F488939

General Info

Members Datasets Scaffolds Average Seq Length
1045 261 2090 171

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0156095|Ga0466957_0156095_874_1377
Length 161
Sequence MKVRPIGFAVAVLVFLIDQLVKWLVTGPLSLNRIGDQLVLLPIFNFTYTENQGISFGYLNATNPVGRWMLVAMTAAIWILRERNRVDQVALGMVLGGALGNILDRVRFGYVVDFADLHFGSVRPFLVFNVGDAAITIGVVILLLRAFLSRKDRPEETVEHA

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
207 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
214 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
215 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
250 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
251 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
252 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 3.92
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0156095 3300044842 Bacteria 1479
2 JGI24736J21556_1007516 3300001904 Bacteria 1831
3 JGI24736J21556_1011447 3300001904 Bacteria 1444
4 JGI24741J21665_1004325 3300001915 Bacteria 3176
5 JGI24752J21851_1002999 3300001976 Bacteria 2238
6 JGI24746J21847_1014119 3300001977 Bacteria 1155
7 JGI24747J21853_1004024 3300001978 Bacteria 1298
8 JGI24740J21852_10009846 3300001979 Bacteria 3716
9 JGI24740J21852_10016311 3300001979 Bacteria 2686
10 JGI24740J21852_10023199 3300001979 Bacteria 2123
11 JGI24740J21852_10053946 3300001979 Bacteria 1138
12 JGI24740J21852_10109432 3300001979 Bacteria 698
13 JGI24739J22299_10003381 3300001989 Bacteria 6090
14 JGI24739J22299_10026131 3300001989 Bacteria 2051
15 JGI24739J22299_10029229 3300001989 Bacteria 1918
16 JGI24737J22298_10020911 3300001990 Bacteria 2086
17 JGI24737J22298_10029727 3300001990 Bacteria 1712
18 JGI24735J21928_10008874 3300002067 Bacteria 3243
19 JGI24735J21928_10009958 3300002067 Bacteria 3043
20 JGI24735J21928_10028737 3300002067 Bacteria 1659
21 JGI24745J21846_1011522 3300002073 Bacteria 1011
22 JGI25406J46586_10149353 3300003203 Bacteria 682
23 Ga0065712_10117537 3300005290 Bacteria 1719
24 Ga0065712_10191391 3300005290 Bacteria 1147
25 Ga0065715_10047950 3300005293 Bacteria 725
26 Ga0065715_10254336 3300005293 Bacteria 1157
27 Ga0065715_10666881 3300005293 Bacteria 670
28 Ga0070658_10001600 3300005327 Bacteria 19143
29 Ga0070658_10004777 3300005327 Bacteria 11022
30 Ga0070658_10045282 3300005327 Bacteria 3557
31 Ga0070658_10048049 3300005327 Bacteria 3454
32 Ga0070658_10146124 3300005327 Bacteria 1977
33 Ga0070658_10148068 3300005327 Bacteria 1964
34 Ga0070658_10360168 3300005327 Bacteria 1246
35 Ga0070658_10424470 3300005327 Bacteria 1144
36 Ga0070658_10621422 3300005327 Bacteria 937
37 Ga0070676_10125805 3300005328 Bacteria 1615
38 Ga0070676_10179233 3300005328 Bacteria 1376
39 Ga0070676_10551824 3300005328 Bacteria 825
40 Ga0070676_10554383 3300005328 Bacteria 823
41 Ga0070683_100002224 3300005329 Bacteria 15369
42 Ga0070683_100002474 3300005329 Bacteria 14703
43 Ga0070683_100036141 3300005329 Bacteria 4518
44 Ga0070683_100145029 3300005329 Bacteria 2249
45 Ga0070690_100138719 3300005330 Bacteria 1649
46 Ga0070690_100404095 3300005330 Bacteria 1004
47 Ga0070670_100001116 3300005331 Bacteria 21345
48 Ga0070670_100130966 3300005331 Bacteria 2166
49 Ga0070670_100207874 3300005331 Bacteria 1701
50 Ga0070670_100245612 3300005331 Bacteria 1559
51 Ga0070670_100360377 3300005331 Bacteria 1278
52 Ga0070670_100510323 3300005331 Bacteria 1070
53 Ga0070677_10192404 3300005333 Bacteria 979
54 Ga0068869_100095902 3300005334 Bacteria 2238
55 Ga0068869_100155784 3300005334 Bacteria 1775
56 Ga0068869_100263849 3300005334 Bacteria 1379
57 Ga0068869_100283415 3300005334 Bacteria 1333
58 Ga0070666_10003135 3300005335 Bacteria 10041
59 Ga0070666_10003536 3300005335 Bacteria 9473
60 Ga0070666_10046806 3300005335 Bacteria 2903
61 Ga0070666_10194047 3300005335 Bacteria 1427
62 Ga0070666_10349641 3300005335 Bacteria 1058
63 Ga0070680_100013944 3300005336 Bacteria 6272
64 Ga0070680_100231029 3300005336 Bacteria 1562
65 Ga0070680_100266319 3300005336 Bacteria 1450
66 Ga0070680_100380855 3300005336 Bacteria 1201
67 Ga0070680_100419184 3300005336 Bacteria 1142
68 Ga0070680_100926890 3300005336 Bacteria 752
69 Ga0070682_100044395 3300005337 Bacteria 2752
70 Ga0070682_100181510 3300005337 Bacteria 1471
71 Ga0070682_100221882 3300005337 Bacteria 1346
72 Ga0068868_100156706 3300005338 Bacteria 1878
73 Ga0070660_100000972 3300005339 Bacteria 19155
74 Ga0070660_100001048 3300005339 Bacteria 18599
75 Ga0070660_100017208 3300005339 Bacteria 5266
76 Ga0070660_100017771 3300005339 Bacteria 5187
77 Ga0070660_100038576 3300005339 Bacteria 3627
78 Ga0070660_100049740 3300005339 Bacteria 3223
79 Ga0070660_100149613 3300005339 Bacteria 1877
80 Ga0070660_100169156 3300005339 Bacteria 1764
81 Ga0070660_100175396 3300005339 Bacteria 1733
82 Ga0070660_100219031 3300005339 Bacteria 1547
83 Ga0070660_100240202 3300005339 Bacteria 1475
84 Ga0070660_100337634 3300005339 Bacteria 1239
85 Ga0070691_10014272 3300005341 Bacteria 3642
86 Ga0070687_100120712 3300005343 Bacteria 1499
87 Ga0070661_100000157 3300005344 Bacteria 55418
88 Ga0070661_100004095 3300005344 Bacteria 10046
89 Ga0070661_100024622 3300005344 Bacteria 4318
90 Ga0070661_100040174 3300005344 Bacteria 3411
91 Ga0070661_100040813 3300005344 Bacteria 3386
92 Ga0070661_100057333 3300005344 Bacteria 2854
93 Ga0070661_100060045 3300005344 Bacteria 2790
94 Ga0070661_100100496 3300005344 Bacteria 2150
95 Ga0070661_100113656 3300005344 Bacteria 2023
96 Ga0070661_100164138 3300005344 Bacteria 1683
97 Ga0070661_100177229 3300005344 Bacteria 1621
98 Ga0070661_100381031 3300005344 Bacteria 1112
99 Ga0070692_10040796 3300005345 Bacteria 2375
100 Ga0070692_10055944 3300005345 Bacteria 2064
101 Ga0070692_10101215 3300005345 Bacteria 1580
102 Ga0070668_100070481 3300005347 Bacteria 2721
103 Ga0070668_100196460 3300005347 Bacteria 1654
104 Ga0070668_100498342 3300005347 Bacteria 1054
105 Ga0070668_100622364 3300005347 Bacteria 946
106 Ga0070668_100637201 3300005347 Bacteria 935
107 Ga0070668_101107106 3300005347 Bacteria 715
108 Ga0070668_101210696 3300005347 Bacteria 684
109 Ga0070669_100056811 3300005353 Bacteria 2870
110 Ga0070669_100096034 3300005353 Bacteria 2230
111 Ga0070669_100248550 3300005353 Bacteria 1415
112 Ga0070669_100332326 3300005353 Bacteria 1229
113 Ga0070669_100388703 3300005353 Bacteria 1139
114 Ga0070669_101771927 3300005353 Unclassified 539
115 Ga0070675_100077866 3300005354 Bacteria 2760
116 Ga0070675_100215526 3300005354 Bacteria 1670
117 Ga0070675_100437553 3300005354 Bacteria 1171
118 Ga0070675_100472281 3300005354 Bacteria 1127
119 Ga0070675_101273876 3300005354 Bacteria 677
120 Ga0070671_100002642 3300005355 Bacteria 13871
121 Ga0070671_100017860 3300005355 Bacteria 5751
122 Ga0070671_100065855 3300005355 Bacteria 3018
123 Ga0070671_100094014 3300005355 Bacteria 2512
124 Ga0070671_100150771 3300005355 Bacteria 1963
125 Ga0070674_100028462 3300005356 Bacteria 3671
126 Ga0070674_100057585 3300005356 Bacteria 2698
127 Ga0070674_100093696 3300005356 Bacteria 2174
128 Ga0070673_100001165 3300005364 Bacteria 15096
129 Ga0070673_100128032 3300005364 Bacteria 2127
130 Ga0070673_100348561 3300005364 Bacteria 1314
131 Ga0070659_100000086 3300005366 Bacteria 70060
132 Ga0070659_100016202 3300005366 Bacteria 5593
133 Ga0070659_100041914 3300005366 Bacteria 3579
134 Ga0070659_100058365 3300005366 Bacteria 3045
135 Ga0070659_100062906 3300005366 Bacteria 2934
136 Ga0070659_100163922 3300005366 Bacteria 1818
137 Ga0070659_100216337 3300005366 Bacteria 1580
138 Ga0070659_100261649 3300005366 Bacteria 1435
139 Ga0070659_100325523 3300005366 Bacteria 1285
140 Ga0070659_100353760 3300005366 Bacteria 1233
141 Ga0070659_100504078 3300005366 Bacteria 1032
142 Ga0070659_100519231 3300005366 Bacteria 1017
143 Ga0070667_100002391 3300005367 Bacteria 16430
144 Ga0070667_100002494 3300005367 Bacteria 16061
145 Ga0070667_100004102 3300005367 Bacteria 12330
146 Ga0070667_100010080 3300005367 Bacteria 7823
147 Ga0070667_100013324 3300005367 Bacteria 6793
148 Ga0070667_100138183 3300005367 Bacteria 2132
149 Ga0070667_100141164 3300005367 Bacteria 2109
150 Ga0070667_101004333 3300005367 Bacteria 779
151 Ga0070667_101385183 3300005367 Unclassified 659
152 Ga0070709_10402570 3300005434 Bacteria 1022
153 Ga0070714_100053630 3300005435 Bacteria 3443
154 Ga0070714_100137687 3300005435 Bacteria 2188
155 Ga0070714_100385700 3300005435 Bacteria 1322
156 Ga0070713_100031108 3300005436 Bacteria 4247
157 Ga0070705_100476935 3300005440 Bacteria 942
158 Ga0070700_100407338 3300005441 Bacteria 1024
159 Ga0070694_100153142 3300005444 Bacteria 1685
160 Ga0070663_100003702 3300005455 Bacteria 8862
161 Ga0070663_100070247 3300005455 Bacteria 2546
162 Ga0070663_100111569 3300005455 Bacteria 2055
163 Ga0070663_100129047 3300005455 Bacteria 1918
164 Ga0070663_100134741 3300005455 Bacteria 1880
165 Ga0070663_100144382 3300005455 Bacteria 1820
166 Ga0070663_100190090 3300005455 Bacteria 1597
167 Ga0070663_100221153 3300005455 Bacteria 1487
168 Ga0070663_100281602 3300005455 Bacteria 1325
169 Ga0070663_100365432 3300005455 Unclassified 1171
170 Ga0070663_100375254 3300005455 Bacteria 1157
171 Ga0070663_100507149 3300005455 Bacteria 1003
172 Ga0070678_100001679 3300005456 Bacteria 11864
173 Ga0070678_100025005 3300005456 Bacteria 4009
174 Ga0070678_100164623 3300005456 Bacteria 1800
175 Ga0070678_100200471 3300005456 Bacteria 1647
176 Ga0070678_100817268 3300005456 Bacteria 847
177 Ga0070662_100000640 3300005457 Bacteria 21171
178 Ga0070662_100002988 3300005457 Bacteria 10513
179 Ga0070662_100027606 3300005457 Bacteria 3942
180 Ga0070662_100050583 3300005457 Bacteria 2998
181 Ga0070662_100147043 3300005457 Bacteria 1831
182 Ga0070662_100213464 3300005457 Bacteria 1537
183 Ga0070662_100309930 3300005457 Bacteria 1285
184 Ga0070662_100312761 3300005457 Bacteria 1279
185 Ga0070662_100343981 3300005457 Bacteria 1221
186 Ga0070662_100457209 3300005457 Bacteria 1060
187 Ga0070662_100490653 3300005457 Bacteria 1023
188 Ga0070662_100503834 3300005457 Bacteria 1010
189 Ga0070662_100523706 3300005457 Bacteria 991
190 Ga0070662_100962581 3300005457 Bacteria 730
191 Ga0070662_101195414 3300005457 Bacteria 653
192 Ga0070681_10039052 3300005458 Bacteria 4759
193 Ga0070681_10108749 3300005458 Bacteria 2713
194 Ga0070681_10230687 3300005458 Bacteria 1766
195 Ga0070681_10273972 3300005458 Bacteria 1599
196 Ga0070681_10443281 3300005458 Bacteria 1210
197 Ga0068867_100019803 3300005459 Bacteria 4795
198 Ga0068867_100073595 3300005459 Bacteria 2558
199 Ga0068867_100141267 3300005459 Bacteria 1882
200 Ga0070685_10249892 3300005466 Bacteria 1174
201 Ga0070679_100001108 3300005530 Bacteria 23557
202 Ga0070679_100072392 3300005530 Bacteria 3438
203 Ga0070679_100119758 3300005530 Bacteria 2617
204 Ga0070679_100295687 3300005530 Bacteria 1570
205 Ga0070679_100341970 3300005530 Bacteria 1444
206 Ga0070679_100537396 3300005530 Bacteria 1113
207 Ga0070679_100567836 3300005530 Bacteria 1078
208 Ga0070679_100742222 3300005530 Bacteria 925
209 Ga0070679_100848865 3300005530 Bacteria 856
210 Ga0070679_100888096 3300005530 Bacteria 835
211 Ga0070679_101106807 3300005530 Bacteria 737
212 Ga0070684_100133349 3300005535 Bacteria 2242
213 Ga0070684_100165532 3300005535 Bacteria 2007
214 Ga0070684_100454032 3300005535 Bacteria 1185
215 Ga0068853_100002366 3300005539 Bacteria 14099
216 Ga0068853_100013793 3300005539 Bacteria 6603
217 Ga0068853_100023829 3300005539 Bacteria 5128
218 Ga0068853_100027460 3300005539 Bacteria 4781
219 Ga0068853_100062753 3300005539 Bacteria 3217
220 Ga0068853_100085670 3300005539 Bacteria 2762
221 Ga0068853_100104953 3300005539 Bacteria 2502
222 Ga0068853_100109053 3300005539 Bacteria 2457
223 Ga0068853_100216282 3300005539 Bacteria 1748
224 Ga0068853_100711259 3300005539 Bacteria 959
225 Ga0068853_100936150 3300005539 Bacteria 833
226 Ga0068853_101427338 3300005539 Bacteria 670
227 Ga0070672_100031129 3300005543 Bacteria 4013
228 Ga0070672_100294023 3300005543 Bacteria 1376
229 Ga0070695_100221357 3300005545 Bacteria 1364
230 Ga0070696_100027074 3300005546 Bacteria 3904
231 Ga0070696_100171766 3300005546 Bacteria 1603
232 Ga0070696_100382018 3300005546 Bacteria 1098
233 Ga0070693_100010206 3300005547 Bacteria 4697
234 Ga0070693_100121610 3300005547 Bacteria 1620
235 Ga0070693_100147716 3300005547 Bacteria 1486
236 Ga0070665_100005304 3300005548 Bacteria 13314
237 Ga0070665_100123352 3300005548 Bacteria 2593
238 Ga0070665_100418212 3300005548 Bacteria 1349
239 Ga0068855_100016873 3300005563 Bacteria 8781
240 Ga0068855_100044812 3300005563 Bacteria 5233
241 Ga0068855_100094637 3300005563 Bacteria 3444
242 Ga0068855_100120169 3300005563 Bacteria 3007
243 Ga0068855_100159330 3300005563 Bacteria 2563
244 Ga0068855_100219726 3300005563 Bacteria 2131
245 Ga0068855_100333332 3300005563 Bacteria 1674
246 Ga0068855_100452491 3300005563 Bacteria 1401
247 Ga0068855_100563252 3300005563 Bacteria 1232
248 Ga0068855_100612587 3300005563 Bacteria 1173
249 Ga0070664_100000888 3300005564 Bacteria 23240
250 Ga0070664_100001052 3300005564 Bacteria 21695
251 Ga0070664_100003552 3300005564 Bacteria 12597
252 Ga0070664_100030341 3300005564 Bacteria 4510
253 Ga0070664_100039412 3300005564 Bacteria 3981
254 Ga0070664_100041914 3300005564 Bacteria 3864
255 Ga0070664_100201429 3300005564 Bacteria 1776
256 Ga0070664_100231216 3300005564 Bacteria 1657
257 Ga0070664_100234325 3300005564 Bacteria 1646
258 Ga0070664_100292201 3300005564 Bacteria 1471
259 Ga0070664_100332625 3300005564 Bacteria 1378
260 Ga0070664_100394026 3300005564 Bacteria 1265
261 Ga0068857_100002979 3300005577 Bacteria 13958
262 Ga0068857_100003804 3300005577 Bacteria 12707
263 Ga0068857_100211740 3300005577 Bacteria 1769
264 Ga0068857_100230730 3300005577 Bacteria 1693
265 Ga0068857_100235161 3300005577 Bacteria 1676
266 Ga0068857_100430022 3300005577 Bacteria 1232
267 Ga0068854_100025954 3300005578 Bacteria 4022
268 Ga0068854_100052325 3300005578 Bacteria 2928
269 Ga0068854_100098044 3300005578 Bacteria 2192
270 Ga0068854_100107209 3300005578 Bacteria 2103
271 Ga0068854_100194317 3300005578 Bacteria 1592
272 Ga0068854_100338180 3300005578 Bacteria 1229
273 Ga0068854_101212348 3300005578 Bacteria 676
274 Ga0068856_100000159 3300005614 Bacteria 70023
275 Ga0068856_100012605 3300005614 Bacteria 8184
276 Ga0068856_100029630 3300005614 Bacteria 5346
277 Ga0068856_100149713 3300005614 Bacteria 2342
278 Ga0068856_100343262 3300005614 Bacteria 1511
279 Ga0068856_100452724 3300005614 Bacteria 1304
280 Ga0068856_100750965 3300005614 Bacteria 996
281 Ga0068856_100925015 3300005614 Bacteria 891
282 Ga0068852_100005858 3300005616 Bacteria 8830
283 Ga0068852_100041440 3300005616 Bacteria 3892
284 Ga0068852_100051761 3300005616 Bacteria 3526
285 Ga0068852_100058173 3300005616 Bacteria 3347
286 Ga0068852_100089764 3300005616 Bacteria 2747
287 Ga0068852_100114750 3300005616 Bacteria 2455
288 Ga0068852_100238561 3300005616 Bacteria 1736
289 Ga0068852_100284013 3300005616 Bacteria 1597
290 Ga0068852_100531882 3300005616 Bacteria 1174
291 Ga0068852_100542278 3300005616 Bacteria 1163
292 Ga0068852_100653770 3300005616 Bacteria 1059
293 Ga0068859_100007208 3300005617 Bacteria 11280
294 Ga0068859_100153229 3300005617 Bacteria 2381
295 Ga0068859_100384557 3300005617 Bacteria 1499
296 Ga0068859_100472331 3300005617 Bacteria 1350
297 Ga0068859_101737929 3300005617 Bacteria 689
298 Ga0068864_100004743 3300005618 Bacteria 11134
299 Ga0068864_100008356 3300005618 Bacteria 8539
300 Ga0068864_100015128 3300005618 Bacteria 6415
301 Ga0068864_100021622 3300005618 Bacteria 5387
302 Ga0068864_100068473 3300005618 Bacteria 3084
303 Ga0068864_100146385 3300005618 Bacteria 2136
304 Ga0068864_100375652 3300005618 Bacteria 1346
305 Ga0068866_10052363 3300005718 Bacteria 2083
306 Ga0068866_10117908 3300005718 Bacteria 1491
307 Ga0068866_10374975 3300005718 Bacteria 911
308 Ga0068861_100301657 3300005719 Bacteria 1388
309 Ga0068861_100403924 3300005719 Bacteria 1213
310 Ga0068851_10027391 3300005834 Bacteria 2808
311 Ga0068851_10032547 3300005834 Bacteria 2594
312 Ga0068851_10039610 3300005834 Bacteria 2367
313 Ga0068851_10102103 3300005834 Bacteria 1523
314 Ga0068851_10509292 3300005834 Bacteria 723
315 Ga0068870_10069453 3300005840 Bacteria 1917
316 Ga0068863_100005224 3300005841 Bacteria 12814
317 Ga0068863_100006283 3300005841 Bacteria 11664
318 Ga0068863_100017839 3300005841 Bacteria 6793
319 Ga0068863_100018865 3300005841 Bacteria 6601
320 Ga0068863_100053846 3300005841 Bacteria 3814
321 Ga0068863_100428988 3300005841 Bacteria 1296
322 Ga0068863_101567897 3300005841 Bacteria 667
323 Ga0068863_101705986 3300005841 Unclassified 639
324 Ga0068858_100002211 3300005842 Bacteria 19692
325 Ga0068858_100005525 3300005842 Bacteria 12375
326 Ga0068858_100076344 3300005842 Bacteria 3111
327 Ga0068858_100082262 3300005842 Bacteria 2993
328 Ga0068858_100317199 3300005842 Bacteria 1489
329 Ga0068858_100873371 3300005842 Bacteria 879
330 Ga0068860_100014529 3300005843 Bacteria 7704
331 Ga0068860_100015613 3300005843 Bacteria 7415
332 Ga0068860_100030740 3300005843 Bacteria 5164
333 Ga0068860_100152237 3300005843 Bacteria 2227
334 Ga0068860_100338497 3300005843 Bacteria 1479
335 Ga0068862_100089982 3300005844 Bacteria 2671
336 Ga0068862_100172814 3300005844 Bacteria 1935
337 Ga0068862_100249953 3300005844 Bacteria 1616
338 Ga0068862_100347971 3300005844 Bacteria 1374
339 Ga0068862_100587656 3300005844 Bacteria 1067
340 Ga0068862_101049502 3300005844 Bacteria 808
341 Ga0081539_10039652 3300005985 Bacteria 2775
342 Ga0081539_10043839 3300005985 Bacteria 2588
343 Ga0070717_10003438 3300006028 Bacteria 11329
344 Ga0070717_10107974 3300006028 Bacteria 2371
345 Ga0070716_100073346 3300006173 Bacteria 2019
346 Ga0070716_100151178 3300006173 Bacteria 1493
347 Ga0070712_100028294 3300006175 Bacteria 3748
348 Ga0097621_100091147 3300006237 Bacteria 2551
349 Ga0097621_100178140 3300006237 Bacteria 1836
350 Ga0097621_100281676 3300006237 Bacteria 1463
351 Ga0068871_100070467 3300006358 Bacteria 2874
352 Ga0068871_100078267 3300006358 Bacteria 2734
353 Ga0068871_100237056 3300006358 Bacteria 1585
354 Ga0068871_100418589 3300006358 Bacteria 1196
355 Ga0068871_100428958 3300006358 Bacteria 1182
356 Ga0068871_100950207 3300006358 Bacteria 798
357 Ga0075428_100475792 3300006844 Bacteria 1337
358 Ga0075431_100422751 3300006847 Bacteria 1332
359 Ga0075433_10004614 3300006852 Bacteria 10749
360 Ga0075434_100551459 3300006871 Bacteria 1172
361 Ga0068865_100110057 3300006881 Bacteria 2031
362 Ga0068865_100344979 3300006881 Bacteria 1204
363 Ga0068865_100481851 3300006881 Bacteria 1031
364 Ga0097620_100007209 3300006931 Bacteria 11280
365 Ga0097620_100153230 3300006931 Bacteria 2381
366 Ga0097620_100384596 3300006931 Bacteria 1499
367 Ga0097620_100472340 3300006931 Bacteria 1350
368 Ga0097620_101738277 3300006931 Bacteria 689
369 Ga0075435_100129329 3300007076 Bacteria 2112
370 Ga0105250_10105385 3300009092 Bacteria 1152
371 Ga0105240_10075971 3300009093 Bacteria 4143
372 Ga0105240_10161501 3300009093 Bacteria 2661
373 Ga0111539_10028755 3300009094 Bacteria 6779
374 Ga0105245_10382525 3300009098 Bacteria 1402
375 Ga0105245_11067980 3300009098 Bacteria 853
376 Ga0105247_10999547 3300009101 Bacteria 653
377 Ga0114129_10468355 3300009147 Bacteria 1650
378 Ga0105243_10291101 3300009148 Bacteria 1475
379 Ga0105243_10419225 3300009148 Bacteria 1248
380 Ga0105243_10715820 3300009148 Bacteria 978
381 Ga0105243_10864860 3300009148 Bacteria 896
382 Ga0105241_10317696 3300009174 Bacteria 1342
383 Ga0105242_10231744 3300009176 Bacteria 1655
384 Ga0105248_10000070 3300009177 Bacteria 119985
385 Ga0105248_10000213 3300009177 Bacteria 66972
386 Ga0105248_10003106 3300009177 Bacteria 18389
387 Ga0105248_10040205 3300009177 Bacteria 5243
388 Ga0105248_10052681 3300009177 Bacteria 4566
389 Ga0105248_10054682 3300009177 Bacteria 4477
390 Ga0105248_10132296 3300009177 Bacteria 2814
391 Ga0105248_10205713 3300009177 Bacteria 2218
392 Ga0105237_10032085 3300009545 Bacteria 5319
393 Ga0105237_10038803 3300009545 Bacteria 4809
394 Ga0105237_10617937 3300009545 Bacteria 1090
395 Ga0105238_10003788 3300009551 Bacteria 15030
396 Ga0105238_10277723 3300009551 Bacteria 1656
397 Ga0105238_10360427 3300009551 Bacteria 1443
398 Ga0105238_10603861 3300009551 Bacteria 1105
399 Ga0105238_10653984 3300009551 Bacteria 1061
400 Ga0105249_10045013 3300009553 Bacteria 4013
401 Ga0105249_10247416 3300009553 Bacteria 1766
402 Ga0105246_10170191 3300011119 Bacteria 1668
403 Ga0105246_10221289 3300011119 Bacteria 1484
404 Ga0105246_10778188 3300011119 Bacteria 847
405 Ga0157373_10020686 3300013100 Bacteria 4780
406 Ga0157373_10026494 3300013100 Bacteria 4187
407 Ga0157373_10072746 3300013100 Bacteria 2426
408 Ga0157373_10135344 3300013100 Bacteria 1733
409 Ga0157373_10151051 3300013100 Bacteria 1634
410 Ga0157373_10151736 3300013100 Bacteria 1630
411 Ga0157373_10195242 3300013100 Bacteria 1427
412 Ga0157373_10253340 3300013100 Bacteria 1245
413 Ga0157373_10625602 3300013100 Bacteria 785
414 Ga0157373_10666974 3300013100 Bacteria 760
415 Ga0157371_10105225 3300013102 Bacteria 2002
416 Ga0157371_10114832 3300013102 Bacteria 1912
417 Ga0157371_10119697 3300013102 Bacteria 1872
418 Ga0157371_10124629 3300013102 Bacteria 1832
419 Ga0157371_10235996 3300013102 Bacteria 1315
420 Ga0157371_10279082 3300013102 Bacteria 1207
421 Ga0157371_10283687 3300013102 Bacteria 1197
422 Ga0157371_10462937 3300013102 Bacteria 933
423 Ga0157371_10485612 3300013102 Bacteria 911
424 Ga0157371_10586216 3300013102 Bacteria 828
425 Ga0157370_10070076 3300013104 Bacteria 3311
426 Ga0157370_10079991 3300013104 Bacteria 3078
427 Ga0157370_10089063 3300013104 Bacteria 2899
428 Ga0157370_10130545 3300013104 Bacteria 2344
429 Ga0157370_10148833 3300013104 Bacteria 2179
430 Ga0157370_10500743 3300013104 Bacteria 1115
431 Ga0157370_11317992 3300013104 Bacteria 650
432 Ga0157369_10093289 3300013105 Bacteria 3213
433 Ga0157369_10114824 3300013105 Bacteria 2859
434 Ga0157369_10641449 3300013105 Bacteria 1095
435 Ga0157369_10703270 3300013105 Bacteria 1041
436 Ga0157369_10732251 3300013105 Bacteria 1018
437 Ga0157374_10002929 3300013296 Bacteria 14299
438 Ga0157374_10117066 3300013296 Bacteria 2568
439 Ga0157374_10311639 3300013296 Bacteria 1558
440 Ga0157374_10658966 3300013296 Bacteria 1059
441 Ga0157374_11019911 3300013296 Bacteria 847
442 Ga0157378_10447142 3300013297 Bacteria 1282
443 Ga0163162_10035426 3300013306 Bacteria 4972
444 Ga0163162_10041643 3300013306 Bacteria 4596
445 Ga0163162_10263687 3300013306 Bacteria 1854
446 Ga0163162_10427793 3300013306 Bacteria 1456
447 Ga0163162_10500439 3300013306 Bacteria 1345
448 Ga0163162_10731537 3300013306 Bacteria 1110
449 Ga0163162_11338111 3300013306 Bacteria 814
450 Ga0157372_10015547 3300013307 Bacteria 8156
451 Ga0157372_10164851 3300013307 Bacteria 2562
452 Ga0157372_10290936 3300013307 Bacteria 1900
453 Ga0157372_10488007 3300013307 Bacteria 1436
454 Ga0157372_11126729 3300013307 Bacteria 907
455 Ga0157372_11144656 3300013307 Bacteria 900
456 Ga0157372_11285584 3300013307 Unclassified 844
457 Ga0157375_10001389 3300013308 Bacteria 20906
458 Ga0157375_10385298 3300013308 Bacteria 1568
459 Ga0163163_10001578 3300014325 Bacteria 19209
460 Ga0163163_10004075 3300014325 Bacteria 12457
461 Ga0163163_10010868 3300014325 Bacteria 8220
462 Ga0163163_10038751 3300014325 Bacteria 4646
463 Ga0157380_10112766 3300014326 Bacteria 2288
464 Ga0157380_10725832 3300014326 Bacteria 1002
465 Ga0157380_11417869 3300014326 Bacteria 745
466 Ga0182008_10095320 3300014497 Bacteria 1468
467 Ga0182008_10333591 3300014497 Bacteria 801
468 Ga0157377_10079836 3300014745 Bacteria 1910
469 Ga0157377_10788005 3300014745 Bacteria 699
470 Ga0157379_10046364 3300014968 Bacteria 3877
471 Ga0157379_10052386 3300014968 Bacteria 3645
472 Ga0157379_10762859 3300014968 Bacteria 911
473 Ga0163161_10138010 3300017792 Bacteria 1844
474 Ga0206353_10295639 3300020082 Bacteria 3187
475 Ga0206353_11387242 3300020082 Bacteria 1309
476 Ga0213876_10018941 3300021384 Bacteria 3636
477 Ga0207673_1007829 3300025290 Bacteria 1345
478 Ga0207697_10070679 3300025315 Bacteria 1462
479 Ga0207697_10105857 3300025315 Bacteria 1202
480 Ga0207656_10008167 3300025321 Bacteria 3842
481 Ga0207656_10021208 3300025321 Bacteria 2593
482 Ga0207656_10047133 3300025321 Bacteria 1852
483 Ga0207656_10320812 3300025321 Bacteria 769
484 Ga0207696_1053173 3300025711 Bacteria 1153
485 Ga0207682_10016516 3300025893 Bacteria 2880
486 Ga0207682_10138060 3300025893 Bacteria 1092
487 Ga0207642_10036385 3300025899 Bacteria 2112
488 Ga0207642_10113172 3300025899 Bacteria 1386
489 Ga0207688_10012160 3300025901 Bacteria 4682
490 Ga0207680_10023515 3300025903 Bacteria 3367
491 Ga0207680_10133507 3300025903 Bacteria 1638
492 Ga0207680_10168045 3300025903 Bacteria 1475
493 Ga0207680_10186583 3300025903 Bacteria 1405
494 Ga0207647_10004086 3300025904 Bacteria 10842
495 Ga0207647_10015527 3300025904 Bacteria 5217
496 Ga0207647_10030619 3300025904 Bacteria 3469
497 Ga0207647_10031069 3300025904 Bacteria 3440
498 Ga0207647_10037150 3300025904 Bacteria 3090
499 Ga0207647_10057939 3300025904 Bacteria 2374
500 Ga0207647_10070509 3300025904 Bacteria 2111
501 Ga0207647_10110982 3300025904 Bacteria 1621
502 Ga0207647_10617287 3300025904 Bacteria 597
503 Ga0207645_10084914 3300025907 Bacteria 2032
504 Ga0207645_10091707 3300025907 Bacteria 1954
505 Ga0207645_10105312 3300025907 Bacteria 1822
506 Ga0207645_10312168 3300025907 Bacteria 1048
507 Ga0207643_10033522 3300025908 Bacteria 2873
508 Ga0207705_10000333 3300025909 Bacteria 42908
509 Ga0207705_10001746 3300025909 Bacteria 17194
510 Ga0207705_10007216 3300025909 Bacteria 8182
511 Ga0207705_10010541 3300025909 Bacteria 6720
512 Ga0207705_10013483 3300025909 Bacteria 5898
513 Ga0207705_10026570 3300025909 Bacteria 4128
514 Ga0207705_10053506 3300025909 Bacteria 2908
515 Ga0207705_10077726 3300025909 Bacteria 2414
516 Ga0207705_10098137 3300025909 Bacteria 2152
517 Ga0207705_10110993 3300025909 Bacteria 2026
518 Ga0207705_10116010 3300025909 Bacteria 1982
519 Ga0207705_10143191 3300025909 Bacteria 1786
520 Ga0207705_10147448 3300025909 Bacteria 1761
521 Ga0207705_10300160 3300025909 Bacteria 1232
522 Ga0207705_10420572 3300025909 Bacteria 1035
523 Ga0207705_10457613 3300025909 Bacteria 990
524 Ga0207705_10499563 3300025909 Bacteria 945
525 Ga0207705_10772540 3300025909 Bacteria 746
526 Ga0207654_10034019 3300025911 Bacteria 2828
527 Ga0207707_10019711 3300025912 Bacteria 5887
528 Ga0207707_10034113 3300025912 Bacteria 4453
529 Ga0207707_10132268 3300025912 Bacteria 2182
530 Ga0207707_10145804 3300025912 Bacteria 2069
531 Ga0207707_10213201 3300025912 Bacteria 1682
532 Ga0207707_10221892 3300025912 Bacteria 1645
533 Ga0207695_10019242 3300025913 Bacteria 7863
534 Ga0207695_10050405 3300025913 Bacteria 4380
535 Ga0207671_10030326 3300025914 Bacteria 4033
536 Ga0207660_10001841 3300025917 Bacteria 14140
537 Ga0207660_10004654 3300025917 Bacteria 8941
538 Ga0207660_10076392 3300025917 Bacteria 2449
539 Ga0207660_10200045 3300025917 Bacteria 1560
540 Ga0207660_10205242 3300025917 Bacteria 1541
541 Ga0207662_10739929 3300025918 Bacteria 691
542 Ga0207657_10001002 3300025919 Bacteria 30045
543 Ga0207657_10006606 3300025919 Bacteria 12004
544 Ga0207657_10014934 3300025919 Bacteria 7546
545 Ga0207657_10023739 3300025919 Bacteria 5703
546 Ga0207657_10033424 3300025919 Bacteria 4636
547 Ga0207657_10042240 3300025919 Bacteria 4024
548 Ga0207657_10054288 3300025919 Bacteria 3465
549 Ga0207657_10074924 3300025919 Bacteria 2857
550 Ga0207657_10079393 3300025919 Bacteria 2761
551 Ga0207657_10081780 3300025919 Bacteria 2712
552 Ga0207657_10088202 3300025919 Bacteria 2593
553 Ga0207657_10093942 3300025919 Bacteria 2498
554 Ga0207657_10147084 3300025919 Bacteria 1921
555 Ga0207657_10226846 3300025919 Bacteria 1495
556 Ga0207657_10924997 3300025919 Bacteria 671
557 Ga0207649_10001645 3300025920 Bacteria 12964
558 Ga0207649_10037381 3300025920 Bacteria 2933
559 Ga0207649_10037833 3300025920 Bacteria 2917
560 Ga0207649_10059702 3300025920 Bacteria 2394
561 Ga0207649_10066218 3300025920 Bacteria 2289
562 Ga0207649_10102241 3300025920 Bacteria 1899
563 Ga0207649_10115893 3300025920 Bacteria 1798
564 Ga0207649_10128169 3300025920 Bacteria 1720
565 Ga0207649_10134511 3300025920 Bacteria 1684
566 Ga0207649_10250208 3300025920 Bacteria 1276
567 Ga0207649_10308230 3300025920 Bacteria 1160
568 Ga0207649_10415107 3300025920 Bacteria 1010
569 Ga0207652_10000597 3300025921 Bacteria 36153
570 Ga0207652_10077412 3300025921 Bacteria 2902
571 Ga0207652_10091046 3300025921 Bacteria 2681
572 Ga0207652_10196018 3300025921 Bacteria 1817
573 Ga0207652_10204875 3300025921 Bacteria 1775
574 Ga0207652_10332173 3300025921 Bacteria 1373
575 Ga0207652_10384503 3300025921 Bacteria 1266
576 Ga0207652_10408131 3300025921 Bacteria 1226
577 Ga0207652_10640862 3300025921 Bacteria 951
578 Ga0207681_10016517 3300025923 Bacteria 4619
579 Ga0207681_10699713 3300025923 Bacteria 842
580 Ga0207681_10729555 3300025923 Bacteria 825
581 Ga0207681_10871869 3300025923 Bacteria 753
582 Ga0207694_10000966 3300025924 Bacteria 25308
583 Ga0207694_10120456 3300025924 Bacteria 2095
584 Ga0207694_10563865 3300025924 Bacteria 956
585 Ga0207650_10019449 3300025925 Bacteria 4771
586 Ga0207650_10024899 3300025925 Bacteria 4260
587 Ga0207650_10026361 3300025925 Bacteria 4145
588 Ga0207650_10030566 3300025925 Bacteria 3881
589 Ga0207650_10038719 3300025925 Bacteria 3483
590 Ga0207650_10122875 3300025925 Bacteria 2023
591 Ga0207650_10205246 3300025925 Bacteria 1580
592 Ga0207659_10080500 3300025926 Bacteria 2406
593 Ga0207659_10093990 3300025926 Bacteria 2246
594 Ga0207659_10131148 3300025926 Bacteria 1934
595 Ga0207659_10263499 3300025926 Bacteria 1403
596 Ga0207659_10916997 3300025926 Bacteria 753
597 Ga0207687_10058982 3300025927 Bacteria 2702
598 Ga0207687_10183270 3300025927 Bacteria 1624
599 Ga0207700_10066722 3300025928 Bacteria 2751
600 Ga0207700_10067393 3300025928 Bacteria 2740
601 Ga0207664_10031060 3300025929 Bacteria 4084
602 Ga0207664_10226352 3300025929 Bacteria 1624
603 Ga0207644_10000227 3300025931 Bacteria 38835
604 Ga0207644_10000461 3300025931 Bacteria 26322
605 Ga0207644_10002289 3300025931 Bacteria 12423
606 Ga0207644_10037092 3300025931 Bacteria 3427
607 Ga0207644_10253743 3300025931 Bacteria 1404
608 Ga0207644_10379296 3300025931 Bacteria 1153
609 Ga0207644_10384423 3300025931 Bacteria 1145
610 Ga0207690_10000100 3300025932 Bacteria 71510
611 Ga0207690_10011329 3300025932 Bacteria 5331
612 Ga0207690_10023845 3300025932 Bacteria 3825
613 Ga0207690_10030755 3300025932 Bacteria 3428
614 Ga0207690_10046462 3300025932 Bacteria 2876
615 Ga0207690_10064278 3300025932 Bacteria 2505
616 Ga0207690_10064694 3300025932 Bacteria 2498
617 Ga0207690_10066423 3300025932 Bacteria 2470
618 Ga0207690_10088790 3300025932 Bacteria 2178
619 Ga0207690_10179437 3300025932 Bacteria 1593
620 Ga0207690_10228145 3300025932 Bacteria 1428
621 Ga0207690_10397830 3300025932 Bacteria 1098
622 Ga0207690_10686902 3300025932 Bacteria 841
623 Ga0207690_11505147 3300025932 Bacteria 563
624 Ga0207706_10000822 3300025933 Bacteria 32219
625 Ga0207706_10002713 3300025933 Bacteria 17246
626 Ga0207706_10012022 3300025933 Bacteria 7886
627 Ga0207706_10084580 3300025933 Bacteria 2789
628 Ga0207706_10098483 3300025933 Bacteria 2572
629 Ga0207706_10115350 3300025933 Bacteria 2362
630 Ga0207706_10220968 3300025933 Bacteria 1659
631 Ga0207706_10293735 3300025933 Bacteria 1417
632 Ga0207706_10312984 3300025933 Bacteria 1367
633 Ga0207706_10472645 3300025933 Bacteria 1083
634 Ga0207706_10522987 3300025933 Bacteria 1023
635 Ga0207706_10544063 3300025933 Bacteria 1000
636 Ga0207706_10567584 3300025933 Bacteria 976
637 Ga0207669_10122525 3300025937 Bacteria 1768
638 Ga0207669_10527462 3300025937 Bacteria 949
639 Ga0207704_10053581 3300025938 Bacteria 2453
640 Ga0207704_10142348 3300025938 Bacteria 1680
641 Ga0207704_10272037 3300025938 Bacteria 1283
642 Ga0207704_10358048 3300025938 Bacteria 1138
643 Ga0207704_10517797 3300025938 Bacteria 964
644 Ga0207665_10060834 3300025939 Bacteria 2558
645 Ga0207665_10188348 3300025939 Bacteria 1498
646 Ga0207691_10001576 3300025940 Bacteria 22626
647 Ga0207691_10015793 3300025940 Bacteria 7176
648 Ga0207691_10064440 3300025940 Bacteria 3320
649 Ga0207691_10151943 3300025940 Bacteria 2035
650 Ga0207691_10268612 3300025940 Bacteria 1469
651 Ga0207711_10001361 3300025941 Bacteria 23065
652 Ga0207711_10001921 3300025941 Bacteria 18877
653 Ga0207711_10001950 3300025941 Bacteria 18727
654 Ga0207711_10014976 3300025941 Bacteria 6442
655 Ga0207711_10035904 3300025941 Bacteria 4203
656 Ga0207711_10123818 3300025941 Bacteria 2311
657 Ga0207711_10166469 3300025941 Bacteria 1998
658 Ga0207711_10414397 3300025941 Bacteria 1252
659 Ga0207689_10042278 3300025942 Bacteria 3771
660 Ga0207689_10123691 3300025942 Bacteria 2128
661 Ga0207689_10152262 3300025942 Bacteria 1906
662 Ga0207689_10595797 3300025942 Bacteria 930
663 Ga0207661_10001153 3300025944 Bacteria 17664
664 Ga0207661_10002619 3300025944 Bacteria 12385
665 Ga0207661_10065832 3300025944 Bacteria 2942
666 Ga0207661_10260356 3300025944 Bacteria 1545
667 Ga0207679_10000287 3300025945 Bacteria 38346
668 Ga0207679_10000689 3300025945 Bacteria 22607
669 Ga0207679_10013542 3300025945 Bacteria 5346
670 Ga0207679_10020813 3300025945 Bacteria 4434
671 Ga0207679_10021623 3300025945 Bacteria 4365
672 Ga0207679_10026472 3300025945 Bacteria 4000
673 Ga0207679_10068896 3300025945 Bacteria 2660
674 Ga0207679_10135378 3300025945 Bacteria 1983
675 Ga0207679_10198554 3300025945 Bacteria 1674
676 Ga0207679_10407316 3300025945 Bacteria 1197
677 Ga0207667_10018275 3300025949 Bacteria 7869
678 Ga0207667_10021727 3300025949 Bacteria 7110
679 Ga0207667_10048178 3300025949 Bacteria 4507
680 Ga0207667_10049168 3300025949 Bacteria 4456
681 Ga0207667_10051486 3300025949 Bacteria 4341
682 Ga0207667_10177450 3300025949 Bacteria 2188
683 Ga0207667_10190887 3300025949 Bacteria 2102
684 Ga0207667_10368922 3300025949 Bacteria 1463
685 Ga0207667_10956511 3300025949 Bacteria 846
686 Ga0207667_11778503 3300025949 Bacteria 581
687 Ga0207651_10039665 3300025960 Bacteria 3107
688 Ga0207651_10041848 3300025960 Bacteria 3044
689 Ga0207651_10107068 3300025960 Bacteria 2089
690 Ga0207651_10189397 3300025960 Bacteria 1639
691 Ga0207651_10307121 3300025960 Bacteria 1321
692 Ga0207712_10002434 3300025961 Bacteria 12030
693 Ga0207712_10081628 3300025961 Bacteria 2355
694 Ga0207668_10058358 3300025972 Bacteria 2697
695 Ga0207668_10274608 3300025972 Bacteria 1379
696 Ga0207668_10397306 3300025972 Bacteria 1165
697 Ga0207640_10013979 3300025981 Bacteria 4610
698 Ga0207640_10023568 3300025981 Bacteria 3701
699 Ga0207640_10034721 3300025981 Bacteria 3149
700 Ga0207640_10099878 3300025981 Bacteria 2032
701 Ga0207640_10199962 3300025981 Bacteria 1514
702 Ga0207640_10214083 3300025981 Bacteria 1470
703 Ga0207640_10284670 3300025981 Bacteria 1300
704 Ga0207640_10333815 3300025981 Bacteria 1212
705 Ga0207640_10485578 3300025981 Bacteria 1026
706 Ga0207658_10005148 3300025986 Bacteria 9003
707 Ga0207658_10009206 3300025986 Bacteria 6695
708 Ga0207658_10012034 3300025986 Bacteria 5902
709 Ga0207658_10023721 3300025986 Bacteria 4285
710 Ga0207658_10025198 3300025986 Bacteria 4164
711 Ga0207658_10038914 3300025986 Bacteria 3429
712 Ga0207658_10090430 3300025986 Bacteria 2372
713 Ga0207658_10264711 3300025986 Bacteria 1467
714 Ga0207658_10312687 3300025986 Bacteria 1357
715 Ga0207658_10322093 3300025986 Bacteria 1338
716 Ga0207658_10502229 3300025986 Bacteria 1080
717 Ga0207658_10783209 3300025986 Bacteria 865
718 Ga0207677_10129550 3300026023 Bacteria 1913
719 Ga0207677_10655332 3300026023 Bacteria 927
720 Ga0207677_10772585 3300026023 Bacteria 858
721 Ga0207703_10000872 3300026035 Bacteria 29607
722 Ga0207703_10003758 3300026035 Bacteria 12627
723 Ga0207703_10044307 3300026035 Bacteria 3575
724 Ga0207703_10111195 3300026035 Bacteria 2338
725 Ga0207703_10130682 3300026035 Bacteria 2168
726 Ga0207639_10000769 3300026041 Bacteria 21887
727 Ga0207639_10017503 3300026041 Bacteria 5081
728 Ga0207639_10021112 3300026041 Bacteria 4672
729 Ga0207639_10110803 3300026041 Bacteria 2236
730 Ga0207639_10111555 3300026041 Bacteria 2230
731 Ga0207639_10230184 3300026041 Bacteria 1606
732 Ga0207639_10893803 3300026041 Bacteria 830
733 Ga0207678_10001504 3300026067 Bacteria 21347
734 Ga0207678_10008151 3300026067 Bacteria 9239
735 Ga0207678_10010248 3300026067 Bacteria 8226
736 Ga0207678_10027050 3300026067 Bacteria 5002
737 Ga0207678_10031304 3300026067 Bacteria 4642
738 Ga0207678_10042037 3300026067 Bacteria 3961
739 Ga0207678_10163189 3300026067 Bacteria 1903
740 Ga0207678_10168822 3300026067 Bacteria 1868
741 Ga0207678_10187909 3300026067 Bacteria 1765
742 Ga0207678_10429170 3300026067 Bacteria 1147
743 Ga0207678_10507620 3300026067 Bacteria 1051
744 Ga0207678_10546928 3300026067 Bacteria 1012
745 Ga0207678_10678622 3300026067 Bacteria 906
746 Ga0207702_10000208 3300026078 Bacteria 69979
747 Ga0207702_10011761 3300026078 Bacteria 7290
748 Ga0207702_10014649 3300026078 Bacteria 6507
749 Ga0207702_10017061 3300026078 Bacteria 6006
750 Ga0207702_10124910 3300026078 Bacteria 2308
751 Ga0207702_10162909 3300026078 Bacteria 2038
752 Ga0207702_10325533 3300026078 Bacteria 1465
753 Ga0207702_10770004 3300026078 Bacteria 951
754 Ga0207641_10002146 3300026088 Bacteria 18591
755 Ga0207641_10016742 3300026088 Bacteria 6004
756 Ga0207641_10037418 3300026088 Bacteria 4052
757 Ga0207641_10099141 3300026088 Bacteria 2563
758 Ga0207641_10120288 3300026088 Bacteria 2342
759 Ga0207641_10229788 3300026088 Bacteria 1724
760 Ga0207641_11438811 3300026088 Bacteria 690
761 Ga0207648_10023329 3300026089 Bacteria 5545
762 Ga0207648_10060536 3300026089 Bacteria 3302
763 Ga0207676_10000139 3300026095 Bacteria 63189
764 Ga0207676_10012422 3300026095 Bacteria 6100
765 Ga0207676_10018657 3300026095 Bacteria 5049
766 Ga0207676_10046525 3300026095 Bacteria 3358
767 Ga0207676_10217465 3300026095 Bacteria 1699
768 Ga0207676_10261961 3300026095 Bacteria 1561
769 Ga0207676_10533282 3300026095 Bacteria 1119
770 Ga0207674_10000065 3300026116 Bacteria 109485
771 Ga0207674_10001471 3300026116 Bacteria 30430
772 Ga0207674_10002506 3300026116 Bacteria 23153
773 Ga0207674_10003445 3300026116 Bacteria 19357
774 Ga0207674_10045988 3300026116 Bacteria 4485
775 Ga0207674_10064693 3300026116 Bacteria 3688
776 Ga0207674_10232704 3300026116 Bacteria 1790
777 Ga0207674_10312579 3300026116 Bacteria 1520
778 Ga0207675_100360284 3300026118 Bacteria 1427
779 Ga0207683_10004578 3300026121 Bacteria 11911
780 Ga0207683_10005313 3300026121 Bacteria 11046
781 Ga0207683_10020153 3300026121 Bacteria 5701
782 Ga0207683_10022398 3300026121 Bacteria 5423
783 Ga0207683_10102665 3300026121 Bacteria 2554
784 Ga0207683_10252807 3300026121 Bacteria 1609
785 Ga0207683_10307686 3300026121 Bacteria 1450
786 Ga0207683_10499786 3300026121 Bacteria 1123
787 Ga0207698_10001407 3300026142 Bacteria 13964
788 Ga0207698_10065971 3300026142 Bacteria 2847
789 Ga0207698_10090310 3300026142 Bacteria 2504
790 Ga0207698_10099345 3300026142 Bacteria 2407
791 Ga0207698_10133024 3300026142 Bacteria 2129
792 Ga0207698_10153787 3300026142 Bacteria 2001
793 Ga0207698_10260574 3300026142 Bacteria 1593
794 Ga0207698_10292540 3300026142 Bacteria 1512
795 Ga0207698_10386427 3300026142 Bacteria 1333
796 Ga0207698_11323704 3300026142 Bacteria 735
797 Ga0207698_12127590 3300026142 Bacteria 574
798 Ga0207428_10163121 3300027907 Bacteria 1691
799 Ga0268266_10001577 3300028379 Bacteria 26652
800 Ga0268266_10008685 3300028379 Bacteria 9012
801 Ga0268266_10089685 3300028379 Bacteria 2693
802 Ga0268266_10275687 3300028379 Bacteria 1562
803 Ga0268265_10071310 3300028380 Bacteria 2705
804 Ga0268265_10102048 3300028380 Bacteria 2319
805 Ga0268265_10142333 3300028380 Bacteria 2009
806 Ga0268265_10203708 3300028380 Bacteria 1718
807 Ga0268265_10241214 3300028380 Bacteria 1595
808 Ga0268265_10256845 3300028380 Bacteria 1551
809 Ga0268265_10287557 3300028380 Bacteria 1474
810 Ga0268264_10003610 3300028381 Bacteria 13321
811 Ga0268264_10006747 3300028381 Bacteria 9648
812 Ga0268264_10043042 3300028381 Bacteria 3740
813 Ga0268264_10078755 3300028381 Bacteria 2810
814 Ga0268264_10135767 3300028381 Bacteria 2187
815 Ga0268264_10291634 3300028381 Bacteria 1532
816 Ga0316182_1281089 3300030745 Bacteria 1739
817 Ga0307513_10379603 3300031456 Bacteria 1153
818 Ga0307408_100021340 3300031548 Bacteria 4383
819 Ga0307408_100173739 3300031548 Bacteria 1722
820 Ga0307408_100338098 3300031548 Bacteria 1273
821 Ga0307408_101151931 3300031548 Bacteria 721
822 Ga0307405_10091328 3300031731 Bacteria 2017
823 Ga0307405_10106672 3300031731 Bacteria 1890
824 Ga0307405_10143290 3300031731 Bacteria 1670
825 Ga0307405_10152759 3300031731 Bacteria 1625
826 Ga0307413_10002465 3300031824 Bacteria 7528
827 Ga0307413_10115940 3300031824 Bacteria 1803
828 Ga0307413_10160396 3300031824 Bacteria 1579
829 Ga0307413_10372886 3300031824 Bacteria 1109
830 Ga0307413_10554875 3300031824 Bacteria 932
831 Ga0307410_10032305 3300031852 Bacteria 3366
832 Ga0307410_10033469 3300031852 Bacteria 3319
833 Ga0307410_10107232 3300031852 Bacteria 2014
834 Ga0307410_10136213 3300031852 Bacteria 1811
835 Ga0307410_10139131 3300031852 Bacteria 1793
836 Ga0307410_10159778 3300031852 Bacteria 1687
837 Ga0307410_11689288 3300031852 Bacteria 561
838 Ga0307406_10060202 3300031901 Bacteria 2447
839 Ga0307406_10192163 3300031901 Bacteria 1495
840 Ga0307406_10210059 3300031901 Bacteria 1439
841 Ga0307406_11041552 3300031901 Bacteria 704
842 Ga0307406_11456777 3300031901 Bacteria 601
843 Ga0307407_10005180 3300031903 Bacteria 5627
844 Ga0307407_10053949 3300031903 Bacteria 2315
845 Ga0307407_10060365 3300031903 Bacteria 2212
846 Ga0307407_10307965 3300031903 Bacteria 1107
847 Ga0307407_10323874 3300031903 Bacteria 1082
848 Ga0307407_10947282 3300031903 Bacteria 663
849 Ga0307412_10115270 3300031911 Bacteria 1926
850 Ga0307412_10185628 3300031911 Bacteria 1568
851 Ga0307412_10226229 3300031911 Bacteria 1437
852 Ga0307412_10401742 3300031911 Bacteria 1115
853 Ga0307412_10692960 3300031911 Bacteria 873
854 Ga0307412_10706333 3300031911 Bacteria 866
855 Ga0307409_100012343 3300031995 Bacteria 5440
856 Ga0307409_100079953 3300031995 Bacteria 2636
857 Ga0307416_100004927 3300032002 Bacteria 8131
858 Ga0307416_100033137 3300032002 Bacteria 3913
859 Ga0307416_100038355 3300032002 Bacteria 3696
860 Ga0307416_100154703 3300032002 Bacteria 2109
861 Ga0307416_100298854 3300032002 Bacteria 1599
862 Ga0307416_100509379 3300032002 Bacteria 1269
863 Ga0307416_101396413 3300032002 Bacteria 806
864 Ga0307416_102429888 3300032002 Bacteria 623
865 Ga0307414_10029655 3300032004 Bacteria 3563
866 Ga0307414_10044406 3300032004 Bacteria 3035
867 Ga0307414_10384657 3300032004 Bacteria 1214
868 Ga0307414_10573699 3300032004 Bacteria 1008
869 Ga0307414_10584229 3300032004 Bacteria 1000
870 Ga0307414_11450984 3300032004 Bacteria 638
871 Ga0307411_10019561 3300032005 Bacteria 3914
872 Ga0307411_10064651 3300032005 Bacteria 2450
873 Ga0307411_10170020 3300032005 Bacteria 1642
874 Ga0307411_10225322 3300032005 Bacteria 1457
875 Ga0307411_10555084 3300032005 Bacteria 980
876 Ga0307415_100005059 3300032126 Bacteria 6942
877 Ga0307415_100014920 3300032126 Bacteria 4585
878 Ga0307415_100071547 3300032126 Bacteria 2439
879 Ga0307415_100318124 3300032126 Bacteria 1296
880 Ga0307415_101070249 3300032126 Bacteria 753
881 Ga0307415_101148844 3300032126 Bacteria 729
882 Ga0373930_0014540 3300034816 Bacteria 1467
883 Ga0373960_0115077 3300035121 Bacteria 887
884 Ga0373946_0493545 3300035171 Bacteria 627
885 Ga0373962_0031509 3300035242 Bacteria 1455
886 Ga0373931_0081369 3300035691 Bacteria 1788
887 Ga0373935_0084121 3300035692 Bacteria 2072
888 Ga0373925_1018695 3300037068 Bacteria 682
889 Ga0395899_0002686 3300037312 Bacteria 14343
890 Ga0395899_0006989 3300037312 Bacteria 8744
891 Ga0395899_0025438 3300037312 Bacteria 4469
892 Ga0395899_0033462 3300037312 Bacteria 3860
893 Ga0395899_0042956 3300037312 Bacteria 3372
894 Ga0395899_0272079 3300037312 Bacteria 1155
895 Ga0395899_0474260 3300037312 Bacteria 816
896 Ga0395900_0008529 3300037418 Bacteria 10533
897 Ga0395900_0008641 3300037418 Bacteria 10466
898 Ga0395900_0039774 3300037418 Bacteria 4845
899 Ga0395900_0086602 3300037418 Bacteria 3219
900 Ga0395900_0192271 3300037418 Bacteria 2069
901 Ga0395900_0223761 3300037418 Bacteria 1895
902 Ga0395900_0296145 3300037418 Bacteria 1605
903 Ga0395900_0507457 3300037418 Bacteria 1155
904 Ga0395898_0003834 3300037466 Bacteria 16661
905 Ga0395898_0005157 3300037466 Bacteria 14138
906 Ga0395898_0043199 3300037466 Bacteria 4442
907 Ga0395898_0090895 3300037466 Bacteria 2937
908 Ga0395898_0105799 3300037466 Bacteria 2698
909 Ga0395898_0221146 3300037466 Bacteria 1806
910 Ga0395898_0326848 3300037466 Bacteria 1462
911 Ga0395905_0002386 3300037471 Bacteria 20908
912 Ga0395905_0005013 3300037471 Bacteria 13639
913 Ga0395905_0010336 3300037471 Bacteria 9084
914 Ga0395905_0014375 3300037471 Bacteria 7562
915 Ga0395905_0015132 3300037471 Bacteria 7342
916 Ga0395905_0020152 3300037471 Bacteria 6317
917 Ga0395905_0034106 3300037471 Bacteria 4778
918 Ga0395905_0043941 3300037471 Bacteria 4192
919 Ga0395905_0044590 3300037471 Bacteria 4162
920 Ga0395905_0046288 3300037471 Bacteria 4079
921 Ga0395905_0061523 3300037471 Bacteria 3512
922 Ga0395905_0062894 3300037471 Bacteria 3471
923 Ga0395905_0091116 3300037471 Bacteria 2858
924 Ga0395905_0091170 3300037471 Bacteria 2858
925 Ga0395905_0136989 3300037471 Bacteria 2303
926 Ga0395905_0146932 3300037471 Bacteria 2218
927 Ga0395905_0215408 3300037471 Bacteria 1798
928 Ga0395905_0288973 3300037471 Bacteria 1526
929 Ga0395905_0323316 3300037471 Bacteria 1432
930 Ga0395905_0417607 3300037471 Bacteria 1237
931 Ga0395905_0496586 3300037471 Bacteria 1120
932 Ga0395905_0557997 3300037471 Bacteria 1046
933 Ga0395905_0819699 3300037471 Bacteria 833
934 Ga0395905_0850288 3300037471 Bacteria 815
935 Ga0395905_0881214 3300037471 Bacteria 798
936 Ga0395905_1697559 3300037471 Bacteria 537
937 Ga0395901_0005487 3300038443 Bacteria 12850
938 Ga0395901_0011994 3300038443 Bacteria 8791
939 Ga0395901_0012646 3300038443 Bacteria 8563
940 Ga0395901_0054660 3300038443 Bacteria 4150
941 Ga0395901_0059663 3300038443 Bacteria 3969
942 Ga0395901_0116534 3300038443 Bacteria 2806
943 Ga0395901_0237220 3300038443 Bacteria 1903
944 Ga0395901_0305579 3300038443 Bacteria 1648
945 Ga0395901_0394655 3300038443 Bacteria 1422
946 Ga0395901_0698753 3300038443 Bacteria 1012
947 Ga0395901_1770480 3300038443 Bacteria 567
948 Ga0237819_01553 3300038705 Bacteria 5803
949 Ga0237816_04878 3300039145 Bacteria 917
950 Ga0436365_0482220 3300039437 Bacteria 16094
951 Ga0439465_0015015 3300041413 Bacteria 2417
952 Ga0439465_0158893 3300041413 Bacteria 810
953 Ga0439448_0002057 3300042005 Bacteria 5395
954 Ga0439432_033936 3300042006 Bacteria 1640
955 Ga0439449_0023318 3300042007 Bacteria 2315
956 Ga0439452_067023 3300042010 Bacteria 796
957 Ga0450905_001683 3300042142 Bacteria 2822
958 Ga0450889_000233 3300042144 Bacteria 6208
959 Ga0439458_0000439 3300042157 Bacteria 10493
960 Ga0450908_029551 3300042184 Bacteria 953
961 Ga0439464_0002400 3300042439 Bacteria 4605
962 Ga0466972_0219201 3300044658 Bacteria 890
963 Ga0466963_0007917 3300044694 Bacteria 6363
964 Ga0466963_0224878 3300044694 Bacteria 1315
965 Ga0466970_0107311 3300044765 Bacteria 1524
966 Ga0466957_0059468 3300044842 Bacteria 2342
967 Ga0466957_0081261 3300044842 Bacteria 2018
968 Ga0466957_0276271 3300044842 Bacteria 1123
969 Ga0466957_0685576 3300044842 Bacteria 722
970 Ga0466960_0142389 3300044901 Bacteria 1275
971 Ga0466967_0024875 3300045976 Bacteria 4930
972 Ga0466967_0051359 3300045976 Bacteria 3613
973 Ga0466967_0132110 3300045976 Bacteria 2318
974 Ga0466967_0214198 3300045976 Bacteria 1828
975 Ga0466967_0244070 3300045976 Bacteria 1714
976 Ga0466967_0614516 3300045976 Bacteria 1073
977 Ga0495663_0111426 3300046525 Bacteria 910
978 Ga0495621_0143978 3300046539 Bacteria 934
979 Ga0495668_0283090 3300046616 Bacteria 908
980 Ga0495669_0009003 3300046684 Bacteria 4206
981 Ga0495669_0035995 3300046684 Bacteria 2187
982 Ga0495669_0103078 3300046684 Bacteria 1326
983 Ga0495669_0166086 3300046684 Bacteria 1049
984 Ga0495669_0247580 3300046684 Bacteria 856
985 Ga0496100_0008859 3300048903 Bacteria 5629
986 Ga0496101_0006555 3300048904 Bacteria 7497
987 Ga0496101_0044294 3300048904 Bacteria 3184
988 Ga0496101_0063710 3300048904 Bacteria 2684
989 Ga0496102_0048701 3300048905 Bacteria 3853
990 Ga0496102_0205598 3300048905 Bacteria 1856
991 Ga0496102_0362690 3300048905 Bacteria 1364
992 Ga0496103_0104521 3300048906 Bacteria 1795
993 Ga0496103_0105619 3300048906 Bacteria 1786
994 Ga0496103_0191468 3300048906 Bacteria 1315
995 Ga0496105_0067406 3300048908 Bacteria 2955
996 Ga0496106_0087172 3300048909 Bacteria 2405
997 Ga0496106_0102141 3300048909 Bacteria 2224
998 Ga0496107_0038759 3300048910 Bacteria 3417
999 Ga0496107_0041310 3300048910 Bacteria 3311
1000 Ga0496107_0054501 3300048910 Bacteria 2886
1001 Ga0496107_0081578 3300048910 Bacteria 2359
1002 Ga0496107_0112169 3300048910 Bacteria 2005
1003 Ga0496107_0425528 3300048910 Bacteria 987
1004 Ga0496108_0001730 3300048911 Bacteria 17332
1005 Ga0496108_0014249 3300048911 Bacteria 6488
1006 Ga0496109_0010337 3300048912 Bacteria 7971
1007 Ga0496109_0017653 3300048912 Bacteria 6258
1008 Ga0496109_0143372 3300048912 Bacteria 2234
1009 Ga0496109_0415996 3300048912 Bacteria 1270
1010 Ga0496109_0628170 3300048912 Bacteria 1011
1011 Ga0496110_0001772 3300048913 Bacteria 15906
1012 Ga0496110_0017149 3300048913 Bacteria 6054
1013 Ga0496110_0304625 3300048913 Bacteria 1451
1014 Ga0496111_0003609 3300048914 Bacteria 9589
1015 Ga0496111_0020942 3300048914 Bacteria 4559
1016 Ga0496111_0078224 3300048914 Bacteria 2412
1017 Ga0496111_0263513 3300048914 Bacteria 1279
1018 Ga0496112_0011496 3300048915 Bacteria 8085
1019 Ga0496112_0012316 3300048915 Bacteria 7855
1020 Ga0496112_0021282 3300048915 Bacteria 6165
1021 Ga0496112_0045983 3300048915 Bacteria 4280
1022 Ga0496113_0000722 3300048916 Bacteria 16924
1023 Ga0496113_0033764 3300048916 Bacteria 3728
1024 Ga0496114_0042645 3300048917 Bacteria 3761
1025 Ga0496115_0232423 3300048918 Bacteria 1520
1026 Ga0501047_0407541 3300049581 Bacteria 1192
1027 Ga0501067_0145691 3300049583 Unclassified 1319
1028 Ga0501069_0062278 3300049585 Bacteria 2083
1029 Ga0501070_0082776 3300049586 Bacteria 2656
1030 Ga0501071_0386726 3300049587 Bacteria 1067
1031 Ga0501223_016462 3300049663 Bacteria 1461
1032 Ga0501227_061895 3300049665 Bacteria 961
1033 Ga0501236_085945 3300049670 Bacteria 597
1034 Ga0501250_084929 3300049680 Bacteria 544
1035 Ga0501229_031816 3300049706 Bacteria 726
1036 Ga0501080_0430457 3300049742 Bacteria 1184
1037 Ga0501268_003066 3300049765 Bacteria 2259
1038 Ga0501035_0654994 3300049822 Bacteria 851
1039 nmdc:mga05p37_1002433_c1 3300050507 Bacteria 887
1040 nmdc:mga08y16_105068_c1 3300050511 Bacteria 2940
1041 nmdc:mga0rr50_423127_c1 3300050513 Bacteria 1127
1042 nmdc:mga0a205_871_c1 3300050515 Bacteria 24762
1043 Ga0500658_0000107 3300053134 Bacteria 38715
1044 Ga0466962_0043504 3300061719 Bacteria 2149
1045 Ga0466962_0100658 3300061719 Bacteria 1388
1046 Ga0466957_0156095
1047 JGI24736J21556_1007516
1048 JGI24736J21556_1011447
1049 JGI24741J21665_1004325
1050 JGI24752J21851_1002999
1051 JGI24746J21847_1014119
1052 JGI24747J21853_1004024
1053 JGI24740J21852_10009846
1054 JGI24740J21852_10016311
1055 JGI24740J21852_10023199
1056 JGI24740J21852_10053946
1057 JGI24740J21852_10109432
1058 JGI24739J22299_10003381
1059 JGI24739J22299_10026131
1060 JGI24739J22299_10029229
1061 JGI24737J22298_10020911
1062 JGI24737J22298_10029727
1063 JGI24735J21928_10008874
1064 JGI24735J21928_10009958
1065 JGI24735J21928_10028737
1066 JGI24745J21846_1011522
1067 JGI25406J46586_10149353
1068 Ga0065712_10117537
1069 Ga0065712_10191391
1070 Ga0065715_10047950
1071 Ga0065715_10254336
1072 Ga0065715_10666881
1073 Ga0070658_10001600
1074 Ga0070658_10004777
1075 Ga0070658_10045282
1076 Ga0070658_10048049
1077 Ga0070658_10146124
1078 Ga0070658_10148068
1079 Ga0070658_10360168
1080 Ga0070658_10424470
1081 Ga0070658_10621422
1082 Ga0070676_10125805
1083 Ga0070676_10179233
1084 Ga0070676_10551824
1085 Ga0070676_10554383
1086 Ga0070683_100002224
1087 Ga0070683_100002474
1088 Ga0070683_100036141
1089 Ga0070683_100145029
1090 Ga0070690_100138719
1091 Ga0070690_100404095
1092 Ga0070670_100001116
1093 Ga0070670_100130966
1094 Ga0070670_100207874
1095 Ga0070670_100245612
1096 Ga0070670_100360377
1097 Ga0070670_100510323
1098 Ga0070677_10192404
1099 Ga0068869_100095902
1100 Ga0068869_100155784
1101 Ga0068869_100263849
1102 Ga0068869_100283415
1103 Ga0070666_10003135
1104 Ga0070666_10003536
1105 Ga0070666_10046806
1106 Ga0070666_10194047
1107 Ga0070666_10349641
1108 Ga0070680_100013944
1109 Ga0070680_100231029
1110 Ga0070680_100266319
1111 Ga0070680_100380855
1112 Ga0070680_100419184
1113 Ga0070680_100926890
1114 Ga0070682_100044395
1115 Ga0070682_100181510
1116 Ga0070682_100221882
1117 Ga0068868_100156706
1118 Ga0070660_100000972
1119 Ga0070660_100001048
1120 Ga0070660_100017208
1121 Ga0070660_100017771
1122 Ga0070660_100038576
1123 Ga0070660_100049740
1124 Ga0070660_100149613
1125 Ga0070660_100169156
1126 Ga0070660_100175396
1127 Ga0070660_100219031
1128 Ga0070660_100240202
1129 Ga0070660_100337634
1130 Ga0070691_10014272
1131 Ga0070687_100120712
1132 Ga0070661_100000157
1133 Ga0070661_100004095
1134 Ga0070661_100024622
1135 Ga0070661_100040174
1136 Ga0070661_100040813
1137 Ga0070661_100057333
1138 Ga0070661_100060045
1139 Ga0070661_100100496
1140 Ga0070661_100113656
1141 Ga0070661_100164138
1142 Ga0070661_100177229
1143 Ga0070661_100381031
1144 Ga0070692_10040796
1145 Ga0070692_10055944
1146 Ga0070692_10101215
1147 Ga0070668_100070481
1148 Ga0070668_100196460
1149 Ga0070668_100498342
1150 Ga0070668_100622364
1151 Ga0070668_100637201
1152 Ga0070668_101107106
1153 Ga0070668_101210696
1154 Ga0070669_100056811
1155 Ga0070669_100096034
1156 Ga0070669_100248550
1157 Ga0070669_100332326
1158 Ga0070669_100388703
1159 Ga0070669_101771927
1160 Ga0070675_100077866
1161 Ga0070675_100215526
1162 Ga0070675_100437553
1163 Ga0070675_100472281
1164 Ga0070675_101273876
1165 Ga0070671_100002642
1166 Ga0070671_100017860
1167 Ga0070671_100065855
1168 Ga0070671_100094014
1169 Ga0070671_100150771
1170 Ga0070674_100028462
1171 Ga0070674_100057585
1172 Ga0070674_100093696
1173 Ga0070673_100001165
1174 Ga0070673_100128032
1175 Ga0070673_100348561
1176 Ga0070659_100000086
1177 Ga0070659_100016202
1178 Ga0070659_100041914
1179 Ga0070659_100058365
1180 Ga0070659_100062906
1181 Ga0070659_100163922
1182 Ga0070659_100216337
1183 Ga0070659_100261649
1184 Ga0070659_100325523
1185 Ga0070659_100353760
1186 Ga0070659_100504078
1187 Ga0070659_100519231
1188 Ga0070667_100002391
1189 Ga0070667_100002494
1190 Ga0070667_100004102
1191 Ga0070667_100010080
1192 Ga0070667_100013324
1193 Ga0070667_100138183
1194 Ga0070667_100141164
1195 Ga0070667_101004333
1196 Ga0070667_101385183
1197 Ga0070709_10402570
1198 Ga0070714_100053630
1199 Ga0070714_100137687
1200 Ga0070714_100385700
1201 Ga0070713_100031108
1202 Ga0070705_100476935
1203 Ga0070700_100407338
1204 Ga0070694_100153142
1205 Ga0070663_100003702
1206 Ga0070663_100070247
1207 Ga0070663_100111569
1208 Ga0070663_100129047
1209 Ga0070663_100134741
1210 Ga0070663_100144382
1211 Ga0070663_100190090
1212 Ga0070663_100221153
1213 Ga0070663_100281602
1214 Ga0070663_100365432
1215 Ga0070663_100375254
1216 Ga0070663_100507149
1217 Ga0070678_100001679
1218 Ga0070678_100025005
1219 Ga0070678_100164623
1220 Ga0070678_100200471
1221 Ga0070678_100817268
1222 Ga0070662_100000640
1223 Ga0070662_100002988
1224 Ga0070662_100027606
1225 Ga0070662_100050583
1226 Ga0070662_100147043
1227 Ga0070662_100213464
1228 Ga0070662_100309930
1229 Ga0070662_100312761
1230 Ga0070662_100343981
1231 Ga0070662_100457209
1232 Ga0070662_100490653
1233 Ga0070662_100503834
1234 Ga0070662_100523706
1235 Ga0070662_100962581
1236 Ga0070662_101195414
1237 Ga0070681_10039052
1238 Ga0070681_10108749
1239 Ga0070681_10230687
1240 Ga0070681_10273972
1241 Ga0070681_10443281
1242 Ga0068867_100019803
1243 Ga0068867_100073595
1244 Ga0068867_100141267
1245 Ga0070685_10249892
1246 Ga0070679_100001108
1247 Ga0070679_100072392
1248 Ga0070679_100119758
1249 Ga0070679_100295687
1250 Ga0070679_100341970
1251 Ga0070679_100537396
1252 Ga0070679_100567836
1253 Ga0070679_100742222
1254 Ga0070679_100848865
1255 Ga0070679_100888096
1256 Ga0070679_101106807
1257 Ga0070684_100133349
1258 Ga0070684_100165532
1259 Ga0070684_100454032
1260 Ga0068853_100002366
1261 Ga0068853_100013793
1262 Ga0068853_100023829
1263 Ga0068853_100027460
1264 Ga0068853_100062753
1265 Ga0068853_100085670
1266 Ga0068853_100104953
1267 Ga0068853_100109053
1268 Ga0068853_100216282
1269 Ga0068853_100711259
1270 Ga0068853_100936150
1271 Ga0068853_101427338
1272 Ga0070672_100031129
1273 Ga0070672_100294023
1274 Ga0070695_100221357
1275 Ga0070696_100027074
1276 Ga0070696_100171766
1277 Ga0070696_100382018
1278 Ga0070693_100010206
1279 Ga0070693_100121610
1280 Ga0070693_100147716
1281 Ga0070665_100005304
1282 Ga0070665_100123352
1283 Ga0070665_100418212
1284 Ga0068855_100016873
1285 Ga0068855_100044812
1286 Ga0068855_100094637
1287 Ga0068855_100120169
1288 Ga0068855_100159330
1289 Ga0068855_100219726
1290 Ga0068855_100333332
1291 Ga0068855_100452491
1292 Ga0068855_100563252
1293 Ga0068855_100612587
1294 Ga0070664_100000888
1295 Ga0070664_100001052
1296 Ga0070664_100003552
1297 Ga0070664_100030341
1298 Ga0070664_100039412
1299 Ga0070664_100041914
1300 Ga0070664_100201429
1301 Ga0070664_100231216
1302 Ga0070664_100234325
1303 Ga0070664_100292201
1304 Ga0070664_100332625
1305 Ga0070664_100394026
1306 Ga0068857_100002979
1307 Ga0068857_100003804
1308 Ga0068857_100211740
1309 Ga0068857_100230730
1310 Ga0068857_100235161
1311 Ga0068857_100430022
1312 Ga0068854_100025954
1313 Ga0068854_100052325
1314 Ga0068854_100098044
1315 Ga0068854_100107209
1316 Ga0068854_100194317
1317 Ga0068854_100338180
1318 Ga0068854_101212348
1319 Ga0068856_100000159
1320 Ga0068856_100012605
1321 Ga0068856_100029630
1322 Ga0068856_100149713
1323 Ga0068856_100343262
1324 Ga0068856_100452724
1325 Ga0068856_100750965
1326 Ga0068856_100925015
1327 Ga0068852_100005858
1328 Ga0068852_100041440
1329 Ga0068852_100051761
1330 Ga0068852_100058173
1331 Ga0068852_100089764
1332 Ga0068852_100114750
1333 Ga0068852_100238561
1334 Ga0068852_100284013
1335 Ga0068852_100531882
1336 Ga0068852_100542278
1337 Ga0068852_100653770
1338 Ga0068859_100007208
1339 Ga0068859_100153229
1340 Ga0068859_100384557
1341 Ga0068859_100472331
1342 Ga0068859_101737929
1343 Ga0068864_100004743
1344 Ga0068864_100008356
1345 Ga0068864_100015128
1346 Ga0068864_100021622
1347 Ga0068864_100068473
1348 Ga0068864_100146385
1349 Ga0068864_100375652
1350 Ga0068866_10052363
1351 Ga0068866_10117908
1352 Ga0068866_10374975
1353 Ga0068861_100301657
1354 Ga0068861_100403924
1355 Ga0068851_10027391
1356 Ga0068851_10032547
1357 Ga0068851_10039610
1358 Ga0068851_10102103
1359 Ga0068851_10509292
1360 Ga0068870_10069453
1361 Ga0068863_100005224
1362 Ga0068863_100006283
1363 Ga0068863_100017839
1364 Ga0068863_100018865
1365 Ga0068863_100053846
1366 Ga0068863_100428988
1367 Ga0068863_101567897
1368 Ga0068863_101705986
1369 Ga0068858_100002211
1370 Ga0068858_100005525
1371 Ga0068858_100076344
1372 Ga0068858_100082262
1373 Ga0068858_100317199
1374 Ga0068858_100873371
1375 Ga0068860_100014529
1376 Ga0068860_100015613
1377 Ga0068860_100030740
1378 Ga0068860_100152237
1379 Ga0068860_100338497
1380 Ga0068862_100089982
1381 Ga0068862_100172814
1382 Ga0068862_100249953
1383 Ga0068862_100347971
1384 Ga0068862_100587656
1385 Ga0068862_101049502
1386 Ga0081539_10039652
1387 Ga0081539_10043839
1388 Ga0070717_10003438
1389 Ga0070717_10107974
1390 Ga0070716_100073346
1391 Ga0070716_100151178
1392 Ga0070712_100028294
1393 Ga0097621_100091147
1394 Ga0097621_100178140
1395 Ga0097621_100281676
1396 Ga0068871_100070467
1397 Ga0068871_100078267
1398 Ga0068871_100237056
1399 Ga0068871_100418589
1400 Ga0068871_100428958
1401 Ga0068871_100950207
1402 Ga0075428_100475792
1403 Ga0075431_100422751
1404 Ga0075433_10004614
1405 Ga0075434_100551459
1406 Ga0068865_100110057
1407 Ga0068865_100344979
1408 Ga0068865_100481851
1409 Ga0097620_100007209
1410 Ga0097620_100153230
1411 Ga0097620_100384596
1412 Ga0097620_100472340
1413 Ga0097620_101738277
1414 Ga0075435_100129329
1415 Ga0105250_10105385
1416 Ga0105240_10075971
1417 Ga0105240_10161501
1418 Ga0111539_10028755
1419 Ga0105245_10382525
1420 Ga0105245_11067980
1421 Ga0105247_10999547
1422 Ga0114129_10468355
1423 Ga0105243_10291101
1424 Ga0105243_10419225
1425 Ga0105243_10715820
1426 Ga0105243_10864860
1427 Ga0105241_10317696
1428 Ga0105242_10231744
1429 Ga0105248_10000070
1430 Ga0105248_10000213
1431 Ga0105248_10003106
1432 Ga0105248_10040205
1433 Ga0105248_10052681
1434 Ga0105248_10054682
1435 Ga0105248_10132296
1436 Ga0105248_10205713
1437 Ga0105237_10032085
1438 Ga0105237_10038803
1439 Ga0105237_10617937
1440 Ga0105238_10003788
1441 Ga0105238_10277723
1442 Ga0105238_10360427
1443 Ga0105238_10603861
1444 Ga0105238_10653984
1445 Ga0105249_10045013
1446 Ga0105249_10247416
1447 Ga0105246_10170191
1448 Ga0105246_10221289
1449 Ga0105246_10778188
1450 Ga0157373_10020686
1451 Ga0157373_10026494
1452 Ga0157373_10072746
1453 Ga0157373_10135344
1454 Ga0157373_10151051
1455 Ga0157373_10151736
1456 Ga0157373_10195242
1457 Ga0157373_10253340
1458 Ga0157373_10625602
1459 Ga0157373_10666974
1460 Ga0157371_10105225
1461 Ga0157371_10114832
1462 Ga0157371_10119697
1463 Ga0157371_10124629
1464 Ga0157371_10235996
1465 Ga0157371_10279082
1466 Ga0157371_10283687
1467 Ga0157371_10462937
1468 Ga0157371_10485612
1469 Ga0157371_10586216
1470 Ga0157370_10070076
1471 Ga0157370_10079991
1472 Ga0157370_10089063
1473 Ga0157370_10130545
1474 Ga0157370_10148833
1475 Ga0157370_10500743
1476 Ga0157370_11317992
1477 Ga0157369_10093289
1478 Ga0157369_10114824
1479 Ga0157369_10641449
1480 Ga0157369_10703270
1481 Ga0157369_10732251
1482 Ga0157374_10002929
1483 Ga0157374_10117066
1484 Ga0157374_10311639
1485 Ga0157374_10658966
1486 Ga0157374_11019911
1487 Ga0157378_10447142
1488 Ga0163162_10035426
1489 Ga0163162_10041643
1490 Ga0163162_10263687
1491 Ga0163162_10427793
1492 Ga0163162_10500439
1493 Ga0163162_10731537
1494 Ga0163162_11338111
1495 Ga0157372_10015547
1496 Ga0157372_10164851
1497 Ga0157372_10290936
1498 Ga0157372_10488007
1499 Ga0157372_11126729
1500 Ga0157372_11144656
1501 Ga0157372_11285584
1502 Ga0157375_10001389
1503 Ga0157375_10385298
1504 Ga0163163_10001578
1505 Ga0163163_10004075
1506 Ga0163163_10010868
1507 Ga0163163_10038751
1508 Ga0157380_10112766
1509 Ga0157380_10725832
1510 Ga0157380_11417869
1511 Ga0182008_10095320
1512 Ga0182008_10333591
1513 Ga0157377_10079836
1514 Ga0157377_10788005
1515 Ga0157379_10046364
1516 Ga0157379_10052386
1517 Ga0157379_10762859
1518 Ga0163161_10138010
1519 Ga0206353_10295639
1520 Ga0206353_11387242
1521 Ga0213876_10018941
1522 Ga0207673_1007829
1523 Ga0207697_10070679
1524 Ga0207697_10105857
1525 Ga0207656_10008167
1526 Ga0207656_10021208
1527 Ga0207656_10047133
1528 Ga0207656_10320812
1529 Ga0207696_1053173
1530 Ga0207682_10016516
1531 Ga0207682_10138060
1532 Ga0207642_10036385
1533 Ga0207642_10113172
1534 Ga0207688_10012160
1535 Ga0207680_10023515
1536 Ga0207680_10133507
1537 Ga0207680_10168045
1538 Ga0207680_10186583
1539 Ga0207647_10004086
1540 Ga0207647_10015527
1541 Ga0207647_10030619
1542 Ga0207647_10031069
1543 Ga0207647_10037150
1544 Ga0207647_10057939
1545 Ga0207647_10070509
1546 Ga0207647_10110982
1547 Ga0207647_10617287
1548 Ga0207645_10084914
1549 Ga0207645_10091707
1550 Ga0207645_10105312
1551 Ga0207645_10312168
1552 Ga0207643_10033522
1553 Ga0207705_10000333
1554 Ga0207705_10001746
1555 Ga0207705_10007216
1556 Ga0207705_10010541
1557 Ga0207705_10013483
1558 Ga0207705_10026570
1559 Ga0207705_10053506
1560 Ga0207705_10077726
1561 Ga0207705_10098137
1562 Ga0207705_10110993
1563 Ga0207705_10116010
1564 Ga0207705_10143191
1565 Ga0207705_10147448
1566 Ga0207705_10300160
1567 Ga0207705_10420572
1568 Ga0207705_10457613
1569 Ga0207705_10499563
1570 Ga0207705_10772540
1571 Ga0207654_10034019
1572 Ga0207707_10019711
1573 Ga0207707_10034113
1574 Ga0207707_10132268
1575 Ga0207707_10145804
1576 Ga0207707_10213201
1577 Ga0207707_10221892
1578 Ga0207695_10019242
1579 Ga0207695_10050405
1580 Ga0207671_10030326
1581 Ga0207660_10001841
1582 Ga0207660_10004654
1583 Ga0207660_10076392
1584 Ga0207660_10200045
1585 Ga0207660_10205242
1586 Ga0207662_10739929
1587 Ga0207657_10001002
1588 Ga0207657_10006606
1589 Ga0207657_10014934
1590 Ga0207657_10023739
1591 Ga0207657_10033424
1592 Ga0207657_10042240
1593 Ga0207657_10054288
1594 Ga0207657_10074924
1595 Ga0207657_10079393
1596 Ga0207657_10081780
1597 Ga0207657_10088202
1598 Ga0207657_10093942
1599 Ga0207657_10147084
1600 Ga0207657_10226846
1601 Ga0207657_10924997
1602 Ga0207649_10001645
1603 Ga0207649_10037381
1604 Ga0207649_10037833
1605 Ga0207649_10059702
1606 Ga0207649_10066218
1607 Ga0207649_10102241
1608 Ga0207649_10115893
1609 Ga0207649_10128169
1610 Ga0207649_10134511
1611 Ga0207649_10250208
1612 Ga0207649_10308230
1613 Ga0207649_10415107
1614 Ga0207652_10000597
1615 Ga0207652_10077412
1616 Ga0207652_10091046
1617 Ga0207652_10196018
1618 Ga0207652_10204875
1619 Ga0207652_10332173
1620 Ga0207652_10384503
1621 Ga0207652_10408131
1622 Ga0207652_10640862
1623 Ga0207681_10016517
1624 Ga0207681_10699713
1625 Ga0207681_10729555
1626 Ga0207681_10871869
1627 Ga0207694_10000966
1628 Ga0207694_10120456
1629 Ga0207694_10563865
1630 Ga0207650_10019449
1631 Ga0207650_10024899
1632 Ga0207650_10026361
1633 Ga0207650_10030566
1634 Ga0207650_10038719
1635 Ga0207650_10122875
1636 Ga0207650_10205246
1637 Ga0207659_10080500
1638 Ga0207659_10093990
1639 Ga0207659_10131148
1640 Ga0207659_10263499
1641 Ga0207659_10916997
1642 Ga0207687_10058982
1643 Ga0207687_10183270
1644 Ga0207700_10066722
1645 Ga0207700_10067393
1646 Ga0207664_10031060
1647 Ga0207664_10226352
1648 Ga0207644_10000227
1649 Ga0207644_10000461
1650 Ga0207644_10002289
1651 Ga0207644_10037092
1652 Ga0207644_10253743
1653 Ga0207644_10379296
1654 Ga0207644_10384423
1655 Ga0207690_10000100
1656 Ga0207690_10011329
1657 Ga0207690_10023845
1658 Ga0207690_10030755
1659 Ga0207690_10046462
1660 Ga0207690_10064278
1661 Ga0207690_10064694
1662 Ga0207690_10066423
1663 Ga0207690_10088790
1664 Ga0207690_10179437
1665 Ga0207690_10228145
1666 Ga0207690_10397830
1667 Ga0207690_10686902
1668 Ga0207690_11505147
1669 Ga0207706_10000822
1670 Ga0207706_10002713
1671 Ga0207706_10012022
1672 Ga0207706_10084580
1673 Ga0207706_10098483
1674 Ga0207706_10115350
1675 Ga0207706_10220968
1676 Ga0207706_10293735
1677 Ga0207706_10312984
1678 Ga0207706_10472645
1679 Ga0207706_10522987
1680 Ga0207706_10544063
1681 Ga0207706_10567584
1682 Ga0207669_10122525
1683 Ga0207669_10527462
1684 Ga0207704_10053581
1685 Ga0207704_10142348
1686 Ga0207704_10272037
1687 Ga0207704_10358048
1688 Ga0207704_10517797
1689 Ga0207665_10060834
1690 Ga0207665_10188348
1691 Ga0207691_10001576
1692 Ga0207691_10015793
1693 Ga0207691_10064440
1694 Ga0207691_10151943
1695 Ga0207691_10268612
1696 Ga0207711_10001361
1697 Ga0207711_10001921
1698 Ga0207711_10001950
1699 Ga0207711_10014976
1700 Ga0207711_10035904
1701 Ga0207711_10123818
1702 Ga0207711_10166469
1703 Ga0207711_10414397
1704 Ga0207689_10042278
1705 Ga0207689_10123691
1706 Ga0207689_10152262
1707 Ga0207689_10595797
1708 Ga0207661_10001153
1709 Ga0207661_10002619
1710 Ga0207661_10065832
1711 Ga0207661_10260356
1712 Ga0207679_10000287
1713 Ga0207679_10000689
1714 Ga0207679_10013542
1715 Ga0207679_10020813
1716 Ga0207679_10021623
1717 Ga0207679_10026472
1718 Ga0207679_10068896
1719 Ga0207679_10135378
1720 Ga0207679_10198554
1721 Ga0207679_10407316
1722 Ga0207667_10018275
1723 Ga0207667_10021727
1724 Ga0207667_10048178
1725 Ga0207667_10049168
1726 Ga0207667_10051486
1727 Ga0207667_10177450
1728 Ga0207667_10190887
1729 Ga0207667_10368922
1730 Ga0207667_10956511
1731 Ga0207667_11778503
1732 Ga0207651_10039665
1733 Ga0207651_10041848
1734 Ga0207651_10107068
1735 Ga0207651_10189397
1736 Ga0207651_10307121
1737 Ga0207712_10002434
1738 Ga0207712_10081628
1739 Ga0207668_10058358
1740 Ga0207668_10274608
1741 Ga0207668_10397306
1742 Ga0207640_10013979
1743 Ga0207640_10023568
1744 Ga0207640_10034721
1745 Ga0207640_10099878
1746 Ga0207640_10199962
1747 Ga0207640_10214083
1748 Ga0207640_10284670
1749 Ga0207640_10333815
1750 Ga0207640_10485578
1751 Ga0207658_10005148
1752 Ga0207658_10009206
1753 Ga0207658_10012034
1754 Ga0207658_10023721
1755 Ga0207658_10025198
1756 Ga0207658_10038914
1757 Ga0207658_10090430
1758 Ga0207658_10264711
1759 Ga0207658_10312687
1760 Ga0207658_10322093
1761 Ga0207658_10502229
1762 Ga0207658_10783209
1763 Ga0207677_10129550
1764 Ga0207677_10655332
1765 Ga0207677_10772585
1766 Ga0207703_10000872
1767 Ga0207703_10003758
1768 Ga0207703_10044307
1769 Ga0207703_10111195
1770 Ga0207703_10130682
1771 Ga0207639_10000769
1772 Ga0207639_10017503
1773 Ga0207639_10021112
1774 Ga0207639_10110803
1775 Ga0207639_10111555
1776 Ga0207639_10230184
1777 Ga0207639_10893803
1778 Ga0207678_10001504
1779 Ga0207678_10008151
1780 Ga0207678_10010248
1781 Ga0207678_10027050
1782 Ga0207678_10031304
1783 Ga0207678_10042037
1784 Ga0207678_10163189
1785 Ga0207678_10168822
1786 Ga0207678_10187909
1787 Ga0207678_10429170
1788 Ga0207678_10507620
1789 Ga0207678_10546928
1790 Ga0207678_10678622
1791 Ga0207702_10000208
1792 Ga0207702_10011761
1793 Ga0207702_10014649
1794 Ga0207702_10017061
1795 Ga0207702_10124910
1796 Ga0207702_10162909
1797 Ga0207702_10325533
1798 Ga0207702_10770004
1799 Ga0207641_10002146
1800 Ga0207641_10016742
1801 Ga0207641_10037418
1802 Ga0207641_10099141
1803 Ga0207641_10120288
1804 Ga0207641_10229788
1805 Ga0207641_11438811
1806 Ga0207648_10023329
1807 Ga0207648_10060536
1808 Ga0207676_10000139
1809 Ga0207676_10012422
1810 Ga0207676_10018657
1811 Ga0207676_10046525
1812 Ga0207676_10217465
1813 Ga0207676_10261961
1814 Ga0207676_10533282
1815 Ga0207674_10000065
1816 Ga0207674_10001471
1817 Ga0207674_10002506
1818 Ga0207674_10003445
1819 Ga0207674_10045988
1820 Ga0207674_10064693
1821 Ga0207674_10232704
1822 Ga0207674_10312579
1823 Ga0207675_100360284
1824 Ga0207683_10004578
1825 Ga0207683_10005313
1826 Ga0207683_10020153
1827 Ga0207683_10022398
1828 Ga0207683_10102665
1829 Ga0207683_10252807
1830 Ga0207683_10307686
1831 Ga0207683_10499786
1832 Ga0207698_10001407
1833 Ga0207698_10065971
1834 Ga0207698_10090310
1835 Ga0207698_10099345
1836 Ga0207698_10133024
1837 Ga0207698_10153787
1838 Ga0207698_10260574
1839 Ga0207698_10292540
1840 Ga0207698_10386427
1841 Ga0207698_11323704
1842 Ga0207698_12127590
1843 Ga0207428_10163121
1844 Ga0268266_10001577
1845 Ga0268266_10008685
1846 Ga0268266_10089685
1847 Ga0268266_10275687
1848 Ga0268265_10071310
1849 Ga0268265_10102048
1850 Ga0268265_10142333
1851 Ga0268265_10203708
1852 Ga0268265_10241214
1853 Ga0268265_10256845
1854 Ga0268265_10287557
1855 Ga0268264_10003610
1856 Ga0268264_10006747
1857 Ga0268264_10043042
1858 Ga0268264_10078755
1859 Ga0268264_10135767
1860 Ga0268264_10291634
1861 Ga0316182_1281089
1862 Ga0307513_10379603
1863 Ga0307408_100021340
1864 Ga0307408_100173739
1865 Ga0307408_100338098
1866 Ga0307408_101151931
1867 Ga0307405_10091328
1868 Ga0307405_10106672
1869 Ga0307405_10143290
1870 Ga0307405_10152759
1871 Ga0307413_10002465
1872 Ga0307413_10115940
1873 Ga0307413_10160396
1874 Ga0307413_10372886
1875 Ga0307413_10554875
1876 Ga0307410_10032305
1877 Ga0307410_10033469
1878 Ga0307410_10107232
1879 Ga0307410_10136213
1880 Ga0307410_10139131
1881 Ga0307410_10159778
1882 Ga0307410_11689288
1883 Ga0307406_10060202
1884 Ga0307406_10192163
1885 Ga0307406_10210059
1886 Ga0307406_11041552
1887 Ga0307406_11456777
1888 Ga0307407_10005180
1889 Ga0307407_10053949
1890 Ga0307407_10060365
1891 Ga0307407_10307965
1892 Ga0307407_10323874
1893 Ga0307407_10947282
1894 Ga0307412_10115270
1895 Ga0307412_10185628
1896 Ga0307412_10226229
1897 Ga0307412_10401742
1898 Ga0307412_10692960
1899 Ga0307412_10706333
1900 Ga0307409_100012343
1901 Ga0307409_100079953
1902 Ga0307416_100004927
1903 Ga0307416_100033137
1904 Ga0307416_100038355
1905 Ga0307416_100154703
1906 Ga0307416_100298854
1907 Ga0307416_100509379
1908 Ga0307416_101396413
1909 Ga0307416_102429888
1910 Ga0307414_10029655
1911 Ga0307414_10044406
1912 Ga0307414_10384657
1913 Ga0307414_10573699
1914 Ga0307414_10584229
1915 Ga0307414_11450984
1916 Ga0307411_10019561
1917 Ga0307411_10064651
1918 Ga0307411_10170020
1919 Ga0307411_10225322
1920 Ga0307411_10555084
1921 Ga0307415_100005059
1922 Ga0307415_100014920
1923 Ga0307415_100071547
1924 Ga0307415_100318124
1925 Ga0307415_101070249
1926 Ga0307415_101148844
1927 Ga0373930_0014540
1928 Ga0373960_0115077
1929 Ga0373946_0493545
1930 Ga0373962_0031509
1931 Ga0373931_0081369
1932 Ga0373935_0084121
1933 Ga0373925_1018695
1934 Ga0395899_0002686
1935 Ga0395899_0006989
1936 Ga0395899_0025438
1937 Ga0395899_0033462
1938 Ga0395899_0042956
1939 Ga0395899_0272079
1940 Ga0395899_0474260
1941 Ga0395900_0008529
1942 Ga0395900_0008641
1943 Ga0395900_0039774
1944 Ga0395900_0086602
1945 Ga0395900_0192271
1946 Ga0395900_0223761
1947 Ga0395900_0296145
1948 Ga0395900_0507457
1949 Ga0395898_0003834
1950 Ga0395898_0005157
1951 Ga0395898_0043199
1952 Ga0395898_0090895
1953 Ga0395898_0105799
1954 Ga0395898_0221146
1955 Ga0395898_0326848
1956 Ga0395905_0002386
1957 Ga0395905_0005013
1958 Ga0395905_0010336
1959 Ga0395905_0014375
1960 Ga0395905_0015132
1961 Ga0395905_0020152
1962 Ga0395905_0034106
1963 Ga0395905_0043941
1964 Ga0395905_0044590
1965 Ga0395905_0046288
1966 Ga0395905_0061523
1967 Ga0395905_0062894
1968 Ga0395905_0091116
1969 Ga0395905_0091170
1970 Ga0395905_0136989
1971 Ga0395905_0146932
1972 Ga0395905_0215408
1973 Ga0395905_0288973
1974 Ga0395905_0323316
1975 Ga0395905_0417607
1976 Ga0395905_0496586
1977 Ga0395905_0557997
1978 Ga0395905_0819699
1979 Ga0395905_0850288
1980 Ga0395905_0881214
1981 Ga0395905_1697559
1982 Ga0395901_0005487
1983 Ga0395901_0011994
1984 Ga0395901_0012646
1985 Ga0395901_0054660
1986 Ga0395901_0059663
1987 Ga0395901_0116534
1988 Ga0395901_0237220
1989 Ga0395901_0305579
1990 Ga0395901_0394655
1991 Ga0395901_0698753
1992 Ga0395901_1770480
1993 Ga0237819_01553
1994 Ga0237816_04878
1995 Ga0436365_0482220
1996 Ga0439465_0015015
1997 Ga0439465_0158893
1998 Ga0439448_0002057
1999 Ga0439432_033936
2000 Ga0439449_0023318
2001 Ga0439452_067023
2002 Ga0450905_001683
2003 Ga0450889_000233
2004 Ga0439458_0000439
2005 Ga0450908_029551
2006 Ga0439464_0002400
2007 Ga0466972_0219201
2008 Ga0466963_0007917
2009 Ga0466963_0224878
2010 Ga0466970_0107311
2011 Ga0466957_0059468
2012 Ga0466957_0081261
2013 Ga0466957_0276271
2014 Ga0466957_0685576
2015 Ga0466960_0142389
2016 Ga0466967_0024875
2017 Ga0466967_0051359
2018 Ga0466967_0132110
2019 Ga0466967_0214198
2020 Ga0466967_0244070
2021 Ga0466967_0614516
2022 Ga0495663_0111426
2023 Ga0495621_0143978
2024 Ga0495668_0283090
2025 Ga0495669_0009003
2026 Ga0495669_0035995
2027 Ga0495669_0103078
2028 Ga0495669_0166086
2029 Ga0495669_0247580
2030 Ga0496100_0008859
2031 Ga0496101_0006555
2032 Ga0496101_0044294
2033 Ga0496101_0063710
2034 Ga0496102_0048701
2035 Ga0496102_0205598
2036 Ga0496102_0362690
2037 Ga0496103_0104521
2038 Ga0496103_0105619
2039 Ga0496103_0191468
2040 Ga0496105_0067406
2041 Ga0496106_0087172
2042 Ga0496106_0102141
2043 Ga0496107_0038759
2044 Ga0496107_0041310
2045 Ga0496107_0054501
2046 Ga0496107_0081578
2047 Ga0496107_0112169
2048 Ga0496107_0425528
2049 Ga0496108_0001730
2050 Ga0496108_0014249
2051 Ga0496109_0010337
2052 Ga0496109_0017653
2053 Ga0496109_0143372
2054 Ga0496109_0415996
2055 Ga0496109_0628170
2056 Ga0496110_0001772
2057 Ga0496110_0017149
2058 Ga0496110_0304625
2059 Ga0496111_0003609
2060 Ga0496111_0020942
2061 Ga0496111_0078224
2062 Ga0496111_0263513
2063 Ga0496112_0011496
2064 Ga0496112_0012316
2065 Ga0496112_0021282
2066 Ga0496112_0045983
2067 Ga0496113_0000722
2068 Ga0496113_0033764
2069 Ga0496114_0042645
2070 Ga0496115_0232423
2071 Ga0501047_0407541
2072 Ga0501067_0145691
2073 Ga0501069_0062278
2074 Ga0501070_0082776
2075 Ga0501071_0386726
2076 Ga0501223_016462
2077 Ga0501227_061895
2078 Ga0501236_085945
2079 Ga0501250_084929
2080 Ga0501229_031816
2081 Ga0501080_0430457
2082 Ga0501268_003066
2083 Ga0501035_0654994
2084 nmdc:mga05p37_1002433_c1
2085 nmdc:mga08y16_105068_c1
2086 nmdc:mga0rr50_423127_c1
2087 nmdc:mga0a205_871_c1
2088 Ga0500658_0000107
2089 Ga0466962_0043504
2090 Ga0466962_0100658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

10

148

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.898 7 153
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8811 7 153
6ryo-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 1.9 a resolution 0.8737 7 152
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.8517 4 150
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.8219 7 149
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8798 11 153 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8642 11 153 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8629 11 153 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8469 11 153 3.90.1420.10
af_B6TC68_118_236_1.20.120.900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Pex19, mPTS binding domain 0.8218 67 115 1.20.120.900
ID Description Score Start End GO Terms
AF-A0A537ML41-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9618 2 164 GO:0004190
GO:0005886
GO:0006508
AF-A0A3B0RTI5-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) 0.96 2 153 GO:0004190
GO:0005886
GO:0006508
AF-A0A558R4Y0-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9547 2 159 GO:0004190
GO:0005886
GO:0006508
AF-A0A2U2J0M9-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9531 3 156 GO:0004190
GO:0005886
GO:0006508
AF-A0A257V020-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9489 1 156 GO:0004190
GO:0005886
GO:0006508

Map