 |
| 371 | Ga0207649_10036891 | 3300025920 | Bacteria | 2948 |
| 372 | Ga0207649_10046063 | 3300025920 | Bacteria | 2677 |
| 373 | Ga0207649_10215320 | 3300025920 | Bacteria | 1365 |
| 374 | Ga0207649_10823825 | 3300025920 | Bacteria | 725 |
| 375 | Ga0207652_10059841 | 3300025921 | Bacteria | 3284 |
| 376 | Ga0207652_10349262 | 3300025921 | Bacteria | 1335 |
| 377 | Ga0207652_10564688 | 3300025921 | Bacteria | 1022 |
| 378 | Ga0207694_10076857 | 3300025924 | Bacteria | 2615 |
| 379 | Ga0207694_10464125 | 3300025924 | Bacteria | 1058 |
| 380 | Ga0207694_10681359 | 3300025924 | Bacteria | 867 |
| 381 | Ga0207650_10300624 | 3300025925 | Bacteria | 1310 |
| 382 | Ga0207659_10097227 | 3300025926 | Bacteria | 2211 |
| 383 | Ga0207659_10224811 | 3300025926 | Bacteria | 1511 |
| 384 | Ga0207659_10589377 | 3300025926 | Bacteria | 947 |
| 385 | Ga0207659_10871998 | 3300025926 | Bacteria | 774 |
| 386 | Ga0207687_10017557 | 3300025927 | Bacteria | 4713 |
| 387 | Ga0207687_10026807 | 3300025927 | Bacteria | 3861 |
| 388 | Ga0207687_10027584 | 3300025927 | Bacteria | 3812 |
| 389 | Ga0207700_10068458 | 3300025928 | Bacteria | 2721 |
| 390 | Ga0207700_10081651 | 3300025928 | Bacteria | 2525 |
| 391 | Ga0207700_10251305 | 3300025928 | Bacteria | 1510 |
| 392 | Ga0207700_10265912 | 3300025928 | Bacteria | 1470 |
| 393 | Ga0207700_10675154 | 3300025928 | Bacteria | 922 |
| 394 | Ga0207664_10164300 | 3300025929 | Bacteria | 1895 |
| 395 | Ga0207664_10210394 | 3300025929 | Bacteria | 1682 |
| 396 | Ga0207664_10299395 | 3300025929 | Bacteria | 1415 |
| 397 | Ga0207664_10314670 | 3300025929 | Bacteria | 1380 |
| 398 | Ga0207664_10452543 | 3300025929 | Bacteria | 1146 |
| 399 | Ga0207664_10570362 | 3300025929 | Bacteria | 1016 |
| 400 | Ga0207664_11087457 | 3300025929 | Bacteria | 715 |
| 401 | Ga0207644_10040756 | 3300025931 | Bacteria | 3283 |
| 402 | Ga0207644_10196119 | 3300025931 | Bacteria | 1590 |
| 403 | Ga0207644_10357890 | 3300025931 | Bacteria | 1186 |
| 404 | Ga0207690_10269245 | 3300025932 | Bacteria | 1323 |
| 405 | Ga0207690_10397491 | 3300025932 | Bacteria | 1098 |
| 406 | Ga0207690_10622651 | 3300025932 | Bacteria | 882 |
| 407 | Ga0207706_10008145 | 3300025933 | Bacteria | 9672 |
| 408 | Ga0207706_10011133 | 3300025933 | Bacteria | 8197 |
| 409 | Ga0207706_10469286 | 3300025933 | Bacteria | 1088 |
| 410 | Ga0207686_10259843 | 3300025934 | Bacteria | 1273 |
| 411 | Ga0207709_10116755 | 3300025935 | Bacteria | 1795 |
| 412 | Ga0207709_10231089 | 3300025935 | Bacteria | 1340 |
| 413 | Ga0207709_10280813 | 3300025935 | Bacteria | 1230 |
| 414 | Ga0207670_10092143 | 3300025936 | Bacteria | 2144 |
| 415 | Ga0207670_10311271 | 3300025936 | Bacteria | 1236 |
| 416 | Ga0207669_10022401 | 3300025937 | Bacteria | 3355 |
| 417 | Ga0207669_10087347 | 3300025937 | Bacteria | 2019 |
| 418 | Ga0207669_10141880 | 3300025937 | Bacteria | 1669 |
| 419 | Ga0207669_10278019 | 3300025937 | Bacteria | 1261 |
| 420 | Ga0207704_10171834 | 3300025938 | Bacteria | 1555 |
| 421 | Ga0207704_10389020 | 3300025938 | Bacteria | 1097 |
| 422 | Ga0207665_10001692 | 3300025939 | Bacteria | 14821 |
| 423 | Ga0207665_10013008 | 3300025939 | Bacteria | 5468 |
| 424 | Ga0207665_10076606 | 3300025939 | Bacteria | 2294 |
| 425 | Ga0207691_10005013 | 3300025940 | Bacteria | 12770 |
| 426 | Ga0207691_10008399 | 3300025940 | Bacteria | 9924 |
| 427 | Ga0207691_10404292 | 3300025940 | Bacteria | 1164 |
| 428 | Ga0207711_10030381 | 3300025941 | Bacteria | 4557 |
| 429 | Ga0207711_10156864 | 3300025941 | Bacteria | 2057 |
| 430 | Ga0207711_10173906 | 3300025941 | Bacteria | 1955 |
| 431 | Ga0207689_10005881 | 3300025942 | Bacteria | 10868 |
| 432 | Ga0207689_10455564 | 3300025942 | Bacteria | 1069 |
| 433 | Ga0207661_10259737 | 3300025944 | Bacteria | 1547 |
| 434 | Ga0207661_11141449 | 3300025944 | Bacteria | 717 |
| 435 | Ga0207679_10057204 | 3300025945 | Bacteria | 2883 |
| 436 | Ga0207679_10112391 | 3300025945 | Bacteria | 2153 |
| 437 | Ga0207679_10444545 | 3300025945 | Bacteria | 1149 |
| 438 | Ga0207667_10055460 | 3300025949 | Bacteria | 4166 |
| 439 | Ga0207667_10209651 | 3300025949 | Bacteria | 1997 |
| 440 | Ga0207667_10381335 | 3300025949 | Bacteria | 1436 |
| 441 | Ga0207651_10079631 | 3300025960 | Bacteria | 2354 |
| 442 | Ga0207651_10108614 | 3300025960 | Bacteria | 2077 |
| 443 | Ga0207651_10173629 | 3300025960 | Bacteria | 1702 |
| 444 | Ga0207651_10896002 | 3300025960 | Bacteria | 790 |
| 445 | Ga0207712_10466177 | 3300025961 | Bacteria | 1074 |
| 446 | Ga0207712_10633154 | 3300025961 | Bacteria | 928 |
| 447 | Ga0207668_10020859 | 3300025972 | Bacteria | 4171 |
| 448 | Ga0207668_10259673 | 3300025972 | Bacteria | 1415 |
| 449 | Ga0207668_10292110 | 3300025972 | Bacteria | 1341 |
| 450 | Ga0207658_10144036 | 3300025986 | Bacteria | 1932 |
| 451 | Ga0207658_10242763 | 3300025986 | Bacteria | 1527 |
| 452 | Ga0207677_10006534 | 3300026023 | Bacteria | 6403 |
| 453 | Ga0207703_10018288 | 3300026035 | Bacteria | 5473 |
| 454 | Ga0207703_10234200 | 3300026035 | Bacteria | 1648 |
| 455 | Ga0207703_10327094 | 3300026035 | Bacteria | 1405 |
| 456 | Ga0207703_11632373 | 3300026035 | Bacteria | 620 |
| 457 | Ga0207639_10118817 | 3300026041 | Bacteria | 2168 |
| 458 | Ga0207639_10221488 | 3300026041 | Bacteria | 1634 |
| 459 | Ga0207639_11245622 | 3300026041 | Bacteria | 698 |
| 460 | Ga0207678_10010183 | 3300026067 | Bacteria | 8254 |
| 461 | Ga0207678_10013601 | 3300026067 | Bacteria | 7149 |
| 462 | Ga0207678_10050732 | 3300026067 | Bacteria | 3584 |
| 463 | Ga0207708_10002044 | 3300026075 | Bacteria | 14870 |
| 464 | Ga0207702_10397283 | 3300026078 | Bacteria | 1329 |
| 465 | Ga0207702_11867673 | 3300026078 | Bacteria | 592 |
| 466 | Ga0207702_12157644 | 3300026078 | Bacteria | 546 |
| 467 | Ga0207641_10062764 | 3300026088 | Bacteria | 3172 |
| 468 | Ga0207641_10068042 | 3300026088 | Bacteria | 3052 |
| 469 | Ga0207648_10017876 | 3300026089 | Bacteria | 6434 |
| 470 | Ga0207648_10317219 | 3300026089 | Bacteria | 1400 |
| 471 | Ga0207648_10448522 | 3300026089 | Bacteria | 1174 |
| 472 | Ga0207676_10008832 | 3300026095 | Bacteria | 7171 |
| 473 | Ga0207676_10401822 | 3300026095 | Bacteria | 1280 |
| 474 | Ga0207675_100015353 | 3300026118 | Bacteria | 7144 |
| 475 | Ga0207683_10012796 | 3300026121 | Bacteria | 7161 |
| 476 | Ga0207683_10031611 | 3300026121 | Bacteria | 4594 |
| 477 | Ga0207683_10040556 | 3300026121 | Bacteria | 4063 |
| 478 | Ga0207683_10205089 | 3300026121 | Bacteria | 1793 |
| 479 | Ga0207698_10004892 | 3300026142 | Bacteria | 8216 |
| 480 | Ga0207698_10054719 | 3300026142 | Bacteria | 3072 |
| 481 | Ga0209179_1010263 | 3300027512 | Bacteria | 1629 |
| 482 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 483 | Ga0207428_10279237 | 3300027907 | Bacteria | 1240 |
| 484 | Ga0207428_10770414 | 3300027907 | Bacteria | 685 |
| 485 | Ga0268266_10000198 | 3300028379 | Bacteria | 104891 |
| 486 | Ga0268266_10041131 | 3300028379 | Bacteria | 3942 |
| 487 | Ga0268265_11247499 | 3300028380 | Bacteria | 742 |
| 488 | Ga0268264_10052038 | 3300028381 | Bacteria | 3414 |
| 489 | Ga0268264_10114234 | 3300028381 | Bacteria | 2370 |
| 490 | Ga0265318_10016787 | 3300028577 | Bacteria | 3017 |
| 491 | Ga0265338_10841493 | 3300028800 | Bacteria | 627 |
| 492 | Ga0265760_10015442 | 3300031090 | Bacteria | 2189 |
| 493 | Ga0265330_10005300 | 3300031235 | Bacteria | 6425 |
| 494 | Ga0265332_10019675 | 3300031238 | Bacteria | 2980 |
| 495 | Ga0265332_10353991 | 3300031238 | Bacteria | 606 |
| 496 | Ga0265325_10014651 | 3300031241 | Bacteria | 4424 |
| 497 | Ga0265340_10003863 | 3300031247 | Bacteria | 8437 |
| 498 | Ga0265340_10041001 | 3300031247 | Bacteria | 2278 |
| 499 | Ga0265339_10027747 | 3300031249 | Bacteria | 3225 |
| 500 | Ga0265331_10186700 | 3300031250 | Bacteria | 935 |
| 501 | Ga0265316_10228287 | 3300031344 | Bacteria | 1372 |
| 502 | Ga0265313_10005489 | 3300031595 | Bacteria | 9305 |
| 503 | Ga0265313_10045452 | 3300031595 | Bacteria | 2138 |
| 504 | Ga0265313_10045717 | 3300031595 | Bacteria | 2130 |
| 505 | Ga0316579_10089162 | 3300031691 | Bacteria | 1472 |
| 506 | Ga0265314_10305981 | 3300031711 | Bacteria | 890 |
| 507 | Ga0265342_10007891 | 3300031712 | Bacteria | 7723 |
| 508 | Ga0316578_10167345 | 3300031728 | Bacteria | 1325 |
| 509 | Ga0307412_10182993 | 3300031911 | Bacteria | 1578 |
| 510 | Ga0307412_11217917 | 3300031911 | Bacteria | 675 |
| 511 | Ga0307414_10235468 | 3300032004 | Bacteria | 1512 |
| 512 | Ga0373938_0033395 | 3300034957 | Bacteria | 1113 |
| 513 | Ga0373926_0038437 | 3300035083 | Bacteria | 1704 |
| 514 | Ga0373934_0185478 | 3300035086 | Bacteria | 855 |
| 515 | Ga0373934_0202130 | 3300035086 | Bacteria | 818 |
| 516 | Ga0373940_0126325 | 3300035088 | Bacteria | 798 |
| 517 | Ga0373944_0006495 | 3300035089 | Bacteria | 3106 |
| 518 | Ga0373944_0011226 | 3300035089 | Bacteria | 2451 |
| 519 | Ga0373944_0012806 | 3300035089 | Bacteria | 2317 |
| 520 | Ga0373949_0002518 | 3300035090 | Bacteria | 4670 |
| 521 | Ga0373952_0133415 | 3300035092 | Bacteria | 684 |
| 522 | Ga0373952_0190729 | 3300035092 | Bacteria | 596 |
| 523 | Ga0373923_0078311 | 3300035111 | Bacteria | 1430 |
| 524 | Ga0373923_0153979 | 3300035111 | Bacteria | 1045 |
| 525 | Ga0373932_0014941 | 3300035112 | Bacteria | 1961 |
| 526 | Ga0373932_0032855 | 3300035112 | Bacteria | 1454 |
| 527 | Ga0373936_0008876 | 3300035113 | Bacteria | 3790 |
| 528 | Ga0373936_0014386 | 3300035113 | Bacteria | 3024 |
| 529 | Ga0373936_0176283 | 3300035113 | Bacteria | 936 |
| 530 | Ga0373936_0395471 | 3300035113 | Bacteria | 634 |
| 531 | Ga0373939_0225857 | 3300035114 | Bacteria | 719 |
| 532 | Ga0373939_0232398 | 3300035114 | Bacteria | 710 |
| 533 | Ga0373941_0305114 | 3300035115 | Bacteria | 636 |
| 534 | Ga0373945_0002830 | 3300035116 | Bacteria | 5450 |
| 535 | Ga0373945_0127374 | 3300035116 | Bacteria | 1017 |
| 536 | Ga0373953_0005229 | 3300035117 | Bacteria | 4196 |
| 537 | Ga0373953_0049398 | 3300035117 | Bacteria | 1697 |
| 538 | Ga0373954_0366982 | 3300035118 | Bacteria | 711 |
| 539 | Ga0373954_0450216 | 3300035118 | Bacteria | 637 |
| 540 | Ga0373956_0037676 | 3300035119 | Bacteria | 2138 |
| 541 | Ga0373956_0074328 | 3300035119 | Bacteria | 1554 |
| 542 | Ga0373957_0051194 | 3300035120 | Bacteria | 1580 |
| 543 | Ga0373960_0013492 | 3300035121 | Bacteria | 2052 |
| 544 | Ga0373943_0078447 | 3300035170 | Bacteria | 1688 |
| 545 | Ga0373943_0101160 | 3300035170 | Bacteria | 1507 |
| 546 | Ga0373943_0150862 | 3300035170 | Bacteria | 1259 |
| 547 | Ga0373943_0337556 | 3300035170 | Bacteria | 861 |
| 548 | Ga0373946_0036006 | 3300035171 | Bacteria | 2004 |
| 549 | Ga0373946_0043245 | 3300035171 | Bacteria | 1855 |
| 550 | Ga0373955_0006687 | 3300035172 | Bacteria | 5261 |
| 551 | Ga0373955_0376009 | 3300035172 | Bacteria | 862 |
| 552 | Ga0373961_0288280 | 3300035241 | Bacteria | 604 |
| 553 | Ga0373962_0051800 | 3300035242 | Bacteria | 1185 |
| 554 | Ga0373931_0123444 | 3300035691 | Bacteria | 1483 |
| 555 | Ga0373931_0256660 | 3300035691 | Bacteria | 1065 |
| 556 | Ga0373935_0017517 | 3300035692 | Bacteria | 4348 |
| 557 | Ga0373935_0073459 | 3300035692 | Bacteria | 2209 |
| 558 | Ga0373935_0078684 | 3300035692 | Bacteria | 2139 |
| 559 | Ga0373935_0254028 | 3300035692 | Bacteria | 1231 |
| 560 | Ga0373935_0925865 | 3300035692 | Bacteria | 646 |
| 561 | Ga0373935_1019323 | 3300035692 | Bacteria | 615 |
| 562 | Ga0373927_0005277 | 3300035695 | Bacteria | 8937 |
| 563 | Ga0373927_0038283 | 3300035695 | Bacteria | 3114 |
| 564 | Ga0373927_0043441 | 3300035695 | Bacteria | 2909 |
| 565 | Ga0373927_0098258 | 3300035695 | Bacteria | 1903 |
| 566 | Ga0373927_0133249 | 3300035695 | Bacteria | 1623 |
| 567 | Ga0373933_0008577 | 3300035724 | Bacteria | 5573 |
| 568 | Ga0373933_0018403 | 3300035724 | Bacteria | 3928 |
| 569 | Ga0373933_0072722 | 3300035724 | Bacteria | 2094 |
| 570 | Ga0373947_0020937 | 3300035725 | Bacteria | 3782 |
| 571 | Ga0373947_0057819 | 3300035725 | Bacteria | 2348 |
| 572 | Ga0373947_0090068 | 3300035725 | Bacteria | 1911 |
| 573 | Ga0373947_0142726 | 3300035725 | Bacteria | 1537 |
| 574 | Ga0373947_0259890 | 3300035725 | Bacteria | 1150 |
| 575 | Ga0373947_0478844 | 3300035725 | Bacteria | 844 |
| 576 | Ga0373937_0051120 | 3300036401 | Bacteria | 3788 |
| 577 | Ga0373937_0087183 | 3300036401 | Bacteria | 2889 |
| 578 | Ga0373937_0089844 | 3300036401 | Bacteria | 2845 |
| 579 | Ga0373937_0114031 | 3300036401 | Bacteria | 2515 |
| 580 | Ga0373937_0339387 | 3300036401 | Bacteria | 1423 |
| 581 | Ga0373937_1532855 | 3300036401 | Bacteria | 614 |
| 582 | Ga0316584_0024959 | 3300036712 | Bacteria | 4380 |
| 583 | Ga0373925_0016020 | 3300037068 | Bacteria | 5428 |
| 584 | Ga0373925_0023568 | 3300037068 | Bacteria | 4492 |
| 585 | Ga0373925_0035688 | 3300037068 | Bacteria | 3669 |
| 586 | Ga0373925_0080227 | 3300037068 | Bacteria | 2480 |
| 587 | Ga0373925_0080702 | 3300037068 | Bacteria | 2473 |
| 588 | Ga0373925_0082871 | 3300037068 | Bacteria | 2442 |
| 589 | Ga0373925_0507291 | 3300037068 | Bacteria | 990 |
| 590 | Ga0373925_0527830 | 3300037068 | Bacteria | 970 |
| 591 | Ga0373925_0872832 | 3300037068 | Bacteria | 741 |
| 592 | Ga0395899_0002674 | 3300037312 | Bacteria | 14372 |
| 593 | Ga0395899_0008653 | 3300037312 | Bacteria | 7832 |
| 594 | Ga0395900_0003303 | 3300037418 | Bacteria | 17453 |
| 595 | Ga0395900_0005284 | 3300037418 | Bacteria | 13537 |
| 596 | Ga0395900_0050245 | 3300037418 | Bacteria | 4296 |
| 597 | Ga0395900_0148014 | 3300037418 | Bacteria | 2401 |
| 598 | Ga0395898_0006986 | 3300037466 | Bacteria | 12000 |
| 599 | Ga0395898_0008249 | 3300037466 | Bacteria | 11015 |
| 600 | Ga0395898_0111092 | 3300037466 | Bacteria | 2627 |
| 601 | Ga0395898_0162511 | 3300037466 | Bacteria | 2136 |
| 602 | Ga0395898_1317543 | 3300037466 | Bacteria | 651 |
| 603 | Ga0436364_1317010 | 3300037853 | Bacteria | 1446 |
| 604 | Ga0395901_0011535 | 3300038443 | Bacteria | 8954 |
| 605 | Ga0395901_0281001 | 3300038443 | Bacteria | 1729 |
| 606 | Ga0436365_0452104 | 3300039437 | Bacteria | 13957 |
| 607 | Ga0436365_0646192 | 3300039437 | Bacteria | 978 |
| 608 | Ga0436365_1260459 | 3300039437 | Bacteria | 1594 |
| 609 | Ga0436365_1827224 | 3300039437 | Bacteria | 6951 |
| 610 | Ga0436361_0315681 | 3300039447 | Bacteria | 1737 |
| 611 | Ga0436361_0486271 | 3300039447 | Bacteria | 3542 |
| 612 | Ga0436363_0827634 | 3300039450 | Bacteria | 717 |
| 613 | Ga0439453_0003801 | 3300041408 | Bacteria | 2201 |
| 614 | Ga0451835_0358279 | 3300041492 | Bacteria | 644 |
| 615 | Ga0451851_0760070 | 3300041507 | Bacteria | 837 |
| 616 | Ga0451853_0275722 | 3300041512 | Bacteria | 1343 |
| 617 | Ga0439435_0017385 | 3300042436 | Bacteria | 1817 |
| 618 | Ga0439464_0110037 | 3300042439 | Bacteria | 843 |
| 619 | Ga0439460_0013166 | 3300042461 | Bacteria | 2160 |
| 620 | Ga0439440_0029502 | 3300042993 | Bacteria | 1287 |
| 621 | Ga0466966_0615765 | 3300044684 | Bacteria | 654 |
| 622 | Ga0466963_0026901 | 3300044694 | Bacteria | 3680 |
| 623 | Ga0466957_0028264 | 3300044842 | Bacteria | 3338 |
| 624 | Ga0466957_0055549 | 3300044842 | Bacteria | 2420 |
| 625 | Ga0466958_0095296 | 3300045836 | Bacteria | 1845 |
| 626 | Ga0466958_0246024 | 3300045836 | Bacteria | 1143 |
| 627 | Ga0466967_0153039 | 3300045976 | Bacteria | 2158 |
| 628 | Ga0466967_0318538 | 3300045976 | Bacteria | 1499 |
| 629 | Ga0466967_0697859 | 3300045976 | Bacteria | 1005 |
| 630 | Ga0495617_042758 | 3300046452 | Bacteria | 1514 |
| 631 | Ga0495617_161288 | 3300046452 | Bacteria | 711 |
| 632 | Ga0495627_129155 | 3300046453 | Bacteria | 711 |
| 633 | Ga0495592_0111715 | 3300046454 | Bacteria | 1933 |
| 634 | Ga0495592_0143166 | 3300046454 | Bacteria | 1660 |
| 635 | Ga0495603_0036669 | 3300046455 | Bacteria | 2943 |
| 636 | Ga0495603_0068863 | 3300046455 | Bacteria | 2082 |
| 637 | Ga0495603_0155636 | 3300046455 | Bacteria | 1326 |
| 638 | Ga0495603_0742861 | 3300046455 | Bacteria | 561 |
| 639 | Ga0495590_0273910 | 3300046457 | Bacteria | 631 |
| 640 | Ga0495629_0001773 | 3300046459 | Bacteria | 16935 |
| 641 | Ga0495629_0035132 | 3300046459 | Bacteria | 3543 |
| 642 | Ga0495629_0054610 | 3300046459 | Bacteria | 2793 |
| 643 | Ga0495629_0181741 | 3300046459 | Bacteria | 1457 |
| 644 | Ga0495641_0018338 | 3300046461 | Bacteria | 3614 |
| 645 | Ga0495641_0039123 | 3300046461 | Bacteria | 2213 |
| 646 | Ga0495641_0098515 | 3300046461 | Bacteria | 1305 |
| 647 | Ga0495651_0016737 | 3300046462 | Bacteria | 5678 |
| 648 | Ga0495651_0173427 | 3300046462 | Bacteria | 1533 |
| 649 | Ga0495653_0005157 | 3300046463 | Bacteria | 10610 |
| 650 | Ga0495653_0017656 | 3300046463 | Bacteria | 5801 |
| 651 | Ga0495653_0457239 | 3300046463 | Bacteria | 802 |
| 652 | Ga0495580_0180456 | 3300046472 | Bacteria | 1458 |
| 653 | Ga0495580_0299575 | 3300046472 | Bacteria | 1095 |
| 654 | Ga0495580_0546030 | 3300046472 | Bacteria | 770 |
| 655 | Ga0495582_0035040 | 3300046473 | Bacteria | 2759 |
| 656 | Ga0495582_0081640 | 3300046473 | Bacteria | 1795 |
| 657 | Ga0495582_0150215 | 3300046473 | Bacteria | 1322 |
| 658 | Ga0495605_0406753 | 3300046474 | Bacteria | 565 |
| 659 | Ga0495639_0040097 | 3300046475 | Bacteria | 2105 |
| 660 | Ga0495639_0071145 | 3300046475 | Bacteria | 1607 |
| 661 | Ga0495639_0111027 | 3300046475 | Bacteria | 1301 |
| 662 | Ga0495662_0008922 | 3300046476 | Bacteria | 4926 |
| 663 | Ga0495662_0163055 | 3300046476 | Bacteria | 1098 |
| 664 | Ga0495664_0026193 | 3300046477 | Bacteria | 3396 |
| 665 | Ga0495664_0036913 | 3300046477 | Bacteria | 2882 |
| 666 | Ga0495664_0073777 | 3300046477 | Bacteria | 2040 |
| 667 | Ga0495584_0063655 | 3300046491 | Bacteria | 1854 |
| 668 | Ga0495584_0121079 | 3300046491 | Bacteria | 1325 |
| 669 | Ga0495585_0011751 | 3300046492 | Bacteria | 5175 |
| 670 | Ga0495585_0043700 | 3300046492 | Bacteria | 2505 |
| 671 | Ga0495585_0179895 | 3300046492 | Bacteria | 1088 |
| 672 | Ga0495594_0007701 | 3300046499 | Bacteria | 5540 |
| 673 | Ga0495594_0095949 | 3300046499 | Bacteria | 1665 |
| 674 | Ga0495594_0110165 | 3300046499 | Bacteria | 1552 |
| 675 | Ga0495607_0046377 | 3300046501 | Bacteria | 2553 |
| 676 | Ga0495607_0337178 | 3300046501 | Bacteria | 699 |
| 677 | Ga0495608_0028343 | 3300046511 | Bacteria | 3806 |
| 678 | Ga0495608_0096122 | 3300046511 | Bacteria | 1913 |
| 679 | Ga0495608_0768730 | 3300046511 | Bacteria | 570 |
| 680 | Ga0495616_0081664 | 3300046513 | Bacteria | 1546 |
| 681 | Ga0495618_0020889 | 3300046514 | Bacteria | 4031 |
| 682 | Ga0495618_0064890 | 3300046514 | Bacteria | 2320 |
| 683 | Ga0495618_0282620 | 3300046514 | Bacteria | 1035 |
| 684 | Ga0495618_0365986 | 3300046514 | Bacteria | 886 |
| 685 | Ga0495618_0746432 | 3300046514 | Bacteria | 573 |
| 686 | Ga0495620_0087186 | 3300046515 | Bacteria | 1256 |
| 687 | Ga0495628_0014056 | 3300046516 | Bacteria | 6719 |
| 688 | Ga0495628_0103685 | 3300046516 | Bacteria | 2193 |
| 689 | Ga0495628_0291018 | 3300046516 | Bacteria | 1211 |
| 690 | Ga0495628_0853736 | 3300046516 | Bacteria | 634 |
| 691 | Ga0495630_0014066 | 3300046517 | Bacteria | 5823 |
| 692 | Ga0495630_0156197 | 3300046517 | Bacteria | 1736 |
| 693 | Ga0495630_0167335 | 3300046517 | Bacteria | 1674 |
| 694 | Ga0495630_0370928 | 3300046517 | Bacteria | 1096 |
| 695 | Ga0495630_0486697 | 3300046517 | Bacteria | 946 |
| 696 | Ga0495630_0580997 | 3300046517 | Bacteria | 859 |
| 697 | Ga0495631_0292563 | 3300046518 | Bacteria | 693 |
| 698 | Ga0495632_0268998 | 3300046519 | Bacteria | 761 |
| 699 | Ga0495644_0003443 | 3300046523 | Bacteria | 6261 |
| 700 | Ga0495663_0077775 | 3300046525 | Bacteria | 1065 |
| 701 | Ga0495663_0115506 | 3300046525 | Bacteria | 895 |
| 702 | Ga0495666_0029039 | 3300046526 | Bacteria | 2720 |
| 703 | Ga0495666_0211681 | 3300046526 | Bacteria | 889 |
| 704 | Ga0495652_0075620 | 3300046529 | Bacteria | 2796 |
| 705 | Ga0495652_0142596 | 3300046529 | Bacteria | 1882 |
| 706 | Ga0495652_0388085 | 3300046529 | Bacteria | 992 |
| 707 | Ga0495665_0042444 | 3300046531 | Unclassified | 2420 |
| 708 | Ga0495665_0229210 | 3300046531 | Bacteria | 959 |
| 709 | Ga0495640_0165590 | 3300046533 | Bacteria | 1414 |
| 710 | Ga0495640_0170766 | 3300046533 | Bacteria | 1389 |
| 711 | Ga0495640_0319364 | 3300046533 | Bacteria | 962 |
| 712 | Ga0495586_0071046 | 3300046535 | Bacteria | 1901 |
| 713 | Ga0495587_0062295 | 3300046536 | Bacteria | 2184 |
| 714 | Ga0495587_0075125 | 3300046536 | Bacteria | 1962 |
| 715 | Ga0495587_0178777 | 3300046536 | Bacteria | 1204 |
| 716 | Ga0495621_0064405 | 3300046539 | Bacteria | 1337 |
| 717 | Ga0495621_0249668 | 3300046539 | Bacteria | 724 |
| 718 | Ga0495597_0077230 | 3300046542 | Bacteria | 1428 |
| 719 | Ga0495645_0092421 | 3300046543 | Bacteria | 2160 |
| 720 | Ga0495622_0087493 | 3300046557 | Bacteria | 1432 |
| 721 | Ga0495633_0024017 | 3300046558 | Bacteria | 3016 |
| 722 | Ga0495667_0003339 | 3300046559 | Bacteria | 10747 |
| 723 | Ga0495667_0017508 | 3300046559 | Bacteria | 4839 |
| 724 | Ga0495667_0154455 | 3300046559 | Bacteria | 1477 |
| 725 | Ga0495668_0099047 | 3300046616 | Bacteria | 1595 |
| 726 | Ga0495668_0277531 | 3300046616 | Bacteria | 918 |
| 727 | Ga0495634_0096023 | 3300046642 | Bacteria | 1919 |
| 728 | Ga0495634_0281088 | 3300046642 | Bacteria | 1011 |
| 729 | Ga0495634_0439237 | 3300046642 | Bacteria | 771 |
| 730 | Ga0495611_0006021 | 3300046648 | Bacteria | 5175 |
| 731 | Ga0495635_0056008 | 3300046663 | Bacteria | 2715 |
| 732 | Ga0495635_0074383 | 3300046663 | Bacteria | 2327 |
| 733 | Ga0495659_0002635 | 3300046664 | Bacteria | 5789 |
| 734 | Ga0495661_0534752 | 3300046665 | Bacteria | 556 |
| 735 | Ga0495588_0024456 | 3300046674 | Bacteria | 3000 |
| 736 | Ga0495588_0035934 | 3300046674 | Bacteria | 2512 |
| 737 | Ga0495588_0117606 | 3300046674 | Bacteria | 1401 |
| 738 | Ga0495657_0018265 | 3300046675 | Bacteria | 5079 |
| 739 | Ga0495599_0036703 | 3300046678 | Bacteria | 3078 |
| 740 | Ga0495599_0147226 | 3300046678 | Bacteria | 1459 |
| 741 | Ga0495646_0014858 | 3300046680 | Bacteria | 4945 |
| 742 | Ga0495647_0014114 | 3300046681 | Bacteria | 2780 |
| 743 | Ga0495647_0020028 | 3300046681 | Bacteria | 2398 |
| 744 | Ga0495647_0195979 | 3300046681 | Bacteria | 884 |
| 745 | Ga0495658_0000874 | 3300046683 | Bacteria | 16183 |
| 746 | Ga0495658_0012072 | 3300046683 | Bacteria | 4363 |
| 747 | Ga0495658_0017486 | 3300046683 | Bacteria | 3705 |
| 748 | Ga0495658_0039366 | 3300046683 | Bacteria | 2622 |
| 749 | Ga0495658_0069570 | 3300046683 | Bacteria | 2040 |
| 750 | Ga0495669_0350992 | 3300046684 | Bacteria | 713 |
| 751 | Ga0495613_0033993 | 3300046689 | Bacteria | 3787 |
| 752 | Ga0495613_0165293 | 3300046689 | Bacteria | 1572 |
| 753 | Ga0495613_0219975 | 3300046689 | Bacteria | 1333 |
| 754 | Ga0495613_0263677 | 3300046689 | Bacteria | 1199 |
| 755 | Ga0495613_0386431 | 3300046689 | Bacteria | 956 |
| 756 | Ga0495624_0014219 | 3300046690 | Bacteria | 5407 |
| 757 | Ga0495624_0156457 | 3300046690 | Bacteria | 1393 |
| 758 | Ga0495624_0371357 | 3300046690 | Bacteria | 860 |
| 759 | Ga0495670_0010427 | 3300046691 | Bacteria | 4565 |
| 760 | Ga0495589_0048978 | 3300046794 | Bacteria | 2091 |
| 761 | Ga0495600_0034024 | 3300046809 | Bacteria | 3309 |
| 762 | Ga0495600_0094745 | 3300046809 | Bacteria | 1947 |
| 763 | Ga0495600_0437738 | 3300046809 | Bacteria | 810 |
| 764 | Ga0495660_0193729 | 3300046810 | Bacteria | 975 |
| 765 | Ga0495660_0296826 | 3300046810 | Bacteria | 734 |
| 766 | Ga0495581_0020869 | 3300047315 | Bacteria | 3801 |
| 767 | Ga0495581_0091934 | 3300047315 | Bacteria | 1761 |
| 768 | Ga0495581_0098035 | 3300047315 | Bacteria | 1702 |
| 769 | Ga0495581_0103795 | 3300047315 | Bacteria | 1652 |
| 770 | Ga0495581_0234441 | 3300047315 | Bacteria | 1073 |
| 771 | Ga0495581_0386843 | 3300047315 | Bacteria | 816 |
| 772 | Ga0495604_0011405 | 3300047317 | Bacteria | 7052 |
| 773 | Ga0495604_0088116 | 3300047317 | Bacteria | 2309 |
| 774 | Ga0495604_0289708 | 3300047317 | Bacteria | 1103 |
| 775 | Ga0495636_0085011 | 3300047318 | Bacteria | 1367 |
| 776 | Ga0495674_0050827 | 3300047319 | Bacteria | 3656 |
| 777 | Ga0495674_0111582 | 3300047319 | Unclassified | 2317 |
| 778 | Ga0495674_0448338 | 3300047319 | Bacteria | 1037 |
| 779 | Ga0495674_0459550 | 3300047319 | Bacteria | 1022 |
| 780 | Ga0495672_0137106 | 3300047320 | Bacteria | 1282 |
| 781 | Ga0495676_0209952 | 3300047321 | Bacteria | 1347 |
| 782 | Ga0495676_0408186 | 3300047321 | Bacteria | 900 |
| 783 | Ga0495680_0105425 | 3300047322 | Bacteria | 2096 |
| 784 | Ga0495680_0132129 | 3300047322 | Bacteria | 1833 |
| 785 | Ga0495683_0268343 | 3300047323 | Bacteria | 743 |
| 786 | Ga0495675_0032513 | 3300047444 | Bacteria | 3329 |
| 787 | Ga0495675_0714614 | 3300047444 | Bacteria | 560 |
| 788 | Ga0495679_089019 | 3300047446 | Bacteria | 868 |
| 789 | Ga0495681_0116858 | 3300047470 | Bacteria | 1149 |
| 790 | Ga0495684_0002658 | 3300047471 | Bacteria | 14168 |
| 791 | Ga0495684_0102263 | 3300047471 | Bacteria | 2166 |
| 792 | Ga0495684_0188132 | 3300047471 | Bacteria | 1528 |
| 793 | Ga0495684_0264861 | 3300047471 | Bacteria | 1245 |
| 794 | Ga0495684_0414999 | 3300047471 | Bacteria | 942 |
| 795 | Ga0495684_0575143 | 3300047471 | Bacteria | 764 |
| 796 | Ga0495593_0033552 | 3300047673 | Bacteria | 2795 |
| 797 | Ga0495593_0088962 | 3300047673 | Bacteria | 1591 |
| 798 | Ga0495602_0080184 | 3300048088 | Bacteria | 2750 |
| 799 | Ga0495602_0427469 | 3300048088 | Bacteria | 939 |
| 800 | Ga0495602_0453544 | 3300048088 | Bacteria | 905 |
| 801 | Ga0495602_0812161 | 3300048088 | Bacteria | 627 |
| 802 | Ga0495614_0035122 | 3300048089 | Bacteria | 2154 |
| 803 | Ga0495614_0131429 | 3300048089 | Bacteria | 1108 |
| 804 | Ga0495614_0184569 | 3300048089 | Bacteria | 939 |
| 805 | Ga0495626_0216935 | 3300048091 | Bacteria | 779 |
| 806 | Ga0496100_0015250 | 3300048903 | Bacteria | 4484 |
| 807 | Ga0496100_0253465 | 3300048903 | Bacteria | 1302 |
| 808 | Ga0496100_0290577 | 3300048903 | Bacteria | 1221 |
| 809 | Ga0496100_0340020 | 3300048903 | Bacteria | 1131 |
| 810 | Ga0496100_0572108 | 3300048903 | Bacteria | 875 |
| 811 | Ga0496100_0728949 | 3300048903 | Bacteria | 774 |
| 812 | Ga0496100_1578710 | 3300048903 | Bacteria | 518 |
| 813 | Ga0496101_0025691 | 3300048904 | Bacteria | 4088 |
| 814 | Ga0496101_0031539 | 3300048904 | Bacteria | 3727 |
| 815 | Ga0496101_0071448 | 3300048904 | Bacteria | 2544 |
| 816 | Ga0496101_0086937 | 3300048904 | Bacteria | 2319 |
| 817 | Ga0496102_0025295 | 3300048905 | Bacteria | 5283 |
| 818 | Ga0496102_0040421 | 3300048905 | Bacteria | 4218 |
| 819 | Ga0496102_0109545 | 3300048905 | Bacteria | 2573 |
| 820 | Ga0496102_0119047 | 3300048905 | Bacteria | 2465 |
| 821 | Ga0496102_0264577 | 3300048905 | Bacteria | 1621 |
| 822 | Ga0496102_0279087 | 3300048905 | Bacteria | 1575 |
| 823 | Ga0496102_0334776 | 3300048905 | Bacteria | 1425 |
| 824 | Ga0496102_0663042 | 3300048905 | Bacteria | 966 |
| 825 | Ga0496103_0003927 | 3300048906 | Bacteria | 9039 |
| 826 | Ga0496103_0026501 | 3300048906 | Bacteria | 3509 |
| 827 | Ga0496103_0114247 | 3300048906 | Bacteria | 1716 |
| 828 | Ga0496103_0178650 | 3300048906 | Bacteria | 1364 |
| 829 | Ga0496103_0243335 | 3300048906 | Bacteria | 1157 |
| 830 | Ga0496103_0294801 | 3300048906 | Bacteria | 1043 |
| 831 | Ga0496103_0320066 | 3300048906 | Bacteria | 997 |
| 832 | Ga0496104_0001281 | 3300048907 | Bacteria | 21671 |
| 833 | Ga0496104_0008189 | 3300048907 | Bacteria | 9280 |
| 834 | Ga0496104_0059307 | 3300048907 | Bacteria | 3623 |
| 835 | Ga0496104_0158686 | 3300048907 | Bacteria | 2170 |
| 836 | Ga0496104_0265602 | 3300048907 | Bacteria | 1628 |
| 837 | Ga0496104_0289707 | 3300048907 | Bacteria | 1549 |
| 838 | Ga0496104_0339354 | 3300048907 | Bacteria | 1415 |
| 839 | Ga0496104_1545905 | 3300048907 | Bacteria | 566 |
| 840 | Ga0496105_0004272 | 3300048908 | Bacteria | 10747 |
| 841 | Ga0496105_0034360 | 3300048908 | Bacteria | 4169 |
| 842 | Ga0496105_0048392 | 3300048908 | Bacteria | 3509 |
| 843 | Ga0496105_0328971 | 3300048908 | Bacteria | 1223 |
| 844 | Ga0496105_0362752 | 3300048908 | Bacteria | 1155 |
| 845 | Ga0496106_0004800 | 3300048909 | Bacteria | 9999 |
| 846 | Ga0496106_0026243 | 3300048909 | Bacteria | 4336 |
| 847 | Ga0496106_0054734 | 3300048909 | Bacteria | 3015 |
| 848 | Ga0496106_0069878 | 3300048909 | Bacteria | 2681 |
| 849 | Ga0496106_0084780 | 3300048909 | Bacteria | 2438 |
| 850 | Ga0496106_0418787 | 3300048909 | Bacteria | 1076 |
| 851 | Ga0496107_0001255 | 3300048910 | Bacteria | 15528 |
| 852 | Ga0496107_0058717 | 3300048910 | Bacteria | 2782 |
| 853 | Ga0496107_0058942 | 3300048910 | Bacteria | 2777 |
| 854 | Ga0496107_0463742 | 3300048910 | Bacteria | 940 |
| 855 | Ga0496107_0471794 | 3300048910 | Bacteria | 931 |
| 856 | Ga0496108_0002441 | 3300048911 | Bacteria | 14859 |
| 857 | Ga0496108_0006245 | 3300048911 | Bacteria | 9648 |
| 858 | Ga0496108_0103984 | 3300048911 | Bacteria | 2423 |
| 859 | Ga0496108_0124470 | 3300048911 | Bacteria | 2213 |
| 860 | Ga0496108_0305712 | 3300048911 | Bacteria | 1385 |
| 861 | Ga0496108_0623478 | 3300048911 | Bacteria | 939 |
| 862 | Ga0496108_0647746 | 3300048911 | Bacteria | 918 |
| 863 | Ga0496109_0011721 | 3300048912 | Bacteria | 7541 |
| 864 | Ga0496109_0194808 | 3300048912 | Bacteria | 1905 |
| 865 | Ga0496109_0210408 | 3300048912 | Bacteria | 1829 |
| 866 | Ga0496109_0278107 | 3300048912 | Bacteria | 1577 |
| 867 | Ga0496109_0311333 | 3300048912 | Bacteria | 1485 |
| 868 | Ga0496109_0358294 | 3300048912 | Bacteria | 1378 |
| 869 | Ga0496109_0477935 | 3300048912 | Bacteria | 1176 |
| 870 | Ga0496109_0527565 | 3300048912 | Bacteria | 1114 |
| 871 | Ga0496110_0003907 | 3300048913 | Bacteria | 11463 |
| 872 | Ga0496110_0159032 | 3300048913 | Bacteria | 2047 |
| 873 | Ga0496110_0439117 | 3300048913 | Bacteria | 1189 |
| 874 | Ga0496110_0706755 | 3300048913 | Bacteria | 910 |
| 875 | Ga0496111_0002435 | 3300048914 | Bacteria | 11236 |
| 876 | Ga0496111_0016908 | 3300048914 | Bacteria | 5035 |
| 877 | Ga0496111_0407428 | 3300048914 | Bacteria | 1004 |
| 878 | Ga0496111_0443088 | 3300048914 | Bacteria | 958 |
| 879 | Ga0496111_0541473 | 3300048914 | Bacteria | 855 |
| 880 | Ga0496112_0148467 | 3300048915 | Bacteria | 2312 |
| 881 | Ga0496112_0186793 | 3300048915 | Bacteria | 2036 |
| 882 | Ga0496112_0200906 | 3300048915 | Bacteria | 1952 |
| 883 | Ga0496112_0339123 | 3300048915 | Bacteria | 1446 |
| 884 | Ga0496112_0374068 | 3300048915 | Bacteria | 1366 |
| 885 | Ga0496112_0446315 | 3300048915 | Bacteria | 1231 |
| 886 | Ga0496112_0464510 | 3300048915 | Bacteria | 1203 |
| 887 | Ga0496112_0721437 | 3300048915 | Bacteria | 924 |
| 888 | Ga0496112_0731540 | 3300048915 | Bacteria | 916 |
| 889 | Ga0496112_0958175 | 3300048915 | Bacteria | 776 |
| 890 | Ga0496112_1196655 | 3300048915 | Bacteria | 677 |
| 891 | Ga0496113_0005649 | 3300048916 | Bacteria | 7828 |
| 892 | Ga0496113_0148279 | 3300048916 | Bacteria | 1849 |
| 893 | Ga0496113_0240873 | 3300048916 | Bacteria | 1443 |
| 894 | Ga0496113_0482429 | 3300048916 | Bacteria | 996 |
| 895 | Ga0496113_0686764 | 3300048916 | Bacteria | 817 |
| 896 | Ga0496113_0757126 | 3300048916 | Bacteria | 773 |
| 897 | Ga0496114_0015843 | 3300048917 | Bacteria | 6066 |
| 898 | Ga0496114_0036935 | 3300048917 | Bacteria | 4039 |
| 899 | Ga0496114_0149708 | 3300048917 | Bacteria | 2024 |
| 900 | Ga0496114_0181467 | 3300048917 | Bacteria | 1838 |
| 901 | Ga0496114_0529556 | 3300048917 | Bacteria | 1042 |
| 902 | Ga0496114_0542808 | 3300048917 | Bacteria | 1027 |
| 903 | Ga0496115_0014583 | 3300048918 | Bacteria | 5949 |
| 904 | Ga0496115_0125319 | 3300048918 | Bacteria | 2115 |
| 905 | Ga0496115_0497117 | 3300048918 | Bacteria | 980 |
| 906 | Ga0496115_0960458 | 3300048918 | Bacteria | 655 |
| 907 | Ga0496115_0973671 | 3300048918 | Bacteria | 650 |
| 908 | Ga0496115_1031390 | 3300048918 | Bacteria | 627 |
| 909 | Ga0496117_0260828 | 3300048920 | Bacteria | 939 |
| 910 | Ga0496118_0024844 | 3300048921 | Bacteria | 5158 |
| 911 | Ga0496119_0027652 | 3300048922 | Bacteria | 3892 |
| 912 | Ga0496121_0006341 | 3300048924 | Bacteria | 14741 |
| 913 | Ga0496121_0013296 | 3300048924 | Bacteria | 8862 |
| 914 | Ga0496121_0329540 | 3300048924 | Bacteria | 1025 |
| 915 | Ga0496122_0070541 | 3300048925 | Bacteria | 2496 |
| 916 | Ga0496123_0056105 | 3300048926 | Bacteria | 2578 |
| 917 | Ga0496124_0112047 | 3300048927 | Bacteria | 2194 |
| 918 | Ga0496125_0081231 | 3300048928 | Bacteria | 2477 |
| 919 | Ga0496126_0013878 | 3300048929 | Bacteria | 8172 |
| 920 | Ga0501034_0795870 | 3300049571 | Bacteria | 838 |
| 921 | Ga0501037_0128141 | 3300049573 | Bacteria | 1821 |
| 922 | Ga0501038_0064985 | 3300049574 | Bacteria | 3110 |
| 923 | Ga0501039_0275070 | 3300049575 | Bacteria | 1324 |
| 924 | Ga0501040_0692271 | 3300049576 | Bacteria | 737 |
| 925 | Ga0501040_1006759 | 3300049576 | Bacteria | 604 |
| 926 | Ga0501043_0117234 | 3300049579 | Bacteria | 2089 |
| 927 | Ga0501046_0572938 | 3300049580 | Bacteria | 803 |
| 928 | Ga0501047_0041000 | 3300049581 | Bacteria | 4475 |
| 929 | Ga0501047_0187113 | 3300049581 | Bacteria | 1935 |
| 930 | Ga0501069_0146269 | 3300049585 | Bacteria | 1357 |
| 931 | Ga0501069_0462251 | 3300049585 | Bacteria | 755 |
| 932 | Ga0501070_0451897 | 3300049586 | Bacteria | 1036 |
| 933 | Ga0501072_0308675 | 3300049588 | Bacteria | 1258 |
| 934 | Ga0501072_1053110 | 3300049588 | Bacteria | 633 |
| 935 | Ga0501073_0012033 | 3300049589 | Bacteria | 6318 |
| 936 | Ga0501074_0146957 | 3300049590 | Bacteria | 1686 |
| 937 | Ga0501076_0106065 | 3300049592 | Bacteria | 2268 |
| 938 | Ga0501076_1108915 | 3300049592 | Bacteria | 652 |
| 939 | Ga0501081_0362895 | 3300049743 | Bacteria | 1069 |
| 940 | Ga0501035_0800739 | 3300049822 | Bacteria | 753 |
| 941 | Ga0501044_0025259 | 3300049823 | Bacteria | 6298 |
| 942 | Ga0501044_0127602 | 3300049823 | Bacteria | 2540 |
| 943 | Ga0501044_0718329 | 3300049823 | Bacteria | 883 |
| 944 | nmdc:mga03683_422798_c1 | 3300050489 | Bacteria | 638 |
| 945 | nmdc:mga00v17_149283_c1 | 3300050491 | Bacteria | 1501 |
| 946 | nmdc:mga00v17_283105_c1 | 3300050491 | Bacteria | 1076 |
| 947 | nmdc:mga0yw44_17748_c1 | 3300050492 | Bacteria | 3881 |
| 948 | nmdc:mga0yw44_689761_c1 | 3300050492 | Bacteria | 694 |
| 949 | nmdc:mga0yw44_98438_c1 | 3300050492 | Bacteria | 1859 |
| 950 | nmdc:mga06z11_340399_c1 | 3300050494 | Bacteria | 897 |
| 951 | nmdc:mga06z11_728387_c1 | 3300050494 | Bacteria | 604 |
| 952 | nmdc:mga04h51_324864_c1 | 3300050495 | Bacteria | 631 |
| 953 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 954 | nmdc:mga05p37_117714_c1 | 3300050507 | Bacteria | 3265 |
| 955 | nmdc:mga05p37_16915_c1 | 3300050507 | Bacteria | 8794 |
| 956 | nmdc:mga05p37_4032_c1 | 3300050507 | Bacteria | 5627 |
| 957 | nmdc:mga05p37_403529_c1 | 3300050507 | Bacteria | 1595 |
| 958 | nmdc:mga05p37_485109_c1 | 3300050507 | Bacteria | 1422 |
| 959 | nmdc:mga09592_160103_c1 | 3300050508 | Bacteria | 1944 |
| 960 | nmdc:mga09592_326286_c1 | 3300050508 | Bacteria | 1329 |
| 961 | nmdc:mga09592_4710_c1 | 3300050508 | Bacteria | 11047 |
| 962 | nmdc:mga0qj67_61_c1 | 3300050509 | Bacteria | 80164 |
| 963 | nmdc:mga0qj67_768_c1 | 3300050509 | Bacteria | 21815 |
| 964 | nmdc:mga06r32_199938_c1 | 3300050510 | Bacteria | 1986 |
| 965 | nmdc:mga06r32_25344_c1 | 3300050510 | Bacteria | 5517 |
| 966 | nmdc:mga06r32_44010_c1 | 3300050510 | Bacteria | 4250 |
| 967 | nmdc:mga08y16_20763_c1 | 3300050511 | Bacteria | 6933 |
| 968 | nmdc:mga08y16_2116_c1 | 3300050511 | Bacteria | 20352 |
| 969 | nmdc:mga08y16_452023_c1 | 3300050511 | Bacteria | 1310 |
| 970 | nmdc:mga08y16_457941_c1 | 3300050511 | Bacteria | 1300 |
| 971 | nmdc:mga0n895_1413901_c1 | 3300050512 | Bacteria | 664 |
| 972 | nmdc:mga0n895_152536_c1 | 3300050512 | Bacteria | 2341 |
| 973 | nmdc:mga0n895_1635535_c1 | 3300050512 | Bacteria | 608 |
| 974 | nmdc:mga0n895_204436_c1 | 3300050512 | Bacteria | 2005 |
| 975 | nmdc:mga0n895_220063_c1 | 3300050512 | Bacteria | 1928 |
| 976 | nmdc:mga0n895_274783_c1 | 3300050512 | Bacteria | 1709 |
| 977 | nmdc:mga0n895_34947_c1 | 3300050512 | Bacteria | 4842 |
| 978 | nmdc:mga0rr50_1039_c1 | 3300050513 | Bacteria | 15047 |
| 979 | nmdc:mga0rr50_119141_c1 | 3300050513 | Bacteria | 2098 |
| 980 | nmdc:mga0rr50_1258700_c1 | 3300050513 | Bacteria | 628 |
| 981 | nmdc:mga0rr50_20744_c1 | 3300050513 | Bacteria | 4469 |
| 982 | nmdc:mga0rr50_217210_c1 | 3300050513 | Bacteria | 1577 |
| 983 | nmdc:mga0rr50_219207_c1 | 3300050513 | Bacteria | 1570 |
| 984 | nmdc:mga0rr50_355785_c1 | 3300050513 | Bacteria | 1232 |
| 985 | nmdc:mga0rr50_600812_c1 | 3300050513 | Bacteria | 938 |
| 986 | nmdc:mga0rr50_897784_c1 | 3300050513 | Bacteria | 756 |
| 987 | nmdc:mga08x19_13478_c1 | 3300050514 | Bacteria | 4944 |
| 988 | nmdc:mga08x19_223631_c1 | 3300050514 | Bacteria | 1294 |
| 989 | nmdc:mga08x19_365303_c1 | 3300050514 | Bacteria | 1009 |
| 990 | nmdc:mga08x19_376437_c1 | 3300050514 | Bacteria | 994 |
| 991 | nmdc:mga08x19_944457_c1 | 3300050514 | Bacteria | 613 |
| 992 | nmdc:mga0a205_520758_c1 | 3300050515 | Bacteria | 1045 |
| 993 | nmdc:mga0a205_719_c1 | 3300050515 | Bacteria | 26646 |
| 994 | nmdc:mga0a205_720869_c1 | 3300050515 | Bacteria | 847 |
| 995 | nmdc:mga0a205_99001_c1 | 3300050515 | Bacteria | 2407 |
| 996 | Ga0495601_0005269 | 3300053077 | Bacteria | 7520 |
| 997 | Ga0495601_0019669 | 3300053077 | Bacteria | 4120 |
| 998 | Ga0495601_0036898 | 3300053077 | Bacteria | 3054 |
| 999 | Ga0495601_0039044 | 3300053077 | Bacteria | 2971 |
| 1000 | Ga0495601_0257904 | 3300053077 | Bacteria | 1138 |
| 1001 | Ga0495601_0269058 | 3300053077 | Bacteria | 1112 |
| 1002 | Ga0495612_0005164 | 3300053078 | Bacteria | 5397 |
| 1003 | Ga0495612_0010545 | 3300053078 | Bacteria | 3735 |
| 1004 | Ga0495612_0065726 | 3300053078 | Bacteria | 1506 |
| 1005 | Ga0495655_0002037 | 3300053083 | Bacteria | 3160 |
| 1006 | Ga0495655_0073455 | 3300053083 | Bacteria | 961 |
| 1007 | Ga0495595_0005910 | 3300053084 | Bacteria | 4961 |
| 1008 | Ga0495595_0024529 | 3300053084 | Bacteria | 2664 |
| 1009 | Ga0495595_0125862 | 3300053084 | Bacteria | 1250 |
| 1010 | Ga0495595_0296007 | 3300053084 | Bacteria | 814 |
| 1011 | Ga0495619_0010084 | 3300053085 | Bacteria | 5948 |
| 1012 | Ga0495619_0011059 | 3300053085 | Bacteria | 5677 |
| 1013 | Ga0495619_0018226 | 3300053085 | Bacteria | 4453 |
| 1014 | Ga0495619_0020366 | 3300053085 | Bacteria | 4223 |
| 1015 | Ga0495619_0027559 | 3300053085 | Bacteria | 3659 |
| 1016 | Ga0495619_0074353 | 3300053085 | Bacteria | 2279 |
| 1017 | Ga0495619_0092152 | 3300053085 | Bacteria | 2052 |
| 1018 | Ga0495619_0114819 | 3300053085 | Bacteria | 1842 |
| 1019 | Ga0500566_0111826 | 3300053094 | Bacteria | 1484 |
| 1020 | Ga0500654_078531 | 3300053099 | Bacteria | 1556 |
| 1021 | Ga0500572_001228 | 3300053111 | Bacteria | 7232 |
| 1022 | Ga0500593_000618 | 3300053117 | Bacteria | 13673 |
| 1023 | Ga0500652_000035 | 3300053131 | Bacteria | 74022 |
| 1024 | Ga0500559_0000579 | 3300053136 | Bacteria | 25120 |
| 1025 | Ga0500588_0208892 | 3300053146 | Bacteria | 725 |
| 1026 | Ga0500616_0065838 | 3300053153 | Bacteria | 1862 |
| 1027 | Ga0500616_0191907 | 3300053153 | Bacteria | 911 |
| 1028 | Ga0500627_0108039 | 3300053158 | Bacteria | 1251 |
| 1029 | Ga0500634_0052191 | 3300053161 | Bacteria | 2197 |
| 1030 | Ga0500639_264902 | 3300053163 | Bacteria | 676 |
| 1031 | Ga0500576_083553 | 3300053725 | Bacteria | 1343 |
| 1032 | Ga0500596_001122 | 3300053735 | Bacteria | 5382 |
| 1033 | Ga0501084_0950222 | 3300054114 | Bacteria | 723 |
| 1034 | Ga0587114_122585 | 3300059655 | Bacteria | 528 |
| 1035 | Ga0501082_0622827 | 3300060353 | Bacteria | 944 |
| 1036 | Ga0530510_0814003 | 3300061734 | Bacteria | 713 |
| 1037 | 2876813183 | 2876808645 | Bacteria | 8824342 |
| 1038 | 2929615681 | 2929615660 | Bacteria | 9193770 |
| 1039 | 2929630296 | 2929624759 | Bacteria | 9339455 |
| 1040 | 2932791876 | 2932784394 | Bacteria | 9704911 |
| 1041 | 2932815617 | 2932809354 | Bacteria | 9135765 |
| 1042 | 2933579032 | 2933577622 | Bacteria | 9116884 |
| 1043 | 2935698904 | 2935694250 | Bacteria | 9291695 |
| 1044 | 2935998812 | 2935992306 | Bacteria | 9802711 |
| 1045 | 8055747329 | 8055742211 | Bacteria | 9226248 |
| 1046 | Ga0373931_0018229 | |||
| 1047 | JGI24743J22301_10008276 | |||
| 1048 | JGI24738J21930_10019599 | |||
| 1049 | JGI24749J21850_1006996 | |||
| 1050 | JGI24744J21845_10004065 | |||
| 1051 | Ga0070676_10010132 | |||
| 1052 | Ga0070676_10291147 | |||
| 1053 | Ga0070676_10429614 | |||
| 1054 | Ga0070683_100131163 | |||
| 1055 | Ga0070683_100967627 | |||
| 1056 | Ga0070690_100389593 | |||
| 1057 | Ga0070670_100037129 | |||
| 1058 | Ga0070670_100042266 | |||
| 1059 | Ga0070670_100227088 | |||
| 1060 | Ga0070677_10028923 | |||
| 1061 | Ga0070677_10158320 | |||
| 1062 | Ga0068869_100159485 | |||
| 1063 | Ga0068869_100315353 | |||
| 1064 | Ga0068869_100632026 | |||
| 1065 | Ga0070666_10290282 | |||
| 1066 | Ga0070680_100766078 | |||
| 1067 | Ga0070682_100033503 | |||
| 1068 | Ga0070682_100188686 | |||
| 1069 | Ga0068868_100012463 | |||
| 1070 | Ga0070660_100781287 | |||
| 1071 | Ga0070660_100824709 | |||
| 1072 | Ga0070691_10051500 | |||
| 1073 | Ga0070691_10537231 | |||
| 1074 | Ga0070687_100045602 | |||
| 1075 | Ga0070661_100091301 | |||
| 1076 | Ga0070661_100362261 | |||
| 1077 | Ga0070692_10126546 | |||
| 1078 | Ga0070668_100038849 | |||
| 1079 | Ga0070669_100249268 | |||
| 1080 | Ga0070669_100612272 | |||
| 1081 | Ga0070675_100022532 | |||
| 1082 | Ga0070675_100062394 | |||
| 1083 | Ga0070675_100143937 | |||
| 1084 | Ga0070671_100004705 | |||
| 1085 | Ga0070671_100073249 | |||
| 1086 | Ga0070671_100178442 | |||
| 1087 | Ga0070671_100367032 | |||
| 1088 | Ga0070674_100044314 | |||
| 1089 | Ga0070674_100522119 | |||
| 1090 | Ga0070673_100002526 | |||
| 1091 | Ga0070673_100050752 | |||
| 1092 | Ga0070673_100234311 | |||
| 1093 | Ga0070673_100592428 | |||
| 1094 | Ga0070688_100006700 | |||
| 1095 | Ga0070688_100070757 | |||
| 1096 | Ga0070688_100082373 | |||
| 1097 | Ga0070659_100097485 | |||
| 1098 | Ga0070659_100146881 | |||
| 1099 | Ga0070659_100854114 | |||
| 1100 | Ga0070667_100024089 | |||
| 1101 | Ga0070667_100110865 | |||
| 1102 | Ga0070667_100153625 | |||
| 1103 | Ga0070667_100237790 | |||
| 1104 | Ga0070709_10015893 | |||
| 1105 | Ga0070709_10178416 | |||
| 1106 | Ga0070709_10296512 | |||
| 1107 | Ga0070714_100009596 | |||
| 1108 | Ga0070714_100177361 | |||
| 1109 | Ga0070714_100293369 | |||
| 1110 | Ga0070714_100299854 | |||
| 1111 | Ga0070714_100344895 | |||
| 1112 | Ga0070714_100369128 | |||
| 1113 | Ga0070714_101981411 | |||
| 1114 | Ga0070713_100023207 | |||
| 1115 | Ga0070713_100140693 | |||
| 1116 | Ga0070713_100321661 | |||
| 1117 | Ga0070713_100354639 | |||
| 1118 | Ga0070713_100887828 | |||
| 1119 | Ga0070710_10078341 | |||
| 1120 | Ga0070710_10101699 | |||
| 1121 | Ga0070710_10305534 | |||
| 1122 | Ga0070711_100012744 | |||
| 1123 | Ga0070711_100017205 | |||
| 1124 | Ga0070711_101237268 | |||
| 1125 | Ga0070705_100206195 | |||
| 1126 | Ga0070705_100850929 | |||
| 1127 | Ga0070700_100005809 | |||
| 1128 | Ga0070700_100245461 | |||
| 1129 | Ga0070694_100227859 | |||
| 1130 | Ga0070694_100540643 | |||
| 1131 | Ga0070708_100157482 | |||
| 1132 | Ga0070663_100006837 | |||
| 1133 | Ga0070663_100054252 | |||
| 1134 | Ga0070678_100052084 | |||
| 1135 | Ga0070662_100084961 | |||
| 1136 | Ga0070681_10070822 | |||
| 1137 | Ga0070681_10283925 | |||
| 1138 | Ga0070681_11342958 | |||
| 1139 | Ga0068867_100030007 | |||
| 1140 | Ga0068867_100423799 | |||
| 1141 | Ga0068867_100597886 | |||
| 1142 | Ga0070685_10027871 | |||
| 1143 | Ga0070685_10048090 | |||
| 1144 | Ga0070685_10266737 | |||
| 1145 | Ga0070699_100003079 | |||
| 1146 | Ga0070699_100234482 | |||
| 1147 | Ga0070699_100925136 | |||
| 1148 | Ga0070679_100149645 | |||
| 1149 | Ga0070679_100168669 | |||
| 1150 | Ga0070679_100170013 | |||
| 1151 | Ga0070684_100056674 | |||
| 1152 | Ga0070684_100358743 | |||
| 1153 | Ga0070697_100070139 | |||
| 1154 | Ga0070697_100407141 | |||
| 1155 | Ga0070697_100866467 | |||
| 1156 | Ga0068853_100146317 | |||
| 1157 | Ga0068853_100359634 | |||
| 1158 | Ga0070672_100009171 | |||
| 1159 | Ga0070672_100255893 | |||
| 1160 | Ga0070672_100607621 | |||
| 1161 | Ga0070686_100006640 | |||
| 1162 | Ga0070696_100211866 | |||
| 1163 | Ga0070693_100014227 | |||
| 1164 | Ga0070693_100136974 | |||
| 1165 | Ga0070693_100629846 | |||
| 1166 | Ga0070665_100001012 | |||
| 1167 | Ga0070665_100041199 | |||
| 1168 | Ga0070665_100159902 | |||
| 1169 | Ga0070665_100345792 | |||
| 1170 | Ga0070704_100080614 | |||
| 1171 | Ga0070704_101388150 | |||
| 1172 | Ga0068855_100020534 | |||
| 1173 | Ga0068855_100294745 | |||
| 1174 | Ga0070664_100021847 | |||
| 1175 | Ga0070664_100026102 | |||
| 1176 | Ga0070664_100484077 | |||
| 1177 | Ga0070664_100639084 | |||
| 1178 | Ga0068857_100944999 | |||
| 1179 | Ga0068854_100096451 | |||
| 1180 | Ga0068856_100061140 | |||
| 1181 | Ga0068856_100167666 | |||
| 1182 | Ga0068856_100924022 | |||
| 1183 | Ga0070702_100006284 | |||
| 1184 | Ga0070702_100252240 | |||
| 1185 | Ga0070702_100376660 | |||
| 1186 | Ga0068852_100561637 | |||
| 1187 | Ga0068852_101107232 | |||
| 1188 | Ga0068859_100058887 | |||
| 1189 | Ga0068859_100761932 | |||
| 1190 | Ga0068864_100017542 | |||
| 1191 | Ga0068866_10014866 | |||
| 1192 | Ga0068866_10515177 | |||
| 1193 | Ga0068861_100091690 | |||
| 1194 | Ga0068861_100680651 | |||
| 1195 | Ga0068861_100862000 | |||
| 1196 | Ga0068851_10010488 | |||
| 1197 | Ga0068870_10002049 | |||
| 1198 | Ga0068863_100006984 | |||
| 1199 | Ga0068863_100053205 | |||
| 1200 | Ga0068863_100367288 | |||
| 1201 | Ga0068858_100010895 | |||
| 1202 | Ga0068858_100037711 | |||
| 1203 | Ga0068858_100232082 | |||
| 1204 | Ga0068858_100379127 | |||
| 1205 | Ga0068858_100625273 | |||
| 1206 | Ga0068860_100017523 | |||
| 1207 | Ga0068860_100159329 | |||
| 1208 | Ga0068862_100023431 | |||
| 1209 | Ga0068862_100177245 | |||
| 1210 | Ga0068862_100238086 | |||
| 1211 | Ga0068862_100422025 | |||
| 1212 | Ga0081455_10007792 | |||
| 1213 | Ga0081455_10011777 | |||
| 1214 | Ga0081455_10035563 | |||
| 1215 | Ga0081455_10040696 | |||
| 1216 | Ga0081455_10138379 | |||
| 1217 | Ga0081538_10182823 | |||
| 1218 | Ga0081540_1059256 | |||
| 1219 | Ga0070717_10088050 | |||
| 1220 | Ga0075365_10101064 | |||
| 1221 | Ga0075365_10132703 | |||
| 1222 | Ga0075363_100279944 | |||
| 1223 | Ga0075363_100856405 | |||
| 1224 | Ga0075364_10075165 | |||
| 1225 | Ga0075364_10479698 | |||
| 1226 | Ga0075432_10022951 | |||
| 1227 | Ga0070715_10012023 | |||
| 1228 | Ga0070715_10040408 | |||
| 1229 | Ga0070715_10100872 | |||
| 1230 | Ga0070716_100003890 | |||
| 1231 | Ga0070716_100317349 | |||
| 1232 | Ga0070716_100382337 | |||
| 1233 | Ga0070716_100816999 | |||
| 1234 | Ga0070712_100051478 | |||
| 1235 | Ga0070712_100212919 | |||
| 1236 | Ga0070712_100427677 | |||
| 1237 | Ga0097621_100016816 | |||
| 1238 | Ga0097621_100047030 | |||
| 1239 | Ga0097621_100379283 | |||
| 1240 | Ga0075370_10000017 | |||
| 1241 | Ga0068871_100130362 | |||
| 1242 | Ga0068871_100277060 | |||
| 1243 | Ga0075428_100023649 | |||
| 1244 | Ga0075428_100049682 | |||
| 1245 | Ga0075430_100000289 | |||
| 1246 | Ga0075430_100048214 | |||
| 1247 | Ga0075431_100004032 | |||
| 1248 | Ga0075431_100020240 | |||
| 1249 | Ga0075431_100151933 | |||
| 1250 | Ga0075431_100357206 | |||
| 1251 | Ga0075431_101091588 | |||
| 1252 | Ga0075433_10000876 | |||
| 1253 | Ga0075433_10646888 | |||
| 1254 | Ga0075433_10996756 | |||
| 1255 | Ga0075434_100013982 | |||
| 1256 | Ga0075434_100027434 | |||
| 1257 | Ga0075434_100036362 | |||
| 1258 | Ga0075434_100074539 | |||
| 1259 | Ga0075434_100102896 | |||
| 1260 | Ga0075434_100113080 | |||
| 1261 | Ga0075434_100204758 | |||
| 1262 | Ga0075434_100332520 | |||
| 1263 | Ga0075434_100849002 | |||
| 1264 | Ga0075434_100927960 | |||
| 1265 | Ga0075434_100944093 | |||
| 1266 | Ga0075429_100154082 | |||
| 1267 | Ga0075429_100482051 | |||
| 1268 | Ga0068865_100023750 | |||
| 1269 | Ga0068865_100487407 | |||
| 1270 | Ga0075436_100010397 | |||
| 1271 | Ga0075436_100238138 | |||
| 1272 | Ga0075436_100256686 | |||
| 1273 | Ga0075436_100391327 | |||
| 1274 | Ga0075436_100456722 | |||
| 1275 | Ga0097620_100058887 | |||
| 1276 | Ga0097620_100761864 | |||
| 1277 | Ga0075435_100100270 | |||
| 1278 | Ga0075435_100137595 | |||
| 1279 | Ga0075435_100293400 | |||
| 1280 | Ga0075435_100362343 | |||
| 1281 | Ga0075435_100443986 | |||
| 1282 | Ga0075435_100780540 | |||
| 1283 | Ga0099795_10000155 | |||
| 1284 | Ga0099795_10033267 | |||
| 1285 | Ga0099795_10051080 | |||
| 1286 | Ga0105251_10076460 | |||
| 1287 | Ga0111539_10042647 | |||
| 1288 | Ga0111539_10047277 | |||
| 1289 | Ga0111539_10399377 | |||
| 1290 | Ga0111539_10696421 | |||
| 1291 | Ga0105245_10053832 | |||
| 1292 | Ga0105245_10226194 | |||
| 1293 | Ga0105247_10005284 | |||
| 1294 | Ga0105247_10167490 | |||
| 1295 | Ga0105247_10237174 | |||
| 1296 | Ga0114129_10011626 | |||
| 1297 | Ga0114129_10058921 | |||
| 1298 | Ga0114129_10277458 | |||
| 1299 | Ga0114129_10640221 | |||
| 1300 | Ga0105243_10013566 | |||
| 1301 | Ga0105243_10026897 | |||
| 1302 | Ga0105243_10347844 | |||
| 1303 | Ga0105242_10034745 | |||
| 1304 | Ga0105242_10073375 | |||
| 1305 | Ga0105242_10080181 | |||
| 1306 | Ga0105248_10108918 | |||
| 1307 | Ga0105248_10225559 | |||
| 1308 | Ga0105248_10509852 | |||
| 1309 | Ga0105248_12579743 | |||
| 1310 | Ga0105237_10110797 | |||
| 1311 | Ga0105237_10175679 | |||
| 1312 | Ga0105237_10559044 | |||
| 1313 | Ga0105237_10852574 | |||
| 1314 | Ga0105238_10031494 | |||
| 1315 | Ga0105238_10081506 | |||
| 1316 | Ga0105238_10434345 | |||
| 1317 | Ga0105238_10838665 | |||
| 1318 | Ga0105238_11048765 | |||
| 1319 | Ga0105249_10027648 | |||
| 1320 | Ga0105249_10216203 | |||
| 1321 | Ga0105249_10421967 | |||
| 1322 | Ga0105249_11207701 | |||
| 1323 | Ga0099796_10002365 | |||
| 1324 | Ga0099796_10025873 | |||
| 1325 | Ga0105239_10030786 | |||
| 1326 | Ga0105239_10258088 | |||
| 1327 | Ga0105239_10370290 | |||
| 1328 | Ga0105239_10570004 | |||
| 1329 | Ga0105239_10992767 | |||
| 1330 | Ga0105246_10006998 | |||
| 1331 | Ga0105246_10029073 | |||
| 1332 | Ga0157373_10177262 | |||
| 1333 | Ga0157373_10200317 | |||
| 1334 | Ga0157373_10643183 | |||
| 1335 | Ga0157369_10973475 | |||
| 1336 | Ga0157369_11768110 | |||
| 1337 | Ga0157369_11782306 | |||
| 1338 | Ga0157374_10014492 | |||
| 1339 | Ga0157374_10687904 | |||
| 1340 | Ga0157374_11002208 | |||
| 1341 | Ga0157378_10137966 | |||
| 1342 | Ga0157378_10169708 | |||
| 1343 | Ga0163162_10118520 | |||
| 1344 | Ga0163162_10280976 | |||
| 1345 | Ga0163162_11303424 | |||
| 1346 | Ga0157375_10054029 | |||
| 1347 | Ga0157375_10689284 | |||
| 1348 | Ga0157375_10891826 | |||
| 1349 | Ga0157375_10903499 | |||
| 1350 | Ga0157375_11436196 | |||
| 1351 | Ga0163163_10029928 | |||
| 1352 | Ga0163163_12460805 | |||
| 1353 | Ga0157380_10009560 | |||
| 1354 | Ga0157380_10497722 | |||
| 1355 | Ga0157380_10816146 | |||
| 1356 | Ga0157377_10051394 | |||
| 1357 | Ga0157377_10313230 | |||
| 1358 | Ga0157379_10010012 | |||
| 1359 | Ga0157379_10060131 | |||
| 1360 | Ga0157379_10205956 | |||
| 1361 | Ga0157376_10081801 | |||
| 1362 | Ga0157376_10408983 | |||
| 1363 | Ga0157376_10429451 | |||
| 1364 | Ga0157376_12677839 | |||
| 1365 | Ga0163161_10570926 | |||
| 1366 | Ga0206353_10336957 | |||
| 1367 | Ga0213876_10021103 | |||
| 1368 | Ga0213876_10075402 | |||
| 1369 | Ga0224572_1041045 | |||
| 1370 | Ga0207682_10004304 | |||
| 1371 | Ga0207692_10065548 | |||
| 1372 | Ga0207692_10157997 | |||
| 1373 | Ga0207642_10002862 | |||
| 1374 | Ga0207710_10005081 | |||
| 1375 | Ga0207710_10145822 | |||
| 1376 | Ga0207688_10003853 | |||
| 1377 | Ga0207680_10259597 | |||
| 1378 | Ga0207680_10840478 | |||
| 1379 | Ga0207685_10023444 | |||
| 1380 | Ga0207685_10023701 | |||
| 1381 | Ga0207685_10080031 | |||
| 1382 | Ga0207699_10103961 | |||
| 1383 | Ga0207699_10212433 | |||
| 1384 | Ga0207699_10281460 | |||
| 1385 | Ga0207699_10797379 | |||
| 1386 | Ga0207645_10008911 | |||
| 1387 | Ga0207645_10034810 | |||
| 1388 | Ga0207645_10095104 | |||
| 1389 | Ga0207643_10075441 | |||
| 1390 | Ga0207705_10047756 | |||
| 1391 | Ga0207684_10135277 | |||
| 1392 | Ga0207654_10161477 | |||
| 1393 | Ga0207671_10121561 | |||
| 1394 | Ga0207693_10008314 | |||
| 1395 | Ga0207693_10032860 | |||
| 1396 | Ga0207693_10041720 | |||
| 1397 | Ga0207693_10072476 | |||
| 1398 | Ga0207693_10074112 | |||
| 1399 | Ga0207693_10086221 | |||
| 1400 | Ga0207693_10253141 | |||
| 1401 | Ga0207663_10012783 | |||
| 1402 | Ga0207663_10166074 | |||
| 1403 | Ga0207663_10206571 | |||
| 1404 | Ga0207663_10514316 | |||
| 1405 | Ga0207660_10111165 | |||
| 1406 | Ga0207660_10351218 | |||
| 1407 | Ga0207662_10000693 | |||
| 1408 | Ga0207662_10141972 | |||
| 1409 | Ga0207662_10146129 | |||
| 1410 | Ga0207662_10744687 | |||
| 1411 | Ga0207657_10016020 | |||
| 1412 | Ga0207657_10026642 | |||
| 1413 | Ga0207657_10251515 | |||
| 1414 | Ga0207657_10704699 | |||
| 1415 | Ga0207657_10987596 | |||
| 1416 | Ga0207649_10036891 | |||
| 1417 | Ga0207649_10046063 | |||
| 1418 | Ga0207649_10215320 | |||
| 1419 | Ga0207649_10823825 | |||
| 1420 | Ga0207652_10059841 | |||
| 1421 | Ga0207652_10349262 | |||
| 1422 | Ga0207652_10564688 | |||
| 1423 | Ga0207694_10076857 | |||
| 1424 | Ga0207694_10464125 | |||
| 1425 | Ga0207694_10681359 | |||
| 1426 | Ga0207650_10300624 | |||
| 1427 | Ga0207659_10097227 | |||
| 1428 | Ga0207659_10224811 | |||
| 1429 | Ga0207659_10589377 | |||
| 1430 | Ga0207659_10871998 | |||
| 1431 | Ga0207687_10017557 | |||
| 1432 | Ga0207687_10026807 | |||
| 1433 | Ga0207687_10027584 | |||
| 1434 | Ga0207700_10068458 | |||
| 1435 | Ga0207700_10081651 | |||
| 1436 | Ga0207700_10251305 | |||
| 1437 | Ga0207700_10265912 | |||
| 1438 | Ga0207700_10675154 | |||
| 1439 | Ga0207664_10164300 | |||
| 1440 | Ga0207664_10210394 | |||
| 1441 | Ga0207664_10299395 | |||
| 1442 | Ga0207664_10314670 | |||
| 1443 | Ga0207664_10452543 | |||
| 1444 | Ga0207664_10570362 | |||
| 1445 | Ga0207664_11087457 | |||
| 1446 | Ga0207644_10040756 | |||
| 1447 | Ga0207644_10196119 | |||
| 1448 | Ga0207644_10357890 | |||
| 1449 | Ga0207690_10269245 | |||
| 1450 | Ga0207690_10397491 | |||
| 1451 | Ga0207690_10622651 | |||
| 1452 | Ga0207706_10008145 | |||
| 1453 | Ga0207706_10011133 | |||
| 1454 | Ga0207706_10469286 | |||
| 1455 | Ga0207686_10259843 | |||
| 1456 | Ga0207709_10116755 | |||
| 1457 | Ga0207709_10231089 | |||
| 1458 | Ga0207709_10280813 | |||
| 1459 | Ga0207670_10092143 | |||
| 1460 | Ga0207670_10311271 | |||
| 1461 | Ga0207669_10022401 | |||
| 1462 | Ga0207669_10087347 | |||
| 1463 | Ga0207669_10141880 | |||
| 1464 | Ga0207669_10278019 | |||
| 1465 | Ga0207704_10171834 | |||
| 1466 | Ga0207704_10389020 | |||
| 1467 | Ga0207665_10001692 | |||
| 1468 | Ga0207665_10013008 | |||
| 1469 | Ga0207665_10076606 | |||
| 1470 | Ga0207691_10005013 | |||
| 1471 | Ga0207691_10008399 | |||
| 1472 | Ga0207691_10404292 | |||
| 1473 | Ga0207711_10030381 | |||
| 1474 | Ga0207711_10156864 | |||
| 1475 | Ga0207711_10173906 | |||
| 1476 | Ga0207689_10005881 | |||
| 1477 | Ga0207689_10455564 | |||
| 1478 | Ga0207661_10259737 | |||
| 1479 | Ga0207661_11141449 | |||
| 1480 | Ga0207679_10057204 | |||
| 1481 | Ga0207679_10112391 | |||
| 1482 | Ga0207679_10444545 | |||
| 1483 | Ga0207667_10055460 | |||
| 1484 | Ga0207667_10209651 | |||
| 1485 | Ga0207667_10381335 | |||
| 1486 | Ga0207651_10079631 | |||
| 1487 | Ga0207651_10108614 | |||
| 1488 | Ga0207651_10173629 | |||
| 1489 | Ga0207651_10896002 | |||
| 1490 | Ga0207712_10466177 | |||
| 1491 | Ga0207712_10633154 | |||
| 1492 | Ga0207668_10020859 | |||
| 1493 | Ga0207668_10259673 | |||
| 1494 | Ga0207668_10292110 | |||
| 1495 | Ga0207658_10144036 | |||
| 1496 | Ga0207658_10242763 | |||
| 1497 | Ga0207677_10006534 | |||
| 1498 | Ga0207703_10018288 | |||
| 1499 | Ga0207703_10234200 | |||
| 1500 | Ga0207703_10327094 | |||
| 1501 | Ga0207703_11632373 | |||
| 1502 | Ga0207639_10118817 | |||
| 1503 | Ga0207639_10221488 | |||
| 1504 | Ga0207639_11245622 | |||
| 1505 | Ga0207678_10010183 | |||
| 1506 | Ga0207678_10013601 | |||
| 1507 | Ga0207678_10050732 | |||
| 1508 | Ga0207708_10002044 | |||
| 1509 | Ga0207702_10397283 | |||
| 1510 | Ga0207702_11867673 | |||
| 1511 | Ga0207702_12157644 | |||
| 1512 | Ga0207641_10062764 | |||
| 1513 | Ga0207641_10068042 | |||
| 1514 | Ga0207648_10017876 | |||
| 1515 | Ga0207648_10317219 | |||
| 1516 | Ga0207648_10448522 | |||
| 1517 | Ga0207676_10008832 | |||
| 1518 | Ga0207676_10401822 | |||
| 1519 | Ga0207675_100015353 | |||
| 1520 | Ga0207683_10012796 | |||
| 1521 | Ga0207683_10031611 | |||
| 1522 | Ga0207683_10040556 | |||
| 1523 | Ga0207683_10205089 | |||
| 1524 | Ga0207698_10004892 | |||
| 1525 | Ga0207698_10054719 | |||
| 1526 | Ga0209179_1010263 | |||
| 1527 | Ga0207428_10000216 | |||
| 1528 | Ga0207428_10279237 | |||
| 1529 | Ga0207428_10770414 | |||
| 1530 | Ga0268266_10000198 | |||
| 1531 | Ga0268266_10041131 | |||
| 1532 | Ga0268265_11247499 | |||
| 1533 | Ga0268264_10052038 | |||
| 1534 | Ga0268264_10114234 | |||
| 1535 | Ga0265318_10016787 | |||
| 1536 | Ga0265338_10841493 | |||
| 1537 | Ga0265760_10015442 | |||
| 1538 | Ga0265330_10005300 | |||
| 1539 | Ga0265332_10019675 | |||
| 1540 | Ga0265332_10353991 | |||
| 1541 | Ga0265325_10014651 | |||
| 1542 | Ga0265340_10003863 | |||
| 1543 | Ga0265340_10041001 | |||
| 1544 | Ga0265339_10027747 | |||
| 1545 | Ga0265331_10186700 | |||
| 1546 | Ga0265316_10228287 | |||
| 1547 | Ga0265313_10005489 | |||
| 1548 | Ga0265313_10045452 | |||
| 1549 | Ga0265313_10045717 | |||
| 1550 | Ga0316579_10089162 | |||
| 1551 | Ga0265314_10305981 | |||
| 1552 | Ga0265342_10007891 | |||
| 1553 | Ga0316578_10167345 | |||
| 1554 | Ga0307412_10182993 | |||
| 1555 | Ga0307412_11217917 | |||
| 1556 | Ga0307414_10235468 | |||
| 1557 | Ga0373938_0033395 | |||
| 1558 | Ga0373926_0038437 | |||
| 1559 | Ga0373934_0185478 | |||
| 1560 | Ga0373934_0202130 | |||
| 1561 | Ga0373940_0126325 | |||
| 1562 | Ga0373944_0006495 | |||
| 1563 | Ga0373944_0011226 | |||
| 1564 | Ga0373944_0012806 | |||
| 1565 | Ga0373949_0002518 | |||
| 1566 | Ga0373952_0133415 | |||
| 1567 | Ga0373952_0190729 | |||
| 1568 | Ga0373923_0078311 | |||
| 1569 | Ga0373923_0153979 | |||
| 1570 | Ga0373932_0014941 | |||
| 1571 | Ga0373932_0032855 | |||
| 1572 | Ga0373936_0008876 | |||
| 1573 | Ga0373936_0014386 | |||
| 1574 | Ga0373936_0176283 | |||
| 1575 | Ga0373936_0395471 | |||
| 1576 | Ga0373939_0225857 | |||
| 1577 | Ga0373939_0232398 | |||
| 1578 | Ga0373941_0305114 | |||
| 1579 | Ga0373945_0002830 | |||
| 1580 | Ga0373945_0127374 | |||
| 1581 | Ga0373953_0005229 | |||
| 1582 | Ga0373953_0049398 | |||
| 1583 | Ga0373954_0366982 | |||
| 1584 | Ga0373954_0450216 | |||
| 1585 | Ga0373956_0037676 | |||
| 1586 | Ga0373956_0074328 | |||
| 1587 | Ga0373957_0051194 | |||
| 1588 | Ga0373960_0013492 | |||
| 1589 | Ga0373943_0078447 | |||
| 1590 | Ga0373943_0101160 | |||
| 1591 | Ga0373943_0150862 | |||
| 1592 | Ga0373943_0337556 | |||
| 1593 | Ga0373946_0036006 | |||
| 1594 | Ga0373946_0043245 | |||
| 1595 | Ga0373955_0006687 | |||
| 1596 | Ga0373955_0376009 | |||
| 1597 | Ga0373961_0288280 | |||
| 1598 | Ga0373962_0051800 | |||
| 1599 | Ga0373931_0123444 | |||
| 1600 | Ga0373931_0256660 | |||
| 1601 | Ga0373935_0017517 | |||
| 1602 | Ga0373935_0073459 | |||
| 1603 | Ga0373935_0078684 | |||
| 1604 | Ga0373935_0254028 | |||
| 1605 | Ga0373935_0925865 | |||
| 1606 | Ga0373935_1019323 | |||
| 1607 | Ga0373927_0005277 | |||
| 1608 | Ga0373927_0038283 | |||
| 1609 | Ga0373927_0043441 | |||
| 1610 | Ga0373927_0098258 | |||
| 1611 | Ga0373927_0133249 | |||
| 1612 | Ga0373933_0008577 | |||
| 1613 | Ga0373933_0018403 | |||
| 1614 | Ga0373933_0072722 | |||
| 1615 | Ga0373947_0020937 | |||
| 1616 | Ga0373947_0057819 | |||
| 1617 | Ga0373947_0090068 | |||
| 1618 | Ga0373947_0142726 | |||
| 1619 | Ga0373947_0259890 | |||
| 1620 | Ga0373947_0478844 | |||
| 1621 | Ga0373937_0051120 | |||
| 1622 | Ga0373937_0087183 | |||
| 1623 | Ga0373937_0089844 | |||
| 1624 | Ga0373937_0114031 | |||
| 1625 | Ga0373937_0339387 | |||
| 1626 | Ga0373937_1532855 | |||
| 1627 | Ga0316584_0024959 | |||
| 1628 | Ga0373925_0016020 | |||
| 1629 | Ga0373925_0023568 | |||
| 1630 | Ga0373925_0035688 | |||
| 1631 | Ga0373925_0080227 | |||
| 1632 | Ga0373925_0080702 | |||
| 1633 | Ga0373925_0082871 | |||
| 1634 | Ga0373925_0507291 | |||
| 1635 | Ga0373925_0527830 | |||
| 1636 | Ga0373925_0872832 | |||
| 1637 | Ga0395899_0002674 | |||
| 1638 | Ga0395899_0008653 | |||
| 1639 | Ga0395900_0003303 | |||
| 1640 | Ga0395900_0005284 | |||
| 1641 | Ga0395900_0050245 | |||
| 1642 | Ga0395900_0148014 | |||
| 1643 | Ga0395898_0006986 | |||
| 1644 | Ga0395898_0008249 | |||
| 1645 | Ga0395898_0111092 | |||
| 1646 | Ga0395898_0162511 | |||
| 1647 | Ga0395898_1317543 | |||
| 1648 | Ga0436364_1317010 | |||
| 1649 | Ga0395901_0011535 | |||
| 1650 | Ga0395901_0281001 | |||
| 1651 | Ga0436365_0452104 | |||
| 1652 | Ga0436365_0646192 | |||
| 1653 | Ga0436365_1260459 | |||
| 1654 | Ga0436365_1827224 | |||
| 1655 | Ga0436361_0315681 | |||
| 1656 | Ga0436361_0486271 | |||
| 1657 | Ga0436363_0827634 | |||
| 1658 | Ga0439453_0003801 | |||
| 1659 | Ga0451835_0358279 | |||
| 1660 | Ga0451851_0760070 | |||
| 1661 | Ga0451853_0275722 | |||
| 1662 | Ga0439435_0017385 | |||
| 1663 | Ga0439464_0110037 | |||
| 1664 | Ga0439460_0013166 | |||
| 1665 | Ga0439440_0029502 | |||
| 1666 | Ga0466966_0615765 | |||
| 1667 | Ga0466963_0026901 | |||
| 1668 | Ga0466957_0028264 | |||
| 1669 | Ga0466957_0055549 | |||
| 1670 | Ga0466958_0095296 | |||
| 1671 | Ga0466958_0246024 | |||
| 1672 | Ga0466967_0153039 | |||
| 1673 | Ga0466967_0318538 | |||
| 1674 | Ga0466967_0697859 | |||
| 1675 | Ga0495617_042758 | |||
| 1676 | Ga0495617_161288 | |||
| 1677 | Ga0495627_129155 | |||
| 1678 | Ga0495592_0111715 | |||
| 1679 | Ga0495592_0143166 | |||
| 1680 | Ga0495603_0036669 | |||
| 1681 | Ga0495603_0068863 | |||
| 1682 | Ga0495603_0155636 | |||
| 1683 | Ga0495603_0742861 | |||
| 1684 | Ga0495590_0273910 | |||
| 1685 | Ga0495629_0001773 | |||
| 1686 | Ga0495629_0035132 | |||
| 1687 | Ga0495629_0054610 | |||
| 1688 | Ga0495629_0181741 | |||
| 1689 | Ga0495641_0018338 | |||
| 1690 | Ga0495641_0039123 | |||
| 1691 | Ga0495641_0098515 | |||
| 1692 | Ga0495651_0016737 | |||
| 1693 | Ga0495651_0173427 | |||
| 1694 | Ga0495653_0005157 | |||
| 1695 | Ga0495653_0017656 | |||
| 1696 | Ga0495653_0457239 | |||
| 1697 | Ga0495580_0180456 | |||
| 1698 | Ga0495580_0299575 | |||
| 1699 | Ga0495580_0546030 | |||
| 1700 | Ga0495582_0035040 | |||
| 1701 | Ga0495582_0081640 | |||
| 1702 | Ga0495582_0150215 | |||
| 1703 | Ga0495605_0406753 | |||
| 1704 | Ga0495639_0040097 | |||
| 1705 | Ga0495639_0071145 | |||
| 1706 | Ga0495639_0111027 | |||
| 1707 | Ga0495662_0008922 | |||
| 1708 | Ga0495662_0163055 | |||
| 1709 | Ga0495664_0026193 | |||
| 1710 | Ga0495664_0036913 | |||
| 1711 | Ga0495664_0073777 | |||
| 1712 | Ga0495584_0063655 | |||
| 1713 | Ga0495584_0121079 | |||
| 1714 | Ga0495585_0011751 | |||
| 1715 | Ga0495585_0043700 | |||
| 1716 | Ga0495585_0179895 | |||
| 1717 | Ga0495594_0007701 | |||
| 1718 | Ga0495594_0095949 | |||
| 1719 | Ga0495594_0110165 | |||
| 1720 | Ga0495607_0046377 | |||
| 1721 | Ga0495607_0337178 | |||
| 1722 | Ga0495608_0028343 | |||
| 1723 | Ga0495608_0096122 | |||
| 1724 | Ga0495608_0768730 | |||
| 1725 | Ga0495616_0081664 | |||
| 1726 | Ga0495618_0020889 | |||
| 1727 | Ga0495618_0064890 | |||
| 1728 | Ga0495618_0282620 | |||
| 1729 | Ga0495618_0365986 | |||
| 1730 | Ga0495618_0746432 | |||
| 1731 | Ga0495620_0087186 | |||
| 1732 | Ga0495628_0014056 | |||
| 1733 | Ga0495628_0103685 | |||
| 1734 | Ga0495628_0291018 | |||
| 1735 | Ga0495628_0853736 | |||
| 1736 | Ga0495630_0014066 | |||
| 1737 | Ga0495630_0156197 | |||
| 1738 | Ga0495630_0167335 | |||
| 1739 | Ga0495630_0370928 | |||
| 1740 | Ga0495630_0486697 | |||
| 1741 | Ga0495630_0580997 | |||
| 1742 | Ga0495631_0292563 | |||
| 1743 | Ga0495632_0268998 | |||
| 1744 | Ga0495644_0003443 | |||
| 1745 | Ga0495663_0077775 | |||
| 1746 | Ga0495663_0115506 | |||
| 1747 | Ga0495666_0029039 | |||
| 1748 | Ga0495666_0211681 | |||
| 1749 | Ga0495652_0075620 | |||
| 1750 | Ga0495652_0142596 | |||
| 1751 | Ga0495652_0388085 | |||
| 1752 | Ga0495665_0042444 | |||
| 1753 | Ga0495665_0229210 | |||
| 1754 | Ga0495640_0165590 | |||
| 1755 | Ga0495640_0170766 | |||
| 1756 | Ga0495640_0319364 | |||
| 1757 | Ga0495586_0071046 | |||
| 1758 | Ga0495587_0062295 | |||
| 1759 | Ga0495587_0075125 | |||
| 1760 | Ga0495587_0178777 | |||
| 1761 | Ga0495621_0064405 | |||
| 1762 | Ga0495621_0249668 | |||
| 1763 | Ga0495597_0077230 | |||
| 1764 | Ga0495645_0092421 | |||
| 1765 | Ga0495622_0087493 | |||
| 1766 | Ga0495633_0024017 | |||
| 1767 | Ga0495667_0003339 | |||
| 1768 | Ga0495667_0017508 | |||
| 1769 | Ga0495667_0154455 | |||
| 1770 | Ga0495668_0099047 | |||
| 1771 | Ga0495668_0277531 | |||
| 1772 | Ga0495634_0096023 | |||
| 1773 | Ga0495634_0281088 | |||
| 1774 | Ga0495634_0439237 | |||
| 1775 | Ga0495611_0006021 | |||
| 1776 | Ga0495635_0056008 | |||
| 1777 | Ga0495635_0074383 | |||
| 1778 | Ga0495659_0002635 | |||
| 1779 | Ga0495661_0534752 | |||
| 1780 | Ga0495588_0024456 | |||
| 1781 | Ga0495588_0035934 | |||
| 1782 | Ga0495588_0117606 | |||
| 1783 | Ga0495657_0018265 | |||
| 1784 | Ga0495599_0036703 | |||
| 1785 | Ga0495599_0147226 | |||
| 1786 | Ga0495646_0014858 | |||
| 1787 | Ga0495647_0014114 | |||
| 1788 | Ga0495647_0020028 | |||
| 1789 | Ga0495647_0195979 | |||
| 1790 | Ga0495658_0000874 | |||
| 1791 | Ga0495658_0012072 | |||
| 1792 | Ga0495658_0017486 | |||
| 1793 | Ga0495658_0039366 | |||
| 1794 | Ga0495658_0069570 | |||
| 1795 | Ga0495669_0350992 | |||
| 1796 | Ga0495613_0033993 | |||
| 1797 | Ga0495613_0165293 | |||
| 1798 | Ga0495613_0219975 | |||
| 1799 | Ga0495613_0263677 | |||
| 1800 | Ga0495613_0386431 | |||
| 1801 | Ga0495624_0014219 | |||
| 1802 | Ga0495624_0156457 | |||
| 1803 | Ga0495624_0371357 | |||
| 1804 | Ga0495670_0010427 | |||
| 1805 | Ga0495589_0048978 | |||
| 1806 | Ga0495600_0034024 | |||
| 1807 | Ga0495600_0094745 | |||
| 1808 | Ga0495600_0437738 | |||
| 1809 | Ga0495660_0193729 | |||
| 1810 | Ga0495660_0296826 | |||
| 1811 | Ga0495581_0020869 | |||
| 1812 | Ga0495581_0091934 | |||
| 1813 | Ga0495581_0098035 | |||
| 1814 | Ga0495581_0103795 | |||
| 1815 | Ga0495581_0234441 | |||
| 1816 | Ga0495581_0386843 | |||
| 1817 | Ga0495604_0011405 | |||
| 1818 | Ga0495604_0088116 | |||
| 1819 | Ga0495604_0289708 | |||
| 1820 | Ga0495636_0085011 | |||
| 1821 | Ga0495674_0050827 | |||
| 1822 | Ga0495674_0111582 | |||
| 1823 | Ga0495674_0448338 | |||
| 1824 | Ga0495674_0459550 | |||
| 1825 | Ga0495672_0137106 | |||
| 1826 | Ga0495676_0209952 | |||
| 1827 | Ga0495676_0408186 | |||
| 1828 | Ga0495680_0105425 | |||
| 1829 | Ga0495680_0132129 | |||
| 1830 | Ga0495683_0268343 | |||
| 1831 | Ga0495675_0032513 | |||
| 1832 | Ga0495675_0714614 | |||
| 1833 | Ga0495679_089019 | |||
| 1834 | Ga0495681_0116858 | |||
| 1835 | Ga0495684_0002658 | |||
| 1836 | Ga0495684_0102263 | |||
| 1837 | Ga0495684_0188132 | |||
| 1838 | Ga0495684_0264861 | |||
| 1839 | Ga0495684_0414999 | |||
| 1840 | Ga0495684_0575143 | |||
| 1841 | Ga0495593_0033552 | |||
| 1842 | Ga0495593_0088962 | |||
| 1843 | Ga0495602_0080184 | |||
| 1844 | Ga0495602_0427469 | |||
| 1845 | Ga0495602_0453544 | |||
| 1846 | Ga0495602_0812161 | |||
| 1847 | Ga0495614_0035122 | |||
| 1848 | Ga0495614_0131429 | |||
| 1849 | Ga0495614_0184569 | |||
| 1850 | Ga0495626_0216935 | |||
| 1851 | Ga0496100_0015250 | |||
| 1852 | Ga0496100_0253465 | |||
| 1853 | Ga0496100_0290577 | |||
| 1854 | Ga0496100_0340020 | |||
| 1855 | Ga0496100_0572108 | |||
| 1856 | Ga0496100_0728949 | |||
| 1857 | Ga0496100_1578710 | |||
| 1858 | Ga0496101_0025691 | |||
| 1859 | Ga0496101_0031539 | |||
| 1860 | Ga0496101_0071448 | |||
| 1861 | Ga0496101_0086937 | |||
| 1862 | Ga0496102_0025295 | |||
| 1863 | Ga0496102_0040421 | |||
| 1864 | Ga0496102_0109545 | |||
| 1865 | Ga0496102_0119047 | |||
| 1866 | Ga0496102_0264577 | |||
| 1867 | Ga0496102_0279087 | |||
| 1868 | Ga0496102_0334776 | |||
| 1869 | Ga0496102_0663042 | |||
| 1870 | Ga0496103_0003927 | |||
| 1871 | Ga0496103_0026501 | |||
| 1872 | Ga0496103_0114247 | |||
| 1873 | Ga0496103_0178650 | |||
| 1874 | Ga0496103_0243335 | |||
| 1875 | Ga0496103_0294801 | |||
| 1876 | Ga0496103_0320066 | |||
| 1877 | Ga0496104_0001281 | |||
| 1878 | Ga0496104_0008189 | |||
| 1879 | Ga0496104_0059307 | |||
| 1880 | Ga0496104_0158686 | |||
| 1881 | Ga0496104_0265602 | |||
| 1882 | Ga0496104_0289707 | |||
| 1883 | Ga0496104_0339354 | |||
| 1884 | Ga0496104_1545905 | |||
| 1885 | Ga0496105_0004272 | |||
| 1886 | Ga0496105_0034360 | |||
| 1887 | Ga0496105_0048392 | |||
| 1888 | Ga0496105_0328971 | |||
| 1889 | Ga0496105_0362752 | |||
| 1890 | Ga0496106_0004800 | |||
| 1891 | Ga0496106_0026243 | |||
| 1892 | Ga0496106_0054734 | |||
| 1893 | Ga0496106_0069878 | |||
| 1894 | Ga0496106_0084780 | |||
| 1895 | Ga0496106_0418787 | |||
| 1896 | Ga0496107_0001255 | |||
| 1897 | Ga0496107_0058717 | |||
| 1898 | Ga0496107_0058942 | |||
| 1899 | Ga0496107_0463742 | |||
| 1900 | Ga0496107_0471794 | |||
| 1901 | Ga0496108_0002441 | |||
| 1902 | Ga0496108_0006245 | |||
| 1903 | Ga0496108_0103984 | |||
| 1904 | Ga0496108_0124470 | |||
| 1905 | Ga0496108_0305712 | |||
| 1906 | Ga0496108_0623478 | |||
| 1907 | Ga0496108_0647746 | |||
| 1908 | Ga0496109_0011721 | |||
| 1909 | Ga0496109_0194808 | |||
| 1910 | Ga0496109_0210408 | |||
| 1911 | Ga0496109_0278107 | |||
| 1912 | Ga0496109_0311333 | |||
| 1913 | Ga0496109_0358294 | |||
| 1914 | Ga0496109_0477935 | |||
| 1915 | Ga0496109_0527565 | |||
| 1916 | Ga0496110_0003907 | |||
| 1917 | Ga0496110_0159032 | |||
| 1918 | Ga0496110_0439117 | |||
| 1919 | Ga0496110_0706755 | |||
| 1920 | Ga0496111_0002435 | |||
| 1921 | Ga0496111_0016908 | |||
| 1922 | Ga0496111_0407428 | |||
| 1923 | Ga0496111_0443088 | |||
| 1924 | Ga0496111_0541473 | |||
| 1925 | Ga0496112_0148467 | |||
| 1926 | Ga0496112_0186793 | |||
| 1927 | Ga0496112_0200906 | |||
| 1928 | Ga0496112_0339123 | |||
| 1929 | Ga0496112_0374068 | |||
| 1930 | Ga0496112_0446315 | |||
| 1931 | Ga0496112_0464510 | |||
| 1932 | Ga0496112_0721437 | |||
| 1933 | Ga0496112_0731540 | |||
| 1934 | Ga0496112_0958175 | |||
| 1935 | Ga0496112_1196655 | |||
| 1936 | Ga0496113_0005649 | |||
| 1937 | Ga0496113_0148279 | |||
| 1938 | Ga0496113_0240873 | |||
| 1939 | Ga0496113_0482429 | |||
| 1940 | Ga0496113_0686764 | |||
| 1941 | Ga0496113_0757126 | |||
| 1942 | Ga0496114_0015843 | |||
| 1943 | Ga0496114_0036935 | |||
| 1944 | Ga0496114_0149708 | |||
| 1945 | Ga0496114_0181467 | |||
| 1946 | Ga0496114_0529556 | |||
| 1947 | Ga0496114_0542808 | |||
| 1948 | Ga0496115_0014583 | |||
| 1949 | Ga0496115_0125319 | |||
| 1950 | Ga0496115_0497117 | |||
| 1951 | Ga0496115_0960458 | |||
| 1952 | Ga0496115_0973671 | |||
| 1953 | Ga0496115_1031390 | |||
| 1954 | Ga0496117_0260828 | |||
| 1955 | Ga0496118_0024844 | |||
| 1956 | Ga0496119_0027652 | |||
| 1957 | Ga0496121_0006341 | |||
| 1958 | Ga0496121_0013296 | |||
| 1959 | Ga0496121_0329540 | |||
| 1960 | Ga0496122_0070541 | |||
| 1961 | Ga0496123_0056105 | |||
| 1962 | Ga0496124_0112047 | |||
| 1963 | Ga0496125_0081231 | |||
| 1964 | Ga0496126_0013878 | |||
| 1965 | Ga0501034_0795870 | |||
| 1966 | Ga0501037_0128141 | |||
| 1967 | Ga0501038_0064985 | |||
| 1968 | Ga0501039_0275070 | |||
| 1969 | Ga0501040_0692271 | |||
| 1970 | Ga0501040_1006759 | |||
| 1971 | Ga0501043_0117234 | |||
| 1972 | Ga0501046_0572938 | |||
| 1973 | Ga0501047_0041000 | |||
| 1974 | Ga0501047_0187113 | |||
| 1975 | Ga0501069_0146269 | |||
| 1976 | Ga0501069_0462251 | |||
| 1977 | Ga0501070_0451897 | |||
| 1978 | Ga0501072_0308675 | |||
| 1979 | Ga0501072_1053110 | |||
| 1980 | Ga0501073_0012033 | |||
| 1981 | Ga0501074_0146957 | |||
| 1982 | Ga0501076_0106065 | |||
| 1983 | Ga0501076_1108915 | |||
| 1984 | Ga0501081_0362895 | |||
| 1985 | Ga0501035_0800739 | |||
| 1986 | Ga0501044_0025259 | |||
| 1987 | Ga0501044_0127602 | |||
| 1988 | Ga0501044_0718329 | |||
| 1989 | nmdc:mga03683_422798_c1 | |||
| 1990 | nmdc:mga00v17_149283_c1 | |||
| 1991 | nmdc:mga00v17_283105_c1 | |||
| 1992 | nmdc:mga0yw44_17748_c1 | |||
| 1993 | nmdc:mga0yw44_689761_c1 | |||
| 1994 | nmdc:mga0yw44_98438_c1 | |||
| 1995 | nmdc:mga06z11_340399_c1 | |||
| 1996 | nmdc:mga06z11_728387_c1 | |||
| 1997 | nmdc:mga04h51_324864_c1 | |||
| 1998 | nmdc:mga07m45_3_c1 | |||
| 1999 | nmdc:mga05p37_117714_c1 | |||
| 2000 | nmdc:mga05p37_16915_c1 | |||
| 2001 | nmdc:mga05p37_4032_c1 | |||
| 2002 | nmdc:mga05p37_403529_c1 | |||
| 2003 | nmdc:mga05p37_485109_c1 | |||
| 2004 | nmdc:mga09592_160103_c1 | |||
| 2005 | nmdc:mga09592_326286_c1 | |||
| 2006 | nmdc:mga09592_4710_c1 | |||
| 2007 | nmdc:mga0qj67_61_c1 | |||
| 2008 | nmdc:mga0qj67_768_c1 | |||
| 2009 | nmdc:mga06r32_199938_c1 | |||
| 2010 | nmdc:mga06r32_25344_c1 | |||
| 2011 | nmdc:mga06r32_44010_c1 | |||
| 2012 | nmdc:mga08y16_20763_c1 | |||
| 2013 | nmdc:mga08y16_2116_c1 | |||
| 2014 | nmdc:mga08y16_452023_c1 | |||
| 2015 | nmdc:mga08y16_457941_c1 | |||
| 2016 | nmdc:mga0n895_1413901_c1 | |||
| 2017 | nmdc:mga0n895_152536_c1 | |||
| 2018 | nmdc:mga0n895_1635535_c1 | |||
| 2019 | nmdc:mga0n895_204436_c1 | |||
| 2020 | nmdc:mga0n895_220063_c1 | |||
| 2021 | nmdc:mga0n895_274783_c1 | |||
| 2022 | nmdc:mga0n895_34947_c1 | |||
| 2023 | nmdc:mga0rr50_1039_c1 | |||
| 2024 | nmdc:mga0rr50_119141_c1 | |||
| 2025 | nmdc:mga0rr50_1258700_c1 | |||
| 2026 | nmdc:mga0rr50_20744_c1 | |||
| 2027 | nmdc:mga0rr50_217210_c1 | |||
| 2028 | nmdc:mga0rr50_219207_c1 | |||
| 2029 | nmdc:mga0rr50_355785_c1 | |||
| 2030 | nmdc:mga0rr50_600812_c1 | |||
| 2031 | nmdc:mga0rr50_897784_c1 | |||
| 2032 | nmdc:mga08x19_13478_c1 | |||
| 2033 | nmdc:mga08x19_223631_c1 | |||
| 2034 | nmdc:mga08x19_365303_c1 | |||
| 2035 | nmdc:mga08x19_376437_c1 | |||
| 2036 | nmdc:mga08x19_944457_c1 | |||
| 2037 | nmdc:mga0a205_520758_c1 | |||
| 2038 | nmdc:mga0a205_719_c1 | |||
| 2039 | nmdc:mga0a205_720869_c1 | |||
| 2040 | nmdc:mga0a205_99001_c1 | |||
| 2041 | Ga0495601_0005269 | |||
| 2042 | Ga0495601_0019669 | |||
| 2043 | Ga0495601_0036898 | |||
| 2044 | Ga0495601_0039044 | |||
| 2045 | Ga0495601_0257904 | |||
| 2046 | Ga0495601_0269058 | |||
| 2047 | Ga0495612_0005164 | |||
| 2048 | Ga0495612_0010545 | |||
| 2049 | Ga0495612_0065726 | |||
| 2050 | Ga0495655_0002037 | |||
| 2051 | Ga0495655_0073455 | |||
| 2052 | Ga0495595_0005910 | |||
| 2053 | Ga0495595_0024529 | |||
| 2054 | Ga0495595_0125862 | |||
| 2055 | Ga0495595_0296007 | |||
| 2056 | Ga0495619_0010084 | |||
| 2057 | Ga0495619_0011059 | |||
| 2058 | Ga0495619_0018226 | |||
| 2059 | Ga0495619_0020366 | |||
| 2060 | Ga0495619_0027559 | |||
| 2061 | Ga0495619_0074353 | |||
| 2062 | Ga0495619_0092152 | |||
| 2063 | Ga0495619_0114819 | |||
| 2064 | Ga0500566_0111826 | |||
| 2065 | Ga0500654_078531 | |||
| 2066 | Ga0500572_001228 | |||
| 2067 | Ga0500593_000618 | |||
| 2068 | Ga0500652_000035 | |||
| 2069 | Ga0500559_0000579 | |||
| 2070 | Ga0500588_0208892 | |||
| 2071 | Ga0500616_0065838 | |||
| 2072 | Ga0500616_0191907 | |||
| 2073 | Ga0500627_0108039 | |||
| 2074 | Ga0500634_0052191 | |||
| 2075 | Ga0500639_264902 | |||
| 2076 | Ga0500576_083553 | |||
| 2077 | Ga0500596_001122 | |||
| 2078 | Ga0501084_0950222 | |||
| 2079 | Ga0587114_122585 | |||
| 2080 | Ga0501082_0622827 | |||
| 2081 | Ga0530510_0814003 | |||
| 2082 | 2876813183 | |||
| 2083 | 2929615681 | |||
| 2084 | 2929630296 | |||
| 2085 | 2932791876 | |||
| 2086 | 2932815617 | |||
| 2087 | 2933579032 | |||
| 2088 | 2935698904 | |||
| 2089 | 2935998812 | |||
| 2090 | 8055747329 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nu0-assembly1.cif.gz_A | structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein | 0.8791 | 18 | 111 |
| 1nmn-assembly1.cif.gz_A | structure of yqgf from escherichia coli, a hypothetical protein | 0.8565 | 19 | 152 |
| 7w89-assembly1.cif.gz_A | the structure of deinococcus radiodurans yqgf | 0.8523 | 19 | 150 |
| 1nu0-assembly2.cif.gz_B | structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein | 0.8361 | 19 | 151 |
| 1nmn-assembly1.cif.gz_A | structure of yqgf from escherichia coli, a hypothetical protein | 0.8299 | 19 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nu0A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.8805 | 19 | 111 | 3.30.420.140 |
| af_Q2FXW1_3_142_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.8778 | 18 | 153 | 3.30.420.140 |
| af_Q2FXW1_3_142_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.8494 | 18 | 153 | 3.30.420.140 |
| af_P9WGV7_22_163_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.7944 | 19 | 160 | 3.30.420.140 |
| af_P9WGV7_22_163_3.30.420.140 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain | 0.7892 | 19 | 160 | 3.30.420.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QUM0-F1-model_v4 | Holliday junction resolvase RuvX | 0.9914 | 1 | 70 |
GO:0006364
|
| AF-A0A1M7URA4-F1-model_v4 | Putative pre-16S rRNA nuclease (EC 3.1.-.-) | 0.9895 | 1 | 156 |
GO:0000967
GO:0004518 GO:0005829 |
| AF-B6JFV9-F1-model_v4 | Putative pre-16S rRNA nuclease (EC 3.1.-.-) | 0.9888 | 1 | 159 |
GO:0000967
GO:0004518 GO:0005829 |
| AF-A0A4Y3WI52-F1-model_v4 | Putative pre-16S rRNA nuclease (EC 3.1.-.-) | 0.9878 | 1 | 159 |
GO:0000967
GO:0004518 GO:0005829 |
| AF-X1G2L9-F1-model_v4 | YqgF/RNase H-like domain-containing protein | 0.9843 | 20 | 107 |
GO:0000967
GO:0004518 GO:0005829 |