F488941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1045 | 772 | 2090 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0081509|Ga0495606_0081509_316_1164 |
| Length | 282 |
| Sequence | MVKTLVPAEMRNFEMFEILEPATQTIPFVYNSPHSGRIYPPDFIAQSRLEGAAIRRSEDHYVDELFKAAADLGAPLLFANFPRAYIDVNREPYELDPRMFDGALPPYANINSIRVAGGLGTIPRIVAENMEIYARRVPVEDALIASTHVQFGFGVLIDCHSMPGNIRVAGSSAHPDIIVGDRYGTSASAELSRAAMCILEDLGFTAVRNKPYAGGFITEHYGRPSRGLHALQIEVNRSLYVDEATLEKRPDFAAVANAITDFMQQMSDYVANFASDRALAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 43 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 44 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 52 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 60 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 63 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 64 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 65 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 66 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 101 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 104 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 107 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 108 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 111 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 112 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 113 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 114 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 115 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 116 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 117 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 118 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 119 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 120 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 121 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 124 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 125 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 126 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 127 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 128 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 174 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 175 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 176 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 177 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 180 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 181 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 182 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 183 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 184 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 195 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 199 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 201 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 202 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 203 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 204 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 205 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 206 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 207 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 209 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 211 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 213 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 214 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 215 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 218 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 219 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 220 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 223 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 224 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 225 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 226 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 227 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 228 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 229 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 230 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 231 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 232 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 233 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 234 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 235 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 236 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 237 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 238 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 239 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 240 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 241 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 242 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 243 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 244 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 245 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 246 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 247 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 248 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 249 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 250 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 251 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 252 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 253 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 254 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 255 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 256 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 257 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 258 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 259 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 260 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 261 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 262 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 263 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 264 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 265 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 266 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 267 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 268 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 269 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 270 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 271 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 272 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 273 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 274 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 275 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 276 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 277 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 278 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 279 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 280 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 281 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 282 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 283 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 284 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 285 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 286 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 287 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 288 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 289 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 290 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 291 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 292 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 293 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 294 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 295 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 296 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 297 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 298 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 299 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 300 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 301 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 302 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 303 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 304 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 305 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 306 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 307 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 308 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 309 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 310 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 311 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 312 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 313 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 314 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 315 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 316 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 317 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 318 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 319 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 320 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 321 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 322 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 323 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 324 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 325 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 326 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 327 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 328 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 329 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 330 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 331 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 332 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 333 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 334 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 335 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 336 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 337 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 338 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 339 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 340 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 341 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 342 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 343 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 344 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 345 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 346 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 347 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 348 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 349 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 350 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 351 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 352 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 353 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 354 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 355 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 356 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 357 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 358 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 359 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 360 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 361 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 362 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 363 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 364 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 365 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 366 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 367 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 368 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 369 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 370 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 371 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 372 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 373 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 374 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 375 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 376 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 377 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 378 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 379 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 380 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 381 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 382 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 383 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 384 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 385 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 386 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 387 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 388 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 389 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 390 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 391 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 392 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 393 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 394 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 395 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 396 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 397 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 398 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 399 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 400 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 401 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 402 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 403 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 404 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 405 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 406 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 407 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 408 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 409 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 410 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 411 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 412 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 413 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 414 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 415 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 416 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 417 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 418 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 419 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 420 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 421 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 422 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 423 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 424 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 425 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 426 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 427 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 428 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 429 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 430 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 431 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 432 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 433 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 434 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 435 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 436 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 437 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 438 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 439 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 440 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 441 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 442 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 443 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 444 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 445 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 446 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 447 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 448 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 449 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 450 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 451 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 452 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 453 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 454 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 455 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 456 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 457 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 458 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 459 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 460 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 461 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 462 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 463 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 464 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 465 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 466 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 467 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 468 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 469 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 470 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 471 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 472 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 473 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 474 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 475 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 476 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 477 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 478 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 479 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 480 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 481 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 482 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 483 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 484 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 485 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 486 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 487 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 488 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 489 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 490 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 491 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 492 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 493 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 494 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 495 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 496 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 497 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 498 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 499 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 500 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 501 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 502 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 503 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 504 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 505 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 506 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 507 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 508 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 509 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 510 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 511 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 512 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 513 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 514 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 515 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 516 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 517 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 518 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 519 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 520 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 521 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 522 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 523 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 524 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 525 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 526 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 527 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 528 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 529 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 530 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 531 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 532 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 533 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 534 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 535 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 536 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 537 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 538 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 539 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 540 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 541 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 542 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 543 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 544 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 545 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 546 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 547 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 548 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 549 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 550 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 551 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 552 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 553 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 554 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 555 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 556 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 557 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 558 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 559 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 560 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 561 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 562 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 563 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 564 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 565 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 566 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 567 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 568 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 569 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 570 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 571 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 572 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 573 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 574 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 575 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 576 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 577 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 578 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 579 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 580 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 581 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 582 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 583 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 584 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 585 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 586 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 587 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 588 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 589 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 590 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 591 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 592 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 593 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 594 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 595 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 596 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 597 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 598 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 599 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 600 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 601 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 602 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 603 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 604 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 605 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 606 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 607 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 608 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 609 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 610 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 611 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 612 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 613 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 614 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 615 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 616 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 617 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 618 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 619 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 620 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 621 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 622 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 623 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 624 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 625 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 626 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 627 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 628 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 629 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 630 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 631 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 632 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 633 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 634 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 635 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 636 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 637 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 638 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 639 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 640 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 641 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 642 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 643 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 644 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 645 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 646 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 647 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 648 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 649 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 650 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 651 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 652 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 653 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 654 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 655 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 656 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 657 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 658 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 659 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 660 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 661 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 662 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 663 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 664 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 665 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 666 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 667 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 668 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 669 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 670 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 671 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 672 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 673 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 674 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 675 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 676 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 677 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 678 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 679 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 680 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 681 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 682 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 683 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 684 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 685 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 686 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 687 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 688 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 689 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 690 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 691 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 692 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 693 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 694 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 695 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 696 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 697 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 698 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 699 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 700 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 701 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 702 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 703 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 704 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 705 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 706 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 707 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 708 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 709 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 710 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 711 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 712 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 713 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 714 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 715 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 716 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 717 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 718 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 719 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 720 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 721 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 722 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 723 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 724 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 725 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 726 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 727 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 728 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 729 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 730 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 731 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 732 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 733 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 734 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 735 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 736 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 737 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 738 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 739 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 740 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 741 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 742 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 743 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 744 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 745 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 746 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 747 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 748 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 749 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 750 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 751 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 752 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 753 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 754 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 755 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 756 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 757 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 758 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 759 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 760 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 761 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 762 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 763 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 764 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 765 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 766 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 767 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 768 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 769 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 770 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 771 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 772 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 46.79 |
| Metatranscriptomes | 0.19 |
| Isolates | 53.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.57 |
| Nodule | 40.86 |
| Rhizoplane | 1.44 |
| Rhizosphere | 18.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495606_0081509 | 3300046507 | Bacteria | 2011 |
| 2 | JGI25155J39150_1000007 | 3300002704 | Bacteria | 238857 |
| 3 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 4 | JGI25156J39149_1001609 | 3300002705 | Bacteria | 9231 |
| 5 | JGI25162J39368_1000449 | 3300002737 | Bacteria | 32568 |
| 6 | JGI25162J39368_1000471 | 3300002737 | Bacteria | 31064 |
| 7 | JGI25154J39366_1001077 | 3300002738 | Bacteria | 10749 |
| 8 | JGI25154J39366_1001309 | 3300002738 | Bacteria | 9240 |
| 9 | JGI25158J39367_1000349 | 3300002739 | Bacteria | 10100 |
| 10 | JGI25158J39367_1010726 | 3300002739 | Bacteria | 1233 |
| 11 | JGI25157J39369_1000124 | 3300002741 | Bacteria | 65844 |
| 12 | JGI25152J39213_1001533 | 3300002773 | Bacteria | 9815 |
| 13 | JGI25152J39213_1002032 | 3300002773 | Bacteria | 7981 |
| 14 | JGI25152J39213_1003616 | 3300002773 | Bacteria | 5226 |
| 15 | JGI25152J39213_1003776 | 3300002773 | Bacteria | 5037 |
| 16 | JGI25152J39213_1013279 | 3300002773 | Bacteria | 1723 |
| 17 | JGI25152J39213_1014056 | 3300002773 | Bacteria | 1638 |
| 18 | JGI25152J39213_1014066 | 3300002773 | Bacteria | 1638 |
| 19 | JGI25150J39212_1000230 | 3300002774 | Bacteria | 30285 |
| 20 | JGI25150J39212_1002298 | 3300002774 | Bacteria | 4826 |
| 21 | JGI25150J39212_1008858 | 3300002774 | Bacteria | 1946 |
| 22 | JGI25159J45721_1000018 | 3300002987 | Bacteria | 132603 |
| 23 | JGI25159J45721_1000663 | 3300002987 | Bacteria | 15229 |
| 24 | JGI25159J45721_1002318 | 3300002987 | Bacteria | 7308 |
| 25 | JGI25151J46595_10000031 | 3300003187 | Bacteria | 197865 |
| 26 | JGI25151J46595_10001231 | 3300003187 | Bacteria | 18298 |
| 27 | JGI25151J46595_10001414 | 3300003187 | Bacteria | 16416 |
| 28 | JGI25151J46595_10017466 | 3300003187 | Bacteria | 3108 |
| 29 | JGI25151J46595_10034862 | 3300003187 | Bacteria | 1918 |
| 30 | JGI25165J46597_1000443 | 3300003214 | Bacteria | 41663 |
| 31 | JGI25165J46597_1000845 | 3300003214 | Bacteria | 22396 |
| 32 | JGI25153J46596_10000937 | 3300003215 | Bacteria | 17751 |
| 33 | JGI25153J46596_10004558 | 3300003215 | Bacteria | 7439 |
| 34 | JGI25153J46596_10008345 | 3300003215 | Bacteria | 4967 |
| 35 | JGI25153J46596_10013198 | 3300003215 | Bacteria | 3509 |
| 36 | JGI25153J46596_10020921 | 3300003215 | Bacteria | 2455 |
| 37 | JGI25153J46596_10034876 | 3300003215 | Bacteria | 1638 |
| 38 | JGI25153J46596_10034878 | 3300003215 | Bacteria | 1638 |
| 39 | JGI25160J50197_1000009 | 3300003354 | Bacteria | 282862 |
| 40 | JGI25160J50197_1000114 | 3300003354 | Bacteria | 75947 |
| 41 | JGI25160J50197_1001417 | 3300003354 | Bacteria | 12009 |
| 42 | JGI25160J50197_1012549 | 3300003354 | Bacteria | 2934 |
| 43 | JGI25161J50226_1000089 | 3300003374 | Bacteria | 73775 |
| 44 | JGI25161J50226_1000901 | 3300003374 | Bacteria | 10703 |
| 45 | JGI25161J50226_1002710 | 3300003374 | Bacteria | 4386 |
| 46 | JGI25161J50226_1004105 | 3300003374 | Bacteria | 3128 |
| 47 | Ga0055526_1000979 | 3300003771 | Bacteria | 21027 |
| 48 | Ga0055526_1003292 | 3300003771 | Bacteria | 10355 |
| 49 | Ga0055526_1006440 | 3300003771 | Bacteria | 6366 |
| 50 | Ga0055526_1015198 | 3300003771 | Bacteria | 3103 |
| 51 | Ga0055526_1015714 | 3300003771 | Bacteria | 3019 |
| 52 | Ga0055524_1002889 | 3300003775 | Bacteria | 8588 |
| 53 | Ga0055524_1003460 | 3300003775 | Bacteria | 7657 |
| 54 | Ga0055524_1005154 | 3300003775 | Bacteria | 5894 |
| 55 | Ga0055524_1011210 | 3300003775 | Bacteria | 3522 |
| 56 | Ga0055524_1017766 | 3300003775 | Bacteria | 2496 |
| 57 | Ga0055536_1000582 | 3300003781 | Bacteria | 24895 |
| 58 | Ga0055528_1000704 | 3300003790 | Bacteria | 23717 |
| 59 | Ga0055528_1002226 | 3300003790 | Bacteria | 10577 |
| 60 | Ga0055528_1006711 | 3300003790 | Bacteria | 5187 |
| 61 | Ga0055528_1006918 | 3300003790 | Bacteria | 5084 |
| 62 | Ga0055530_10000287 | 3300003791 | Bacteria | 45977 |
| 63 | Ga0055530_10011799 | 3300003791 | Bacteria | 3103 |
| 64 | Ga0055540_1000537 | 3300003792 | Bacteria | 28483 |
| 65 | Ga0055540_1004346 | 3300003792 | Bacteria | 6435 |
| 66 | Ga0055531_10002239 | 3300003794 | Bacteria | 13094 |
| 67 | Ga0055531_10002396 | 3300003794 | Bacteria | 12589 |
| 68 | Ga0058692_1016793 | 3300003856 | Bacteria | 1618 |
| 69 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 70 | Ga0055543_1000055 | 3300004625 | Bacteria | 103837 |
| 71 | Ga0055543_1000077 | 3300004625 | Bacteria | 86457 |
| 72 | Ga0055543_1000724 | 3300004625 | Bacteria | 16747 |
| 73 | Ga0065165_1000020 | 3300005262 | Bacteria | 265570 |
| 74 | Ga0065165_1000537 | 3300005262 | Bacteria | 57544 |
| 75 | Ga0065165_1002901 | 3300005262 | Bacteria | 13155 |
| 76 | Ga0065165_1004459 | 3300005262 | Bacteria | 8658 |
| 77 | Ga0065165_1010015 | 3300005262 | Bacteria | 4166 |
| 78 | Ga0070670_100000577 | 3300005331 | Bacteria | 28993 |
| 79 | Ga0070671_100066028 | 3300005355 | Bacteria | 3015 |
| 80 | Ga0070667_100073952 | 3300005367 | Bacteria | 2906 |
| 81 | Ga0070663_100078389 | 3300005455 | Bacteria | 2421 |
| 82 | Ga0070662_100408109 | 3300005457 | Bacteria | 1122 |
| 83 | Ga0070665_100003560 | 3300005548 | Bacteria | 16520 |
| 84 | Ga0070665_100130182 | 3300005548 | Bacteria | 2518 |
| 85 | Ga0068856_100351846 | 3300005614 | Bacteria | 1492 |
| 86 | Ga0068852_100115404 | 3300005616 | Bacteria | 2448 |
| 87 | Ga0075365_10004800 | 3300006038 | Bacteria | 7210 |
| 88 | Ga0075365_10031222 | 3300006038 | Bacteria | 3417 |
| 89 | Ga0075368_10001630 | 3300006042 | Bacteria | 7207 |
| 90 | Ga0075368_10018029 | 3300006042 | Bacteria | 2648 |
| 91 | Ga0075363_100071258 | 3300006048 | Bacteria | 1889 |
| 92 | Ga0075364_10000009 | 3300006051 | Bacteria | 64760 |
| 93 | Ga0075364_10162552 | 3300006051 | Bacteria | 1507 |
| 94 | Ga0075362_10009877 | 3300006177 | Bacteria | 3706 |
| 95 | Ga0075362_10014139 | 3300006177 | Bacteria | 3215 |
| 96 | Ga0075367_10007124 | 3300006178 | Bacteria | 5703 |
| 97 | Ga0075367_10020813 | 3300006178 | Bacteria | 3659 |
| 98 | Ga0075367_10081074 | 3300006178 | Bacteria | 1963 |
| 99 | Ga0075367_10096813 | 3300006178 | Bacteria | 1800 |
| 100 | Ga0075369_10001520 | 3300006186 | Bacteria | 7936 |
| 101 | Ga0075369_10006231 | 3300006186 | Bacteria | 4505 |
| 102 | Ga0075366_10162942 | 3300006195 | Bacteria | 1351 |
| 103 | Ga0075370_10000872 | 3300006353 | Bacteria | 12280 |
| 104 | Ga0075370_10115253 | 3300006353 | Bacteria | 1562 |
| 105 | Ga0079104_1000042 | 3300006946 | Bacteria | 185991 |
| 106 | Ga0079104_1006567 | 3300006946 | Bacteria | 4370 |
| 107 | Ga0099826_10000270 | 3300006948 | Bacteria | 23085 |
| 108 | Ga0105251_10006217 | 3300009011 | Bacteria | 7659 |
| 109 | Ga0105250_10028882 | 3300009092 | Bacteria | 2232 |
| 110 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 111 | Ga0105243_10247981 | 3300009148 | Bacteria | 1588 |
| 112 | Ga0105237_10001085 | 3300009545 | Bacteria | 36406 |
| 113 | Ga0105238_10256518 | 3300009551 | Bacteria | 1728 |
| 114 | Ga0123341_1000016 | 3300009765 | Bacteria | 85309 |
| 115 | Ga0123342_1011116 | 3300009766 | Bacteria | 10003 |
| 116 | Ga0123342_1044877 | 3300009766 | Bacteria | 1478 |
| 117 | Ga0105239_10030478 | 3300010375 | Bacteria | 5930 |
| 118 | Ga0105246_10035508 | 3300011119 | Bacteria | 3333 |
| 119 | Ga0157322_1002157 | 3300012490 | Bacteria | 1077 |
| 120 | Ga0157373_10006893 | 3300013100 | Bacteria | 8454 |
| 121 | Ga0157373_10108052 | 3300013100 | Bacteria | 1956 |
| 122 | Ga0157371_10000304 | 3300013102 | Bacteria | 64521 |
| 123 | Ga0157370_10000824 | 3300013104 | Bacteria | 39223 |
| 124 | Ga0157370_10010711 | 3300013104 | Bacteria | 9647 |
| 125 | Ga0157370_10029226 | 3300013104 | Bacteria | 5414 |
| 126 | Ga0171463_1006 | 3300013249 | Bacteria | 336402 |
| 127 | Ga0182007_10004588 | 3300015262 | Bacteria | 6239 |
| 128 | Ga0182005_1007509 | 3300015265 | Bacteria | 3267 |
| 129 | Ga0183363_1123 | 3300015690 | Bacteria | 20240 |
| 130 | Ga0214544_1000063 | 3300021320 | Bacteria | 129929 |
| 131 | Ga0214542_1010067 | 3300021321 | Bacteria | 14119 |
| 132 | Ga0214543_1010170 | 3300021327 | Bacteria | 14126 |
| 133 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 134 | Ga0209436_100072 | 3300025208 | Bacteria | 51104 |
| 135 | Ga0209436_100601 | 3300025208 | Bacteria | 15395 |
| 136 | Ga0209436_105953 | 3300025208 | Bacteria | 2731 |
| 137 | Ga0209672_109696 | 3300025228 | Bacteria | 1343 |
| 138 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 139 | Ga0209437_100291 | 3300025233 | Bacteria | 72764 |
| 140 | Ga0207425_1000070 | 3300025245 | Bacteria | 116438 |
| 141 | Ga0207425_1003108 | 3300025245 | Bacteria | 5482 |
| 142 | Ga0207425_1004995 | 3300025245 | Bacteria | 3861 |
| 143 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 144 | Ga0209646_1007664 | 3300025246 | Bacteria | 1752 |
| 145 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 146 | Ga0209677_100640 | 3300025253 | Bacteria | 18579 |
| 147 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 148 | Ga0209129_1000080 | 3300025258 | Bacteria | 186416 |
| 149 | Ga0209129_1000172 | 3300025258 | Bacteria | 95144 |
| 150 | Ga0209129_1000232 | 3300025258 | Bacteria | 61645 |
| 151 | Ga0209129_1000681 | 3300025258 | Bacteria | 22426 |
| 152 | Ga0209129_1000773 | 3300025258 | Bacteria | 20269 |
| 153 | Ga0209129_1001915 | 3300025258 | Bacteria | 10961 |
| 154 | Ga0209129_1002970 | 3300025258 | Bacteria | 7729 |
| 155 | Ga0209129_1007179 | 3300025258 | Bacteria | 3386 |
| 156 | Ga0209233_1000157 | 3300025261 | Bacteria | 164269 |
| 157 | Ga0209233_1000192 | 3300025261 | Bacteria | 127171 |
| 158 | Ga0209233_1000194 | 3300025261 | Bacteria | 126185 |
| 159 | Ga0209455_1015810 | 3300025272 | Bacteria | 1642 |
| 160 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 161 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 162 | Ga0209673_1000312 | 3300025273 | Bacteria | 89594 |
| 163 | Ga0209673_1000439 | 3300025273 | Bacteria | 71645 |
| 164 | Ga0209673_1000649 | 3300025273 | Bacteria | 51399 |
| 165 | Ga0209673_1001880 | 3300025273 | Bacteria | 16931 |
| 166 | Ga0209673_1004749 | 3300025273 | Bacteria | 7146 |
| 167 | Ga0209673_1006702 | 3300025273 | Bacteria | 5495 |
| 168 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 169 | Ga0209130_1000037 | 3300025284 | Bacteria | 284019 |
| 170 | Ga0209130_1000083 | 3300025284 | Bacteria | 162582 |
| 171 | Ga0209130_1029986 | 3300025284 | Bacteria | 1128 |
| 172 | Ga0209676_1001698 | 3300025292 | Bacteria | 19051 |
| 173 | Ga0209676_1009885 | 3300025292 | Bacteria | 4050 |
| 174 | Ga0209676_1036147 | 3300025292 | Bacteria | 1441 |
| 175 | Ga0209025_1000052 | 3300025294 | Bacteria | 324648 |
| 176 | Ga0209025_1000083 | 3300025294 | Bacteria | 265556 |
| 177 | Ga0209025_1000196 | 3300025294 | Bacteria | 147356 |
| 178 | Ga0209025_1000389 | 3300025294 | Bacteria | 90997 |
| 179 | Ga0209025_1000607 | 3300025294 | Bacteria | 64560 |
| 180 | Ga0209025_1004571 | 3300025294 | Bacteria | 11892 |
| 181 | Ga0209025_1011198 | 3300025294 | Bacteria | 5953 |
| 182 | Ga0209025_1015269 | 3300025294 | Bacteria | 4645 |
| 183 | Ga0209564_1000086 | 3300025295 | Bacteria | 251385 |
| 184 | Ga0209564_1000116 | 3300025295 | Bacteria | 207889 |
| 185 | Ga0209564_1000125 | 3300025295 | Bacteria | 201709 |
| 186 | Ga0209564_1000281 | 3300025295 | Bacteria | 104019 |
| 187 | Ga0209564_1003058 | 3300025295 | Bacteria | 11889 |
| 188 | Ga0209564_1014851 | 3300025295 | Bacteria | 3208 |
| 189 | Ga0209564_1019396 | 3300025295 | Bacteria | 2543 |
| 190 | Ga0209758_1000090 | 3300025297 | Bacteria | 246564 |
| 191 | Ga0209758_1000357 | 3300025297 | Bacteria | 82792 |
| 192 | Ga0209758_1000657 | 3300025297 | Bacteria | 51923 |
| 193 | Ga0209758_1000892 | 3300025297 | Bacteria | 40679 |
| 194 | Ga0209758_1001670 | 3300025297 | Bacteria | 25082 |
| 195 | Ga0209758_1002964 | 3300025297 | Bacteria | 16280 |
| 196 | Ga0209758_1004285 | 3300025297 | Bacteria | 12034 |
| 197 | Ga0209758_1013680 | 3300025297 | Bacteria | 4398 |
| 198 | Ga0209758_1015070 | 3300025297 | Bacteria | 4039 |
| 199 | Ga0209758_1055329 | 3300025297 | Bacteria | 1348 |
| 200 | Ga0209050_1001713 | 3300025298 | Bacteria | 21893 |
| 201 | Ga0209050_1014318 | 3300025298 | Bacteria | 3428 |
| 202 | Ga0209050_1048529 | 3300025298 | Bacteria | 1096 |
| 203 | Ga0209256_1000321 | 3300025299 | Bacteria | 82735 |
| 204 | Ga0209256_1000854 | 3300025299 | Bacteria | 37992 |
| 205 | Ga0209256_1001561 | 3300025299 | Bacteria | 22609 |
| 206 | Ga0209256_1001567 | 3300025299 | Bacteria | 22489 |
| 207 | Ga0209256_1001901 | 3300025299 | Bacteria | 19097 |
| 208 | Ga0209256_1004259 | 3300025299 | Bacteria | 9147 |
| 209 | Ga0209256_1023559 | 3300025299 | Bacteria | 1833 |
| 210 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 211 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 212 | Ga0207426_1000173 | 3300025302 | Bacteria | 162697 |
| 213 | Ga0207426_1000268 | 3300025302 | Bacteria | 109321 |
| 214 | Ga0207426_1001666 | 3300025302 | Bacteria | 17230 |
| 215 | Ga0209051_1000371 | 3300025303 | Bacteria | 64402 |
| 216 | Ga0209051_1002253 | 3300025303 | Bacteria | 14170 |
| 217 | Ga0209051_1004310 | 3300025303 | Bacteria | 8833 |
| 218 | Ga0209051_1008182 | 3300025303 | Bacteria | 5577 |
| 219 | Ga0209051_1021849 | 3300025303 | Bacteria | 2709 |
| 220 | Ga0209257_1002934 | 3300025304 | Bacteria | 15715 |
| 221 | Ga0209257_1005862 | 3300025304 | Bacteria | 8308 |
| 222 | Ga0209257_1005871 | 3300025304 | Bacteria | 8295 |
| 223 | Ga0209257_1040705 | 3300025304 | Bacteria | 1384 |
| 224 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 225 | Ga0207671_10001282 | 3300025914 | Bacteria | 29524 |
| 226 | Ga0207650_10004194 | 3300025925 | Bacteria | 9847 |
| 227 | Ga0207644_10019252 | 3300025931 | Bacteria | 4628 |
| 228 | Ga0207709_10087673 | 3300025935 | Bacteria | 2024 |
| 229 | Ga0207702_10387045 | 3300026078 | Bacteria | 1346 |
| 230 | Ga0209281_1000068 | 3300027111 | Bacteria | 280238 |
| 231 | Ga0209281_1000141 | 3300027111 | Bacteria | 175634 |
| 232 | Ga0209371_1002415 | 3300027312 | Bacteria | 10488 |
| 233 | Ga0268266_10003136 | 3300028379 | Bacteria | 16800 |
| 234 | Ga0268266_10101428 | 3300028379 | Bacteria | 2537 |
| 235 | Ga0268266_10145867 | 3300028379 | Bacteria | 2128 |
| 236 | Ga0307515_10000263 | 3300028794 | Bacteria | 130303 |
| 237 | Ga0307515_10004358 | 3300028794 | Bacteria | 29343 |
| 238 | Ga0307515_10011563 | 3300028794 | Bacteria | 16739 |
| 239 | Ga0307515_10040917 | 3300028794 | Bacteria | 7311 |
| 240 | Ga0307515_10295593 | 3300028794 | Bacteria | 1310 |
| 241 | Ga0268256_1002345 | 3300030500 | Bacteria | 9760 |
| 242 | Ga0268256_1005024 | 3300030500 | Bacteria | 5307 |
| 243 | Ga0316181_1213661 | 3300030744 | Bacteria | 6969 |
| 244 | Ga0307513_10002589 | 3300031456 | Bacteria | 24996 |
| 245 | Ga0307513_10056159 | 3300031456 | Bacteria | 4206 |
| 246 | Ga0307513_10060399 | 3300031456 | Bacteria | 4019 |
| 247 | Ga0307405_10000994 | 3300031731 | Bacteria | 11415 |
| 248 | Ga0307413_10181017 | 3300031824 | Bacteria | 1503 |
| 249 | Ga0307410_10199425 | 3300031852 | Bacteria | 1527 |
| 250 | Ga0307412_10003267 | 3300031911 | Bacteria | 8998 |
| 251 | Ga0307412_10135531 | 3300031911 | Bacteria | 1796 |
| 252 | Ga0307412_10158243 | 3300031911 | Bacteria | 1680 |
| 253 | Ga0307412_10441012 | 3300031911 | Bacteria | 1070 |
| 254 | Ga0307414_10087343 | 3300032004 | Bacteria | 2304 |
| 255 | Ga0373927_0001739 | 3300035695 | Bacteria | 16274 |
| 256 | Ga0373925_0012096 | 3300037068 | Bacteria | 6247 |
| 257 | Ga0395905_0004700 | 3300037471 | Bacteria | 14116 |
| 258 | Ga0395905_0005359 | 3300037471 | Bacteria | 13104 |
| 259 | Ga0439436_0058730 | 3300041404 | Bacteria | 1078 |
| 260 | Ga0439465_0003521 | 3300041413 | Bacteria | 5102 |
| 261 | Ga0439465_0007359 | 3300041413 | Bacteria | 3497 |
| 262 | Ga0439465_0028355 | 3300041413 | Bacteria | 1775 |
| 263 | Ga0439465_0041893 | 3300041413 | Bacteria | 1483 |
| 264 | Ga0451833_0051479 | 3300041491 | Bacteria | 1926 |
| 265 | Ga0451835_0302626 | 3300041492 | Bacteria | 4319 |
| 266 | Ga0451837_0060979 | 3300041494 | Bacteria | 1303 |
| 267 | Ga0451839_0718998 | 3300041496 | Bacteria | 1924 |
| 268 | Ga0451839_0917332 | 3300041496 | Bacteria | 1560 |
| 269 | Ga0451845_0681531 | 3300041501 | Bacteria | 2580 |
| 270 | Ga0451847_0508924 | 3300041503 | Bacteria | 1035 |
| 271 | Ga0451850_50252 | 3300041506 | Bacteria | 1045 |
| 272 | Ga0451851_1216410 | 3300041507 | Bacteria | 4077 |
| 273 | Ga0451843_0986684 | 3300041509 | Bacteria | 1196 |
| 274 | Ga0451855_1356713 | 3300041511 | Bacteria | 1376 |
| 275 | Ga0451853_0980795 | 3300041512 | Bacteria | 2071 |
| 276 | Ga0439449_0016157 | 3300042007 | Bacteria | 2806 |
| 277 | Ga0439462_0030023 | 3300042015 | Bacteria | 1438 |
| 278 | Ga0450907_007846 | 3300042146 | Bacteria | 1777 |
| 279 | Ga0450909_016653 | 3300042185 | Bacteria | 1086 |
| 280 | Ga0439434_0009734 | 3300042435 | Bacteria | 2827 |
| 281 | Ga0450918_012085 | 3300042531 | Bacteria | 1504 |
| 282 | Ga0466970_0005750 | 3300044765 | Bacteria | 6161 |
| 283 | Ga0495629_0039434 | 3300046459 | Bacteria | 3324 |
| 284 | Ga0495638_0002245 | 3300046460 | Bacteria | 16025 |
| 285 | Ga0495638_0032082 | 3300046460 | Bacteria | 3370 |
| 286 | Ga0495638_0081074 | 3300046460 | Bacteria | 1970 |
| 287 | Ga0495651_0056767 | 3300046462 | Bacteria | 3007 |
| 288 | Ga0495650_0098029 | 3300046471 | Bacteria | 1104 |
| 289 | Ga0495662_0008770 | 3300046476 | Bacteria | 4974 |
| 290 | Ga0495585_0062116 | 3300046492 | Bacteria | 2052 |
| 291 | Ga0495585_0089691 | 3300046492 | Bacteria | 1657 |
| 292 | Ga0495607_0051193 | 3300046501 | Bacteria | 2400 |
| 293 | Ga0495607_0079425 | 3300046501 | Bacteria | 1807 |
| 294 | Ga0495607_0097619 | 3300046501 | Bacteria | 1579 |
| 295 | Ga0495583_0006132 | 3300046506 | Bacteria | 7927 |
| 296 | Ga0495606_0005438 | 3300046507 | Bacteria | 12202 |
| 297 | Ga0495606_0027058 | 3300046507 | Bacteria | 4073 |
| 298 | Ga0495610_0003921 | 3300046512 | Bacteria | 11275 |
| 299 | Ga0495610_0124406 | 3300046512 | Bacteria | 1126 |
| 300 | Ga0495610_0174513 | 3300046512 | Bacteria | 899 |
| 301 | Ga0495616_0014904 | 3300046513 | Bacteria | 4338 |
| 302 | Ga0495616_0099911 | 3300046513 | Bacteria | 1362 |
| 303 | Ga0495616_0105253 | 3300046513 | Bacteria | 1317 |
| 304 | Ga0495620_0035007 | 3300046515 | Bacteria | 2263 |
| 305 | Ga0495620_0064260 | 3300046515 | Bacteria | 1518 |
| 306 | Ga0495631_0001536 | 3300046518 | Bacteria | 13881 |
| 307 | Ga0495632_0002903 | 3300046519 | Bacteria | 12596 |
| 308 | Ga0495632_0011408 | 3300046519 | Bacteria | 5186 |
| 309 | Ga0495632_0094918 | 3300046519 | Bacteria | 1410 |
| 310 | Ga0495643_0015771 | 3300046522 | Bacteria | 4457 |
| 311 | Ga0495643_0028426 | 3300046522 | Bacteria | 3135 |
| 312 | Ga0495643_0049203 | 3300046522 | Bacteria | 2274 |
| 313 | Ga0495643_0124401 | 3300046522 | Bacteria | 1300 |
| 314 | Ga0495648_0076026 | 3300046524 | Bacteria | 1929 |
| 315 | Ga0495654_0000401 | 3300046530 | Bacteria | 37059 |
| 316 | Ga0495654_0021069 | 3300046530 | Bacteria | 3394 |
| 317 | Ga0495640_0042763 | 3300046533 | Bacteria | 3159 |
| 318 | Ga0495609_0016177 | 3300046538 | Bacteria | 3478 |
| 319 | Ga0495597_0023913 | 3300046542 | Bacteria | 2824 |
| 320 | Ga0495622_0015658 | 3300046557 | Bacteria | 3525 |
| 321 | Ga0495611_0005032 | 3300046648 | Bacteria | 5664 |
| 322 | Ga0495625_0003752 | 3300046660 | Bacteria | 14760 |
| 323 | Ga0495625_0060586 | 3300046660 | Bacteria | 2681 |
| 324 | Ga0495661_0075275 | 3300046665 | Bacteria | 1962 |
| 325 | Ga0495588_0004270 | 3300046674 | Bacteria | 6302 |
| 326 | Ga0495657_0031373 | 3300046675 | Bacteria | 3715 |
| 327 | Ga0495658_0035776 | 3300046683 | Bacteria | 2735 |
| 328 | Ga0495670_0017514 | 3300046691 | Bacteria | 3526 |
| 329 | Ga0495671_0061466 | 3300046692 | Bacteria | 1853 |
| 330 | Ga0495649_0034661 | 3300046694 | Bacteria | 2777 |
| 331 | Ga0495600_0053585 | 3300046809 | Bacteria | 2634 |
| 332 | Ga0495660_0088553 | 3300046810 | Bacteria | 1612 |
| 333 | Ga0495636_0058652 | 3300047318 | Bacteria | 1623 |
| 334 | Ga0495676_0202724 | 3300047321 | Bacteria | 1378 |
| 335 | Ga0495687_031132 | 3300047443 | Bacteria | 2450 |
| 336 | Ga0495687_034233 | 3300047443 | Bacteria | 2297 |
| 337 | Ga0495673_0125702 | 3300047469 | Bacteria | 1012 |
| 338 | Ga0495681_0011425 | 3300047470 | Bacteria | 5288 |
| 339 | Ga0495681_0054588 | 3300047470 | Bacteria | 1866 |
| 340 | Ga0495686_0006222 | 3300047472 | Bacteria | 9200 |
| 341 | Ga0495686_0019963 | 3300047472 | Bacteria | 4472 |
| 342 | Ga0495686_0025145 | 3300047472 | Bacteria | 3904 |
| 343 | Ga0495686_0259158 | 3300047472 | Bacteria | 974 |
| 344 | Ga0495626_0041805 | 3300048091 | Bacteria | 2156 |
| 345 | Ga0495626_0085445 | 3300048091 | Bacteria | 1395 |
| 346 | Ga0496102_0021717 | 3300048905 | Bacteria | 5679 |
| 347 | Ga0496104_0040272 | 3300048907 | Bacteria | 4379 |
| 348 | Ga0496106_0000326 | 3300048909 | Bacteria | 33680 |
| 349 | Ga0496106_0153230 | 3300048909 | Bacteria | 1819 |
| 350 | Ga0496111_0001131 | 3300048914 | Bacteria | 14787 |
| 351 | Ga0496114_0088108 | 3300048917 | Bacteria | 2633 |
| 352 | Ga0496116_0013575 | 3300048919 | Bacteria | 6553 |
| 353 | Ga0496116_0025407 | 3300048919 | Bacteria | 4354 |
| 354 | Ga0496116_0053121 | 3300048919 | Bacteria | 2678 |
| 355 | Ga0496116_0100069 | 3300048919 | Bacteria | 1735 |
| 356 | Ga0496116_0132087 | 3300048919 | Bacteria | 1421 |
| 357 | Ga0496116_0161513 | 3300048919 | Bacteria | 1228 |
| 358 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 359 | Ga0496117_0000814 | 3300048920 | Bacteria | 48319 |
| 360 | Ga0496117_0005480 | 3300048920 | Bacteria | 13300 |
| 361 | Ga0496117_0017733 | 3300048920 | Bacteria | 5936 |
| 362 | Ga0496117_0139948 | 3300048920 | Bacteria | 1451 |
| 363 | Ga0496117_0174737 | 3300048920 | Bacteria | 1242 |
| 364 | Ga0496117_0208383 | 3300048920 | Bacteria | 1098 |
| 365 | Ga0496118_0001701 | 3300048921 | Bacteria | 32176 |
| 366 | Ga0496118_0002033 | 3300048921 | Bacteria | 28616 |
| 367 | Ga0496118_0044052 | 3300048921 | Bacteria | 3498 |
| 368 | Ga0496119_0007227 | 3300048922 | Bacteria | 10054 |
| 369 | Ga0496119_0008625 | 3300048922 | Bacteria | 8921 |
| 370 | Ga0496119_0026534 | 3300048922 | Bacteria | 4014 |
| 371 | Ga0496119_0074156 | 3300048922 | Bacteria | 1982 |
| 372 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 373 | Ga0496120_0043823 | 3300048923 | Bacteria | 2604 |
| 374 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 375 | Ga0496121_0001407 | 3300048924 | Bacteria | 40738 |
| 376 | Ga0496121_0001871 | 3300048924 | Bacteria | 33787 |
| 377 | Ga0496121_0009541 | 3300048924 | Bacteria | 11117 |
| 378 | Ga0496121_0017896 | 3300048924 | Bacteria | 7191 |
| 379 | Ga0496121_0018198 | 3300048924 | Bacteria | 7101 |
| 380 | Ga0496121_0037911 | 3300048924 | Bacteria | 4276 |
| 381 | Ga0496121_0048898 | 3300048924 | Bacteria | 3593 |
| 382 | Ga0496121_0111031 | 3300048924 | Bacteria | 2091 |
| 383 | Ga0496121_0115924 | 3300048924 | Bacteria | 2033 |
| 384 | Ga0496121_0201253 | 3300048924 | Bacteria | 1419 |
| 385 | Ga0496122_0000024 | 3300048925 | Bacteria | 372400 |
| 386 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 387 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 388 | Ga0496122_0008439 | 3300048925 | Bacteria | 11115 |
| 389 | Ga0496122_0008929 | 3300048925 | Bacteria | 10664 |
| 390 | Ga0496122_0015748 | 3300048925 | Bacteria | 7207 |
| 391 | Ga0496122_0067215 | 3300048925 | Bacteria | 2583 |
| 392 | Ga0496122_0089305 | 3300048925 | Bacteria | 2107 |
| 393 | Ga0496122_0093950 | 3300048925 | Bacteria | 2032 |
| 394 | Ga0496122_0135156 | 3300048925 | Bacteria | 1556 |
| 395 | Ga0496122_0316296 | 3300048925 | Bacteria | 833 |
| 396 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 397 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 398 | Ga0496123_0000086 | 3300048926 | Bacteria | 183266 |
| 399 | Ga0496123_0009011 | 3300048926 | Bacteria | 9052 |
| 400 | Ga0496123_0011406 | 3300048926 | Bacteria | 7705 |
| 401 | Ga0496123_0032582 | 3300048926 | Bacteria | 3769 |
| 402 | Ga0496123_0063904 | 3300048926 | Bacteria | 2348 |
| 403 | Ga0496123_0065804 | 3300048926 | Bacteria | 2300 |
| 404 | Ga0496123_0074475 | 3300048926 | Bacteria | 2101 |
| 405 | Ga0496124_0000413 | 3300048927 | Bacteria | 76781 |
| 406 | Ga0496124_0002161 | 3300048927 | Bacteria | 26367 |
| 407 | Ga0496124_0002342 | 3300048927 | Bacteria | 25007 |
| 408 | Ga0496124_0102667 | 3300048927 | Bacteria | 2313 |
| 409 | Ga0496124_0107757 | 3300048927 | Bacteria | 2247 |
| 410 | Ga0496124_0121992 | 3300048927 | Bacteria | 2081 |
| 411 | Ga0496124_0139774 | 3300048927 | Bacteria | 1912 |
| 412 | Ga0496124_0258564 | 3300048927 | Bacteria | 1283 |
| 413 | Ga0496124_0262981 | 3300048927 | Bacteria | 1268 |
| 414 | Ga0496124_0263578 | 3300048927 | Bacteria | 1266 |
| 415 | Ga0496124_0280210 | 3300048927 | Bacteria | 1216 |
| 416 | Ga0496124_0360467 | 3300048927 | Bacteria | 1025 |
| 417 | Ga0496125_0000345 | 3300048928 | Bacteria | 88357 |
| 418 | Ga0496125_0000651 | 3300048928 | Bacteria | 58001 |
| 419 | Ga0496125_0006752 | 3300048928 | Bacteria | 12327 |
| 420 | Ga0496125_0013018 | 3300048928 | Bacteria | 8211 |
| 421 | Ga0496125_0033327 | 3300048928 | Bacteria | 4559 |
| 422 | Ga0496125_0290283 | 3300048928 | Bacteria | 1008 |
| 423 | Ga0496126_0002468 | 3300048929 | Bacteria | 24901 |
| 424 | Ga0496126_0021729 | 3300048929 | Bacteria | 6260 |
| 425 | Ga0496126_0082360 | 3300048929 | Bacteria | 2843 |
| 426 | Ga0496126_0128089 | 3300048929 | Bacteria | 2195 |
| 427 | Ga0496126_0131579 | 3300048929 | Bacteria | 2161 |
| 428 | Ga0496126_0138432 | 3300048929 | Bacteria | 2097 |
| 429 | Ga0496126_0194513 | 3300048929 | Bacteria | 1716 |
| 430 | Ga0495678_021016 | 3300049459 | Bacteria | 2881 |
| 431 | Ga0495678_041453 | 3300049459 | Bacteria | 1842 |
| 432 | Ga0501031_0019801 | 3300049568 | Bacteria | 4385 |
| 433 | Ga0501032_0126854 | 3300049569 | Bacteria | 1685 |
| 434 | Ga0501033_0004143 | 3300049570 | Bacteria | 11677 |
| 435 | Ga0501034_0052265 | 3300049571 | Bacteria | 4116 |
| 436 | Ga0501034_0224955 | 3300049571 | Bacteria | 1827 |
| 437 | Ga0501034_0242704 | 3300049571 | Bacteria | 1747 |
| 438 | Ga0501037_0076208 | 3300049573 | Bacteria | 2435 |
| 439 | Ga0501038_0025453 | 3300049574 | Bacteria | 5275 |
| 440 | Ga0501038_0170638 | 3300049574 | Bacteria | 1761 |
| 441 | Ga0501039_0059846 | 3300049575 | Bacteria | 2950 |
| 442 | Ga0501039_0115254 | 3300049575 | Bacteria | 2103 |
| 443 | Ga0501080_0513309 | 3300049742 | Bacteria | 1070 |
| 444 | Ga0501083_0190490 | 3300049744 | Bacteria | 1338 |
| 445 | Ga0501280_004492 | 3300049776 | Bacteria | 2049 |
| 446 | Ga0501035_0000707 | 3300049822 | Bacteria | 36103 |
| 447 | Ga0501044_0034844 | 3300049823 | Bacteria | 5276 |
| 448 | nmdc:mga03683_11702_c1 | 3300050489 | Bacteria | 3186 |
| 449 | nmdc:mga03683_54147_c1 | 3300050489 | Bacteria | 1682 |
| 450 | nmdc:mga00v17_11_c1 | 3300050491 | Bacteria | 135478 |
| 451 | nmdc:mga00v17_130168_c1 | 3300050491 | Bacteria | 1608 |
| 452 | nmdc:mga00v17_244730_c1 | 3300050491 | Bacteria | 1163 |
| 453 | nmdc:mga00v17_609_c1 | 3300050491 | Bacteria | 19791 |
| 454 | nmdc:mga0yw44_1642_c1 | 3300050492 | Bacteria | 9004 |
| 455 | nmdc:mga0yw44_41859_c1 | 3300050492 | Bacteria | 2729 |
| 456 | nmdc:mga0yw44_65_c1 | 3300050492 | Bacteria | 38061 |
| 457 | nmdc:mga0k408_126577_c1 | 3300050493 | Bacteria | 1516 |
| 458 | nmdc:mga0k408_7034_c1 | 3300050493 | Bacteria | 5801 |
| 459 | nmdc:mga06z11_17309_c1 | 3300050494 | Bacteria | 3269 |
| 460 | nmdc:mga06z11_7904_c2 | 3300050494 | Bacteria | 2615 |
| 461 | nmdc:mga04h51_1588_c1 | 3300050495 | Bacteria | 5290 |
| 462 | nmdc:mga07m45_14585_c1 | 3300050496 | Bacteria | 4190 |
| 463 | nmdc:mga07m45_80704_c1 | 3300050496 | Bacteria | 1857 |
| 464 | nmdc:mga0sz30_1144_c1 | 3300050516 | Bacteria | 9516 |
| 465 | nmdc:mga0sz30_13690_c1 | 3300050516 | Bacteria | 3181 |
| 466 | nmdc:mga0sz30_6648_c1 | 3300050516 | Bacteria | 4307 |
| 467 | Ga0500644_0003536 | 3300053088 | Bacteria | 3877 |
| 468 | Ga0500560_097676 | 3300053107 | Bacteria | 983 |
| 469 | Ga0500618_000891 | 3300053125 | Bacteria | 15758 |
| 470 | Ga0500618_001118 | 3300053125 | Bacteria | 13110 |
| 471 | Ga0500655_002005 | 3300053133 | Bacteria | 3785 |
| 472 | Ga0500658_0000868 | 3300053134 | Bacteria | 12408 |
| 473 | Ga0500559_0015626 | 3300053136 | Bacteria | 3205 |
| 474 | Ga0500561_0000931 | 3300053137 | Bacteria | 4678 |
| 475 | Ga0500568_0003075 | 3300053139 | Bacteria | 9524 |
| 476 | Ga0500568_0079018 | 3300053139 | Bacteria | 1251 |
| 477 | Ga0500573_0002542 | 3300053140 | Bacteria | 9159 |
| 478 | Ga0500573_0072051 | 3300053140 | Bacteria | 1970 |
| 479 | Ga0500590_000352 | 3300053148 | Bacteria | 15073 |
| 480 | Ga0500604_0051822 | 3300053151 | Bacteria | 1268 |
| 481 | Ga0500616_0002052 | 3300053153 | Bacteria | 17695 |
| 482 | Ga0500616_0006118 | 3300053153 | Bacteria | 7963 |
| 483 | Ga0500616_0039225 | 3300053153 | Bacteria | 2554 |
| 484 | Ga0500622_0000918 | 3300053156 | Bacteria | 25056 |
| 485 | Ga0500622_0001540 | 3300053156 | Bacteria | 18261 |
| 486 | Ga0500622_0152819 | 3300053156 | Bacteria | 1089 |
| 487 | Ga0500624_000692 | 3300053157 | Bacteria | 8527 |
| 488 | Ga0500624_004903 | 3300053157 | Bacteria | 1770 |
| 489 | Ga0500627_0097611 | 3300053158 | Bacteria | 1318 |
| 490 | Ga0587073_0036208 | 3300059492 | Bacteria | 1051 |
| 491 | Ga0501082_0029595 | 3300060353 | Bacteria | 4718 |
| 492 | 2509109811 | 2508501122 | Bacteria | 6292184 |
| 493 | 2509379037 | 2509276019 | Bacteria | 6802256 |
| 494 | 2509386455 | 2509276021 | Bacteria | 7634384 |
| 495 | 2509389868 | 2509276021 | Bacteria | 7634384 |
| 496 | 2509447881 | 2509276033 | Bacteria | 7180565 |
| 497 | 2510134815 | 2510065019 | Bacteria | 6903379 |
| 498 | 2510303674 | 2510065057 | Bacteria | 6649661 |
| 499 | 2510839401 | 2510461069 | Bacteria | 5505000 |
| 500 | 2510896223 | 2510461076 | Bacteria | 8618824 |
| 501 | 2511136581 | 2510917022 | Bacteria | 6504556 |
| 502 | 2511185116 | 2510917028 | Bacteria | 6185411 |
| 503 | 2511198429 | 2510917030 | Bacteria | 7460662 |
| 504 | 2511502969 | 2511231052 | Bacteria | 6974333 |
| 505 | 2512534232 | 2512047086 | Bacteria | 6850303 |
| 506 | 2512973946 | 2512875026 | Bacteria | 6861065 |
| 507 | 2513572580 | 2513237084 | Bacteria | 7231967 |
| 508 | 2513580191 | 2513237085 | Bacteria | 7695351 |
| 509 | 2513585296 | 2513237086 | Bacteria | 7265287 |
| 510 | 2513597148 | 2513237088 | Bacteria | 6927906 |
| 511 | 2513602336 | 2513237089 | Bacteria | 6553624 |
| 512 | 2513617140 | 2513237091 | Bacteria | 6900273 |
| 513 | 2513631345 | 2513237093 | Bacteria | 7545552 |
| 514 | 2513710736 | 2513237103 | Bacteria | 7647401 |
| 515 | 2513868129 | 2513237138 | Bacteria | 7368160 |
| 516 | 2513882881 | 2513237140 | Bacteria | 7076289 |
| 517 | 2513902909 | 2513237143 | Bacteria | 6664116 |
| 518 | 2513908216 | 2513237144 | Bacteria | 7530820 |
| 519 | 2513926917 | 2513237146 | Bacteria | 7166346 |
| 520 | 2513985881 | 2513237156 | Bacteria | 6402557 |
| 521 | 2513998069 | 2513237159 | Bacteria | 6810126 |
| 522 | 2514003979 | 2513237160 | Bacteria | 6650282 |
| 523 | 2514022362 | 2513237162 | Bacteria | 7468464 |
| 524 | 2515113900 | 2515075009 | Bacteria | 7288508 |
| 525 | 2515610358 | 2515154107 | Bacteria | 6795637 |
| 526 | 2515638777 | 2515154113 | Bacteria | 7807172 |
| 527 | 2515643081 | 2515154114 | Bacteria | 7848616 |
| 528 | 2515656804 | 2515154116 | Bacteria | 7552979 |
| 529 | 2515743746 | 2515154134 | Bacteria | 7220242 |
| 530 | 2516205214 | 2516143018 | Bacteria | 6951533 |
| 531 | 2516894374 | 2516653046 | Bacteria | 6989037 |
| 532 | 2517037531 | 2516653077 | Bacteria | 7555578 |
| 533 | 2517077816 | 2516653085 | Bacteria | 7346596 |
| 534 | 2517096615 | 2517093000 | Bacteria | 7412387 |
| 535 | 2517410330 | 2517287029 | Bacteria | 6905599 |
| 536 | 2517570991 | 2517487022 | Bacteria | 7227575 |
| 537 | 2520377911 | 2519899620 | Bacteria | 6499161 |
| 538 | 2524451853 | 2524023207 | Bacteria | 6813453 |
| 539 | 2524460089 | 2524023209 | Bacteria | 6679728 |
| 540 | 2530646927 | 2529292951 | Bacteria | 6916614 |
| 541 | 2535519469 | 2534681796 | Bacteria | 7146037 |
| 542 | 2537873064 | 2537561587 | Bacteria | 5425293 |
| 543 | 2551679842 | 2551306084 | Bacteria | 8942552 |
| 544 | 2551685967 | 2551306085 | Bacteria | 7347181 |
| 545 | 2551694544 | 2551306086 | Bacteria | 6843938 |
| 546 | 2551698062 | 2551306087 | Bacteria | 7351905 |
| 547 | 2551710427 | 2551306089 | Bacteria | 7162724 |
| 548 | 2551711865 | 2551306089 | Bacteria | 7162724 |
| 549 | 2551715702 | 2551306090 | Bacteria | 7953713 |
| 550 | 2551726332 | 2551306091 | Bacteria | 7086830 |
| 551 | 2551733515 | 2551306092 | Bacteria | 6992595 |
| 552 | 2551740284 | 2551306093 | Bacteria | 7064773 |
| 553 | 2551746374 | 2551306093 | Bacteria | 7064773 |
| 554 | 2554245090 | 2554235003 | Bacteria | 5877155 |
| 555 | 2558860385 | 2558860100 | Bacteria | 8458965 |
| 556 | 2559297079 | 2558860242 | Bacteria | 5568029 |
| 557 | 2561468164 | 2558860983 | Bacteria | 4133860 |
| 558 | 2585168013 | 2582581283 | Bacteria | 6030556 |
| 559 | 2585202497 | 2582581294 | Bacteria | 6626667 |
| 560 | 2585224809 | 2582581298 | Bacteria | 7315509 |
| 561 | 2585227795 | 2582581299 | Bacteria | 6518058 |
| 562 | 2585257795 | 2582581304 | Bacteria | 5831370 |
| 563 | 2585265388 | 2582581306 | Bacteria | 6450535 |
| 564 | 2585274263 | 2582581307 | Bacteria | 6597605 |
| 565 | 2585280323 | 2582581308 | Bacteria | 7413247 |
| 566 | 2585322601 | 2582581315 | Bacteria | 7318924 |
| 567 | 2585330714 | 2582581316 | Bacteria | 7774528 |
| 568 | 2585388531 | 2582581865 | Bacteria | 6644329 |
| 569 | 2585392406 | 2582581866 | Bacteria | 6859583 |
| 570 | 2585402193 | 2582581867 | Bacteria | 7184437 |
| 571 | 2585529106 | 2585427526 | Bacteria | 7258840 |
| 572 | 2585532553 | 2585427527 | Bacteria | 7273426 |
| 573 | 2585541045 | 2585427528 | Bacteria | 6842387 |
| 574 | 2585547365 | 2585427529 | Bacteria | 7395659 |
| 575 | 2585554431 | 2585427530 | Bacteria | 7383882 |
| 576 | 2585560712 | 2585427531 | Bacteria | 6992870 |
| 577 | 2585822507 | 2585427590 | Bacteria | 6824633 |
| 578 | 2585839807 | 2585427593 | Bacteria | 7141551 |
| 579 | 2585845327 | 2585427594 | Bacteria | 6180594 |
| 580 | 2585898915 | 2585427608 | Bacteria | 6544331 |
| 581 | 2585903490 | 2585427609 | Bacteria | 6667127 |
| 582 | 2585997116 | 2585427633 | Bacteria | 6413184 |
| 583 | 2586001717 | 2585427634 | Bacteria | 6455027 |
| 584 | 2587981391 | 2585428125 | Bacteria | 6662905 |
| 585 | 2599334761 | 2599185156 | Bacteria | 5403036 |
| 586 | 2599420589 | 2599185170 | Bacteria | 7295545 |
| 587 | 2599604956 | 2599185210 | Bacteria | 5624189 |
| 588 | 2599723929 | 2599185236 | Bacteria | 6875203 |
| 589 | 2600194061 | 2599185352 | Bacteria | 7228948 |
| 590 | 2600373676 | 2600254933 | Bacteria | 4750527 |
| 591 | 2601611080 | 2600255279 | Bacteria | 5605316 |
| 592 | 2601747853 | 2600255308 | Bacteria | 5611129 |
| 593 | 2616295529 | 2615840624 | Bacteria | 6557588 |
| 594 | 2616307376 | 2615840626 | Bacteria | 7921970 |
| 595 | 2616554919 | 2615840698 | Bacteria | 7319877 |
| 596 | 2617383368 | 2617270742 | Bacteria | 6808054 |
| 597 | 2643809798 | 2643221557 | Bacteria | 7184309 |
| 598 | 2643916758 | 2643221582 | Bacteria | 5804683 |
| 599 | 2644006380 | 2643221599 | Bacteria | 6292121 |
| 600 | 2644051100 | 2643221607 | Bacteria | 6314006 |
| 601 | 2644063979 | 2643221610 | Bacteria | 7480339 |
| 602 | 2644108509 | 2643221618 | Bacteria | 7717186 |
| 603 | 2644145555 | 2643221626 | Bacteria | 8069654 |
| 604 | 2644195857 | 2643221634 | Bacteria | 6705461 |
| 605 | 2644205580 | 2643221636 | Bacteria | 6583769 |
| 606 | 2644209893 | 2643221637 | Bacteria | 5345260 |
| 607 | 2644241835 | 2643221643 | Bacteria | 5749658 |
| 608 | 2644299224 | 2643221653 | Bacteria | 4569637 |
| 609 | 2644312368 | 2643221655 | Bacteria | 7722067 |
| 610 | 2644335996 | 2643221659 | Bacteria | 7890716 |
| 611 | 2644381500 | 2643221668 | Bacteria | 7306521 |
| 612 | 2644415812 | 2643221675 | Bacteria | 7473456 |
| 613 | 2644448852 | 2643221680 | Bacteria | 7473610 |
| 614 | 2644484004 | 2643221686 | Bacteria | 6310811 |
| 615 | 2644496351 | 2643221688 | Bacteria | 5260751 |
| 616 | 2644500216 | 2643221689 | Bacteria | 6042950 |
| 617 | 2644521322 | 2643221693 | Bacteria | 5513853 |
| 618 | 2644546853 | 2643221698 | Bacteria | 7756764 |
| 619 | 2644618051 | 2643221712 | Bacteria | 7729434 |
| 620 | 2644653444 | 2643221718 | Bacteria | 5345506 |
| 621 | 2644657452 | 2643221719 | Bacteria | 4568197 |
| 622 | 2644676772 | 2643221723 | Bacteria | 7095460 |
| 623 | 2644686754 | 2643221726 | Bacteria | 7455827 |
| 624 | 2657684007 | 2657244999 | Bacteria | 5946535 |
| 625 | 2671112169 | 2667528174 | Bacteria | 6435400 |
| 626 | 2692314523 | 2690316117 | Bacteria | 6800650 |
| 627 | 2719182571 | 2718217882 | Bacteria | 6556348 |
| 628 | 2719387246 | 2718217927 | Bacteria | 6972593 |
| 629 | 2719666883 | 2718217997 | Bacteria | 6740740 |
| 630 | 2719733290 | 2718218009 | Bacteria | 6478651 |
| 631 | 2720493303 | 2718218199 | Bacteria | 6740745 |
| 632 | 2720614777 | 2718218232 | Bacteria | 6720332 |
| 633 | 2720621550 | 2718218233 | Bacteria | 6662049 |
| 634 | 2720632878 | 2718218235 | Bacteria | 6630699 |
| 635 | 2720776602 | 2718218269 | Bacteria | 6906114 |
| 636 | 2721148684 | 2718218363 | Bacteria | 6524337 |
| 637 | 2721160070 | 2718218365 | Bacteria | 6274507 |
| 638 | 2721165498 | 2718218366 | Bacteria | 6425255 |
| 639 | 2721400881 | 2718218423 | Bacteria | 6438183 |
| 640 | 2722841668 | 2721755514 | Bacteria | 6424414 |
| 641 | 2723028190 | 2721755556 | Bacteria | 6745503 |
| 642 | 2723561821 | 2721755684 | Bacteria | 6859907 |
| 643 | 2723568450 | 2721755685 | Bacteria | 6704835 |
| 644 | 2724039694 | 2721755809 | Bacteria | 6438790 |
| 645 | 2724046046 | 2721755810 | Bacteria | 6479005 |
| 646 | 2724091209 | 2721755819 | Bacteria | 6906405 |
| 647 | 2724105715 | 2721755822 | Bacteria | 6726041 |
| 648 | 2724111544 | 2721755823 | Bacteria | 6752556 |
| 649 | 2725945495 | 2724679232 | Bacteria | 7646494 |
| 650 | 2730109126 | 2728369352 | Bacteria | 6745171 |
| 651 | 2730165806 | 2728369365 | Bacteria | 6555560 |
| 652 | 2730299702 | 2728369397 | Bacteria | 6274511 |
| 653 | 2738800467 | 2738541293 | Bacteria | 7065685 |
| 654 | 2738944481 | 2738541317 | Bacteria | 5340176 |
| 655 | 2739035599 | 2738541333 | Bacteria | 7106503 |
| 656 | 2753458639 | 2751185821 | Bacteria | 6189929 |
| 657 | 2766065348 | 2765235942 | Bacteria | 7445910 |
| 658 | 2776914534 | 2775507049 | Bacteria | 6284736 |
| 659 | 2778175984 | 2775507266 | Bacteria | 7392367 |
| 660 | 2792582572 | 2791355082 | Bacteria | 5973319 |
| 661 | 2792622975 | 2791355091 | Bacteria | 6135441 |
| 662 | 2792629230 | 2791355092 | Bacteria | 6248105 |
| 663 | 2792640423 | 2791355094 | Bacteria | 7011481 |
| 664 | 2793293676 | 2791355256 | Bacteria | 6798008 |
| 665 | 2793313100 | 2791355259 | Bacteria | 7254731 |
| 666 | 2793319747 | 2791355260 | Bacteria | 6598818 |
| 667 | 2793327747 | 2791355261 | Bacteria | 6661293 |
| 668 | 2793333338 | 2791355262 | Bacteria | 6774204 |
| 669 | 2793342116 | 2791355263 | Bacteria | 6872478 |
| 670 | 2793347345 | 2791355264 | Bacteria | 6429314 |
| 671 | 2793353668 | 2791355265 | Bacteria | 6539969 |
| 672 | 2793359743 | 2791355266 | Bacteria | 7116587 |
| 673 | 2793369480 | 2791355267 | Bacteria | 7222458 |
| 674 | 2802717920 | 2802428858 | Bacteria | 6636079 |
| 675 | 2802725229 | 2802428859 | Bacteria | 6667919 |
| 676 | 2802730647 | 2802428860 | Bacteria | 6525526 |
| 677 | 2802737994 | 2802428861 | Bacteria | 6534206 |
| 678 | 2802744136 | 2802428862 | Bacteria | 6633353 |
| 679 | 2802753179 | 2802428863 | Bacteria | 6410669 |
| 680 | 2804753301 | 2802429268 | Bacteria | 6094027 |
| 681 | 2805930524 | 2802429605 | Bacteria | 6875453 |
| 682 | 2805934296 | 2802429606 | Bacteria | 6346811 |
| 683 | 2806044587 | 2802429633 | Bacteria | 7341974 |
| 684 | 2806052787 | 2802429634 | Bacteria | 7083200 |
| 685 | 2806059087 | 2802429635 | Bacteria | 7650140 |
| 686 | 2806068250 | 2802429636 | Bacteria | 7597525 |
| 687 | 2806074370 | 2802429637 | Bacteria | 7067217 |
| 688 | 2808988960 | 2808606387 | Bacteria | 5697198 |
| 689 | 2819243795 | 2818991272 | Bacteria | 4622173 |
| 690 | 2819609624 | 2818991448 | Bacteria | 6772224 |
| 691 | 2819639722 | 2818991453 | Bacteria | 7181617 |
| 692 | 2819686377 | 2818991461 | Bacteria | 7026071 |
| 693 | 2821126129 | 2821123053 | Bacteria | 7836056 |
| 694 | 2838019079 | 2838016132 | Bacteria | 6577831 |
| 695 | 2838024325 | 2838022645 | Bacteria | 6494267 |
| 696 | 2838033107 | 2838029111 | Bacteria | 6603031 |
| 697 | 2838040737 | 2838035591 | Bacteria | 7166484 |
| 698 | 2838046275 | 2838042994 | Bacteria | 6046894 |
| 699 | 2838051203 | 2838048938 | Bacteria | 6044578 |
| 700 | 2838063821 | 2838061910 | Bacteria | 6794874 |
| 701 | 2838073304 | 2838068647 | Bacteria | 6208656 |
| 702 | 2838664875 | 2838661181 | Bacteria | 7385261 |
| 703 | 2838671172 | 2838668709 | Bacteria | 6671819 |
| 704 | 2838678426 | 2838675328 | Bacteria | 4909118 |
| 705 | 2838684987 | 2838680041 | Bacteria | 6545511 |
| 706 | 2838691350 | 2838686498 | Bacteria | 7807632 |
| 707 | 2838699176 | 2838694306 | Bacteria | 6853137 |
| 708 | 2838703648 | 2838701080 | Bacteria | 6669771 |
| 709 | 2838712657 | 2838707686 | Bacteria | 6619912 |
| 710 | 2838716666 | 2838714209 | Bacteria | 5525906 |
| 711 | 2838722722 | 2838719591 | Bacteria | 5523910 |
| 712 | 2838727417 | 2838724970 | Bacteria | 4908691 |
| 713 | 2838733309 | 2838729681 | Bacteria | 7400765 |
| 714 | 2838737396 | 2838736955 | Bacteria | 5760694 |
| 715 | 2838746119 | 2838742623 | Bacteria | 7396178 |
| 716 | 2841842235 | 2841840854 | Bacteria | 5761912 |
| 717 | 2841849035 | 2841846520 | Bacteria | 5345850 |
| 718 | 2841853831 | 2841851746 | Bacteria | 7532261 |
| 719 | 2841861945 | 2841859092 | Bacteria | 5436171 |
| 720 | 2841868197 | 2841864319 | Bacteria | 6742987 |
| 721 | 2842082134 | 2842077413 | Bacteria | 6508645 |
| 722 | 2842113464 | 2842110456 | Bacteria | 7656360 |
| 723 | 2842123056 | 2842118031 | Bacteria | 7033875 |
| 724 | 2842128216 | 2842124991 | Bacteria | 5346824 |
| 725 | 2842133319 | 2842130223 | Bacteria | 4909145 |
| 726 | 2842142014 | 2842140634 | Bacteria | 5759631 |
| 727 | 2842149350 | 2842146304 | Bacteria | 5957337 |
| 728 | 2842155312 | 2842152218 | Bacteria | 4908957 |
| 729 | 2842162162 | 2842156927 | Bacteria | 6894975 |
| 730 | 2842169920 | 2842163707 | Bacteria | 6916235 |
| 731 | 2842173812 | 2842170452 | Bacteria | 5525737 |
| 732 | 2842178933 | 2842175837 | Bacteria | 4908771 |
| 733 | 2842185088 | 2842180545 | Bacteria | 6888678 |
| 734 | 2842189774 | 2842187318 | Bacteria | 5524014 |
| 735 | 2842198288 | 2842192696 | Bacteria | 6147454 |
| 736 | 2842199868 | 2842198810 | Bacteria | 6608673 |
| 737 | 2842208276 | 2842205361 | Bacteria | 6340321 |
| 738 | 2842214088 | 2842211629 | Bacteria | 5523832 |
| 739 | 2842220107 | 2842217011 | Bacteria | 7497767 |
| 740 | 2842226808 | 2842224351 | Bacteria | 5524473 |
| 741 | 2842233526 | 2842229732 | Bacteria | 7475766 |
| 742 | 2842242041 | 2842237096 | Bacteria | 6620661 |
| 743 | 2842247619 | 2842243621 | Bacteria | 7421798 |
| 744 | 2842254012 | 2842250916 | Bacteria | 6579627 |
| 745 | 2842262113 | 2842257432 | Bacteria | 7401195 |
| 746 | 2842266584 | 2842264693 | Bacteria | 6472963 |
| 747 | 2842275824 | 2842271015 | Bacteria | 7807131 |
| 748 | 2842281715 | 2842278818 | Bacteria | 6340002 |
| 749 | 2842288825 | 2842285085 | Bacteria | 6011953 |
| 750 | 2842296134 | 2842291075 | Bacteria | 7076806 |
| 751 | 2842298686 | 2842298080 | Bacteria | 6123127 |
| 752 | 2842308192 | 2842304105 | Bacteria | 7023636 |
| 753 | 2842315571 | 2842311132 | Bacteria | 6616990 |
| 754 | 2842321424 | 2842317721 | Bacteria | 6793725 |
| 755 | 2842344976 | 2842341865 | Bacteria | 7003929 |
| 756 | 2842359447 | 2842357229 | Bacteria | 6485165 |
| 757 | 2842370024 | 2842363717 | Bacteria | 6844742 |
| 758 | 2842375665 | 2842370503 | Bacteria | 7038661 |
| 759 | 2842382533 | 2842377471 | Bacteria | 7140707 |
| 760 | 2842389934 | 2842384541 | Bacteria | 7057858 |
| 761 | 2842398544 | 2842395702 | Bacteria | 6780583 |
| 762 | 2842406508 | 2842402390 | Bacteria | 6681310 |
| 763 | 2842413065 | 2842409023 | Bacteria | 6687331 |
| 764 | 2842419708 | 2842415677 | Bacteria | 6596907 |
| 765 | 2842426939 | 2842422224 | Bacteria | 6239196 |
| 766 | 2842429903 | 2842428310 | Bacteria | 6767288 |
| 767 | 2842436437 | 2842434925 | Bacteria | 6502746 |
| 768 | 2842444140 | 2842441272 | Bacteria | 6769273 |
| 769 | 2842451002 | 2842447887 | Bacteria | 6754142 |
| 770 | 2842464324 | 2842462802 | Bacteria | 6588055 |
| 771 | 2842470766 | 2842469257 | Bacteria | 6752936 |
| 772 | 2842479840 | 2842475841 | Bacteria | 6603183 |
| 773 | 2842483414 | 2842482326 | Bacteria | 7212537 |
| 774 | 2842493242 | 2842489311 | Bacteria | 6620893 |
| 775 | 2842499190 | 2842495871 | Bacteria | 6820686 |
| 776 | 2842507016 | 2842502639 | Bacteria | 6604161 |
| 777 | 2842510709 | 2842509118 | Bacteria | 6850950 |
| 778 | 2842517789 | 2842515876 | Bacteria | 5436280 |
| 779 | 2842523174 | 2842521101 | Bacteria | 6569494 |
| 780 | 2842925888 | 2842922631 | Bacteria | 5824079 |
| 781 | 2844169221 | 2844163670 | Bacteria | 7266046 |
| 782 | 2844457524 | 2844454524 | Bacteria | 7952546 |
| 783 | 2848995232 | 2848992105 | Bacteria | 6810864 |
| 784 | 2852391173 | 2852387548 | Bacteria | 8025568 |
| 785 | 2854900265 | 2854896431 | Bacteria | 5869725 |
| 786 | 2854919136 | 2854916844 | Bacteria | 5725939 |
| 787 | 2855842405 | 2855839649 | Bacteria | 7135830 |
| 788 | 2855878447 | 2855872281 | Bacteria | 6964271 |
| 789 | 2857518931 | 2857516855 | Bacteria | 7787325 |
| 790 | 2857532690 | 2857531043 | Bacteria | 6754041 |
| 791 | 2858803221 | 2858800743 | Bacteria | 6603254 |
| 792 | 2891377538 | 2891373044 | Bacteria | 5202277 |
| 793 | 2896386423 | 2896384573 | Bacteria | 7700774 |
| 794 | 2899794728 | 2899792073 | Bacteria | 4926588 |
| 795 | 2899806450 | 2899803654 | Bacteria | 5577784 |
| 796 | 2899845319 | 2899845264 | Bacteria | 5672268 |
| 797 | 2913299819 | 2913295892 | Bacteria | 6333755 |
| 798 | 2913309100 | 2913308742 | Bacteria | 5350706 |
| 799 | 2915991016 | 2915986958 | Bacteria | 6739310 |
| 800 | 2915996674 | 2915993759 | Bacteria | 7016183 |
| 801 | 2916005084 | 2916000859 | Bacteria | 6865702 |
| 802 | 2916013418 | 2916007675 | Bacteria | 6898660 |
| 803 | 2916016940 | 2916014648 | Bacteria | 6946486 |
| 804 | 2916028197 | 2916021584 | Bacteria | 6854472 |
| 805 | 2916029288 | 2916028427 | Bacteria | 6748433 |
| 806 | 2916038336 | 2916035215 | Bacteria | 6755766 |
| 807 | 2916044918 | 2916041962 | Bacteria | 6820487 |
| 808 | 2916049272 | 2916048683 | Bacteria | 6543552 |
| 809 | 2916058225 | 2916055098 | Bacteria | 6758838 |
| 810 | 2916066261 | 2916061851 | Bacteria | 6737736 |
| 811 | 2916083120 | 2916076590 | Bacteria | 6596108 |
| 812 | 2919104537 | 2919100787 | Bacteria | 7710546 |
| 813 | 2919116883 | 2919114240 | Bacteria | 5700270 |
| 814 | 2919173367 | 2919171160 | Bacteria | 6499771 |
| 815 | 2919410655 | 2919408235 | Bacteria | 6149349 |
| 816 | 2920760801 | 2920760137 | Bacteria | 7427611 |
| 817 | 2920828514 | 2920822456 | Bacteria | 6897201 |
| 818 | 2921203282 | 2921201388 | Bacteria | 6926299 |
| 819 | 2921213308 | 2921208531 | Bacteria | 6745326 |
| 820 | 2921242309 | 2921237296 | Bacteria | 6876710 |
| 821 | 2921244196 | 2921244191 | Bacteria | 6568419 |
| 822 | 2921252476 | 2921250672 | Bacteria | 6677771 |
| 823 | 2921260113 | 2921257292 | Bacteria | 6808382 |
| 824 | 2921266108 | 2921263974 | Bacteria | 6864552 |
| 825 | 2921287789 | 2921282425 | Bacteria | 6826397 |
| 826 | 2921289560 | 2921289301 | Bacteria | 7316391 |
| 827 | 2921299884 | 2921296804 | Bacteria | 7176999 |
| 828 | 2923562877 | 2923556063 | Bacteria | 6793593 |
| 829 | 2924148841 | 2924144063 | Bacteria | 6883928 |
| 830 | 2924152116 | 2924150972 | Bacteria | 7169444 |
| 831 | 2924164052 | 2924158325 | Bacteria | 7188855 |
| 832 | 2924168690 | 2924165586 | Bacteria | 7260590 |
| 833 | 2924175338 | 2924172951 | Bacteria | 6749356 |
| 834 | 2924183840 | 2924179722 | Bacteria | 6843264 |
| 835 | 2924189959 | 2924186466 | Bacteria | 6876637 |
| 836 | 2924193752 | 2924193448 | Bacteria | 6955718 |
| 837 | 2924206721 | 2924200457 | Bacteria | 6757188 |
| 838 | 2924213153 | 2924207177 | Bacteria | 6917007 |
| 839 | 2924220647 | 2924214083 | Bacteria | 7080103 |
| 840 | 2924221788 | 2924221636 | Bacteria | 7113495 |
| 841 | 2924232421 | 2924228884 | Bacteria | 6633132 |
| 842 | 2926758396 | 2926754445 | Bacteria | 5964435 |
| 843 | 2926764046 | 2926760298 | Bacteria | 5505990 |
| 844 | 2929141358 | 2929138655 | Bacteria | 5810547 |
| 845 | 2933009309 | 2933006813 | Bacteria | 4912075 |
| 846 | 2933013418 | 2933011516 | Bacteria | 5439334 |
| 847 | 2933020534 | 2933016740 | Bacteria | 6355406 |
| 848 | 2933574641 | 2933570622 | Bacteria | 7023390 |
| 849 | 2933589246 | 2933586486 | Bacteria | 7667493 |
| 850 | 2933598244 | 2933594066 | Bacteria | 5594265 |
| 851 | 2933603566 | 2933599457 | Bacteria | 5858799 |
| 852 | 2935899762 | 2935894831 | Bacteria | 6620579 |
| 853 | 2935907585 | 2935901341 | Bacteria | 7341747 |
| 854 | 2936374899 | 2936367885 | Bacteria | 7324495 |
| 855 | 2936380590 | 2936375103 | Bacteria | 6652732 |
| 856 | 2936382239 | 2936381700 | Bacteria | 7006523 |
| 857 | 2937000029 | 2936996657 | Bacteria | 6298727 |
| 858 | 2937007011 | 2937002841 | Bacteria | 6934057 |
| 859 | 2937015480 | 2937009748 | Bacteria | 6746052 |
| 860 | 2937018200 | 2937016420 | Bacteria | 6782579 |
| 861 | 2937026729 | 2937023124 | Bacteria | 6815156 |
| 862 | 2937033022 | 2937029754 | Bacteria | 6424026 |
| 863 | 2937042196 | 2937036028 | Bacteria | 6846469 |
| 864 | 2937047836 | 2937042894 | Bacteria | 6741576 |
| 865 | 2937052367 | 2937049772 | Bacteria | 6757901 |
| 866 | 2937062214 | 2937056579 | Bacteria | 7107896 |
| 867 | 2937067611 | 2937063883 | Bacteria | 7199456 |
| 868 | 2937071425 | 2937071275 | Bacteria | 6984483 |
| 869 | 2937078603 | 2937078374 | Bacteria | 6610289 |
| 870 | 2937087280 | 2937084907 | Bacteria | 6618516 |
| 871 | 2937093419 | 2937091812 | Bacteria | 6979387 |
| 872 | 2937102289 | 2937098957 | Bacteria | 7249374 |
| 873 | 2937111387 | 2937106411 | Bacteria | 6947143 |
| 874 | 2937114852 | 2937113482 | Bacteria | 6505872 |
| 875 | 2937123674 | 2937119839 | Bacteria | 6597547 |
| 876 | 2937129348 | 2937126314 | Bacteria | 6771275 |
| 877 | 2941501722 | 2941499720 | Bacteria | 7599444 |
| 878 | 2957376958 | 2957375807 | Bacteria | 6425588 |
| 879 | 2957386109 | 2957382221 | Bacteria | 6737050 |
| 880 | 2957392088 | 2957388812 | Bacteria | 6778072 |
| 881 | 2957406290 | 2957402308 | Bacteria | 6741770 |
| 882 | 2957409043 | 2957408893 | Bacteria | 6558585 |
| 883 | 2957416350 | 2957415311 | Bacteria | 6991633 |
| 884 | 2957426792 | 2957422303 | Bacteria | 7172205 |
| 885 | 2957436806 | 2957430029 | Bacteria | 7022557 |
| 886 | 2957437361 | 2957437181 | Bacteria | 6568994 |
| 887 | 2957449528 | 2957443900 | Bacteria | 6869977 |
| 888 | 2957452804 | 2957450854 | Bacteria | 6765715 |
| 889 | 2957459079 | 2957457609 | Bacteria | 6967680 |
| 890 | 2957468171 | 2957464669 | Bacteria | 6568877 |
| 891 | 2957472257 | 2957471148 | Bacteria | 6797643 |
| 892 | 2957481126 | 2957478035 | Bacteria | 6756658 |
| 893 | 2957487585 | 2957484790 | Bacteria | 6703082 |
| 894 | 2957495297 | 2957491536 | Bacteria | 6695180 |
| 895 | 2957498676 | 2957498199 | Bacteria | 7126688 |
| 896 | 2957508678 | 2957505466 | Bacteria | 7253085 |
| 897 | 2960585339 | 2960584000 | Bacteria | 6864594 |
| 898 | 2960591251 | 2960591022 | Bacteria | 6622873 |
| 899 | 2960598802 | 2960597568 | Bacteria | 6550735 |
| 900 | 2960605019 | 2960603979 | Bacteria | 6898737 |
| 901 | 2960617226 | 2960610863 | Bacteria | 6691244 |
| 902 | 2960622832 | 2960617483 | Bacteria | 6727748 |
| 903 | 2960628120 | 2960624210 | Bacteria | 6875384 |
| 904 | 2960632502 | 2960631154 | Bacteria | 6732508 |
| 905 | 2960638994 | 2960637947 | Bacteria | 7296468 |
| 906 | 2960650131 | 2960645483 | Bacteria | 7211087 |
| 907 | 2960656748 | 2960652885 | Bacteria | 7083688 |
| 908 | 2960665295 | 2960660292 | Bacteria | 7041660 |
| 909 | 2960671522 | 2960667422 | Bacteria | 6763020 |
| 910 | 2960677398 | 2960674078 | Bacteria | 6609048 |
| 911 | 2960681333 | 2960680706 | Bacteria | 6624464 |
| 912 | 2960692369 | 2960687367 | Bacteria | 6535474 |
| 913 | 2960696438 | 2960693952 | Bacteria | 6749742 |
| 914 | 2964612985 | 2964607997 | Bacteria | 7101408 |
| 915 | 2964620427 | 2964615318 | Bacteria | 6809089 |
| 916 | 2964622427 | 2964621998 | Bacteria | 6834995 |
| 917 | 2964629985 | 2964628898 | Bacteria | 7083044 |
| 918 | 2964637601 | 2964636051 | Bacteria | 7091832 |
| 919 | 2964647267 | 2964643177 | Bacteria | 6820887 |
| 920 | 2964652291 | 2964649959 | Bacteria | 6675118 |
| 921 | 2964657774 | 2964656573 | Bacteria | 7100150 |
| 922 | 2964668883 | 2964663802 | Bacteria | 7019362 |
| 923 | 2964673827 | 2964670856 | Bacteria | 6851364 |
| 924 | 2964681817 | 2964678106 | Bacteria | 6792020 |
| 925 | 2964687005 | 2964685014 | Bacteria | 6839111 |
| 926 | 2964697678 | 2964691889 | Bacteria | 6802758 |
| 927 | 2964702984 | 2964698721 | Bacteria | 6765331 |
| 928 | 2964712445 | 2964705432 | Bacteria | 7114648 |
| 929 | 2964717465 | 2964712639 | Bacteria | 6695970 |
| 930 | 2964720080 | 2964719344 | Bacteria | 7286602 |
| 931 | 2967670849 | 2967664464 | Bacteria | 6948836 |
| 932 | 2967674424 | 2967671571 | Bacteria | 7021409 |
| 933 | 2967685929 | 2967678726 | Bacteria | 7264382 |
| 934 | 2967686481 | 2967686174 | Bacteria | 6678622 |
| 935 | 2967696185 | 2967693043 | Bacteria | 6804451 |
| 936 | 2967705640 | 2967699805 | Bacteria | 6854538 |
| 937 | 2967710080 | 2967706974 | Bacteria | 7186053 |
| 938 | 2967720053 | 2967714385 | Bacteria | 7000047 |
| 939 | 2967724867 | 2967721400 | Bacteria | 7073753 |
| 940 | 2967732514 | 2967728569 | Bacteria | 6641507 |
| 941 | 2967735361 | 2967735183 | Bacteria | 6827012 |
| 942 | 2967746848 | 2967742019 | Bacteria | 6794534 |
| 943 | 2967752416 | 2967748971 | Bacteria | 6733771 |
| 944 | 2967758864 | 2967755722 | Bacteria | 6814706 |
| 945 | 2967769246 | 2967762386 | Bacteria | 6923502 |
| 946 | 2967774613 | 2967769361 | Bacteria | 6587838 |
| 947 | 2967776383 | 2967775926 | Bacteria | 6738189 |
| 948 | 2970022204 | 2970019648 | Bacteria | 7072033 |
| 949 | 2970028277 | 2970026789 | Bacteria | 6785236 |
| 950 | 2970040576 | 2970033650 | Bacteria | 7118744 |
| 951 | 2970043475 | 2970040964 | Bacteria | 6731123 |
| 952 | 2970050567 | 2970047711 | Bacteria | 7088379 |
| 953 | 2970058449 | 2970054988 | Bacteria | 6611507 |
| 954 | 2970067041 | 2970061556 | Bacteria | 7099761 |
| 955 | 2970075741 | 2970068827 | Bacteria | 7123112 |
| 956 | 2970079142 | 2970076120 | Bacteria | 6697332 |
| 957 | 2970083450 | 2970082768 | Bacteria | 6183754 |
| 958 | 2970090060 | 2970088815 | Bacteria | 6933825 |
| 959 | 2970100379 | 2970095765 | Bacteria | 6936963 |
| 960 | 2970108890 | 2970102677 | Bacteria | 6812532 |
| 961 | 2970112719 | 2970109326 | Bacteria | 6863976 |
| 962 | 2970121322 | 2970116247 | Bacteria | 6501857 |
| 963 | 2970126491 | 2970122695 | Bacteria | 6625855 |
| 964 | 2970134360 | 2970129317 | Bacteria | 6806560 |
| 965 | 2970141286 | 2970136068 | Bacteria | 7207982 |
| 966 | 2970146606 | 2970143518 | Bacteria | 6446480 |
| 967 | 2970152742 | 2970149975 | Bacteria | 6779706 |
| 968 | 2970157911 | 2970156795 | Bacteria | 7168044 |
| 969 | 2970166749 | 2970164137 | Bacteria | 6861252 |
| 970 | 2970173408 | 2970170962 | Bacteria | 6876229 |
| 971 | 2970179167 | 2970177841 | Bacteria | 6768001 |
| 972 | 2970187730 | 2970184632 | Bacteria | 7054431 |
| 973 | 2970195089 | 2970191845 | Bacteria | 7032787 |
| 974 | 2977522546 | 2977516862 | Bacteria | 6940108 |
| 975 | 2977528721 | 2977523885 | Bacteria | 6960446 |
| 976 | 2977532503 | 2977530762 | Bacteria | 6951399 |
| 977 | 2977541030 | 2977537788 | Bacteria | 6929320 |
| 978 | 2977551057 | 2977544691 | Bacteria | 6875412 |
| 979 | 2977556910 | 2977551784 | Bacteria | 7125765 |
| 980 | 2977561154 | 2977558990 | Bacteria | 6863948 |
| 981 | 2977567188 | 2977565890 | Bacteria | 6901543 |
| 982 | 2977576092 | 2977572785 | Bacteria | 6763888 |
| 983 | 2977579773 | 2977579622 | Bacteria | 6772100 |
| 984 | 2979090856 | 2979089926 | Bacteria | 5670289 |
| 985 | 2979096381 | 2979095461 | Bacteria | 5669583 |
| 986 | 2989354671 | 2989349275 | Bacteria | 6349068 |
| 987 | 2989780326 | 2989776772 | Bacteria | 4843317 |
| 988 | 2996889173 | 2996887358 | Bacteria | 5795980 |
| 989 | 2996896347 | 2996893221 | Bacteria | 5823108 |
| 990 | 3003934904 | 3003930520 | Bacteria | 5667563 |
| 991 | 3005415519 | 3005409236 | Bacteria | 7188837 |
| 992 | 3005418510 | 3005416602 | Bacteria | 7064308 |
| 993 | 3005449249 | 3005445848 | Bacteria | 6906074 |
| 994 | 3005455529 | 3005452660 | Bacteria | 5889319 |
| 995 | 639649970 | 639633055 | Bacteria | 7751309 |
| 996 | 643827065 | 643692032 | Bacteria | 6891900 |
| 997 | 648735866 | 648276728 | Bacteria | 6968865 |
| 998 | 650843508 | 650716007 | Bacteria | 5573770 |
| 999 | 8003573180 | 8003570095 | Bacteria | 5747666 |
| 1000 | 8003994946 | 8003992118 | Bacteria | 7266902 |
| 1001 | 8004002705 | 8003999396 | Bacteria | 7063185 |
| 1002 | 8005249587 | 8005246636 | Bacteria | 4933972 |
| 1003 | 8005264249 | 8005258706 | Bacteria | 6184835 |
| 1004 | 8005281977 | 8005275841 | Bacteria | 6929066 |
| 1005 | 8005288960 | 8005282627 | Bacteria | 6675747 |
| 1006 | 8005294299 | 8005289223 | Bacteria | 6634003 |
| 1007 | 8005306704 | 8005301065 | Bacteria | 6614431 |
| 1008 | 8005309356 | 8005307578 | Bacteria | 7395396 |
| 1009 | 8005318598 | 8005314921 | Bacteria | 7072929 |
| 1010 | 8005323700 | 8005321885 | Bacteria | 5795980 |
| 1011 | 8005382818 | 8005376324 | Bacteria | 6590079 |
| 1012 | 8005383870 | 8005382845 | Bacteria | 6732062 |
| 1013 | 8005401195 | 8005395548 | Bacteria | 6806915 |
| 1014 | 8005434148 | 8005430974 | Bacteria | 6689030 |
| 1015 | 8005464587 | 8005460587 | Bacteria | 7157962 |
| 1016 | 8005488517 | 8005484373 | Bacteria | 6297373 |
| 1017 | 8005501635 | 8005497431 | Bacteria | 6477605 |
| 1018 | 8005547160 | 8005542996 | Bacteria | 7077758 |
| 1019 | 8005558411 | 8005556819 | Bacteria | 6908598 |
| 1020 | 8005566745 | 8005563573 | Bacteria | 7153261 |
| 1021 | 8005574973 | 8005570704 | Bacteria | 6957481 |
| 1022 | 8005622991 | 8005619151 | Bacteria | 7030230 |
| 1023 | 8005631706 | 8005626139 | Bacteria | 6534237 |
| 1024 | 8005648984 | 8005645114 | Bacteria | 6950293 |
| 1025 | 8005662472 | 8005658619 | Bacteria | 4500593 |
| 1026 | 8005673057 | 8005668836 | Bacteria | 6953162 |
| 1027 | 8005682224 | 8005682033 | Bacteria | 6726518 |
| 1028 | 8005693600 | 8005688590 | Bacteria | 6610080 |
| 1029 | 8005700832 | 8005695170 | Bacteria | 6912330 |
| 1030 | 8018133643 | 8018127388 | Bacteria | 7351159 |
| 1031 | 8018170189 | 8018163183 | Bacteria | 7277977 |
| 1032 | 8018178489 | 8018176218 | Bacteria | 6896178 |
| 1033 | 8023687579 | 8023680758 | Bacteria | 7729763 |
| 1034 | 8024481752 | 8024479707 | Bacteria | 6954785 |
| 1035 | 8024489327 | 8024486573 | Bacteria | 6540512 |
| 1036 | 8024505975 | 8024501048 | Bacteria | 6427847 |
| 1037 | 8046773246 | 8046767195 | Bacteria | 7547379 |
| 1038 | 8049295914 | 8049293176 | Bacteria | 6128433 |
| 1039 | 8054560549 | 8054558443 | Bacteria | 5204801 |
| 1040 | 8055432052 | 8055431914 | Bacteria | 4551896 |
| 1041 | 8056381554 | 8056375014 | Bacteria | 7006639 |
| 1042 | 8056386987 | 8056382006 | Bacteria | 6408074 |
| 1043 | 8056876141 | 8056875544 | Bacteria | 4355797 |
| 1044 | 8057581019 | 8057575449 | Bacteria | 7367519 |
| 1045 | 8057876795 | 8057874678 | Bacteria | 7494653 |
| 1046 | Ga0495606_0081509 | |||
| 1047 | JGI25155J39150_1000007 | |||
| 1048 | JGI25155J39150_1000012 | |||
| 1049 | JGI25156J39149_1001609 | |||
| 1050 | JGI25162J39368_1000449 | |||
| 1051 | JGI25162J39368_1000471 | |||
| 1052 | JGI25154J39366_1001077 | |||
| 1053 | JGI25154J39366_1001309 | |||
| 1054 | JGI25158J39367_1000349 | |||
| 1055 | JGI25158J39367_1010726 | |||
| 1056 | JGI25157J39369_1000124 | |||
| 1057 | JGI25152J39213_1001533 | |||
| 1058 | JGI25152J39213_1002032 | |||
| 1059 | JGI25152J39213_1003616 | |||
| 1060 | JGI25152J39213_1003776 | |||
| 1061 | JGI25152J39213_1013279 | |||
| 1062 | JGI25152J39213_1014056 | |||
| 1063 | JGI25152J39213_1014066 | |||
| 1064 | JGI25150J39212_1000230 | |||
| 1065 | JGI25150J39212_1002298 | |||
| 1066 | JGI25150J39212_1008858 | |||
| 1067 | JGI25159J45721_1000018 | |||
| 1068 | JGI25159J45721_1000663 | |||
| 1069 | JGI25159J45721_1002318 | |||
| 1070 | JGI25151J46595_10000031 | |||
| 1071 | JGI25151J46595_10001231 | |||
| 1072 | JGI25151J46595_10001414 | |||
| 1073 | JGI25151J46595_10017466 | |||
| 1074 | JGI25151J46595_10034862 | |||
| 1075 | JGI25165J46597_1000443 | |||
| 1076 | JGI25165J46597_1000845 | |||
| 1077 | JGI25153J46596_10000937 | |||
| 1078 | JGI25153J46596_10004558 | |||
| 1079 | JGI25153J46596_10008345 | |||
| 1080 | JGI25153J46596_10013198 | |||
| 1081 | JGI25153J46596_10020921 | |||
| 1082 | JGI25153J46596_10034876 | |||
| 1083 | JGI25153J46596_10034878 | |||
| 1084 | JGI25160J50197_1000009 | |||
| 1085 | JGI25160J50197_1000114 | |||
| 1086 | JGI25160J50197_1001417 | |||
| 1087 | JGI25160J50197_1012549 | |||
| 1088 | JGI25161J50226_1000089 | |||
| 1089 | JGI25161J50226_1000901 | |||
| 1090 | JGI25161J50226_1002710 | |||
| 1091 | JGI25161J50226_1004105 | |||
| 1092 | Ga0055526_1000979 | |||
| 1093 | Ga0055526_1003292 | |||
| 1094 | Ga0055526_1006440 | |||
| 1095 | Ga0055526_1015198 | |||
| 1096 | Ga0055526_1015714 | |||
| 1097 | Ga0055524_1002889 | |||
| 1098 | Ga0055524_1003460 | |||
| 1099 | Ga0055524_1005154 | |||
| 1100 | Ga0055524_1011210 | |||
| 1101 | Ga0055524_1017766 | |||
| 1102 | Ga0055536_1000582 | |||
| 1103 | Ga0055528_1000704 | |||
| 1104 | Ga0055528_1002226 | |||
| 1105 | Ga0055528_1006711 | |||
| 1106 | Ga0055528_1006918 | |||
| 1107 | Ga0055530_10000287 | |||
| 1108 | Ga0055530_10011799 | |||
| 1109 | Ga0055540_1000537 | |||
| 1110 | Ga0055540_1004346 | |||
| 1111 | Ga0055531_10002239 | |||
| 1112 | Ga0055531_10002396 | |||
| 1113 | Ga0058692_1016793 | |||
| 1114 | Ga0055543_1000002 | |||
| 1115 | Ga0055543_1000055 | |||
| 1116 | Ga0055543_1000077 | |||
| 1117 | Ga0055543_1000724 | |||
| 1118 | Ga0065165_1000020 | |||
| 1119 | Ga0065165_1000537 | |||
| 1120 | Ga0065165_1002901 | |||
| 1121 | Ga0065165_1004459 | |||
| 1122 | Ga0065165_1010015 | |||
| 1123 | Ga0070670_100000577 | |||
| 1124 | Ga0070671_100066028 | |||
| 1125 | Ga0070667_100073952 | |||
| 1126 | Ga0070663_100078389 | |||
| 1127 | Ga0070662_100408109 | |||
| 1128 | Ga0070665_100003560 | |||
| 1129 | Ga0070665_100130182 | |||
| 1130 | Ga0068856_100351846 | |||
| 1131 | Ga0068852_100115404 | |||
| 1132 | Ga0075365_10004800 | |||
| 1133 | Ga0075365_10031222 | |||
| 1134 | Ga0075368_10001630 | |||
| 1135 | Ga0075368_10018029 | |||
| 1136 | Ga0075363_100071258 | |||
| 1137 | Ga0075364_10000009 | |||
| 1138 | Ga0075364_10162552 | |||
| 1139 | Ga0075362_10009877 | |||
| 1140 | Ga0075362_10014139 | |||
| 1141 | Ga0075367_10007124 | |||
| 1142 | Ga0075367_10020813 | |||
| 1143 | Ga0075367_10081074 | |||
| 1144 | Ga0075367_10096813 | |||
| 1145 | Ga0075369_10001520 | |||
| 1146 | Ga0075369_10006231 | |||
| 1147 | Ga0075366_10162942 | |||
| 1148 | Ga0075370_10000872 | |||
| 1149 | Ga0075370_10115253 | |||
| 1150 | Ga0079104_1000042 | |||
| 1151 | Ga0079104_1006567 | |||
| 1152 | Ga0099826_10000270 | |||
| 1153 | Ga0105251_10006217 | |||
| 1154 | Ga0105250_10028882 | |||
| 1155 | Ga0105240_10000019 | |||
| 1156 | Ga0105243_10247981 | |||
| 1157 | Ga0105237_10001085 | |||
| 1158 | Ga0105238_10256518 | |||
| 1159 | Ga0123341_1000016 | |||
| 1160 | Ga0123342_1011116 | |||
| 1161 | Ga0123342_1044877 | |||
| 1162 | Ga0105239_10030478 | |||
| 1163 | Ga0105246_10035508 | |||
| 1164 | Ga0157322_1002157 | |||
| 1165 | Ga0157373_10006893 | |||
| 1166 | Ga0157373_10108052 | |||
| 1167 | Ga0157371_10000304 | |||
| 1168 | Ga0157370_10000824 | |||
| 1169 | Ga0157370_10010711 | |||
| 1170 | Ga0157370_10029226 | |||
| 1171 | Ga0171463_1006 | |||
| 1172 | Ga0182007_10004588 | |||
| 1173 | Ga0182005_1007509 | |||
| 1174 | Ga0183363_1123 | |||
| 1175 | Ga0214544_1000063 | |||
| 1176 | Ga0214542_1010067 | |||
| 1177 | Ga0214543_1010170 | |||
| 1178 | Ga0209435_100005 | |||
| 1179 | Ga0209436_100072 | |||
| 1180 | Ga0209436_100601 | |||
| 1181 | Ga0209436_105953 | |||
| 1182 | Ga0209672_109696 | |||
| 1183 | Ga0209437_100078 | |||
| 1184 | Ga0209437_100291 | |||
| 1185 | Ga0207425_1000070 | |||
| 1186 | Ga0207425_1003108 | |||
| 1187 | Ga0207425_1004995 | |||
| 1188 | Ga0209646_1000011 | |||
| 1189 | Ga0209646_1007664 | |||
| 1190 | Ga0209026_1000008 | |||
| 1191 | Ga0209677_100640 | |||
| 1192 | Ga0209759_1000004 | |||
| 1193 | Ga0209129_1000080 | |||
| 1194 | Ga0209129_1000172 | |||
| 1195 | Ga0209129_1000232 | |||
| 1196 | Ga0209129_1000681 | |||
| 1197 | Ga0209129_1000773 | |||
| 1198 | Ga0209129_1001915 | |||
| 1199 | Ga0209129_1002970 | |||
| 1200 | Ga0209129_1007179 | |||
| 1201 | Ga0209233_1000157 | |||
| 1202 | Ga0209233_1000192 | |||
| 1203 | Ga0209233_1000194 | |||
| 1204 | Ga0209455_1015810 | |||
| 1205 | Ga0209673_1000037 | |||
| 1206 | Ga0209673_1000060 | |||
| 1207 | Ga0209673_1000312 | |||
| 1208 | Ga0209673_1000439 | |||
| 1209 | Ga0209673_1000649 | |||
| 1210 | Ga0209673_1001880 | |||
| 1211 | Ga0209673_1004749 | |||
| 1212 | Ga0209673_1006702 | |||
| 1213 | Ga0209130_1000030 | |||
| 1214 | Ga0209130_1000037 | |||
| 1215 | Ga0209130_1000083 | |||
| 1216 | Ga0209130_1029986 | |||
| 1217 | Ga0209676_1001698 | |||
| 1218 | Ga0209676_1009885 | |||
| 1219 | Ga0209676_1036147 | |||
| 1220 | Ga0209025_1000052 | |||
| 1221 | Ga0209025_1000083 | |||
| 1222 | Ga0209025_1000196 | |||
| 1223 | Ga0209025_1000389 | |||
| 1224 | Ga0209025_1000607 | |||
| 1225 | Ga0209025_1004571 | |||
| 1226 | Ga0209025_1011198 | |||
| 1227 | Ga0209025_1015269 | |||
| 1228 | Ga0209564_1000086 | |||
| 1229 | Ga0209564_1000116 | |||
| 1230 | Ga0209564_1000125 | |||
| 1231 | Ga0209564_1000281 | |||
| 1232 | Ga0209564_1003058 | |||
| 1233 | Ga0209564_1014851 | |||
| 1234 | Ga0209564_1019396 | |||
| 1235 | Ga0209758_1000090 | |||
| 1236 | Ga0209758_1000357 | |||
| 1237 | Ga0209758_1000657 | |||
| 1238 | Ga0209758_1000892 | |||
| 1239 | Ga0209758_1001670 | |||
| 1240 | Ga0209758_1002964 | |||
| 1241 | Ga0209758_1004285 | |||
| 1242 | Ga0209758_1013680 | |||
| 1243 | Ga0209758_1015070 | |||
| 1244 | Ga0209758_1055329 | |||
| 1245 | Ga0209050_1001713 | |||
| 1246 | Ga0209050_1014318 | |||
| 1247 | Ga0209050_1048529 | |||
| 1248 | Ga0209256_1000321 | |||
| 1249 | Ga0209256_1000854 | |||
| 1250 | Ga0209256_1001561 | |||
| 1251 | Ga0209256_1001567 | |||
| 1252 | Ga0209256_1001901 | |||
| 1253 | Ga0209256_1004259 | |||
| 1254 | Ga0209256_1023559 | |||
| 1255 | Ga0207426_1000047 | |||
| 1256 | Ga0207426_1000048 | |||
| 1257 | Ga0207426_1000173 | |||
| 1258 | Ga0207426_1000268 | |||
| 1259 | Ga0207426_1001666 | |||
| 1260 | Ga0209051_1000371 | |||
| 1261 | Ga0209051_1002253 | |||
| 1262 | Ga0209051_1004310 | |||
| 1263 | Ga0209051_1008182 | |||
| 1264 | Ga0209051_1021849 | |||
| 1265 | Ga0209257_1002934 | |||
| 1266 | Ga0209257_1005862 | |||
| 1267 | Ga0209257_1005871 | |||
| 1268 | Ga0209257_1040705 | |||
| 1269 | Ga0207695_10000049 | |||
| 1270 | Ga0207671_10001282 | |||
| 1271 | Ga0207650_10004194 | |||
| 1272 | Ga0207644_10019252 | |||
| 1273 | Ga0207709_10087673 | |||
| 1274 | Ga0207702_10387045 | |||
| 1275 | Ga0209281_1000068 | |||
| 1276 | Ga0209281_1000141 | |||
| 1277 | Ga0209371_1002415 | |||
| 1278 | Ga0268266_10003136 | |||
| 1279 | Ga0268266_10101428 | |||
| 1280 | Ga0268266_10145867 | |||
| 1281 | Ga0307515_10000263 | |||
| 1282 | Ga0307515_10004358 | |||
| 1283 | Ga0307515_10011563 | |||
| 1284 | Ga0307515_10040917 | |||
| 1285 | Ga0307515_10295593 | |||
| 1286 | Ga0268256_1002345 | |||
| 1287 | Ga0268256_1005024 | |||
| 1288 | Ga0316181_1213661 | |||
| 1289 | Ga0307513_10002589 | |||
| 1290 | Ga0307513_10056159 | |||
| 1291 | Ga0307513_10060399 | |||
| 1292 | Ga0307405_10000994 | |||
| 1293 | Ga0307413_10181017 | |||
| 1294 | Ga0307410_10199425 | |||
| 1295 | Ga0307412_10003267 | |||
| 1296 | Ga0307412_10135531 | |||
| 1297 | Ga0307412_10158243 | |||
| 1298 | Ga0307412_10441012 | |||
| 1299 | Ga0307414_10087343 | |||
| 1300 | Ga0373927_0001739 | |||
| 1301 | Ga0373925_0012096 | |||
| 1302 | Ga0395905_0004700 | |||
| 1303 | Ga0395905_0005359 | |||
| 1304 | Ga0439436_0058730 | |||
| 1305 | Ga0439465_0003521 | |||
| 1306 | Ga0439465_0007359 | |||
| 1307 | Ga0439465_0028355 | |||
| 1308 | Ga0439465_0041893 | |||
| 1309 | Ga0451833_0051479 | |||
| 1310 | Ga0451835_0302626 | |||
| 1311 | Ga0451837_0060979 | |||
| 1312 | Ga0451839_0718998 | |||
| 1313 | Ga0451839_0917332 | |||
| 1314 | Ga0451845_0681531 | |||
| 1315 | Ga0451847_0508924 | |||
| 1316 | Ga0451850_50252 | |||
| 1317 | Ga0451851_1216410 | |||
| 1318 | Ga0451843_0986684 | |||
| 1319 | Ga0451855_1356713 | |||
| 1320 | Ga0451853_0980795 | |||
| 1321 | Ga0439449_0016157 | |||
| 1322 | Ga0439462_0030023 | |||
| 1323 | Ga0450907_007846 | |||
| 1324 | Ga0450909_016653 | |||
| 1325 | Ga0439434_0009734 | |||
| 1326 | Ga0450918_012085 | |||
| 1327 | Ga0466970_0005750 | |||
| 1328 | Ga0495629_0039434 | |||
| 1329 | Ga0495638_0002245 | |||
| 1330 | Ga0495638_0032082 | |||
| 1331 | Ga0495638_0081074 | |||
| 1332 | Ga0495651_0056767 | |||
| 1333 | Ga0495650_0098029 | |||
| 1334 | Ga0495662_0008770 | |||
| 1335 | Ga0495585_0062116 | |||
| 1336 | Ga0495585_0089691 | |||
| 1337 | Ga0495607_0051193 | |||
| 1338 | Ga0495607_0079425 | |||
| 1339 | Ga0495607_0097619 | |||
| 1340 | Ga0495583_0006132 | |||
| 1341 | Ga0495606_0005438 | |||
| 1342 | Ga0495606_0027058 | |||
| 1343 | Ga0495610_0003921 | |||
| 1344 | Ga0495610_0124406 | |||
| 1345 | Ga0495610_0174513 | |||
| 1346 | Ga0495616_0014904 | |||
| 1347 | Ga0495616_0099911 | |||
| 1348 | Ga0495616_0105253 | |||
| 1349 | Ga0495620_0035007 | |||
| 1350 | Ga0495620_0064260 | |||
| 1351 | Ga0495631_0001536 | |||
| 1352 | Ga0495632_0002903 | |||
| 1353 | Ga0495632_0011408 | |||
| 1354 | Ga0495632_0094918 | |||
| 1355 | Ga0495643_0015771 | |||
| 1356 | Ga0495643_0028426 | |||
| 1357 | Ga0495643_0049203 | |||
| 1358 | Ga0495643_0124401 | |||
| 1359 | Ga0495648_0076026 | |||
| 1360 | Ga0495654_0000401 | |||
| 1361 | Ga0495654_0021069 | |||
| 1362 | Ga0495640_0042763 | |||
| 1363 | Ga0495609_0016177 | |||
| 1364 | Ga0495597_0023913 | |||
| 1365 | Ga0495622_0015658 | |||
| 1366 | Ga0495611_0005032 | |||
| 1367 | Ga0495625_0003752 | |||
| 1368 | Ga0495625_0060586 | |||
| 1369 | Ga0495661_0075275 | |||
| 1370 | Ga0495588_0004270 | |||
| 1371 | Ga0495657_0031373 | |||
| 1372 | Ga0495658_0035776 | |||
| 1373 | Ga0495670_0017514 | |||
| 1374 | Ga0495671_0061466 | |||
| 1375 | Ga0495649_0034661 | |||
| 1376 | Ga0495600_0053585 | |||
| 1377 | Ga0495660_0088553 | |||
| 1378 | Ga0495636_0058652 | |||
| 1379 | Ga0495676_0202724 | |||
| 1380 | Ga0495687_031132 | |||
| 1381 | Ga0495687_034233 | |||
| 1382 | Ga0495673_0125702 | |||
| 1383 | Ga0495681_0011425 | |||
| 1384 | Ga0495681_0054588 | |||
| 1385 | Ga0495686_0006222 | |||
| 1386 | Ga0495686_0019963 | |||
| 1387 | Ga0495686_0025145 | |||
| 1388 | Ga0495686_0259158 | |||
| 1389 | Ga0495626_0041805 | |||
| 1390 | Ga0495626_0085445 | |||
| 1391 | Ga0496102_0021717 | |||
| 1392 | Ga0496104_0040272 | |||
| 1393 | Ga0496106_0000326 | |||
| 1394 | Ga0496106_0153230 | |||
| 1395 | Ga0496111_0001131 | |||
| 1396 | Ga0496114_0088108 | |||
| 1397 | Ga0496116_0013575 | |||
| 1398 | Ga0496116_0025407 | |||
| 1399 | Ga0496116_0053121 | |||
| 1400 | Ga0496116_0100069 | |||
| 1401 | Ga0496116_0132087 | |||
| 1402 | Ga0496116_0161513 | |||
| 1403 | Ga0496117_0000052 | |||
| 1404 | Ga0496117_0000814 | |||
| 1405 | Ga0496117_0005480 | |||
| 1406 | Ga0496117_0017733 | |||
| 1407 | Ga0496117_0139948 | |||
| 1408 | Ga0496117_0174737 | |||
| 1409 | Ga0496117_0208383 | |||
| 1410 | Ga0496118_0001701 | |||
| 1411 | Ga0496118_0002033 | |||
| 1412 | Ga0496118_0044052 | |||
| 1413 | Ga0496119_0007227 | |||
| 1414 | Ga0496119_0008625 | |||
| 1415 | Ga0496119_0026534 | |||
| 1416 | Ga0496119_0074156 | |||
| 1417 | Ga0496120_0000019 | |||
| 1418 | Ga0496120_0043823 | |||
| 1419 | Ga0496121_0000003 | |||
| 1420 | Ga0496121_0001407 | |||
| 1421 | Ga0496121_0001871 | |||
| 1422 | Ga0496121_0009541 | |||
| 1423 | Ga0496121_0017896 | |||
| 1424 | Ga0496121_0018198 | |||
| 1425 | Ga0496121_0037911 | |||
| 1426 | Ga0496121_0048898 | |||
| 1427 | Ga0496121_0111031 | |||
| 1428 | Ga0496121_0115924 | |||
| 1429 | Ga0496121_0201253 | |||
| 1430 | Ga0496122_0000024 | |||
| 1431 | Ga0496122_0000053 | |||
| 1432 | Ga0496122_0000107 | |||
| 1433 | Ga0496122_0008439 | |||
| 1434 | Ga0496122_0008929 | |||
| 1435 | Ga0496122_0015748 | |||
| 1436 | Ga0496122_0067215 | |||
| 1437 | Ga0496122_0089305 | |||
| 1438 | Ga0496122_0093950 | |||
| 1439 | Ga0496122_0135156 | |||
| 1440 | Ga0496122_0316296 | |||
| 1441 | Ga0496123_0000038 | |||
| 1442 | Ga0496123_0000063 | |||
| 1443 | Ga0496123_0000086 | |||
| 1444 | Ga0496123_0009011 | |||
| 1445 | Ga0496123_0011406 | |||
| 1446 | Ga0496123_0032582 | |||
| 1447 | Ga0496123_0063904 | |||
| 1448 | Ga0496123_0065804 | |||
| 1449 | Ga0496123_0074475 | |||
| 1450 | Ga0496124_0000413 | |||
| 1451 | Ga0496124_0002161 | |||
| 1452 | Ga0496124_0002342 | |||
| 1453 | Ga0496124_0102667 | |||
| 1454 | Ga0496124_0107757 | |||
| 1455 | Ga0496124_0121992 | |||
| 1456 | Ga0496124_0139774 | |||
| 1457 | Ga0496124_0258564 | |||
| 1458 | Ga0496124_0262981 | |||
| 1459 | Ga0496124_0263578 | |||
| 1460 | Ga0496124_0280210 | |||
| 1461 | Ga0496124_0360467 | |||
| 1462 | Ga0496125_0000345 | |||
| 1463 | Ga0496125_0000651 | |||
| 1464 | Ga0496125_0006752 | |||
| 1465 | Ga0496125_0013018 | |||
| 1466 | Ga0496125_0033327 | |||
| 1467 | Ga0496125_0290283 | |||
| 1468 | Ga0496126_0002468 | |||
| 1469 | Ga0496126_0021729 | |||
| 1470 | Ga0496126_0082360 | |||
| 1471 | Ga0496126_0128089 | |||
| 1472 | Ga0496126_0131579 | |||
| 1473 | Ga0496126_0138432 | |||
| 1474 | Ga0496126_0194513 | |||
| 1475 | Ga0495678_021016 | |||
| 1476 | Ga0495678_041453 | |||
| 1477 | Ga0501031_0019801 | |||
| 1478 | Ga0501032_0126854 | |||
| 1479 | Ga0501033_0004143 | |||
| 1480 | Ga0501034_0052265 | |||
| 1481 | Ga0501034_0224955 | |||
| 1482 | Ga0501034_0242704 | |||
| 1483 | Ga0501037_0076208 | |||
| 1484 | Ga0501038_0025453 | |||
| 1485 | Ga0501038_0170638 | |||
| 1486 | Ga0501039_0059846 | |||
| 1487 | Ga0501039_0115254 | |||
| 1488 | Ga0501080_0513309 | |||
| 1489 | Ga0501083_0190490 | |||
| 1490 | Ga0501280_004492 | |||
| 1491 | Ga0501035_0000707 | |||
| 1492 | Ga0501044_0034844 | |||
| 1493 | nmdc:mga03683_11702_c1 | |||
| 1494 | nmdc:mga03683_54147_c1 | |||
| 1495 | nmdc:mga00v17_11_c1 | |||
| 1496 | nmdc:mga00v17_130168_c1 | |||
| 1497 | nmdc:mga00v17_244730_c1 | |||
| 1498 | nmdc:mga00v17_609_c1 | |||
| 1499 | nmdc:mga0yw44_1642_c1 | |||
| 1500 | nmdc:mga0yw44_41859_c1 | |||
| 1501 | nmdc:mga0yw44_65_c1 | |||
| 1502 | nmdc:mga0k408_126577_c1 | |||
| 1503 | nmdc:mga0k408_7034_c1 | |||
| 1504 | nmdc:mga06z11_17309_c1 | |||
| 1505 | nmdc:mga06z11_7904_c2 | |||
| 1506 | nmdc:mga04h51_1588_c1 | |||
| 1507 | nmdc:mga07m45_14585_c1 | |||
| 1508 | nmdc:mga07m45_80704_c1 | |||
| 1509 | nmdc:mga0sz30_1144_c1 | |||
| 1510 | nmdc:mga0sz30_13690_c1 | |||
| 1511 | nmdc:mga0sz30_6648_c1 | |||
| 1512 | Ga0500644_0003536 | |||
| 1513 | Ga0500560_097676 | |||
| 1514 | Ga0500618_000891 | |||
| 1515 | Ga0500618_001118 | |||
| 1516 | Ga0500655_002005 | |||
| 1517 | Ga0500658_0000868 | |||
| 1518 | Ga0500559_0015626 | |||
| 1519 | Ga0500561_0000931 | |||
| 1520 | Ga0500568_0003075 | |||
| 1521 | Ga0500568_0079018 | |||
| 1522 | Ga0500573_0002542 | |||
| 1523 | Ga0500573_0072051 | |||
| 1524 | Ga0500590_000352 | |||
| 1525 | Ga0500604_0051822 | |||
| 1526 | Ga0500616_0002052 | |||
| 1527 | Ga0500616_0006118 | |||
| 1528 | Ga0500616_0039225 | |||
| 1529 | Ga0500622_0000918 | |||
| 1530 | Ga0500622_0001540 | |||
| 1531 | Ga0500622_0152819 | |||
| 1532 | Ga0500624_000692 | |||
| 1533 | Ga0500624_004903 | |||
| 1534 | Ga0500627_0097611 | |||
| 1535 | Ga0587073_0036208 | |||
| 1536 | Ga0501082_0029595 | |||
| 1537 | 2509109811 | |||
| 1538 | 2509379037 | |||
| 1539 | 2509386455 | |||
| 1540 | 2509389868 | |||
| 1541 | 2509447881 | |||
| 1542 | 2510134815 | |||
| 1543 | 2510303674 | |||
| 1544 | 2510839401 | |||
| 1545 | 2510896223 | |||
| 1546 | 2511136581 | |||
| 1547 | 2511185116 | |||
| 1548 | 2511198429 | |||
| 1549 | 2511502969 | |||
| 1550 | 2512534232 | |||
| 1551 | 2512973946 | |||
| 1552 | 2513572580 | |||
| 1553 | 2513580191 | |||
| 1554 | 2513585296 | |||
| 1555 | 2513597148 | |||
| 1556 | 2513602336 | |||
| 1557 | 2513617140 | |||
| 1558 | 2513631345 | |||
| 1559 | 2513710736 | |||
| 1560 | 2513868129 | |||
| 1561 | 2513882881 | |||
| 1562 | 2513902909 | |||
| 1563 | 2513908216 | |||
| 1564 | 2513926917 | |||
| 1565 | 2513985881 | |||
| 1566 | 2513998069 | |||
| 1567 | 2514003979 | |||
| 1568 | 2514022362 | |||
| 1569 | 2515113900 | |||
| 1570 | 2515610358 | |||
| 1571 | 2515638777 | |||
| 1572 | 2515643081 | |||
| 1573 | 2515656804 | |||
| 1574 | 2515743746 | |||
| 1575 | 2516205214 | |||
| 1576 | 2516894374 | |||
| 1577 | 2517037531 | |||
| 1578 | 2517077816 | |||
| 1579 | 2517096615 | |||
| 1580 | 2517410330 | |||
| 1581 | 2517570991 | |||
| 1582 | 2520377911 | |||
| 1583 | 2524451853 | |||
| 1584 | 2524460089 | |||
| 1585 | 2530646927 | |||
| 1586 | 2535519469 | |||
| 1587 | 2537873064 | |||
| 1588 | 2551679842 | |||
| 1589 | 2551685967 | |||
| 1590 | 2551694544 | |||
| 1591 | 2551698062 | |||
| 1592 | 2551710427 | |||
| 1593 | 2551711865 | |||
| 1594 | 2551715702 | |||
| 1595 | 2551726332 | |||
| 1596 | 2551733515 | |||
| 1597 | 2551740284 | |||
| 1598 | 2551746374 | |||
| 1599 | 2554245090 | |||
| 1600 | 2558860385 | |||
| 1601 | 2559297079 | |||
| 1602 | 2561468164 | |||
| 1603 | 2585168013 | |||
| 1604 | 2585202497 | |||
| 1605 | 2585224809 | |||
| 1606 | 2585227795 | |||
| 1607 | 2585257795 | |||
| 1608 | 2585265388 | |||
| 1609 | 2585274263 | |||
| 1610 | 2585280323 | |||
| 1611 | 2585322601 | |||
| 1612 | 2585330714 | |||
| 1613 | 2585388531 | |||
| 1614 | 2585392406 | |||
| 1615 | 2585402193 | |||
| 1616 | 2585529106 | |||
| 1617 | 2585532553 | |||
| 1618 | 2585541045 | |||
| 1619 | 2585547365 | |||
| 1620 | 2585554431 | |||
| 1621 | 2585560712 | |||
| 1622 | 2585822507 | |||
| 1623 | 2585839807 | |||
| 1624 | 2585845327 | |||
| 1625 | 2585898915 | |||
| 1626 | 2585903490 | |||
| 1627 | 2585997116 | |||
| 1628 | 2586001717 | |||
| 1629 | 2587981391 | |||
| 1630 | 2599334761 | |||
| 1631 | 2599420589 | |||
| 1632 | 2599604956 | |||
| 1633 | 2599723929 | |||
| 1634 | 2600194061 | |||
| 1635 | 2600373676 | |||
| 1636 | 2601611080 | |||
| 1637 | 2601747853 | |||
| 1638 | 2616295529 | |||
| 1639 | 2616307376 | |||
| 1640 | 2616554919 | |||
| 1641 | 2617383368 | |||
| 1642 | 2643809798 | |||
| 1643 | 2643916758 | |||
| 1644 | 2644006380 | |||
| 1645 | 2644051100 | |||
| 1646 | 2644063979 | |||
| 1647 | 2644108509 | |||
| 1648 | 2644145555 | |||
| 1649 | 2644195857 | |||
| 1650 | 2644205580 | |||
| 1651 | 2644209893 | |||
| 1652 | 2644241835 | |||
| 1653 | 2644299224 | |||
| 1654 | 2644312368 | |||
| 1655 | 2644335996 | |||
| 1656 | 2644381500 | |||
| 1657 | 2644415812 | |||
| 1658 | 2644448852 | |||
| 1659 | 2644484004 | |||
| 1660 | 2644496351 | |||
| 1661 | 2644500216 | |||
| 1662 | 2644521322 | |||
| 1663 | 2644546853 | |||
| 1664 | 2644618051 | |||
| 1665 | 2644653444 | |||
| 1666 | 2644657452 | |||
| 1667 | 2644676772 | |||
| 1668 | 2644686754 | |||
| 1669 | 2657684007 | |||
| 1670 | 2671112169 | |||
| 1671 | 2692314523 | |||
| 1672 | 2719182571 | |||
| 1673 | 2719387246 | |||
| 1674 | 2719666883 | |||
| 1675 | 2719733290 | |||
| 1676 | 2720493303 | |||
| 1677 | 2720614777 | |||
| 1678 | 2720621550 | |||
| 1679 | 2720632878 | |||
| 1680 | 2720776602 | |||
| 1681 | 2721148684 | |||
| 1682 | 2721160070 | |||
| 1683 | 2721165498 | |||
| 1684 | 2721400881 | |||
| 1685 | 2722841668 | |||
| 1686 | 2723028190 | |||
| 1687 | 2723561821 | |||
| 1688 | 2723568450 | |||
| 1689 | 2724039694 | |||
| 1690 | 2724046046 | |||
| 1691 | 2724091209 | |||
| 1692 | 2724105715 | |||
| 1693 | 2724111544 | |||
| 1694 | 2725945495 | |||
| 1695 | 2730109126 | |||
| 1696 | 2730165806 | |||
| 1697 | 2730299702 | |||
| 1698 | 2738800467 | |||
| 1699 | 2738944481 | |||
| 1700 | 2739035599 | |||
| 1701 | 2753458639 | |||
| 1702 | 2766065348 | |||
| 1703 | 2776914534 | |||
| 1704 | 2778175984 | |||
| 1705 | 2792582572 | |||
| 1706 | 2792622975 | |||
| 1707 | 2792629230 | |||
| 1708 | 2792640423 | |||
| 1709 | 2793293676 | |||
| 1710 | 2793313100 | |||
| 1711 | 2793319747 | |||
| 1712 | 2793327747 | |||
| 1713 | 2793333338 | |||
| 1714 | 2793342116 | |||
| 1715 | 2793347345 | |||
| 1716 | 2793353668 | |||
| 1717 | 2793359743 | |||
| 1718 | 2793369480 | |||
| 1719 | 2802717920 | |||
| 1720 | 2802725229 | |||
| 1721 | 2802730647 | |||
| 1722 | 2802737994 | |||
| 1723 | 2802744136 | |||
| 1724 | 2802753179 | |||
| 1725 | 2804753301 | |||
| 1726 | 2805930524 | |||
| 1727 | 2805934296 | |||
| 1728 | 2806044587 | |||
| 1729 | 2806052787 | |||
| 1730 | 2806059087 | |||
| 1731 | 2806068250 | |||
| 1732 | 2806074370 | |||
| 1733 | 2808988960 | |||
| 1734 | 2819243795 | |||
| 1735 | 2819609624 | |||
| 1736 | 2819639722 | |||
| 1737 | 2819686377 | |||
| 1738 | 2821126129 | |||
| 1739 | 2838019079 | |||
| 1740 | 2838024325 | |||
| 1741 | 2838033107 | |||
| 1742 | 2838040737 | |||
| 1743 | 2838046275 | |||
| 1744 | 2838051203 | |||
| 1745 | 2838063821 | |||
| 1746 | 2838073304 | |||
| 1747 | 2838664875 | |||
| 1748 | 2838671172 | |||
| 1749 | 2838678426 | |||
| 1750 | 2838684987 | |||
| 1751 | 2838691350 | |||
| 1752 | 2838699176 | |||
| 1753 | 2838703648 | |||
| 1754 | 2838712657 | |||
| 1755 | 2838716666 | |||
| 1756 | 2838722722 | |||
| 1757 | 2838727417 | |||
| 1758 | 2838733309 | |||
| 1759 | 2838737396 | |||
| 1760 | 2838746119 | |||
| 1761 | 2841842235 | |||
| 1762 | 2841849035 | |||
| 1763 | 2841853831 | |||
| 1764 | 2841861945 | |||
| 1765 | 2841868197 | |||
| 1766 | 2842082134 | |||
| 1767 | 2842113464 | |||
| 1768 | 2842123056 | |||
| 1769 | 2842128216 | |||
| 1770 | 2842133319 | |||
| 1771 | 2842142014 | |||
| 1772 | 2842149350 | |||
| 1773 | 2842155312 | |||
| 1774 | 2842162162 | |||
| 1775 | 2842169920 | |||
| 1776 | 2842173812 | |||
| 1777 | 2842178933 | |||
| 1778 | 2842185088 | |||
| 1779 | 2842189774 | |||
| 1780 | 2842198288 | |||
| 1781 | 2842199868 | |||
| 1782 | 2842208276 | |||
| 1783 | 2842214088 | |||
| 1784 | 2842220107 | |||
| 1785 | 2842226808 | |||
| 1786 | 2842233526 | |||
| 1787 | 2842242041 | |||
| 1788 | 2842247619 | |||
| 1789 | 2842254012 | |||
| 1790 | 2842262113 | |||
| 1791 | 2842266584 | |||
| 1792 | 2842275824 | |||
| 1793 | 2842281715 | |||
| 1794 | 2842288825 | |||
| 1795 | 2842296134 | |||
| 1796 | 2842298686 | |||
| 1797 | 2842308192 | |||
| 1798 | 2842315571 | |||
| 1799 | 2842321424 | |||
| 1800 | 2842344976 | |||
| 1801 | 2842359447 | |||
| 1802 | 2842370024 | |||
| 1803 | 2842375665 | |||
| 1804 | 2842382533 | |||
| 1805 | 2842389934 | |||
| 1806 | 2842398544 | |||
| 1807 | 2842406508 | |||
| 1808 | 2842413065 | |||
| 1809 | 2842419708 | |||
| 1810 | 2842426939 | |||
| 1811 | 2842429903 | |||
| 1812 | 2842436437 | |||
| 1813 | 2842444140 | |||
| 1814 | 2842451002 | |||
| 1815 | 2842464324 | |||
| 1816 | 2842470766 | |||
| 1817 | 2842479840 | |||
| 1818 | 2842483414 | |||
| 1819 | 2842493242 | |||
| 1820 | 2842499190 | |||
| 1821 | 2842507016 | |||
| 1822 | 2842510709 | |||
| 1823 | 2842517789 | |||
| 1824 | 2842523174 | |||
| 1825 | 2842925888 | |||
| 1826 | 2844169221 | |||
| 1827 | 2844457524 | |||
| 1828 | 2848995232 | |||
| 1829 | 2852391173 | |||
| 1830 | 2854900265 | |||
| 1831 | 2854919136 | |||
| 1832 | 2855842405 | |||
| 1833 | 2855878447 | |||
| 1834 | 2857518931 | |||
| 1835 | 2857532690 | |||
| 1836 | 2858803221 | |||
| 1837 | 2891377538 | |||
| 1838 | 2896386423 | |||
| 1839 | 2899794728 | |||
| 1840 | 2899806450 | |||
| 1841 | 2899845319 | |||
| 1842 | 2913299819 | |||
| 1843 | 2913309100 | |||
| 1844 | 2915991016 | |||
| 1845 | 2915996674 | |||
| 1846 | 2916005084 | |||
| 1847 | 2916013418 | |||
| 1848 | 2916016940 | |||
| 1849 | 2916028197 | |||
| 1850 | 2916029288 | |||
| 1851 | 2916038336 | |||
| 1852 | 2916044918 | |||
| 1853 | 2916049272 | |||
| 1854 | 2916058225 | |||
| 1855 | 2916066261 | |||
| 1856 | 2916083120 | |||
| 1857 | 2919104537 | |||
| 1858 | 2919116883 | |||
| 1859 | 2919173367 | |||
| 1860 | 2919410655 | |||
| 1861 | 2920760801 | |||
| 1862 | 2920828514 | |||
| 1863 | 2921203282 | |||
| 1864 | 2921213308 | |||
| 1865 | 2921242309 | |||
| 1866 | 2921244196 | |||
| 1867 | 2921252476 | |||
| 1868 | 2921260113 | |||
| 1869 | 2921266108 | |||
| 1870 | 2921287789 | |||
| 1871 | 2921289560 | |||
| 1872 | 2921299884 | |||
| 1873 | 2923562877 | |||
| 1874 | 2924148841 | |||
| 1875 | 2924152116 | |||
| 1876 | 2924164052 | |||
| 1877 | 2924168690 | |||
| 1878 | 2924175338 | |||
| 1879 | 2924183840 | |||
| 1880 | 2924189959 | |||
| 1881 | 2924193752 | |||
| 1882 | 2924206721 | |||
| 1883 | 2924213153 | |||
| 1884 | 2924220647 | |||
| 1885 | 2924221788 | |||
| 1886 | 2924232421 | |||
| 1887 | 2926758396 | |||
| 1888 | 2926764046 | |||
| 1889 | 2929141358 | |||
| 1890 | 2933009309 | |||
| 1891 | 2933013418 | |||
| 1892 | 2933020534 | |||
| 1893 | 2933574641 | |||
| 1894 | 2933589246 | |||
| 1895 | 2933598244 | |||
| 1896 | 2933603566 | |||
| 1897 | 2935899762 | |||
| 1898 | 2935907585 | |||
| 1899 | 2936374899 | |||
| 1900 | 2936380590 | |||
| 1901 | 2936382239 | |||
| 1902 | 2937000029 | |||
| 1903 | 2937007011 | |||
| 1904 | 2937015480 | |||
| 1905 | 2937018200 | |||
| 1906 | 2937026729 | |||
| 1907 | 2937033022 | |||
| 1908 | 2937042196 | |||
| 1909 | 2937047836 | |||
| 1910 | 2937052367 | |||
| 1911 | 2937062214 | |||
| 1912 | 2937067611 | |||
| 1913 | 2937071425 | |||
| 1914 | 2937078603 | |||
| 1915 | 2937087280 | |||
| 1916 | 2937093419 | |||
| 1917 | 2937102289 | |||
| 1918 | 2937111387 | |||
| 1919 | 2937114852 | |||
| 1920 | 2937123674 | |||
| 1921 | 2937129348 | |||
| 1922 | 2941501722 | |||
| 1923 | 2957376958 | |||
| 1924 | 2957386109 | |||
| 1925 | 2957392088 | |||
| 1926 | 2957406290 | |||
| 1927 | 2957409043 | |||
| 1928 | 2957416350 | |||
| 1929 | 2957426792 | |||
| 1930 | 2957436806 | |||
| 1931 | 2957437361 | |||
| 1932 | 2957449528 | |||
| 1933 | 2957452804 | |||
| 1934 | 2957459079 | |||
| 1935 | 2957468171 | |||
| 1936 | 2957472257 | |||
| 1937 | 2957481126 | |||
| 1938 | 2957487585 | |||
| 1939 | 2957495297 | |||
| 1940 | 2957498676 | |||
| 1941 | 2957508678 | |||
| 1942 | 2960585339 | |||
| 1943 | 2960591251 | |||
| 1944 | 2960598802 | |||
| 1945 | 2960605019 | |||
| 1946 | 2960617226 | |||
| 1947 | 2960622832 | |||
| 1948 | 2960628120 | |||
| 1949 | 2960632502 | |||
| 1950 | 2960638994 | |||
| 1951 | 2960650131 | |||
| 1952 | 2960656748 | |||
| 1953 | 2960665295 | |||
| 1954 | 2960671522 | |||
| 1955 | 2960677398 | |||
| 1956 | 2960681333 | |||
| 1957 | 2960692369 | |||
| 1958 | 2960696438 | |||
| 1959 | 2964612985 | |||
| 1960 | 2964620427 | |||
| 1961 | 2964622427 | |||
| 1962 | 2964629985 | |||
| 1963 | 2964637601 | |||
| 1964 | 2964647267 | |||
| 1965 | 2964652291 | |||
| 1966 | 2964657774 | |||
| 1967 | 2964668883 | |||
| 1968 | 2964673827 | |||
| 1969 | 2964681817 | |||
| 1970 | 2964687005 | |||
| 1971 | 2964697678 | |||
| 1972 | 2964702984 | |||
| 1973 | 2964712445 | |||
| 1974 | 2964717465 | |||
| 1975 | 2964720080 | |||
| 1976 | 2967670849 | |||
| 1977 | 2967674424 | |||
| 1978 | 2967685929 | |||
| 1979 | 2967686481 | |||
| 1980 | 2967696185 | |||
| 1981 | 2967705640 | |||
| 1982 | 2967710080 | |||
| 1983 | 2967720053 | |||
| 1984 | 2967724867 | |||
| 1985 | 2967732514 | |||
| 1986 | 2967735361 | |||
| 1987 | 2967746848 | |||
| 1988 | 2967752416 | |||
| 1989 | 2967758864 | |||
| 1990 | 2967769246 | |||
| 1991 | 2967774613 | |||
| 1992 | 2967776383 | |||
| 1993 | 2970022204 | |||
| 1994 | 2970028277 | |||
| 1995 | 2970040576 | |||
| 1996 | 2970043475 | |||
| 1997 | 2970050567 | |||
| 1998 | 2970058449 | |||
| 1999 | 2970067041 | |||
| 2000 | 2970075741 | |||
| 2001 | 2970079142 | |||
| 2002 | 2970083450 | |||
| 2003 | 2970090060 | |||
| 2004 | 2970100379 | |||
| 2005 | 2970108890 | |||
| 2006 | 2970112719 | |||
| 2007 | 2970121322 | |||
| 2008 | 2970126491 | |||
| 2009 | 2970134360 | |||
| 2010 | 2970141286 | |||
| 2011 | 2970146606 | |||
| 2012 | 2970152742 | |||
| 2013 | 2970157911 | |||
| 2014 | 2970166749 | |||
| 2015 | 2970173408 | |||
| 2016 | 2970179167 | |||
| 2017 | 2970187730 | |||
| 2018 | 2970195089 | |||
| 2019 | 2977522546 | |||
| 2020 | 2977528721 | |||
| 2021 | 2977532503 | |||
| 2022 | 2977541030 | |||
| 2023 | 2977551057 | |||
| 2024 | 2977556910 | |||
| 2025 | 2977561154 | |||
| 2026 | 2977567188 | |||
| 2027 | 2977576092 | |||
| 2028 | 2977579773 | |||
| 2029 | 2979090856 | |||
| 2030 | 2979096381 | |||
| 2031 | 2989354671 | |||
| 2032 | 2989780326 | |||
| 2033 | 2996889173 | |||
| 2034 | 2996896347 | |||
| 2035 | 3003934904 | |||
| 2036 | 3005415519 | |||
| 2037 | 3005418510 | |||
| 2038 | 3005449249 | |||
| 2039 | 3005455529 | |||
| 2040 | 639649970 | |||
| 2041 | 643827065 | |||
| 2042 | 648735866 | |||
| 2043 | 650843508 | |||
| 2044 | 8003573180 | |||
| 2045 | 8003994946 | |||
| 2046 | 8004002705 | |||
| 2047 | 8005249587 | |||
| 2048 | 8005264249 | |||
| 2049 | 8005281977 | |||
| 2050 | 8005288960 | |||
| 2051 | 8005294299 | |||
| 2052 | 8005306704 | |||
| 2053 | 8005309356 | |||
| 2054 | 8005318598 | |||
| 2055 | 8005323700 | |||
| 2056 | 8005382818 | |||
| 2057 | 8005383870 | |||
| 2058 | 8005401195 | |||
| 2059 | 8005434148 | |||
| 2060 | 8005464587 | |||
| 2061 | 8005488517 | |||
| 2062 | 8005501635 | |||
| 2063 | 8005547160 | |||
| 2064 | 8005558411 | |||
| 2065 | 8005566745 | |||
| 2066 | 8005574973 | |||
| 2067 | 8005622991 | |||
| 2068 | 8005631706 | |||
| 2069 | 8005648984 | |||
| 2070 | 8005662472 | |||
| 2071 | 8005673057 | |||
| 2072 | 8005682224 | |||
| 2073 | 8005693600 | |||
| 2074 | 8005700832 | |||
| 2075 | 8018133643 | |||
| 2076 | 8018170189 | |||
| 2077 | 8018178489 | |||
| 2078 | 8023687579 | |||
| 2079 | 8024481752 | |||
| 2080 | 8024489327 | |||
| 2081 | 8024505975 | |||
| 2082 | 8046773246 | |||
| 2083 | 8049295914 | |||
| 2084 | 8054560549 | |||
| 2085 | 8055432052 | |||
| 2086 | 8056381554 | |||
| 2087 | 8056386987 | |||
| 2088 | 8056876141 | |||
| 2089 | 8057581019 | |||
| 2090 | 8057876795 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8929 | 11 | 284 |
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8927 | 11 | 284 |
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8739 | 11 | 284 |
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8718 | 11 | 284 |
| 3a9l-assembly1.cif.gz_B | structure of bacteriophage poly-gamma-glutamate hydrolase | 0.6009 | 10 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.881 | 11 | 284 | 3.40.630.40 |
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.8622 | 11 | 284 | 3.40.630.40 |
| 4hz2B01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7662 | 189 | 221 | 3.40.30.10 |
| af_Q4D776_60_147_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.6172 | 182 | 221 | 3.40.30.10 |
| 3a9lB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Poly-gamma-glutamate hydrolase, zinc-binding motif | 0.6009 | 10 | 277 | 3.40.630.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M9P8M4-F1-model_v4 | N-formylglutamate amidohydrolase | 0.9753 | 10 | 72 |
GO:0016787
|
| AF-A0A2G1ZS25-F1-model_v4 | N-formylglutamate amidohydrolase | 0.9622 | 10 | 74 |
GO:0016787
|
| AF-A0A530MR67-F1-model_v4 | deleted | 0.9525 | 123 | 278 |
|
| AF-A0A4P1JT73-F1-model_v4 | N-formylglutamate deformylase | 0.9515 | 187 | 280 |
|
| AF-A0A526PZ33-F1-model_v4 | N-formylglutamate amidohydrolase | 0.9512 | 124 | 255 |
GO:0016787
|