F488947
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1045 | 326 | 2090 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300049677|Ga0501247_013341|Ga0501247_013341_386_877 |
| Length | 163 |
| Sequence | VKEIQASGFQIIFLAVNAAGFNVFTMEAQIDEILKKNQLSVTGSRKRILELFLMSNGALAHGDIEKKTGEKFDRVTVYRTLQTFLEKGIIHTIPTSDNSVLYALCKDDCSEGHHHDNHVHFICHKCNKTICLADVHIPEVKLPGGFLPHDYQMVVTGLCKECR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 105 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 211 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 216 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 217 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 220 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 221 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 224 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 225 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 228 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 229 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 230 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 231 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 234 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 266 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 281 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 282 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 283 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 284 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 285 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 286 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 288 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 289 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 290 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 291 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 292 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 305 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 306 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 307 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 309 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 310 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 311 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 312 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 315 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 316 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 317 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 318 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 319 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 321 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 322 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 323 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 324 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 325 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 326 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0.38 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.5 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 91.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501247_013341 | 3300049677 | Bacteria | 1009 |
| 2 | ARcpr5yngRDRAFT_c003023 | 3300000043 | Unclassified | 1691 |
| 3 | JGI24743J22301_10105365 | 3300001991 | Bacteria | 610 |
| 4 | JGI24738J21930_10017758 | 3300002075 | Bacteria | 1494 |
| 5 | JGI24744J21845_10011998 | 3300002077 | Bacteria | 1764 |
| 6 | JGI25406J46586_10005934 | 3300003203 | Bacteria | 5651 |
| 7 | rootH1_10034736 | 3300003316 | Bacteria | 4729 |
| 8 | rootH1_10129298 | 3300003316 | Bacteria | 2419 |
| 9 | rootH2_10011035 | 3300003320 | Bacteria | 21460 |
| 10 | rootH2_10019611 | 3300003320 | Bacteria | 4011 |
| 11 | rootH2_10061393 | 3300003320 | Bacteria | 15275 |
| 12 | rootH2_10080418 | 3300003320 | Bacteria | 1224 |
| 13 | rootL2_10016148 | 3300003322 | Bacteria | 1313 |
| 14 | rootL2_10016149 | 3300003322 | Bacteria | 3394 |
| 15 | rootL2_10070142 | 3300003322 | Viruses | 1873 |
| 16 | rootH1_10026407 | 3300003323 | Bacteria | 31111 |
| 17 | rootH1_10039810 | 3300003323 | Bacteria | 1972 |
| 18 | rootH1_10164376 | 3300003323 | Bacteria | 3523 |
| 19 | Ga0065165_1146059 | 3300005262 | Bacteria | 555 |
| 20 | Ga0065704_10393489 | 3300005289 | Unclassified | 736 |
| 21 | Ga0065712_10008487 | 3300005290 | Bacteria | 2945 |
| 22 | Ga0065712_10033528 | 3300005290 | Bacteria | 1450 |
| 23 | Ga0065712_10041081 | 3300005290 | Bacteria | 982 |
| 24 | Ga0065712_10044321 | 3300005290 | Unclassified | 893 |
| 25 | Ga0065712_10107087 | 3300005290 | Bacteria | 1903 |
| 26 | Ga0065712_10787117 | 3300005290 | Unclassified | 516 |
| 27 | Ga0065715_10140141 | 3300005293 | Bacteria | 1866 |
| 28 | Ga0065715_10813972 | 3300005293 | Unclassified | 605 |
| 29 | Ga0065715_10850861 | 3300005293 | Bacteria | 591 |
| 30 | Ga0065715_10959137 | 3300005293 | Unclassified | 557 |
| 31 | Ga0065707_10014537 | 3300005295 | Bacteria | 1739 |
| 32 | Ga0070658_11008456 | 3300005327 | Unclassified | 724 |
| 33 | Ga0070658_11252203 | 3300005327 | Bacteria | 645 |
| 34 | Ga0070658_11516361 | 3300005327 | Bacteria | 581 |
| 35 | Ga0070676_10035857 | 3300005328 | Bacteria | 2855 |
| 36 | Ga0070676_10099574 | 3300005328 | Bacteria | 1793 |
| 37 | Ga0070683_100001414 | 3300005329 | Bacteria | 18428 |
| 38 | Ga0070683_100028320 | 3300005329 | Bacteria | 5062 |
| 39 | Ga0070683_100454138 | 3300005329 | Bacteria | 1223 |
| 40 | Ga0070690_100020891 | 3300005330 | Bacteria | 3993 |
| 41 | Ga0070690_100101866 | 3300005330 | Bacteria | 1905 |
| 42 | Ga0070690_100676327 | 3300005330 | Bacteria | 791 |
| 43 | Ga0070670_100100191 | 3300005331 | Bacteria | 2494 |
| 44 | Ga0070670_100250848 | 3300005331 | Bacteria | 1542 |
| 45 | Ga0070670_100315799 | 3300005331 | Bacteria | 1368 |
| 46 | Ga0070670_100448839 | 3300005331 | Bacteria | 1143 |
| 47 | Ga0070670_100813368 | 3300005331 | Unclassified | 844 |
| 48 | Ga0070670_100921072 | 3300005331 | Bacteria | 793 |
| 49 | Ga0070677_10063338 | 3300005333 | Bacteria | 1533 |
| 50 | Ga0070677_10097925 | 3300005333 | Bacteria | 1288 |
| 51 | Ga0068869_100008418 | 3300005334 | Bacteria | 6650 |
| 52 | Ga0068869_100044478 | 3300005334 | Bacteria | 3193 |
| 53 | Ga0068869_100068716 | 3300005334 | Bacteria | 2618 |
| 54 | Ga0068869_100083636 | 3300005334 | Bacteria | 2387 |
| 55 | Ga0068869_100106834 | 3300005334 | Bacteria | 2124 |
| 56 | Ga0068869_100112157 | 3300005334 | Bacteria | 2075 |
| 57 | Ga0068869_100219527 | 3300005334 | Bacteria | 1506 |
| 58 | Ga0068869_101853342 | 3300005334 | Unclassified | 540 |
| 59 | Ga0070666_10000019 | 3300005335 | Bacteria | 185877 |
| 60 | Ga0070666_10038889 | 3300005335 | Bacteria | 3167 |
| 61 | Ga0070666_10042186 | 3300005335 | Bacteria | 3052 |
| 62 | Ga0070666_10079785 | 3300005335 | Bacteria | 2235 |
| 63 | Ga0070666_10100180 | 3300005335 | Bacteria | 1996 |
| 64 | Ga0070682_100019174 | 3300005337 | Bacteria | 4009 |
| 65 | Ga0068868_100005373 | 3300005338 | Bacteria | 9000 |
| 66 | Ga0068868_100029834 | 3300005338 | Bacteria | 4178 |
| 67 | Ga0068868_100034352 | 3300005338 | Bacteria | 3914 |
| 68 | Ga0068868_100068221 | 3300005338 | Bacteria | 2832 |
| 69 | Ga0068868_100125546 | 3300005338 | Bacteria | 2096 |
| 70 | Ga0068868_100552722 | 3300005338 | Bacteria | 1015 |
| 71 | Ga0068868_100666711 | 3300005338 | Unclassified | 928 |
| 72 | Ga0070660_100009104 | 3300005339 | Bacteria | 6968 |
| 73 | Ga0070660_100578255 | 3300005339 | Unclassified | 938 |
| 74 | Ga0070689_100008953 | 3300005340 | Bacteria | 7082 |
| 75 | Ga0070689_100053041 | 3300005340 | Bacteria | 3137 |
| 76 | Ga0070689_100070706 | 3300005340 | Bacteria | 2725 |
| 77 | Ga0070689_100107571 | 3300005340 | Bacteria | 2214 |
| 78 | Ga0070689_100195742 | 3300005340 | Unclassified | 1648 |
| 79 | Ga0070689_100238872 | 3300005340 | Bacteria | 1496 |
| 80 | Ga0070689_101163518 | 3300005340 | Unclassified | 691 |
| 81 | Ga0070691_10014732 | 3300005341 | Bacteria | 3590 |
| 82 | Ga0070691_10101471 | 3300005341 | Bacteria | 1430 |
| 83 | Ga0070687_100045080 | 3300005343 | Unclassified | 2249 |
| 84 | Ga0070687_100063170 | 3300005343 | Bacteria | 1963 |
| 85 | Ga0070661_100030970 | 3300005344 | Bacteria | 3867 |
| 86 | Ga0070661_100757651 | 3300005344 | Unclassified | 794 |
| 87 | Ga0070661_101161606 | 3300005344 | Bacteria | 645 |
| 88 | Ga0070668_100005214 | 3300005347 | Bacteria | 9640 |
| 89 | Ga0070668_100092743 | 3300005347 | Bacteria | 2382 |
| 90 | Ga0070668_100149216 | 3300005347 | Bacteria | 1889 |
| 91 | Ga0070668_100241687 | 3300005347 | Bacteria | 1496 |
| 92 | Ga0070668_101325906 | 3300005347 | Bacteria | 655 |
| 93 | Ga0070668_102202751 | 3300005347 | Bacteria | 509 |
| 94 | Ga0070669_100034447 | 3300005353 | Bacteria | 3666 |
| 95 | Ga0070669_100034784 | 3300005353 | Bacteria | 3647 |
| 96 | Ga0070669_100144455 | 3300005353 | Bacteria | 1837 |
| 97 | Ga0070669_100253976 | 3300005353 | Bacteria | 1401 |
| 98 | Ga0070669_100583417 | 3300005353 | Unclassified | 935 |
| 99 | Ga0070669_100702301 | 3300005353 | Bacteria | 854 |
| 100 | Ga0070669_100742872 | 3300005353 | Bacteria | 831 |
| 101 | Ga0070669_101504183 | 3300005353 | Unclassified | 585 |
| 102 | Ga0070675_100034864 | 3300005354 | Bacteria | 4086 |
| 103 | Ga0070675_100080305 | 3300005354 | Unclassified | 2718 |
| 104 | Ga0070675_100099346 | 3300005354 | Bacteria | 2449 |
| 105 | Ga0070675_100125848 | 3300005354 | Bacteria | 2180 |
| 106 | Ga0070671_100010972 | 3300005355 | Bacteria | 7271 |
| 107 | Ga0070671_100045546 | 3300005355 | Unclassified | 3647 |
| 108 | Ga0070671_100113496 | 3300005355 | Bacteria | 2277 |
| 109 | Ga0070671_100133278 | 3300005355 | Bacteria | 2093 |
| 110 | Ga0070671_100690817 | 3300005355 | Bacteria | 885 |
| 111 | Ga0070674_100010025 | 3300005356 | Bacteria | 5705 |
| 112 | Ga0070674_100040946 | 3300005356 | Bacteria | 3136 |
| 113 | Ga0070674_100084253 | 3300005356 | Bacteria | 2279 |
| 114 | Ga0070674_100130467 | 3300005356 | Bacteria | 1873 |
| 115 | Ga0070674_100282104 | 3300005356 | Bacteria | 1317 |
| 116 | Ga0070674_100792031 | 3300005356 | Unclassified | 818 |
| 117 | Ga0070674_100924580 | 3300005356 | Bacteria | 761 |
| 118 | Ga0070674_101588788 | 3300005356 | Unclassified | 589 |
| 119 | Ga0070674_101631439 | 3300005356 | Bacteria | 582 |
| 120 | Ga0070674_101906006 | 3300005356 | Bacteria | 540 |
| 121 | Ga0070674_101908860 | 3300005356 | Bacteria | 540 |
| 122 | Ga0070673_100016058 | 3300005364 | Bacteria | 5282 |
| 123 | Ga0070673_100042190 | 3300005364 | Bacteria | 3515 |
| 124 | Ga0070673_100108488 | 3300005364 | Bacteria | 2299 |
| 125 | Ga0070673_100132623 | 3300005364 | Bacteria | 2092 |
| 126 | Ga0070673_100138278 | 3300005364 | Bacteria | 2053 |
| 127 | Ga0070673_100208721 | 3300005364 | Bacteria | 1686 |
| 128 | Ga0070673_100259143 | 3300005364 | Bacteria | 1519 |
| 129 | Ga0070673_100772777 | 3300005364 | Bacteria | 886 |
| 130 | Ga0070673_100899284 | 3300005364 | Bacteria | 821 |
| 131 | Ga0070673_101110532 | 3300005364 | Bacteria | 739 |
| 132 | Ga0070688_100027466 | 3300005365 | Bacteria | 3391 |
| 133 | Ga0070688_100042702 | 3300005365 | Bacteria | 2790 |
| 134 | Ga0070688_100379211 | 3300005365 | Bacteria | 1042 |
| 135 | Ga0070688_100562201 | 3300005365 | Bacteria | 869 |
| 136 | Ga0070659_100010175 | 3300005366 | Bacteria | 6921 |
| 137 | Ga0070659_100078867 | 3300005366 | Bacteria | 2628 |
| 138 | Ga0070659_100784610 | 3300005366 | Unclassified | 828 |
| 139 | Ga0070667_100012137 | 3300005367 | Bacteria | 7131 |
| 140 | Ga0070667_100042945 | 3300005367 | Bacteria | 3793 |
| 141 | Ga0070667_100099243 | 3300005367 | Bacteria | 2513 |
| 142 | Ga0070667_100150387 | 3300005367 | Bacteria | 2045 |
| 143 | Ga0070667_100442042 | 3300005367 | Bacteria | 1187 |
| 144 | Ga0070667_100768392 | 3300005367 | Bacteria | 894 |
| 145 | Ga0070667_100830356 | 3300005367 | Bacteria | 859 |
| 146 | Ga0070667_101355428 | 3300005367 | Bacteria | 667 |
| 147 | Ga0070701_11022206 | 3300005438 | Unclassified | 578 |
| 148 | Ga0070711_101280964 | 3300005439 | Bacteria | 636 |
| 149 | Ga0070705_100853083 | 3300005440 | Bacteria | 729 |
| 150 | Ga0070700_100177715 | 3300005441 | Bacteria | 1479 |
| 151 | Ga0070700_100518803 | 3300005441 | Bacteria | 920 |
| 152 | Ga0070700_100970436 | 3300005441 | Bacteria | 697 |
| 153 | Ga0070663_100459708 | 3300005455 | Bacteria | 1051 |
| 154 | Ga0070663_100540213 | 3300005455 | Bacteria | 973 |
| 155 | Ga0070678_100019852 | 3300005456 | Bacteria | 4394 |
| 156 | Ga0070678_100141488 | 3300005456 | Bacteria | 1926 |
| 157 | Ga0070678_100248819 | 3300005456 | Bacteria | 1490 |
| 158 | Ga0070678_100310139 | 3300005456 | Bacteria | 1344 |
| 159 | Ga0070678_100643798 | 3300005456 | Unclassified | 950 |
| 160 | Ga0070662_100005642 | 3300005457 | Bacteria | 8003 |
| 161 | Ga0070662_100169574 | 3300005457 | Bacteria | 1713 |
| 162 | Ga0070662_100216588 | 3300005457 | Bacteria | 1526 |
| 163 | Ga0070662_100478508 | 3300005457 | Bacteria | 1036 |
| 164 | Ga0070662_100959065 | 3300005457 | Unclassified | 731 |
| 165 | Ga0070681_10025121 | 3300005458 | Bacteria | 5995 |
| 166 | Ga0070681_10124742 | 3300005458 | Bacteria | 2508 |
| 167 | Ga0068867_100001050 | 3300005459 | Bacteria | 18843 |
| 168 | Ga0068867_100105693 | 3300005459 | Bacteria | 2156 |
| 169 | Ga0068867_100113200 | 3300005459 | Bacteria | 2087 |
| 170 | Ga0068867_100269897 | 3300005459 | Unclassified | 1390 |
| 171 | Ga0068867_100864704 | 3300005459 | Bacteria | 811 |
| 172 | Ga0070685_10028657 | 3300005466 | Bacteria | 3087 |
| 173 | Ga0070685_10047461 | 3300005466 | Bacteria | 2469 |
| 174 | Ga0070685_10085642 | 3300005466 | Bacteria | 1898 |
| 175 | Ga0070685_10145125 | 3300005466 | Bacteria | 1498 |
| 176 | Ga0070685_10545789 | 3300005466 | Unclassified | 827 |
| 177 | Ga0070698_100011129 | 3300005471 | Bacteria | 9556 |
| 178 | Ga0070698_100011210 | 3300005471 | Bacteria | 9525 |
| 179 | Ga0070698_100018892 | 3300005471 | Bacteria | 7251 |
| 180 | Ga0070698_100044930 | 3300005471 | Bacteria | 4522 |
| 181 | Ga0070699_100963158 | 3300005518 | Bacteria | 782 |
| 182 | Ga0070679_100494997 | 3300005530 | Bacteria | 1166 |
| 183 | Ga0070684_100000823 | 3300005535 | Bacteria | 21717 |
| 184 | Ga0070684_100011717 | 3300005535 | Bacteria | 6993 |
| 185 | Ga0068853_100003746 | 3300005539 | Bacteria | 11662 |
| 186 | Ga0068853_100026213 | 3300005539 | Bacteria | 4894 |
| 187 | Ga0068853_100029532 | 3300005539 | Bacteria | 4623 |
| 188 | Ga0068853_100041104 | 3300005539 | Bacteria | 3948 |
| 189 | Ga0068853_100130912 | 3300005539 | Bacteria | 2246 |
| 190 | Ga0068853_100349042 | 3300005539 | Bacteria | 1376 |
| 191 | Ga0068853_100456475 | 3300005539 | Bacteria | 1202 |
| 192 | Ga0068853_100831326 | 3300005539 | Bacteria | 885 |
| 193 | Ga0070672_100015713 | 3300005543 | Bacteria | 5404 |
| 194 | Ga0070672_100053966 | 3300005543 | Bacteria | 3144 |
| 195 | Ga0070672_100253969 | 3300005543 | Unclassified | 1481 |
| 196 | Ga0070672_100538813 | 3300005543 | Unclassified | 1012 |
| 197 | Ga0070672_100540795 | 3300005543 | Bacteria | 1011 |
| 198 | Ga0070672_100746174 | 3300005543 | Bacteria | 859 |
| 199 | Ga0070672_100748575 | 3300005543 | Bacteria | 857 |
| 200 | Ga0070686_100001004 | 3300005544 | Bacteria | 16245 |
| 201 | Ga0070686_100102284 | 3300005544 | Bacteria | 1938 |
| 202 | Ga0070686_100149456 | 3300005544 | Bacteria | 1634 |
| 203 | Ga0070696_100100746 | 3300005546 | Bacteria | 2070 |
| 204 | Ga0070693_100157385 | 3300005547 | Bacteria | 1444 |
| 205 | Ga0070665_100000047 | 3300005548 | Bacteria | 269702 |
| 206 | Ga0070665_100250877 | 3300005548 | Bacteria | 1770 |
| 207 | Ga0070665_100360504 | 3300005548 | Bacteria | 1460 |
| 208 | Ga0070665_101366527 | 3300005548 | Bacteria | 718 |
| 209 | Ga0070704_100156663 | 3300005549 | Bacteria | 1797 |
| 210 | Ga0070704_100212070 | 3300005549 | Unclassified | 1570 |
| 211 | Ga0068855_100001426 | 3300005563 | Bacteria | 29706 |
| 212 | Ga0068855_100040750 | 3300005563 | Bacteria | 5510 |
| 213 | Ga0068855_100047716 | 3300005563 | Bacteria | 5059 |
| 214 | Ga0068855_100050618 | 3300005563 | Bacteria | 4894 |
| 215 | Ga0068855_100063390 | 3300005563 | Bacteria | 4313 |
| 216 | Ga0068855_100103619 | 3300005563 | Bacteria | 3273 |
| 217 | Ga0068855_101735984 | 3300005563 | Bacteria | 636 |
| 218 | Ga0070664_100011372 | 3300005564 | Bacteria | 7219 |
| 219 | Ga0070664_100014161 | 3300005564 | Bacteria | 6505 |
| 220 | Ga0070664_100019836 | 3300005564 | Bacteria | 5534 |
| 221 | Ga0070664_100238002 | 3300005564 | Bacteria | 1633 |
| 222 | Ga0070664_100300218 | 3300005564 | Bacteria | 1451 |
| 223 | Ga0070664_100975884 | 3300005564 | Bacteria | 796 |
| 224 | Ga0070664_101876142 | 3300005564 | Bacteria | 569 |
| 225 | Ga0068857_100020535 | 3300005577 | Bacteria | 5810 |
| 226 | Ga0068857_100044436 | 3300005577 | Bacteria | 3941 |
| 227 | Ga0068857_100079559 | 3300005577 | Bacteria | 2926 |
| 228 | Ga0068857_100190954 | 3300005577 | Bacteria | 1865 |
| 229 | Ga0068857_100197941 | 3300005577 | Bacteria | 1831 |
| 230 | Ga0068857_100206749 | 3300005577 | Bacteria | 1790 |
| 231 | Ga0068857_100375236 | 3300005577 | Bacteria | 1320 |
| 232 | Ga0068857_100410407 | 3300005577 | Bacteria | 1261 |
| 233 | Ga0068857_100595899 | 3300005577 | Bacteria | 1044 |
| 234 | Ga0068857_100720326 | 3300005577 | Unclassified | 949 |
| 235 | Ga0068857_102126915 | 3300005577 | Bacteria | 551 |
| 236 | Ga0068854_100049602 | 3300005578 | Bacteria | 2999 |
| 237 | Ga0068854_100060547 | 3300005578 | Bacteria | 2740 |
| 238 | Ga0068854_100179281 | 3300005578 | Bacteria | 1654 |
| 239 | Ga0068854_100401792 | 3300005578 | Bacteria | 1134 |
| 240 | Ga0068854_100749551 | 3300005578 | Unclassified | 847 |
| 241 | Ga0068856_100023585 | 3300005614 | Bacteria | 5983 |
| 242 | Ga0068856_100046135 | 3300005614 | Bacteria | 4292 |
| 243 | Ga0068856_101086230 | 3300005614 | Bacteria | 818 |
| 244 | Ga0068856_102652955 | 3300005614 | Unclassified | 507 |
| 245 | Ga0070702_100014930 | 3300005615 | Bacteria | 3953 |
| 246 | Ga0070702_100263346 | 3300005615 | Bacteria | 1175 |
| 247 | Ga0068852_100008777 | 3300005616 | Bacteria | 7477 |
| 248 | Ga0068852_100088967 | 3300005616 | Bacteria | 2759 |
| 249 | Ga0068852_100162780 | 3300005616 | Bacteria | 2085 |
| 250 | Ga0068852_100173670 | 3300005616 | Bacteria | 2022 |
| 251 | Ga0068852_100406215 | 3300005616 | Bacteria | 1341 |
| 252 | Ga0068852_100438068 | 3300005616 | Bacteria | 1292 |
| 253 | Ga0068852_100624444 | 3300005616 | Bacteria | 1083 |
| 254 | Ga0068852_101199068 | 3300005616 | Bacteria | 780 |
| 255 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 256 | Ga0068859_100023510 | 3300005617 | Bacteria | 6184 |
| 257 | Ga0068859_100037391 | 3300005617 | Bacteria | 4872 |
| 258 | Ga0068859_100059896 | 3300005617 | Bacteria | 3836 |
| 259 | Ga0068859_100115699 | 3300005617 | Bacteria | 2746 |
| 260 | Ga0068859_100154190 | 3300005617 | Bacteria | 2374 |
| 261 | Ga0068859_100215928 | 3300005617 | Bacteria | 2005 |
| 262 | Ga0068859_100270926 | 3300005617 | Bacteria | 1790 |
| 263 | Ga0068859_100286553 | 3300005617 | Bacteria | 1740 |
| 264 | Ga0068859_100317433 | 3300005617 | Bacteria | 1652 |
| 265 | Ga0068859_100414816 | 3300005617 | Unclassified | 1443 |
| 266 | Ga0068859_100664728 | 3300005617 | Bacteria | 1133 |
| 267 | Ga0068859_100708088 | 3300005617 | Bacteria | 1097 |
| 268 | Ga0068859_100774966 | 3300005617 | Bacteria | 1047 |
| 269 | Ga0068859_101438133 | 3300005617 | Bacteria | 761 |
| 270 | Ga0068864_100005159 | 3300005618 | Bacteria | 10700 |
| 271 | Ga0068864_100009571 | 3300005618 | Bacteria | 7990 |
| 272 | Ga0068864_100118052 | 3300005618 | Bacteria | 2368 |
| 273 | Ga0068864_100890220 | 3300005618 | Bacteria | 879 |
| 274 | Ga0068864_101036798 | 3300005618 | Bacteria | 814 |
| 275 | Ga0068866_10002239 | 3300005718 | Bacteria | 8020 |
| 276 | Ga0068866_10029152 | 3300005718 | Unclassified | 2637 |
| 277 | Ga0068861_100003393 | 3300005719 | Bacteria | 10570 |
| 278 | Ga0068861_100004879 | 3300005719 | Bacteria | 9029 |
| 279 | Ga0068861_100386104 | 3300005719 | Bacteria | 1238 |
| 280 | Ga0068861_100555578 | 3300005719 | Bacteria | 1047 |
| 281 | Ga0068861_101941897 | 3300005719 | Bacteria | 586 |
| 282 | Ga0068851_10008282 | 3300005834 | Bacteria | 4802 |
| 283 | Ga0068851_10037416 | 3300005834 | Bacteria | 2432 |
| 284 | Ga0068851_10170550 | 3300005834 | Bacteria | 1201 |
| 285 | Ga0068851_10229280 | 3300005834 | Bacteria | 1046 |
| 286 | Ga0068851_10337367 | 3300005834 | Bacteria | 874 |
| 287 | Ga0068870_10042542 | 3300005840 | Bacteria | 2366 |
| 288 | Ga0068870_10272224 | 3300005840 | Bacteria | 1058 |
| 289 | Ga0068863_100001058 | 3300005841 | Bacteria | 27510 |
| 290 | Ga0068863_100016960 | 3300005841 | Bacteria | 6985 |
| 291 | Ga0068863_100086089 | 3300005841 | Bacteria | 2977 |
| 292 | Ga0068863_100640728 | 3300005841 | Bacteria | 1053 |
| 293 | Ga0068858_100008721 | 3300005842 | Bacteria | 9735 |
| 294 | Ga0068858_100184416 | 3300005842 | Bacteria | 1971 |
| 295 | Ga0068858_100185624 | 3300005842 | Bacteria | 1964 |
| 296 | Ga0068858_100222577 | 3300005842 | Bacteria | 1787 |
| 297 | Ga0068858_100225118 | 3300005842 | Bacteria | 1777 |
| 298 | Ga0068858_100625037 | 3300005842 | Bacteria | 1046 |
| 299 | Ga0068858_101153919 | 3300005842 | Unclassified | 761 |
| 300 | Ga0068860_100007046 | 3300005843 | Bacteria | 11253 |
| 301 | Ga0068860_100010672 | 3300005843 | Bacteria | 9072 |
| 302 | Ga0068860_100031416 | 3300005843 | Bacteria | 5104 |
| 303 | Ga0068860_100054255 | 3300005843 | Bacteria | 3810 |
| 304 | Ga0068860_100108260 | 3300005843 | Bacteria | 2656 |
| 305 | Ga0068860_100394158 | 3300005843 | Bacteria | 1369 |
| 306 | Ga0068860_100403432 | 3300005843 | Bacteria | 1353 |
| 307 | Ga0068860_100476426 | 3300005843 | Bacteria | 1244 |
| 308 | Ga0068860_100568048 | 3300005843 | Bacteria | 1137 |
| 309 | Ga0068862_100020317 | 3300005844 | Bacteria | 5547 |
| 310 | Ga0068862_100051872 | 3300005844 | Bacteria | 3509 |
| 311 | Ga0068862_100227169 | 3300005844 | Bacteria | 1692 |
| 312 | Ga0068862_100272610 | 3300005844 | Bacteria | 1548 |
| 313 | Ga0081540_1002465 | 3300005983 | Bacteria | 15078 |
| 314 | Ga0081539_10000622 | 3300005985 | Bacteria | 71778 |
| 315 | Ga0070715_10116530 | 3300006163 | Bacteria | 1267 |
| 316 | Ga0075366_10004245 | 3300006195 | Bacteria | 7682 |
| 317 | Ga0075366_10029867 | 3300006195 | Bacteria | 3203 |
| 318 | Ga0075366_10167008 | 3300006195 | Bacteria | 1335 |
| 319 | Ga0075366_10190988 | 3300006195 | Bacteria | 1245 |
| 320 | Ga0097621_100027576 | 3300006237 | Bacteria | 4468 |
| 321 | Ga0097621_100138420 | 3300006237 | Bacteria | 2078 |
| 322 | Ga0097621_100273291 | 3300006237 | Bacteria | 1485 |
| 323 | Ga0097621_100520658 | 3300006237 | Unclassified | 1079 |
| 324 | Ga0097621_100720769 | 3300006237 | Bacteria | 919 |
| 325 | Ga0097621_101179396 | 3300006237 | Bacteria | 721 |
| 326 | Ga0097621_102099047 | 3300006237 | Unclassified | 540 |
| 327 | Ga0068871_100003860 | 3300006358 | Bacteria | 10333 |
| 328 | Ga0068871_100131843 | 3300006358 | Bacteria | 2120 |
| 329 | Ga0068871_100194192 | 3300006358 | Bacteria | 1750 |
| 330 | Ga0068871_100201149 | 3300006358 | Bacteria | 1720 |
| 331 | Ga0068871_100234064 | 3300006358 | Bacteria | 1595 |
| 332 | Ga0068871_100340384 | 3300006358 | Bacteria | 1324 |
| 333 | Ga0068871_100391876 | 3300006358 | Bacteria | 1235 |
| 334 | Ga0068871_100513554 | 3300006358 | Bacteria | 1081 |
| 335 | Ga0068871_100848649 | 3300006358 | Unclassified | 844 |
| 336 | Ga0068871_101301985 | 3300006358 | Unclassified | 683 |
| 337 | Ga0075428_100004493 | 3300006844 | Bacteria | 15403 |
| 338 | Ga0075428_100006287 | 3300006844 | Bacteria | 13203 |
| 339 | Ga0075428_100184136 | 3300006844 | Bacteria | 2260 |
| 340 | Ga0075430_100001704 | 3300006846 | Bacteria | 17938 |
| 341 | Ga0075430_100079490 | 3300006846 | Bacteria | 2748 |
| 342 | Ga0075431_100001979 | 3300006847 | Bacteria | 19547 |
| 343 | Ga0075431_100004445 | 3300006847 | Bacteria | 13748 |
| 344 | Ga0075431_100304740 | 3300006847 | Bacteria | 1609 |
| 345 | Ga0075431_101766056 | 3300006847 | Bacteria | 575 |
| 346 | Ga0075429_100009495 | 3300006880 | Bacteria | 8441 |
| 347 | Ga0075429_100027574 | 3300006880 | Bacteria | 4930 |
| 348 | Ga0075429_100667119 | 3300006880 | Unclassified | 911 |
| 349 | Ga0068865_100005349 | 3300006881 | Bacteria | 7775 |
| 350 | Ga0068865_100064557 | 3300006881 | Unclassified | 2577 |
| 351 | Ga0068865_100066850 | 3300006881 | Bacteria | 2537 |
| 352 | Ga0068865_100095451 | 3300006881 | Bacteria | 2166 |
| 353 | Ga0068865_100115404 | 3300006881 | Bacteria | 1987 |
| 354 | Ga0068865_100393970 | 3300006881 | Bacteria | 1133 |
| 355 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 356 | Ga0097620_100023509 | 3300006931 | Bacteria | 6184 |
| 357 | Ga0097620_100037391 | 3300006931 | Bacteria | 4872 |
| 358 | Ga0097620_100059898 | 3300006931 | Bacteria | 3836 |
| 359 | Ga0097620_100115690 | 3300006931 | Bacteria | 2746 |
| 360 | Ga0097620_100154169 | 3300006931 | Bacteria | 2374 |
| 361 | Ga0097620_100215933 | 3300006931 | Bacteria | 2005 |
| 362 | Ga0097620_100270951 | 3300006931 | Bacteria | 1790 |
| 363 | Ga0097620_100286547 | 3300006931 | Bacteria | 1740 |
| 364 | Ga0097620_100317453 | 3300006931 | Bacteria | 1652 |
| 365 | Ga0097620_100414818 | 3300006931 | Unclassified | 1443 |
| 366 | Ga0097620_100664680 | 3300006931 | Bacteria | 1133 |
| 367 | Ga0097620_100708124 | 3300006931 | Bacteria | 1097 |
| 368 | Ga0097620_100774972 | 3300006931 | Bacteria | 1047 |
| 369 | Ga0097620_101438027 | 3300006931 | Bacteria | 761 |
| 370 | Ga0105240_10000445 | 3300009093 | Bacteria | 76036 |
| 371 | Ga0105240_10000597 | 3300009093 | Bacteria | 67036 |
| 372 | Ga0105240_10001169 | 3300009093 | Bacteria | 46003 |
| 373 | Ga0105240_10004801 | 3300009093 | Bacteria | 20370 |
| 374 | Ga0105240_10048480 | 3300009093 | Bacteria | 5368 |
| 375 | Ga0105240_10096013 | 3300009093 | Bacteria | 3613 |
| 376 | Ga0105240_10428914 | 3300009093 | Bacteria | 1484 |
| 377 | Ga0105240_10463039 | 3300009093 | Bacteria | 1416 |
| 378 | Ga0105240_10851145 | 3300009093 | Bacteria | 984 |
| 379 | Ga0105240_10927471 | 3300009093 | Bacteria | 935 |
| 380 | Ga0111539_10029563 | 3300009094 | Bacteria | 6671 |
| 381 | Ga0111539_10220895 | 3300009094 | Bacteria | 2207 |
| 382 | Ga0111539_10311084 | 3300009094 | Bacteria | 1833 |
| 383 | Ga0111539_10364302 | 3300009094 | Unclassified | 1682 |
| 384 | Ga0111539_11299339 | 3300009094 | Unclassified | 844 |
| 385 | Ga0111539_11719637 | 3300009094 | Bacteria | 727 |
| 386 | Ga0105245_10204984 | 3300009098 | Bacteria | 1895 |
| 387 | Ga0105245_11620913 | 3300009098 | Bacteria | 699 |
| 388 | Ga0105247_10000408 | 3300009101 | Bacteria | 36396 |
| 389 | Ga0105247_10006290 | 3300009101 | Bacteria | 7361 |
| 390 | Ga0105247_10233189 | 3300009101 | Bacteria | 1251 |
| 391 | Ga0114129_10017155 | 3300009147 | Bacteria | 10311 |
| 392 | Ga0114129_10025999 | 3300009147 | Bacteria | 8289 |
| 393 | Ga0114129_10107082 | 3300009147 | Bacteria | 3862 |
| 394 | Ga0114129_10209240 | 3300009147 | Bacteria | 2638 |
| 395 | Ga0105243_11311175 | 3300009148 | Bacteria | 741 |
| 396 | Ga0105241_10000607 | 3300009174 | Bacteria | 27006 |
| 397 | Ga0105241_10000920 | 3300009174 | Bacteria | 22283 |
| 398 | Ga0105241_10023912 | 3300009174 | Bacteria | 4535 |
| 399 | Ga0105241_10103018 | 3300009174 | Bacteria | 2272 |
| 400 | Ga0105241_10203219 | 3300009174 | Bacteria | 1656 |
| 401 | Ga0105241_10266422 | 3300009174 | Bacteria | 1458 |
| 402 | Ga0105241_10335890 | 3300009174 | Bacteria | 1307 |
| 403 | Ga0105241_10346384 | 3300009174 | Bacteria | 1289 |
| 404 | Ga0105241_10548891 | 3300009174 | Bacteria | 1037 |
| 405 | Ga0105241_10844738 | 3300009174 | Bacteria | 846 |
| 406 | Ga0105242_10034221 | 3300009176 | Bacteria | 4073 |
| 407 | Ga0105242_10036616 | 3300009176 | Bacteria | 3938 |
| 408 | Ga0105242_10082962 | 3300009176 | Bacteria | 2683 |
| 409 | Ga0105242_10097396 | 3300009176 | Bacteria | 2487 |
| 410 | Ga0105242_10131153 | 3300009176 | Bacteria | 2164 |
| 411 | Ga0105248_10661174 | 3300009177 | Bacteria | 1179 |
| 412 | Ga0105237_10000294 | 3300009545 | Bacteria | 69126 |
| 413 | Ga0105237_10000379 | 3300009545 | Bacteria | 63367 |
| 414 | Ga0105237_10005546 | 3300009545 | Bacteria | 14228 |
| 415 | Ga0105237_10015830 | 3300009545 | Bacteria | 7844 |
| 416 | Ga0105237_10018568 | 3300009545 | Bacteria | 7194 |
| 417 | Ga0105237_10019707 | 3300009545 | Bacteria | 6964 |
| 418 | Ga0105237_10171652 | 3300009545 | Bacteria | 2169 |
| 419 | Ga0105237_11481182 | 3300009545 | Bacteria | 685 |
| 420 | Ga0105237_11896579 | 3300009545 | Bacteria | 604 |
| 421 | Ga0105238_10051017 | 3300009551 | Bacteria | 4162 |
| 422 | Ga0105238_10102156 | 3300009551 | Bacteria | 2849 |
| 423 | Ga0105238_10191824 | 3300009551 | Bacteria | 2019 |
| 424 | Ga0105249_10000911 | 3300009553 | Bacteria | 26124 |
| 425 | Ga0105249_10014002 | 3300009553 | Bacteria | 7089 |
| 426 | Ga0105249_10059437 | 3300009553 | Bacteria | 3506 |
| 427 | Ga0105249_10094951 | 3300009553 | Bacteria | 2795 |
| 428 | Ga0105249_10102443 | 3300009553 | Bacteria | 2694 |
| 429 | Ga0105249_10105642 | 3300009553 | Bacteria | 2655 |
| 430 | Ga0105249_10399727 | 3300009553 | Bacteria | 1404 |
| 431 | Ga0105249_10448126 | 3300009553 | Bacteria | 1329 |
| 432 | Ga0105249_10464415 | 3300009553 | Unclassified | 1306 |
| 433 | Ga0105249_10559526 | 3300009553 | Bacteria | 1195 |
| 434 | Ga0105249_11392722 | 3300009553 | Unclassified | 773 |
| 435 | Ga0105239_10000628 | 3300010375 | Bacteria | 50293 |
| 436 | Ga0105239_10001099 | 3300010375 | Bacteria | 37369 |
| 437 | Ga0105239_10002389 | 3300010375 | Bacteria | 23937 |
| 438 | Ga0105239_10005474 | 3300010375 | Bacteria | 14893 |
| 439 | Ga0105239_10031608 | 3300010375 | Bacteria | 5819 |
| 440 | Ga0105239_10183305 | 3300010375 | Unclassified | 2343 |
| 441 | Ga0105239_10205317 | 3300010375 | Bacteria | 2208 |
| 442 | Ga0105239_10206398 | 3300010375 | Bacteria | 2202 |
| 443 | Ga0105239_10451242 | 3300010375 | Bacteria | 1459 |
| 444 | Ga0105239_10459382 | 3300010375 | Bacteria | 1445 |
| 445 | Ga0105239_11419349 | 3300010375 | Bacteria | 802 |
| 446 | Ga0105246_10006786 | 3300011119 | Bacteria | 7000 |
| 447 | Ga0105246_10025841 | 3300011119 | Bacteria | 3829 |
| 448 | Ga0105246_10030904 | 3300011119 | Bacteria | 3541 |
| 449 | Ga0105246_10202600 | 3300011119 | Unclassified | 1544 |
| 450 | Ga0105246_10227029 | 3300011119 | Bacteria | 1468 |
| 451 | Ga0157325_1013106 | 3300012485 | Bacteria | 648 |
| 452 | Ga0157339_1032814 | 3300012505 | Bacteria | 616 |
| 453 | Ga0157373_10013242 | 3300013100 | Bacteria | 6056 |
| 454 | Ga0157373_10196141 | 3300013100 | Bacteria | 1423 |
| 455 | Ga0157373_10258420 | 3300013100 | Bacteria | 1232 |
| 456 | Ga0157373_10261860 | 3300013100 | Bacteria | 1224 |
| 457 | Ga0157371_10024279 | 3300013102 | Bacteria | 4429 |
| 458 | Ga0157371_10063383 | 3300013102 | Bacteria | 2620 |
| 459 | Ga0157371_10261485 | 3300013102 | Bacteria | 1248 |
| 460 | Ga0157370_10004027 | 3300013104 | Bacteria | 17072 |
| 461 | Ga0157370_10008237 | 3300013104 | Bacteria | 11255 |
| 462 | Ga0157370_10014566 | 3300013104 | Bacteria | 8035 |
| 463 | Ga0157370_10378380 | 3300013104 | Bacteria | 1304 |
| 464 | Ga0157369_10004023 | 3300013105 | Bacteria | 17427 |
| 465 | Ga0157369_10039153 | 3300013105 | Bacteria | 5182 |
| 466 | Ga0157369_10089290 | 3300013105 | Bacteria | 3290 |
| 467 | Ga0157369_10133662 | 3300013105 | Bacteria | 2627 |
| 468 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 469 | Ga0157374_10011739 | 3300013296 | Bacteria | 7599 |
| 470 | Ga0157374_10020540 | 3300013296 | Bacteria | 5862 |
| 471 | Ga0157374_10248196 | 3300013296 | Bacteria | 1751 |
| 472 | Ga0157374_10421973 | 3300013296 | Bacteria | 1333 |
| 473 | Ga0157378_10001243 | 3300013297 | Bacteria | 23019 |
| 474 | Ga0157378_10003796 | 3300013297 | Bacteria | 13379 |
| 475 | Ga0157378_10017269 | 3300013297 | Bacteria | 6329 |
| 476 | Ga0157378_10023553 | 3300013297 | Bacteria | 5416 |
| 477 | Ga0157378_10026251 | 3300013297 | Bacteria | 5135 |
| 478 | Ga0157378_10247973 | 3300013297 | Bacteria | 1704 |
| 479 | Ga0157378_10261598 | 3300013297 | Bacteria | 1660 |
| 480 | Ga0157378_10264251 | 3300013297 | Bacteria | 1652 |
| 481 | Ga0157378_10303547 | 3300013297 | Bacteria | 1546 |
| 482 | Ga0157378_10450110 | 3300013297 | Bacteria | 1278 |
| 483 | Ga0157378_10569826 | 3300013297 | Bacteria | 1140 |
| 484 | Ga0157378_10626895 | 3300013297 | Bacteria | 1089 |
| 485 | Ga0157378_10933149 | 3300013297 | Bacteria | 900 |
| 486 | Ga0157378_11458145 | 3300013297 | Unclassified | 728 |
| 487 | Ga0163162_10000722 | 3300013306 | Bacteria | 30672 |
| 488 | Ga0163162_10055403 | 3300013306 | Bacteria | 3992 |
| 489 | Ga0163162_10184626 | 3300013306 | Bacteria | 2212 |
| 490 | Ga0163162_10710167 | 3300013306 | Unclassified | 1127 |
| 491 | Ga0163162_11525313 | 3300013306 | Unclassified | 761 |
| 492 | Ga0163162_11559007 | 3300013306 | Bacteria | 753 |
| 493 | Ga0157372_10001266 | 3300013307 | Bacteria | 27333 |
| 494 | Ga0157372_10002206 | 3300013307 | Bacteria | 21137 |
| 495 | Ga0157372_10025127 | 3300013307 | Bacteria | 6473 |
| 496 | Ga0157372_10027244 | 3300013307 | Bacteria | 6221 |
| 497 | Ga0157372_10042294 | 3300013307 | Bacteria | 5039 |
| 498 | Ga0157372_10191750 | 3300013307 | Bacteria | 2367 |
| 499 | Ga0157372_10465238 | 3300013307 | Bacteria | 1474 |
| 500 | Ga0157372_10542150 | 3300013307 | Bacteria | 1356 |
| 501 | Ga0157372_10603801 | 3300013307 | Unclassified | 1279 |
| 502 | Ga0157372_10855055 | 3300013307 | Bacteria | 1056 |
| 503 | Ga0157372_10913371 | 3300013307 | Bacteria | 1018 |
| 504 | Ga0157372_11413211 | 3300013307 | Bacteria | 802 |
| 505 | Ga0157372_11869793 | 3300013307 | Bacteria | 690 |
| 506 | Ga0157372_12415098 | 3300013307 | Unclassified | 604 |
| 507 | Ga0157375_10015089 | 3300013308 | Bacteria | 6911 |
| 508 | Ga0157375_10126515 | 3300013308 | Bacteria | 2670 |
| 509 | Ga0157375_10159417 | 3300013308 | Bacteria | 2397 |
| 510 | Ga0157375_10189293 | 3300013308 | Bacteria | 2212 |
| 511 | Ga0157375_10265845 | 3300013308 | Bacteria | 1877 |
| 512 | Ga0157375_10288357 | 3300013308 | Bacteria | 1804 |
| 513 | Ga0157375_10371194 | 3300013308 | Bacteria | 1597 |
| 514 | Ga0157375_10744611 | 3300013308 | Bacteria | 1132 |
| 515 | Ga0157375_10874750 | 3300013308 | Bacteria | 1044 |
| 516 | Ga0157375_10930105 | 3300013308 | Bacteria | 1012 |
| 517 | Ga0163163_10059543 | 3300014325 | Bacteria | 3778 |
| 518 | Ga0163163_10192411 | 3300014325 | Bacteria | 2088 |
| 519 | Ga0163163_10234162 | 3300014325 | Bacteria | 1886 |
| 520 | Ga0163163_10418196 | 3300014325 | Unclassified | 1399 |
| 521 | Ga0163163_10441910 | 3300014325 | Bacteria | 1360 |
| 522 | Ga0163163_10517481 | 3300014325 | Unclassified | 1255 |
| 523 | Ga0163163_10592073 | 3300014325 | Bacteria | 1172 |
| 524 | Ga0163163_11379723 | 3300014325 | Bacteria | 766 |
| 525 | Ga0157380_10003383 | 3300014326 | Bacteria | 10945 |
| 526 | Ga0157380_10013238 | 3300014326 | Bacteria | 6008 |
| 527 | Ga0157380_10284713 | 3300014326 | Bacteria | 1514 |
| 528 | Ga0157380_10512076 | 3300014326 | Unclassified | 1168 |
| 529 | Ga0157380_10744300 | 3300014326 | Bacteria | 991 |
| 530 | Ga0157380_11080625 | 3300014326 | Bacteria | 840 |
| 531 | Ga0157377_10021504 | 3300014745 | Bacteria | 3394 |
| 532 | Ga0157377_10040540 | 3300014745 | Bacteria | 2579 |
| 533 | Ga0157377_10310854 | 3300014745 | Bacteria | 1044 |
| 534 | Ga0157377_10330490 | 3300014745 | Bacteria | 1016 |
| 535 | Ga0157377_10359563 | 3300014745 | Bacteria | 979 |
| 536 | Ga0157379_10131221 | 3300014968 | Bacteria | 2255 |
| 537 | Ga0157379_10172452 | 3300014968 | Bacteria | 1953 |
| 538 | Ga0157379_10343194 | 3300014968 | Unclassified | 1366 |
| 539 | Ga0157379_10515704 | 3300014968 | Bacteria | 1109 |
| 540 | Ga0157379_11262786 | 3300014968 | Unclassified | 712 |
| 541 | Ga0157379_11362665 | 3300014968 | Bacteria | 687 |
| 542 | Ga0157376_10000304 | 3300014969 | Bacteria | 33027 |
| 543 | Ga0157376_10001243 | 3300014969 | Bacteria | 16788 |
| 544 | Ga0157376_10138281 | 3300014969 | Bacteria | 2182 |
| 545 | Ga0157376_10747791 | 3300014969 | Bacteria | 987 |
| 546 | Ga0157376_10920300 | 3300014969 | Bacteria | 893 |
| 547 | Ga0157376_11193278 | 3300014969 | Bacteria | 789 |
| 548 | Ga0157376_11406348 | 3300014969 | Bacteria | 729 |
| 549 | Ga0157376_11441929 | 3300014969 | Bacteria | 721 |
| 550 | Ga0182005_1283711 | 3300015265 | Unclassified | 520 |
| 551 | Ga0163161_10030053 | 3300017792 | Bacteria | 3864 |
| 552 | Ga0163161_10259246 | 3300017792 | Bacteria | 1357 |
| 553 | Ga0163161_10940145 | 3300017792 | Bacteria | 735 |
| 554 | Ga0184599_107303 | 3300019188 | Unclassified | 500 |
| 555 | Ga0206352_10624817 | 3300020078 | Bacteria | 1150 |
| 556 | Ga0209646_1002470 | 3300025246 | Bacteria | 4074 |
| 557 | Ga0207666_1007756 | 3300025271 | Bacteria | 1421 |
| 558 | Ga0207697_10123714 | 3300025315 | Bacteria | 1114 |
| 559 | Ga0207656_10004462 | 3300025321 | Bacteria | 4890 |
| 560 | Ga0207656_10023988 | 3300025321 | Bacteria | 2462 |
| 561 | Ga0207656_10024644 | 3300025321 | Bacteria | 2435 |
| 562 | Ga0207656_10291150 | 3300025321 | Bacteria | 807 |
| 563 | Ga0207682_10006822 | 3300025893 | Bacteria | 4581 |
| 564 | Ga0207682_10030762 | 3300025893 | Bacteria | 2152 |
| 565 | Ga0207642_10014031 | 3300025899 | Bacteria | 2943 |
| 566 | Ga0207642_10315857 | 3300025899 | Bacteria | 911 |
| 567 | Ga0207642_10851484 | 3300025899 | Bacteria | 582 |
| 568 | Ga0207710_10001389 | 3300025900 | Bacteria | 12142 |
| 569 | Ga0207710_10020943 | 3300025900 | Bacteria | 2799 |
| 570 | Ga0207688_10009249 | 3300025901 | Bacteria | 5371 |
| 571 | Ga0207688_10009990 | 3300025901 | Bacteria | 5164 |
| 572 | Ga0207680_10000113 | 3300025903 | Bacteria | 37153 |
| 573 | Ga0207680_10018056 | 3300025903 | Bacteria | 3740 |
| 574 | Ga0207680_10133077 | 3300025903 | Bacteria | 1641 |
| 575 | Ga0207680_10960669 | 3300025903 | Bacteria | 612 |
| 576 | Ga0207647_10035197 | 3300025904 | Unclassified | 3192 |
| 577 | Ga0207647_10203390 | 3300025904 | Unclassified | 1145 |
| 578 | Ga0207645_10000733 | 3300025907 | Bacteria | 27302 |
| 579 | Ga0207645_10019738 | 3300025907 | Bacteria | 4416 |
| 580 | Ga0207645_10035397 | 3300025907 | Bacteria | 3206 |
| 581 | Ga0207645_10414862 | 3300025907 | Bacteria | 907 |
| 582 | Ga0207645_10780861 | 3300025907 | Unclassified | 649 |
| 583 | Ga0207643_10169908 | 3300025908 | Unclassified | 1315 |
| 584 | Ga0207643_10502168 | 3300025908 | Bacteria | 775 |
| 585 | Ga0207643_10683874 | 3300025908 | Bacteria | 663 |
| 586 | Ga0207705_10109588 | 3300025909 | Bacteria | 2039 |
| 587 | Ga0207705_10693816 | 3300025909 | Unclassified | 791 |
| 588 | Ga0207705_10906409 | 3300025909 | Bacteria | 683 |
| 589 | Ga0207654_10007676 | 3300025911 | Bacteria | 5442 |
| 590 | Ga0207654_10009841 | 3300025911 | Bacteria | 4862 |
| 591 | Ga0207654_10023175 | 3300025911 | Bacteria | 3321 |
| 592 | Ga0207654_10067317 | 3300025911 | Bacteria | 2115 |
| 593 | Ga0207654_10108370 | 3300025911 | Bacteria | 1723 |
| 594 | Ga0207654_10531494 | 3300025911 | Bacteria | 833 |
| 595 | Ga0207707_10157806 | 3300025912 | Bacteria | 1984 |
| 596 | Ga0207707_10165578 | 3300025912 | Bacteria | 1932 |
| 597 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 598 | Ga0207695_10000299 | 3300025913 | Bacteria | 122118 |
| 599 | Ga0207695_10000676 | 3300025913 | Bacteria | 67018 |
| 600 | Ga0207695_10002728 | 3300025913 | Bacteria | 25766 |
| 601 | Ga0207695_10026034 | 3300025913 | Bacteria | 6535 |
| 602 | Ga0207695_10037664 | 3300025913 | Bacteria | 5217 |
| 603 | Ga0207695_10040779 | 3300025913 | Bacteria | 4973 |
| 604 | Ga0207695_10314102 | 3300025913 | Bacteria | 1457 |
| 605 | Ga0207695_10634855 | 3300025913 | Bacteria | 949 |
| 606 | Ga0207695_11222649 | 3300025913 | Bacteria | 631 |
| 607 | Ga0207671_10000965 | 3300025914 | Bacteria | 35673 |
| 608 | Ga0207671_10001222 | 3300025914 | Bacteria | 30430 |
| 609 | Ga0207671_10003407 | 3300025914 | Bacteria | 15900 |
| 610 | Ga0207671_10009011 | 3300025914 | Bacteria | 8392 |
| 611 | Ga0207671_10017027 | 3300025914 | Bacteria | 5622 |
| 612 | Ga0207671_10085221 | 3300025914 | Bacteria | 2374 |
| 613 | Ga0207663_11059169 | 3300025916 | Bacteria | 651 |
| 614 | Ga0207662_10015085 | 3300025918 | Bacteria | 4342 |
| 615 | Ga0207662_10191046 | 3300025918 | Unclassified | 1321 |
| 616 | Ga0207657_10001373 | 3300025919 | Bacteria | 25953 |
| 617 | Ga0207657_10050779 | 3300025919 | Bacteria | 3607 |
| 618 | Ga0207657_10747833 | 3300025919 | Unclassified | 758 |
| 619 | Ga0207652_10062132 | 3300025921 | Bacteria | 3227 |
| 620 | Ga0207681_10010004 | 3300025923 | Bacteria | 5805 |
| 621 | Ga0207681_10041427 | 3300025923 | Bacteria | 3070 |
| 622 | Ga0207681_10079746 | 3300025923 | Bacteria | 2307 |
| 623 | Ga0207681_10229826 | 3300025923 | Bacteria | 1439 |
| 624 | Ga0207681_10346393 | 3300025923 | Bacteria | 1188 |
| 625 | Ga0207694_10015300 | 3300025924 | Bacteria | 5789 |
| 626 | Ga0207694_10038282 | 3300025924 | Bacteria | 3687 |
| 627 | Ga0207694_10101719 | 3300025924 | Bacteria | 2278 |
| 628 | Ga0207694_11100599 | 3300025924 | Bacteria | 672 |
| 629 | Ga0207650_10059459 | 3300025925 | Bacteria | 2849 |
| 630 | Ga0207650_10116856 | 3300025925 | Unclassified | 2072 |
| 631 | Ga0207650_10263481 | 3300025925 | Bacteria | 1399 |
| 632 | Ga0207650_10289002 | 3300025925 | Bacteria | 1336 |
| 633 | Ga0207650_10810329 | 3300025925 | Bacteria | 794 |
| 634 | Ga0207650_10915450 | 3300025925 | Bacteria | 745 |
| 635 | Ga0207650_11164017 | 3300025925 | Unclassified | 657 |
| 636 | Ga0207650_11658155 | 3300025925 | Unclassified | 542 |
| 637 | Ga0207659_10360295 | 3300025926 | Bacteria | 1208 |
| 638 | Ga0207659_10501664 | 3300025926 | Bacteria | 1027 |
| 639 | Ga0207687_10186070 | 3300025927 | Bacteria | 1612 |
| 640 | Ga0207644_10100678 | 3300025931 | Bacteria | 2170 |
| 641 | Ga0207644_10132991 | 3300025931 | Bacteria | 1907 |
| 642 | Ga0207644_10210567 | 3300025931 | Bacteria | 1537 |
| 643 | Ga0207690_10723990 | 3300025932 | Unclassified | 819 |
| 644 | Ga0207706_10005466 | 3300025933 | Bacteria | 11846 |
| 645 | Ga0207706_10027139 | 3300025933 | Bacteria | 5122 |
| 646 | Ga0207706_10066701 | 3300025933 | Bacteria | 3167 |
| 647 | Ga0207706_10234127 | 3300025933 | Bacteria | 1606 |
| 648 | Ga0207686_10007790 | 3300025934 | Bacteria | 5774 |
| 649 | Ga0207686_10026021 | 3300025934 | Bacteria | 3411 |
| 650 | Ga0207686_10060808 | 3300025934 | Bacteria | 2393 |
| 651 | Ga0207686_10214760 | 3300025934 | Bacteria | 1385 |
| 652 | Ga0207709_10324059 | 3300025935 | Bacteria | 1154 |
| 653 | Ga0207709_10887322 | 3300025935 | Bacteria | 724 |
| 654 | Ga0207670_10015831 | 3300025936 | Bacteria | 4515 |
| 655 | Ga0207670_10042643 | 3300025936 | Bacteria | 2991 |
| 656 | Ga0207670_10283606 | 3300025936 | Bacteria | 1292 |
| 657 | Ga0207670_10793623 | 3300025936 | Bacteria | 789 |
| 658 | Ga0207670_11209233 | 3300025936 | Unclassified | 640 |
| 659 | Ga0207669_10005474 | 3300025937 | Bacteria | 5701 |
| 660 | Ga0207669_10061429 | 3300025937 | Bacteria | 2309 |
| 661 | Ga0207669_10110638 | 3300025937 | Bacteria | 1840 |
| 662 | Ga0207669_10178137 | 3300025937 | Bacteria | 1521 |
| 663 | Ga0207669_10796232 | 3300025937 | Bacteria | 783 |
| 664 | Ga0207704_10059624 | 3300025938 | Unclassified | 2357 |
| 665 | Ga0207704_10099775 | 3300025938 | Bacteria | 1932 |
| 666 | Ga0207704_10767102 | 3300025938 | Bacteria | 803 |
| 667 | Ga0207691_10027475 | 3300025940 | Bacteria | 5334 |
| 668 | Ga0207691_10027486 | 3300025940 | Bacteria | 5333 |
| 669 | Ga0207691_10210104 | 3300025940 | Unclassified | 1691 |
| 670 | Ga0207691_10211035 | 3300025940 | Bacteria | 1686 |
| 671 | Ga0207691_10229673 | 3300025940 | Bacteria | 1607 |
| 672 | Ga0207691_10475903 | 3300025940 | Bacteria | 1062 |
| 673 | Ga0207691_10903771 | 3300025940 | Bacteria | 739 |
| 674 | Ga0207691_11484503 | 3300025940 | Unclassified | 555 |
| 675 | Ga0207689_10000380 | 3300025942 | Bacteria | 41875 |
| 676 | Ga0207689_10001184 | 3300025942 | Bacteria | 25069 |
| 677 | Ga0207689_10005168 | 3300025942 | Bacteria | 11724 |
| 678 | Ga0207689_10012109 | 3300025942 | Bacteria | 7384 |
| 679 | Ga0207689_10033947 | 3300025942 | Bacteria | 4238 |
| 680 | Ga0207689_10147967 | 3300025942 | Unclassified | 1935 |
| 681 | Ga0207689_10182040 | 3300025942 | Bacteria | 1733 |
| 682 | Ga0207689_10560041 | 3300025942 | Unclassified | 960 |
| 683 | Ga0207689_10761143 | 3300025942 | Unclassified | 817 |
| 684 | Ga0207689_11361904 | 3300025942 | Bacteria | 595 |
| 685 | Ga0207661_10040403 | 3300025944 | Bacteria | 3666 |
| 686 | Ga0207661_10350642 | 3300025944 | Bacteria | 1331 |
| 687 | Ga0207661_10822963 | 3300025944 | Bacteria | 855 |
| 688 | Ga0207661_10867433 | 3300025944 | Bacteria | 831 |
| 689 | Ga0207679_10017159 | 3300025945 | Bacteria | 4821 |
| 690 | Ga0207679_10035092 | 3300025945 | Bacteria | 3545 |
| 691 | Ga0207679_10147399 | 3300025945 | Bacteria | 1911 |
| 692 | Ga0207679_10201780 | 3300025945 | Bacteria | 1662 |
| 693 | Ga0207679_10393809 | 3300025945 | Bacteria | 1217 |
| 694 | Ga0207679_11064151 | 3300025945 | Bacteria | 742 |
| 695 | Ga0207679_11513051 | 3300025945 | Bacteria | 615 |
| 696 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 697 | Ga0207667_10001462 | 3300025949 | Bacteria | 29619 |
| 698 | Ga0207667_10001812 | 3300025949 | Bacteria | 26915 |
| 699 | Ga0207667_10068944 | 3300025949 | Bacteria | 3681 |
| 700 | Ga0207667_10423946 | 3300025949 | Bacteria | 1354 |
| 701 | Ga0207651_10100448 | 3300025960 | Bacteria | 2145 |
| 702 | Ga0207651_10112293 | 3300025960 | Unclassified | 2048 |
| 703 | Ga0207651_10163621 | 3300025960 | Bacteria | 1747 |
| 704 | Ga0207651_10212223 | 3300025960 | Bacteria | 1559 |
| 705 | Ga0207651_11366085 | 3300025960 | Unclassified | 637 |
| 706 | Ga0207651_11693858 | 3300025960 | Bacteria | 569 |
| 707 | Ga0207712_10001901 | 3300025961 | Bacteria | 13735 |
| 708 | Ga0207712_10002225 | 3300025961 | Bacteria | 12616 |
| 709 | Ga0207712_10030178 | 3300025961 | Bacteria | 3643 |
| 710 | Ga0207712_10293518 | 3300025961 | Unclassified | 1331 |
| 711 | Ga0207668_10097215 | 3300025972 | Bacteria | 2179 |
| 712 | Ga0207668_10125097 | 3300025972 | Bacteria | 1953 |
| 713 | Ga0207668_10170188 | 3300025972 | Bacteria | 1708 |
| 714 | Ga0207668_10263967 | 3300025972 | Bacteria | 1404 |
| 715 | Ga0207640_10065994 | 3300025981 | Bacteria | 2417 |
| 716 | Ga0207640_10165858 | 3300025981 | Bacteria | 1640 |
| 717 | Ga0207640_10216350 | 3300025981 | Bacteria | 1464 |
| 718 | Ga0207640_11467956 | 3300025981 | Bacteria | 612 |
| 719 | Ga0207640_11534398 | 3300025981 | Unclassified | 599 |
| 720 | Ga0207640_11558290 | 3300025981 | Unclassified | 595 |
| 721 | Ga0207658_10003708 | 3300025986 | Bacteria | 10759 |
| 722 | Ga0207658_10061585 | 3300025986 | Bacteria | 2805 |
| 723 | Ga0207658_10328443 | 3300025986 | Bacteria | 1326 |
| 724 | Ga0207658_10492984 | 3300025986 | Bacteria | 1090 |
| 725 | Ga0207658_10650425 | 3300025986 | Bacteria | 950 |
| 726 | Ga0207677_10031330 | 3300026023 | Bacteria | 3405 |
| 727 | Ga0207677_10053742 | 3300026023 | Bacteria | 2744 |
| 728 | Ga0207677_10110431 | 3300026023 | Bacteria | 2046 |
| 729 | Ga0207677_10196790 | 3300026023 | Bacteria | 1599 |
| 730 | Ga0207677_10213509 | 3300026023 | Bacteria | 1543 |
| 731 | Ga0207677_10420161 | 3300026023 | Unclassified | 1138 |
| 732 | Ga0207677_10689796 | 3300026023 | Bacteria | 905 |
| 733 | Ga0207703_10036407 | 3300026035 | Bacteria | 3917 |
| 734 | Ga0207703_10154592 | 3300026035 | Bacteria | 2003 |
| 735 | Ga0207703_10207737 | 3300026035 | Bacteria | 1744 |
| 736 | Ga0207703_10272585 | 3300026035 | Bacteria | 1534 |
| 737 | Ga0207703_10675601 | 3300026035 | Bacteria | 981 |
| 738 | Ga0207703_10738163 | 3300026035 | Bacteria | 938 |
| 739 | Ga0207703_11161920 | 3300026035 | Unclassified | 742 |
| 740 | Ga0207639_10003650 | 3300026041 | Bacteria | 10345 |
| 741 | Ga0207639_10055525 | 3300026041 | Bacteria | 3032 |
| 742 | Ga0207639_10179286 | 3300026041 | Bacteria | 1801 |
| 743 | Ga0207639_10380949 | 3300026041 | Bacteria | 1267 |
| 744 | Ga0207639_10452144 | 3300026041 | Bacteria | 1166 |
| 745 | Ga0207639_10570713 | 3300026041 | Bacteria | 1041 |
| 746 | Ga0207639_10595695 | 3300026041 | Unclassified | 1019 |
| 747 | Ga0207639_10982125 | 3300026041 | Unclassified | 791 |
| 748 | Ga0207639_11004308 | 3300026041 | Bacteria | 781 |
| 749 | Ga0207639_11035430 | 3300026041 | Unclassified | 769 |
| 750 | Ga0207639_11534443 | 3300026041 | Unclassified | 625 |
| 751 | Ga0207678_10024931 | 3300026067 | Bacteria | 5222 |
| 752 | Ga0207708_10106639 | 3300026075 | Bacteria | 2173 |
| 753 | Ga0207708_10599568 | 3300026075 | Unclassified | 933 |
| 754 | Ga0207708_11000894 | 3300026075 | Bacteria | 726 |
| 755 | Ga0207702_10238519 | 3300026078 | Bacteria | 1703 |
| 756 | Ga0207702_10747995 | 3300026078 | Bacteria | 965 |
| 757 | Ga0207641_10000184 | 3300026088 | Bacteria | 86994 |
| 758 | Ga0207641_10058960 | 3300026088 | Bacteria | 3268 |
| 759 | Ga0207641_10088428 | 3300026088 | Bacteria | 2705 |
| 760 | Ga0207641_10102006 | 3300026088 | Bacteria | 2529 |
| 761 | Ga0207641_10339822 | 3300026088 | Bacteria | 1428 |
| 762 | Ga0207641_10475159 | 3300026088 | Bacteria | 1211 |
| 763 | Ga0207648_10001353 | 3300026089 | Bacteria | 27120 |
| 764 | Ga0207648_10003727 | 3300026089 | Bacteria | 15940 |
| 765 | Ga0207648_10270402 | 3300026089 | Bacteria | 1518 |
| 766 | Ga0207648_10823376 | 3300026089 | Bacteria | 865 |
| 767 | Ga0207648_10862061 | 3300026089 | Bacteria | 845 |
| 768 | Ga0207676_10001997 | 3300026095 | Bacteria | 14856 |
| 769 | Ga0207676_10105182 | 3300026095 | Bacteria | 2349 |
| 770 | Ga0207676_10116789 | 3300026095 | Bacteria | 2243 |
| 771 | Ga0207676_10125290 | 3300026095 | Bacteria | 2174 |
| 772 | Ga0207676_10200625 | 3300026095 | Bacteria | 1762 |
| 773 | Ga0207674_10016309 | 3300026116 | Bacteria | 8137 |
| 774 | Ga0207674_10016912 | 3300026116 | Bacteria | 7968 |
| 775 | Ga0207674_10017831 | 3300026116 | Bacteria | 7738 |
| 776 | Ga0207674_10017880 | 3300026116 | Bacteria | 7728 |
| 777 | Ga0207674_10037545 | 3300026116 | Bacteria | 5037 |
| 778 | Ga0207674_10199773 | 3300026116 | Bacteria | 1949 |
| 779 | Ga0207674_10410623 | 3300026116 | Bacteria | 1308 |
| 780 | Ga0207674_10484227 | 3300026116 | Bacteria | 1196 |
| 781 | Ga0207674_10671071 | 3300026116 | Unclassified | 1001 |
| 782 | Ga0207674_11903963 | 3300026116 | Bacteria | 561 |
| 783 | Ga0207675_100014073 | 3300026118 | Bacteria | 7460 |
| 784 | Ga0207675_100027316 | 3300026118 | Bacteria | 5316 |
| 785 | Ga0207675_100044779 | 3300026118 | Bacteria | 4135 |
| 786 | Ga0207675_100190750 | 3300026118 | Bacteria | 1966 |
| 787 | Ga0207675_100192283 | 3300026118 | Bacteria | 1958 |
| 788 | Ga0207675_100213583 | 3300026118 | Bacteria | 1856 |
| 789 | Ga0207675_100709255 | 3300026118 | Bacteria | 1015 |
| 790 | Ga0207675_102330803 | 3300026118 | Bacteria | 549 |
| 791 | Ga0207683_10002586 | 3300026121 | Bacteria | 15807 |
| 792 | Ga0207683_10034739 | 3300026121 | Bacteria | 4383 |
| 793 | Ga0207683_10133808 | 3300026121 | Bacteria | 2231 |
| 794 | Ga0207683_10358985 | 3300026121 | Bacteria | 1338 |
| 795 | Ga0207698_10003372 | 3300026142 | Bacteria | 9623 |
| 796 | Ga0207698_10069458 | 3300026142 | Bacteria | 2786 |
| 797 | Ga0207698_10080184 | 3300026142 | Bacteria | 2628 |
| 798 | Ga0207698_10112921 | 3300026142 | Bacteria | 2282 |
| 799 | Ga0207698_10346137 | 3300026142 | Bacteria | 1402 |
| 800 | Ga0207698_10404869 | 3300026142 | Bacteria | 1305 |
| 801 | Ga0207698_10818463 | 3300026142 | Bacteria | 935 |
| 802 | Ga0207698_11128481 | 3300026142 | Bacteria | 797 |
| 803 | Ga0207698_11219734 | 3300026142 | Unclassified | 766 |
| 804 | Ga0207698_11806223 | 3300026142 | Bacteria | 626 |
| 805 | Ga0209995_1033985 | 3300027471 | Bacteria | 856 |
| 806 | Ga0268266_10000104 | 3300028379 | Bacteria | 178320 |
| 807 | Ga0268266_10552442 | 3300028379 | Bacteria | 1103 |
| 808 | Ga0268265_10029947 | 3300028380 | Bacteria | 3916 |
| 809 | Ga0268265_10077127 | 3300028380 | Bacteria | 2617 |
| 810 | Ga0268265_10267189 | 3300028380 | Bacteria | 1524 |
| 811 | Ga0268265_10296879 | 3300028380 | Bacteria | 1453 |
| 812 | Ga0268265_10785963 | 3300028380 | Bacteria | 927 |
| 813 | Ga0268265_11029131 | 3300028380 | Bacteria | 815 |
| 814 | Ga0268264_10012233 | 3300028381 | Bacteria | 7060 |
| 815 | Ga0268264_10017697 | 3300028381 | Bacteria | 5834 |
| 816 | Ga0268264_10022803 | 3300028381 | Bacteria | 5109 |
| 817 | Ga0268264_10036688 | 3300028381 | Bacteria | 4039 |
| 818 | Ga0268264_10118436 | 3300028381 | Bacteria | 2330 |
| 819 | Ga0268264_10414387 | 3300028381 | Bacteria | 1298 |
| 820 | Ga0268264_10564910 | 3300028381 | Bacteria | 1117 |
| 821 | Ga0268264_10809682 | 3300028381 | Bacteria | 936 |
| 822 | Ga0268264_11126813 | 3300028381 | Bacteria | 793 |
| 823 | Ga0307517_10002234 | 3300028786 | Bacteria | 31286 |
| 824 | Ga0307517_10258767 | 3300028786 | Bacteria | 1013 |
| 825 | Ga0307517_10568992 | 3300028786 | Bacteria | 563 |
| 826 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 827 | Ga0265327_10149322 | 3300031251 | Bacteria | 1086 |
| 828 | Ga0307513_10106773 | 3300031456 | Bacteria | 2805 |
| 829 | Ga0307513_10608136 | 3300031456 | Bacteria | 802 |
| 830 | Ga0307509_10030579 | 3300031507 | Bacteria | 5953 |
| 831 | Ga0307509_10080126 | 3300031507 | Bacteria | 3378 |
| 832 | Ga0307509_10162480 | 3300031507 | Bacteria | 2128 |
| 833 | Ga0265313_10056037 | 3300031595 | Bacteria | 1865 |
| 834 | Ga0265313_10083679 | 3300031595 | Bacteria | 1444 |
| 835 | Ga0307508_10000969 | 3300031616 | Bacteria | 33410 |
| 836 | Ga0307516_10000486 | 3300031730 | Bacteria | 52749 |
| 837 | Ga0307516_10137106 | 3300031730 | Bacteria | 2220 |
| 838 | Ga0307516_10272981 | 3300031730 | Unclassified | 1376 |
| 839 | Ga0307413_10371435 | 3300031824 | Bacteria | 1111 |
| 840 | Ga0307410_10012506 | 3300031852 | Bacteria | 4914 |
| 841 | Ga0307410_10183522 | 3300031852 | Bacteria | 1586 |
| 842 | Ga0307406_10153770 | 3300031901 | Bacteria | 1644 |
| 843 | Ga0307412_10330224 | 3300031911 | Bacteria | 1217 |
| 844 | Ga0307414_10067866 | 3300032004 | Bacteria | 2557 |
| 845 | Ga0307414_10080824 | 3300032004 | Bacteria | 2378 |
| 846 | Ga0307414_10095291 | 3300032004 | Bacteria | 2224 |
| 847 | Ga0307411_10256316 | 3300032005 | Bacteria | 1379 |
| 848 | Ga0307415_100451128 | 3300032126 | Bacteria | 1112 |
| 849 | Ga0307510_10002428 | 3300033180 | Bacteria | 21155 |
| 850 | Ga0373952_0099225 | 3300035092 | Bacteria | 766 |
| 851 | Ga0373931_0225963 | 3300035691 | Bacteria | 1129 |
| 852 | Ga0373935_0545526 | 3300035692 | Unclassified | 845 |
| 853 | Ga0373947_0072118 | 3300035725 | Bacteria | 2120 |
| 854 | Ga0373947_0537936 | 3300035725 | Unclassified | 795 |
| 855 | Ga0373937_0071372 | 3300036401 | Bacteria | 3203 |
| 856 | Ga0373925_0441226 | 3300037068 | Unclassified | 1065 |
| 857 | Ga0395900_0331586 | 3300037418 | Bacteria | 1500 |
| 858 | Ga0395905_1168144 | 3300037471 | Unclassified | 673 |
| 859 | Ga0439436_0000137 | 3300041404 | Bacteria | 16722 |
| 860 | Ga0439436_0029590 | 3300041404 | Bacteria | 1595 |
| 861 | Ga0439465_0090303 | 3300041413 | Bacteria | 1047 |
| 862 | Ga0451791_1067968 | 3300041451 | Bacteria | 568 |
| 863 | Ga0451791_1278243 | 3300041451 | Bacteria | 609 |
| 864 | Ga0451797_0540034 | 3300041453 | Bacteria | 758 |
| 865 | Ga0451798_0465207 | 3300041458 | Bacteria | 804 |
| 866 | Ga0451807_2273190 | 3300041486 | Bacteria | 1689 |
| 867 | Ga0451835_0566391 | 3300041492 | Unclassified | 1239 |
| 868 | Ga0451839_0589464 | 3300041496 | Bacteria | 1118 |
| 869 | Ga0451849_1288791 | 3300041505 | Bacteria | 1162 |
| 870 | Ga0439431_0018393 | 3300041997 | Bacteria | 1653 |
| 871 | Ga0439441_004078 | 3300042001 | Unclassified | 2194 |
| 872 | Ga0439442_021501 | 3300042002 | Bacteria | 1338 |
| 873 | Ga0439443_013499 | 3300042003 | Unclassified | 1222 |
| 874 | Ga0439445_0004845 | 3300042004 | Bacteria | 3057 |
| 875 | Ga0439445_0041855 | 3300042004 | Bacteria | 1219 |
| 876 | Ga0439449_0026441 | 3300042007 | Bacteria | 2166 |
| 877 | Ga0439454_036926 | 3300042011 | Bacteria | 787 |
| 878 | Ga0439457_000860 | 3300042014 | Bacteria | 9155 |
| 879 | Ga0439462_0003058 | 3300042015 | Bacteria | 3974 |
| 880 | Ga0439462_0196415 | 3300042015 | Bacteria | 574 |
| 881 | Ga0450920_046578 | 3300042122 | Bacteria | 867 |
| 882 | Ga0450897_015515 | 3300042128 | Bacteria | 779 |
| 883 | Ga0450896_015092 | 3300042133 | Bacteria | 1105 |
| 884 | Ga0450898_002958 | 3300042134 | Bacteria | 2400 |
| 885 | Ga0450899_009552 | 3300042135 | Bacteria | 1070 |
| 886 | Ga0439446_0128623 | 3300042156 | Bacteria | 820 |
| 887 | Ga0439434_0017033 | 3300042435 | Bacteria | 2173 |
| 888 | Ga0450893_0054143 | 3300042532 | Bacteria | 757 |
| 889 | Ga0451577_0083254 | 3300042876 | Unclassified | 2854 |
| 890 | Ga0466969_0000514 | 3300044656 | Bacteria | 21251 |
| 891 | Ga0466969_0119554 | 3300044656 | Bacteria | 1228 |
| 892 | Ga0466972_0001500 | 3300044658 | Bacteria | 11362 |
| 893 | Ga0466972_0045477 | 3300044658 | Bacteria | 2127 |
| 894 | Ga0466972_0086690 | 3300044658 | Bacteria | 1488 |
| 895 | Ga0466966_0000242 | 3300044684 | Bacteria | 36224 |
| 896 | Ga0466966_0473712 | 3300044684 | Bacteria | 753 |
| 897 | Ga0466961_0157131 | 3300044693 | Bacteria | 1418 |
| 898 | Ga0466961_0303481 | 3300044693 | Bacteria | 975 |
| 899 | Ga0466964_0119378 | 3300044706 | Bacteria | 1187 |
| 900 | Ga0453684_0323910 | 3300044712 | Bacteria | 1744 |
| 901 | Ga0466971_0007611 | 3300044719 | Bacteria | 4723 |
| 902 | Ga0466971_0277681 | 3300044719 | Bacteria | 801 |
| 903 | Ga0466968_0005140 | 3300044735 | Bacteria | 4895 |
| 904 | Ga0466968_0224926 | 3300044735 | Bacteria | 885 |
| 905 | Ga0466957_0127759 | 3300044842 | Bacteria | 1625 |
| 906 | Ga0466957_0676247 | 3300044842 | Bacteria | 727 |
| 907 | Ga0466960_0751461 | 3300044901 | Bacteria | 588 |
| 908 | Ga0466959_0000045 | 3300045049 | Bacteria | 89773 |
| 909 | Ga0466959_0005062 | 3300045049 | Bacteria | 8962 |
| 910 | Ga0495638_0523421 | 3300046460 | Unclassified | 594 |
| 911 | Ga0495650_0007919 | 3300046471 | Bacteria | 6302 |
| 912 | Ga0495650_0103847 | 3300046471 | Bacteria | 1064 |
| 913 | Ga0495606_0003901 | 3300046507 | Bacteria | 15366 |
| 914 | Ga0495643_0034626 | 3300046522 | Bacteria | 2786 |
| 915 | Ga0495648_0003009 | 3300046524 | Bacteria | 15103 |
| 916 | Ga0495621_0097219 | 3300046539 | Bacteria | 1116 |
| 917 | Ga0495668_0004365 | 3300046616 | Bacteria | 10087 |
| 918 | Ga0495668_0485907 | 3300046616 | Unclassified | 680 |
| 919 | Ga0495611_0000065 | 3300046648 | Bacteria | 74332 |
| 920 | Ga0495611_0329244 | 3300046648 | Bacteria | 702 |
| 921 | Ga0495625_0116120 | 3300046660 | Bacteria | 1826 |
| 922 | Ga0495657_0711501 | 3300046675 | Unclassified | 577 |
| 923 | Ga0495646_0699034 | 3300046680 | Unclassified | 510 |
| 924 | Ga0495649_0144455 | 3300046694 | Bacteria | 1251 |
| 925 | Ga0495649_0176604 | 3300046694 | Unclassified | 1116 |
| 926 | Ga0495649_0636655 | 3300046694 | Unclassified | 525 |
| 927 | Ga0495672_0065528 | 3300047320 | Bacteria | 2076 |
| 928 | Ga0495672_0365029 | 3300047320 | Bacteria | 667 |
| 929 | Ga0495687_000129 | 3300047443 | Bacteria | 116030 |
| 930 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 931 | Ga0495686_0022603 | 3300047472 | Bacteria | 4161 |
| 932 | Ga0495686_0449759 | 3300047472 | Unclassified | 684 |
| 933 | Ga0496108_1061606 | 3300048911 | Unclassified | 690 |
| 934 | Ga0496110_0425840 | 3300048913 | Bacteria | 1210 |
| 935 | Ga0496115_0292137 | 3300048918 | Bacteria | 1337 |
| 936 | Ga0501296_068221 | 3300049519 | Bacteria | 548 |
| 937 | Ga0501315_023229 | 3300049531 | Bacteria | 850 |
| 938 | Ga0501336_016860 | 3300049552 | Bacteria | 637 |
| 939 | Ga0501032_0028617 | 3300049569 | Unclassified | 3828 |
| 940 | Ga0501032_0186921 | 3300049569 | Bacteria | 1355 |
| 941 | Ga0501032_0926497 | 3300049569 | Bacteria | 548 |
| 942 | Ga0501033_0800208 | 3300049570 | Bacteria | 637 |
| 943 | Ga0501034_0000937 | 3300049571 | Bacteria | 42464 |
| 944 | Ga0501034_0019334 | 3300049571 | Bacteria | 6967 |
| 945 | Ga0501034_0123084 | 3300049571 | Bacteria | 2579 |
| 946 | Ga0501034_1139536 | 3300049571 | Bacteria | 660 |
| 947 | Ga0501036_0008894 | 3300049572 | Bacteria | 8249 |
| 948 | Ga0501036_0308194 | 3300049572 | Bacteria | 1324 |
| 949 | Ga0501037_0000718 | 3300049573 | Bacteria | 25144 |
| 950 | Ga0501037_0008646 | 3300049573 | Bacteria | 7467 |
| 951 | Ga0501037_0121290 | 3300049573 | Bacteria | 1880 |
| 952 | Ga0501038_0005004 | 3300049574 | Bacteria | 12307 |
| 953 | Ga0501038_0086961 | 3300049574 | Bacteria | 2625 |
| 954 | Ga0501039_0038233 | 3300049575 | Bacteria | 3707 |
| 955 | Ga0501043_0004294 | 3300049579 | Bacteria | 11599 |
| 956 | Ga0501043_0041216 | 3300049579 | Bacteria | 3628 |
| 957 | Ga0501043_0300355 | 3300049579 | Bacteria | 1227 |
| 958 | Ga0501046_0073318 | 3300049580 | Bacteria | 2657 |
| 959 | Ga0501046_0978880 | 3300049580 | Bacteria | 588 |
| 960 | Ga0501047_0003596 | 3300049581 | Bacteria | 14624 |
| 961 | Ga0501047_0033530 | 3300049581 | Bacteria | 4957 |
| 962 | Ga0501047_0548271 | 3300049581 | Bacteria | 981 |
| 963 | Ga0501071_1055186 | 3300049587 | Bacteria | 628 |
| 964 | Ga0501072_0188734 | 3300049588 | Bacteria | 1644 |
| 965 | Ga0501206_030542 | 3300049653 | Bacteria | 800 |
| 966 | Ga0501207_046978 | 3300049654 | Unclassified | 763 |
| 967 | Ga0501209_257325 | 3300049656 | Unclassified | 546 |
| 968 | Ga0501217_043386 | 3300049661 | Bacteria | 1152 |
| 969 | Ga0501217_057204 | 3300049661 | Bacteria | 1033 |
| 970 | Ga0501217_059515 | 3300049661 | Unclassified | 1017 |
| 971 | Ga0501228_006760 | 3300049666 | Bacteria | 1056 |
| 972 | Ga0501230_067973 | 3300049667 | Unclassified | 730 |
| 973 | Ga0501233_043893 | 3300049668 | Bacteria | 1061 |
| 974 | Ga0501240_008856 | 3300049673 | Bacteria | 1302 |
| 975 | Ga0501257_085348 | 3300049686 | Unclassified | 817 |
| 976 | Ga0501259_090263 | 3300049688 | Bacteria | 687 |
| 977 | Ga0501219_000343 | 3300049703 | Bacteria | 7963 |
| 978 | Ga0501221_074593 | 3300049704 | Unclassified | 806 |
| 979 | Ga0501225_0010764 | 3300049705 | Bacteria | 2585 |
| 980 | Ga0501080_0464217 | 3300049742 | Bacteria | 1134 |
| 981 | Ga0501035_0000916 | 3300049822 | Bacteria | 31216 |
| 982 | Ga0501035_0278317 | 3300049822 | Bacteria | 1415 |
| 983 | Ga0501044_0002695 | 3300049823 | Bacteria | 20191 |
| 984 | Ga0501044_0003481 | 3300049823 | Bacteria | 17732 |
| 985 | Ga0501044_0007349 | 3300049823 | Bacteria | 12110 |
| 986 | Ga0501044_0119774 | 3300049823 | Bacteria | 2634 |
| 987 | Ga0501044_0560823 | 3300049823 | Unclassified | 1038 |
| 988 | Ga0501284_00007 | 3300050005 | Bacteria | 147956 |
| 989 | nmdc:mga0k408_13393_c1 | 3300050493 | Bacteria | 4496 |
| 990 | nmdc:mga0k408_155043_c1 | 3300050493 | Bacteria | 1364 |
| 991 | nmdc:mga0k408_20773_c1 | 3300050493 | Bacteria | 3684 |
| 992 | nmdc:mga0k408_305483_c1 | 3300050493 | Bacteria | 949 |
| 993 | nmdc:mga0k408_53167_c1 | 3300050493 | Bacteria | 2347 |
| 994 | nmdc:mga0k408_66805_c1 | 3300050493 | Bacteria | 2095 |
| 995 | nmdc:mga05p37_18486_c1 | 3300050507 | Bacteria | 8420 |
| 996 | nmdc:mga05p37_26669_c1 | 3300050507 | Bacteria | 7026 |
| 997 | nmdc:mga05p37_66791_c1 | 3300050507 | Bacteria | 4423 |
| 998 | nmdc:mga09592_4549_c1 | 3300050508 | Bacteria | 11223 |
| 999 | nmdc:mga0qj67_17410_c1 | 3300050509 | Bacteria | 5463 |
| 1000 | nmdc:mga0qj67_74104_c1 | 3300050509 | Bacteria | 2720 |
| 1001 | nmdc:mga06r32_188981_c1 | 3300050510 | Unclassified | 2047 |
| 1002 | nmdc:mga06r32_259487_c1 | 3300050510 | Bacteria | 1725 |
| 1003 | nmdc:mga06r32_6055_c1 | 3300050510 | Bacteria | 10872 |
| 1004 | nmdc:mga08y16_198056_c1 | 3300050511 | Bacteria | 2082 |
| 1005 | nmdc:mga08y16_311888_c1 | 3300050511 | Unclassified | 1620 |
| 1006 | nmdc:mga08y16_864603_c1 | 3300050511 | Unclassified | 893 |
| 1007 | Ga0500578_0000026 | 3300053086 | Bacteria | 145328 |
| 1008 | Ga0500578_0045550 | 3300053086 | Bacteria | 2814 |
| 1009 | Ga0500578_0143837 | 3300053086 | Bacteria | 1490 |
| 1010 | Ga0500578_0381609 | 3300053086 | Unclassified | 817 |
| 1011 | Ga0500646_0017575 | 3300053090 | Bacteria | 1876 |
| 1012 | Ga0500646_0018495 | 3300053090 | Bacteria | 1836 |
| 1013 | Ga0500646_0037505 | 3300053090 | Bacteria | 1354 |
| 1014 | Ga0500646_0048905 | 3300053090 | Bacteria | 1214 |
| 1015 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 1016 | Ga0500583_0000770 | 3300053092 | Bacteria | 9324 |
| 1017 | Ga0500583_0007230 | 3300053092 | Bacteria | 3890 |
| 1018 | Ga0500583_0021694 | 3300053092 | Bacteria | 2676 |
| 1019 | Ga0500650_0116018 | 3300053098 | Bacteria | 1249 |
| 1020 | Ga0500555_005151 | 3300053103 | Bacteria | 3708 |
| 1021 | Ga0500572_121816 | 3300053111 | Bacteria | 844 |
| 1022 | Ga0500594_0130185 | 3300053118 | Bacteria | 796 |
| 1023 | Ga0500642_0048455 | 3300053130 | Bacteria | 1866 |
| 1024 | Ga0500652_014603 | 3300053131 | Bacteria | 2813 |
| 1025 | Ga0500559_0165661 | 3300053136 | Bacteria | 1039 |
| 1026 | Ga0500559_0215070 | 3300053136 | Bacteria | 907 |
| 1027 | Ga0500568_0000088 | 3300053139 | Bacteria | 89215 |
| 1028 | Ga0500577_0172052 | 3300053142 | Bacteria | 927 |
| 1029 | Ga0500588_0113411 | 3300053146 | Bacteria | 948 |
| 1030 | Ga0500588_0168463 | 3300053146 | Bacteria | 800 |
| 1031 | Ga0500604_0000889 | 3300053151 | Bacteria | 8258 |
| 1032 | Ga0500604_0012386 | 3300053151 | Bacteria | 2302 |
| 1033 | Ga0500604_0101584 | 3300053151 | Bacteria | 949 |
| 1034 | Ga0500622_0001195 | 3300053156 | Bacteria | 21360 |
| 1035 | Ga0500622_0090233 | 3300053156 | Bacteria | 1521 |
| 1036 | Ga0500622_0170848 | 3300053156 | Bacteria | 1012 |
| 1037 | Ga0500639_029716 | 3300053163 | Bacteria | 2888 |
| 1038 | Ga0500636_0237004 | 3300053177 | Bacteria | 940 |
| 1039 | Ga0500637_0398215 | 3300053178 | Bacteria | 716 |
| 1040 | Ga0500570_187542 | 3300053724 | Bacteria | 654 |
| 1041 | Ga0500611_000038 | 3300053727 | Bacteria | 71407 |
| 1042 | Ga0500661_031858 | 3300055283 | Bacteria | 930 |
| 1043 | Ga0466962_0019883 | 3300061719 | Bacteria | 3227 |
| 1044 | 2738725299 | 2738541278 | Bacteria | 9755573 |
| 1045 | 2914762744 | 2914759650 | Bacteria | 4701441 |
| 1046 | Ga0501247_013341 | |||
| 1047 | ARcpr5yngRDRAFT_c003023 | |||
| 1048 | JGI24743J22301_10105365 | |||
| 1049 | JGI24738J21930_10017758 | |||
| 1050 | JGI24744J21845_10011998 | |||
| 1051 | JGI25406J46586_10005934 | |||
| 1052 | rootH1_10034736 | |||
| 1053 | rootH1_10129298 | |||
| 1054 | rootH2_10011035 | |||
| 1055 | rootH2_10019611 | |||
| 1056 | rootH2_10061393 | |||
| 1057 | rootH2_10080418 | |||
| 1058 | rootL2_10016148 | |||
| 1059 | rootL2_10016149 | |||
| 1060 | rootL2_10070142 | |||
| 1061 | rootH1_10026407 | |||
| 1062 | rootH1_10039810 | |||
| 1063 | rootH1_10164376 | |||
| 1064 | Ga0065165_1146059 | |||
| 1065 | Ga0065704_10393489 | |||
| 1066 | Ga0065712_10008487 | |||
| 1067 | Ga0065712_10033528 | |||
| 1068 | Ga0065712_10041081 | |||
| 1069 | Ga0065712_10044321 | |||
| 1070 | Ga0065712_10107087 | |||
| 1071 | Ga0065712_10787117 | |||
| 1072 | Ga0065715_10140141 | |||
| 1073 | Ga0065715_10813972 | |||
| 1074 | Ga0065715_10850861 | |||
| 1075 | Ga0065715_10959137 | |||
| 1076 | Ga0065707_10014537 | |||
| 1077 | Ga0070658_11008456 | |||
| 1078 | Ga0070658_11252203 | |||
| 1079 | Ga0070658_11516361 | |||
| 1080 | Ga0070676_10035857 | |||
| 1081 | Ga0070676_10099574 | |||
| 1082 | Ga0070683_100001414 | |||
| 1083 | Ga0070683_100028320 | |||
| 1084 | Ga0070683_100454138 | |||
| 1085 | Ga0070690_100020891 | |||
| 1086 | Ga0070690_100101866 | |||
| 1087 | Ga0070690_100676327 | |||
| 1088 | Ga0070670_100100191 | |||
| 1089 | Ga0070670_100250848 | |||
| 1090 | Ga0070670_100315799 | |||
| 1091 | Ga0070670_100448839 | |||
| 1092 | Ga0070670_100813368 | |||
| 1093 | Ga0070670_100921072 | |||
| 1094 | Ga0070677_10063338 | |||
| 1095 | Ga0070677_10097925 | |||
| 1096 | Ga0068869_100008418 | |||
| 1097 | Ga0068869_100044478 | |||
| 1098 | Ga0068869_100068716 | |||
| 1099 | Ga0068869_100083636 | |||
| 1100 | Ga0068869_100106834 | |||
| 1101 | Ga0068869_100112157 | |||
| 1102 | Ga0068869_100219527 | |||
| 1103 | Ga0068869_101853342 | |||
| 1104 | Ga0070666_10000019 | |||
| 1105 | Ga0070666_10038889 | |||
| 1106 | Ga0070666_10042186 | |||
| 1107 | Ga0070666_10079785 | |||
| 1108 | Ga0070666_10100180 | |||
| 1109 | Ga0070682_100019174 | |||
| 1110 | Ga0068868_100005373 | |||
| 1111 | Ga0068868_100029834 | |||
| 1112 | Ga0068868_100034352 | |||
| 1113 | Ga0068868_100068221 | |||
| 1114 | Ga0068868_100125546 | |||
| 1115 | Ga0068868_100552722 | |||
| 1116 | Ga0068868_100666711 | |||
| 1117 | Ga0070660_100009104 | |||
| 1118 | Ga0070660_100578255 | |||
| 1119 | Ga0070689_100008953 | |||
| 1120 | Ga0070689_100053041 | |||
| 1121 | Ga0070689_100070706 | |||
| 1122 | Ga0070689_100107571 | |||
| 1123 | Ga0070689_100195742 | |||
| 1124 | Ga0070689_100238872 | |||
| 1125 | Ga0070689_101163518 | |||
| 1126 | Ga0070691_10014732 | |||
| 1127 | Ga0070691_10101471 | |||
| 1128 | Ga0070687_100045080 | |||
| 1129 | Ga0070687_100063170 | |||
| 1130 | Ga0070661_100030970 | |||
| 1131 | Ga0070661_100757651 | |||
| 1132 | Ga0070661_101161606 | |||
| 1133 | Ga0070668_100005214 | |||
| 1134 | Ga0070668_100092743 | |||
| 1135 | Ga0070668_100149216 | |||
| 1136 | Ga0070668_100241687 | |||
| 1137 | Ga0070668_101325906 | |||
| 1138 | Ga0070668_102202751 | |||
| 1139 | Ga0070669_100034447 | |||
| 1140 | Ga0070669_100034784 | |||
| 1141 | Ga0070669_100144455 | |||
| 1142 | Ga0070669_100253976 | |||
| 1143 | Ga0070669_100583417 | |||
| 1144 | Ga0070669_100702301 | |||
| 1145 | Ga0070669_100742872 | |||
| 1146 | Ga0070669_101504183 | |||
| 1147 | Ga0070675_100034864 | |||
| 1148 | Ga0070675_100080305 | |||
| 1149 | Ga0070675_100099346 | |||
| 1150 | Ga0070675_100125848 | |||
| 1151 | Ga0070671_100010972 | |||
| 1152 | Ga0070671_100045546 | |||
| 1153 | Ga0070671_100113496 | |||
| 1154 | Ga0070671_100133278 | |||
| 1155 | Ga0070671_100690817 | |||
| 1156 | Ga0070674_100010025 | |||
| 1157 | Ga0070674_100040946 | |||
| 1158 | Ga0070674_100084253 | |||
| 1159 | Ga0070674_100130467 | |||
| 1160 | Ga0070674_100282104 | |||
| 1161 | Ga0070674_100792031 | |||
| 1162 | Ga0070674_100924580 | |||
| 1163 | Ga0070674_101588788 | |||
| 1164 | Ga0070674_101631439 | |||
| 1165 | Ga0070674_101906006 | |||
| 1166 | Ga0070674_101908860 | |||
| 1167 | Ga0070673_100016058 | |||
| 1168 | Ga0070673_100042190 | |||
| 1169 | Ga0070673_100108488 | |||
| 1170 | Ga0070673_100132623 | |||
| 1171 | Ga0070673_100138278 | |||
| 1172 | Ga0070673_100208721 | |||
| 1173 | Ga0070673_100259143 | |||
| 1174 | Ga0070673_100772777 | |||
| 1175 | Ga0070673_100899284 | |||
| 1176 | Ga0070673_101110532 | |||
| 1177 | Ga0070688_100027466 | |||
| 1178 | Ga0070688_100042702 | |||
| 1179 | Ga0070688_100379211 | |||
| 1180 | Ga0070688_100562201 | |||
| 1181 | Ga0070659_100010175 | |||
| 1182 | Ga0070659_100078867 | |||
| 1183 | Ga0070659_100784610 | |||
| 1184 | Ga0070667_100012137 | |||
| 1185 | Ga0070667_100042945 | |||
| 1186 | Ga0070667_100099243 | |||
| 1187 | Ga0070667_100150387 | |||
| 1188 | Ga0070667_100442042 | |||
| 1189 | Ga0070667_100768392 | |||
| 1190 | Ga0070667_100830356 | |||
| 1191 | Ga0070667_101355428 | |||
| 1192 | Ga0070701_11022206 | |||
| 1193 | Ga0070711_101280964 | |||
| 1194 | Ga0070705_100853083 | |||
| 1195 | Ga0070700_100177715 | |||
| 1196 | Ga0070700_100518803 | |||
| 1197 | Ga0070700_100970436 | |||
| 1198 | Ga0070663_100459708 | |||
| 1199 | Ga0070663_100540213 | |||
| 1200 | Ga0070678_100019852 | |||
| 1201 | Ga0070678_100141488 | |||
| 1202 | Ga0070678_100248819 | |||
| 1203 | Ga0070678_100310139 | |||
| 1204 | Ga0070678_100643798 | |||
| 1205 | Ga0070662_100005642 | |||
| 1206 | Ga0070662_100169574 | |||
| 1207 | Ga0070662_100216588 | |||
| 1208 | Ga0070662_100478508 | |||
| 1209 | Ga0070662_100959065 | |||
| 1210 | Ga0070681_10025121 | |||
| 1211 | Ga0070681_10124742 | |||
| 1212 | Ga0068867_100001050 | |||
| 1213 | Ga0068867_100105693 | |||
| 1214 | Ga0068867_100113200 | |||
| 1215 | Ga0068867_100269897 | |||
| 1216 | Ga0068867_100864704 | |||
| 1217 | Ga0070685_10028657 | |||
| 1218 | Ga0070685_10047461 | |||
| 1219 | Ga0070685_10085642 | |||
| 1220 | Ga0070685_10145125 | |||
| 1221 | Ga0070685_10545789 | |||
| 1222 | Ga0070698_100011129 | |||
| 1223 | Ga0070698_100011210 | |||
| 1224 | Ga0070698_100018892 | |||
| 1225 | Ga0070698_100044930 | |||
| 1226 | Ga0070699_100963158 | |||
| 1227 | Ga0070679_100494997 | |||
| 1228 | Ga0070684_100000823 | |||
| 1229 | Ga0070684_100011717 | |||
| 1230 | Ga0068853_100003746 | |||
| 1231 | Ga0068853_100026213 | |||
| 1232 | Ga0068853_100029532 | |||
| 1233 | Ga0068853_100041104 | |||
| 1234 | Ga0068853_100130912 | |||
| 1235 | Ga0068853_100349042 | |||
| 1236 | Ga0068853_100456475 | |||
| 1237 | Ga0068853_100831326 | |||
| 1238 | Ga0070672_100015713 | |||
| 1239 | Ga0070672_100053966 | |||
| 1240 | Ga0070672_100253969 | |||
| 1241 | Ga0070672_100538813 | |||
| 1242 | Ga0070672_100540795 | |||
| 1243 | Ga0070672_100746174 | |||
| 1244 | Ga0070672_100748575 | |||
| 1245 | Ga0070686_100001004 | |||
| 1246 | Ga0070686_100102284 | |||
| 1247 | Ga0070686_100149456 | |||
| 1248 | Ga0070696_100100746 | |||
| 1249 | Ga0070693_100157385 | |||
| 1250 | Ga0070665_100000047 | |||
| 1251 | Ga0070665_100250877 | |||
| 1252 | Ga0070665_100360504 | |||
| 1253 | Ga0070665_101366527 | |||
| 1254 | Ga0070704_100156663 | |||
| 1255 | Ga0070704_100212070 | |||
| 1256 | Ga0068855_100001426 | |||
| 1257 | Ga0068855_100040750 | |||
| 1258 | Ga0068855_100047716 | |||
| 1259 | Ga0068855_100050618 | |||
| 1260 | Ga0068855_100063390 | |||
| 1261 | Ga0068855_100103619 | |||
| 1262 | Ga0068855_101735984 | |||
| 1263 | Ga0070664_100011372 | |||
| 1264 | Ga0070664_100014161 | |||
| 1265 | Ga0070664_100019836 | |||
| 1266 | Ga0070664_100238002 | |||
| 1267 | Ga0070664_100300218 | |||
| 1268 | Ga0070664_100975884 | |||
| 1269 | Ga0070664_101876142 | |||
| 1270 | Ga0068857_100020535 | |||
| 1271 | Ga0068857_100044436 | |||
| 1272 | Ga0068857_100079559 | |||
| 1273 | Ga0068857_100190954 | |||
| 1274 | Ga0068857_100197941 | |||
| 1275 | Ga0068857_100206749 | |||
| 1276 | Ga0068857_100375236 | |||
| 1277 | Ga0068857_100410407 | |||
| 1278 | Ga0068857_100595899 | |||
| 1279 | Ga0068857_100720326 | |||
| 1280 | Ga0068857_102126915 | |||
| 1281 | Ga0068854_100049602 | |||
| 1282 | Ga0068854_100060547 | |||
| 1283 | Ga0068854_100179281 | |||
| 1284 | Ga0068854_100401792 | |||
| 1285 | Ga0068854_100749551 | |||
| 1286 | Ga0068856_100023585 | |||
| 1287 | Ga0068856_100046135 | |||
| 1288 | Ga0068856_101086230 | |||
| 1289 | Ga0068856_102652955 | |||
| 1290 | Ga0070702_100014930 | |||
| 1291 | Ga0070702_100263346 | |||
| 1292 | Ga0068852_100008777 | |||
| 1293 | Ga0068852_100088967 | |||
| 1294 | Ga0068852_100162780 | |||
| 1295 | Ga0068852_100173670 | |||
| 1296 | Ga0068852_100406215 | |||
| 1297 | Ga0068852_100438068 | |||
| 1298 | Ga0068852_100624444 | |||
| 1299 | Ga0068852_101199068 | |||
| 1300 | Ga0068859_100000013 | |||
| 1301 | Ga0068859_100023510 | |||
| 1302 | Ga0068859_100037391 | |||
| 1303 | Ga0068859_100059896 | |||
| 1304 | Ga0068859_100115699 | |||
| 1305 | Ga0068859_100154190 | |||
| 1306 | Ga0068859_100215928 | |||
| 1307 | Ga0068859_100270926 | |||
| 1308 | Ga0068859_100286553 | |||
| 1309 | Ga0068859_100317433 | |||
| 1310 | Ga0068859_100414816 | |||
| 1311 | Ga0068859_100664728 | |||
| 1312 | Ga0068859_100708088 | |||
| 1313 | Ga0068859_100774966 | |||
| 1314 | Ga0068859_101438133 | |||
| 1315 | Ga0068864_100005159 | |||
| 1316 | Ga0068864_100009571 | |||
| 1317 | Ga0068864_100118052 | |||
| 1318 | Ga0068864_100890220 | |||
| 1319 | Ga0068864_101036798 | |||
| 1320 | Ga0068866_10002239 | |||
| 1321 | Ga0068866_10029152 | |||
| 1322 | Ga0068861_100003393 | |||
| 1323 | Ga0068861_100004879 | |||
| 1324 | Ga0068861_100386104 | |||
| 1325 | Ga0068861_100555578 | |||
| 1326 | Ga0068861_101941897 | |||
| 1327 | Ga0068851_10008282 | |||
| 1328 | Ga0068851_10037416 | |||
| 1329 | Ga0068851_10170550 | |||
| 1330 | Ga0068851_10229280 | |||
| 1331 | Ga0068851_10337367 | |||
| 1332 | Ga0068870_10042542 | |||
| 1333 | Ga0068870_10272224 | |||
| 1334 | Ga0068863_100001058 | |||
| 1335 | Ga0068863_100016960 | |||
| 1336 | Ga0068863_100086089 | |||
| 1337 | Ga0068863_100640728 | |||
| 1338 | Ga0068858_100008721 | |||
| 1339 | Ga0068858_100184416 | |||
| 1340 | Ga0068858_100185624 | |||
| 1341 | Ga0068858_100222577 | |||
| 1342 | Ga0068858_100225118 | |||
| 1343 | Ga0068858_100625037 | |||
| 1344 | Ga0068858_101153919 | |||
| 1345 | Ga0068860_100007046 | |||
| 1346 | Ga0068860_100010672 | |||
| 1347 | Ga0068860_100031416 | |||
| 1348 | Ga0068860_100054255 | |||
| 1349 | Ga0068860_100108260 | |||
| 1350 | Ga0068860_100394158 | |||
| 1351 | Ga0068860_100403432 | |||
| 1352 | Ga0068860_100476426 | |||
| 1353 | Ga0068860_100568048 | |||
| 1354 | Ga0068862_100020317 | |||
| 1355 | Ga0068862_100051872 | |||
| 1356 | Ga0068862_100227169 | |||
| 1357 | Ga0068862_100272610 | |||
| 1358 | Ga0081540_1002465 | |||
| 1359 | Ga0081539_10000622 | |||
| 1360 | Ga0070715_10116530 | |||
| 1361 | Ga0075366_10004245 | |||
| 1362 | Ga0075366_10029867 | |||
| 1363 | Ga0075366_10167008 | |||
| 1364 | Ga0075366_10190988 | |||
| 1365 | Ga0097621_100027576 | |||
| 1366 | Ga0097621_100138420 | |||
| 1367 | Ga0097621_100273291 | |||
| 1368 | Ga0097621_100520658 | |||
| 1369 | Ga0097621_100720769 | |||
| 1370 | Ga0097621_101179396 | |||
| 1371 | Ga0097621_102099047 | |||
| 1372 | Ga0068871_100003860 | |||
| 1373 | Ga0068871_100131843 | |||
| 1374 | Ga0068871_100194192 | |||
| 1375 | Ga0068871_100201149 | |||
| 1376 | Ga0068871_100234064 | |||
| 1377 | Ga0068871_100340384 | |||
| 1378 | Ga0068871_100391876 | |||
| 1379 | Ga0068871_100513554 | |||
| 1380 | Ga0068871_100848649 | |||
| 1381 | Ga0068871_101301985 | |||
| 1382 | Ga0075428_100004493 | |||
| 1383 | Ga0075428_100006287 | |||
| 1384 | Ga0075428_100184136 | |||
| 1385 | Ga0075430_100001704 | |||
| 1386 | Ga0075430_100079490 | |||
| 1387 | Ga0075431_100001979 | |||
| 1388 | Ga0075431_100004445 | |||
| 1389 | Ga0075431_100304740 | |||
| 1390 | Ga0075431_101766056 | |||
| 1391 | Ga0075429_100009495 | |||
| 1392 | Ga0075429_100027574 | |||
| 1393 | Ga0075429_100667119 | |||
| 1394 | Ga0068865_100005349 | |||
| 1395 | Ga0068865_100064557 | |||
| 1396 | Ga0068865_100066850 | |||
| 1397 | Ga0068865_100095451 | |||
| 1398 | Ga0068865_100115404 | |||
| 1399 | Ga0068865_100393970 | |||
| 1400 | Ga0097620_100000013 | |||
| 1401 | Ga0097620_100023509 | |||
| 1402 | Ga0097620_100037391 | |||
| 1403 | Ga0097620_100059898 | |||
| 1404 | Ga0097620_100115690 | |||
| 1405 | Ga0097620_100154169 | |||
| 1406 | Ga0097620_100215933 | |||
| 1407 | Ga0097620_100270951 | |||
| 1408 | Ga0097620_100286547 | |||
| 1409 | Ga0097620_100317453 | |||
| 1410 | Ga0097620_100414818 | |||
| 1411 | Ga0097620_100664680 | |||
| 1412 | Ga0097620_100708124 | |||
| 1413 | Ga0097620_100774972 | |||
| 1414 | Ga0097620_101438027 | |||
| 1415 | Ga0105240_10000445 | |||
| 1416 | Ga0105240_10000597 | |||
| 1417 | Ga0105240_10001169 | |||
| 1418 | Ga0105240_10004801 | |||
| 1419 | Ga0105240_10048480 | |||
| 1420 | Ga0105240_10096013 | |||
| 1421 | Ga0105240_10428914 | |||
| 1422 | Ga0105240_10463039 | |||
| 1423 | Ga0105240_10851145 | |||
| 1424 | Ga0105240_10927471 | |||
| 1425 | Ga0111539_10029563 | |||
| 1426 | Ga0111539_10220895 | |||
| 1427 | Ga0111539_10311084 | |||
| 1428 | Ga0111539_10364302 | |||
| 1429 | Ga0111539_11299339 | |||
| 1430 | Ga0111539_11719637 | |||
| 1431 | Ga0105245_10204984 | |||
| 1432 | Ga0105245_11620913 | |||
| 1433 | Ga0105247_10000408 | |||
| 1434 | Ga0105247_10006290 | |||
| 1435 | Ga0105247_10233189 | |||
| 1436 | Ga0114129_10017155 | |||
| 1437 | Ga0114129_10025999 | |||
| 1438 | Ga0114129_10107082 | |||
| 1439 | Ga0114129_10209240 | |||
| 1440 | Ga0105243_11311175 | |||
| 1441 | Ga0105241_10000607 | |||
| 1442 | Ga0105241_10000920 | |||
| 1443 | Ga0105241_10023912 | |||
| 1444 | Ga0105241_10103018 | |||
| 1445 | Ga0105241_10203219 | |||
| 1446 | Ga0105241_10266422 | |||
| 1447 | Ga0105241_10335890 | |||
| 1448 | Ga0105241_10346384 | |||
| 1449 | Ga0105241_10548891 | |||
| 1450 | Ga0105241_10844738 | |||
| 1451 | Ga0105242_10034221 | |||
| 1452 | Ga0105242_10036616 | |||
| 1453 | Ga0105242_10082962 | |||
| 1454 | Ga0105242_10097396 | |||
| 1455 | Ga0105242_10131153 | |||
| 1456 | Ga0105248_10661174 | |||
| 1457 | Ga0105237_10000294 | |||
| 1458 | Ga0105237_10000379 | |||
| 1459 | Ga0105237_10005546 | |||
| 1460 | Ga0105237_10015830 | |||
| 1461 | Ga0105237_10018568 | |||
| 1462 | Ga0105237_10019707 | |||
| 1463 | Ga0105237_10171652 | |||
| 1464 | Ga0105237_11481182 | |||
| 1465 | Ga0105237_11896579 | |||
| 1466 | Ga0105238_10051017 | |||
| 1467 | Ga0105238_10102156 | |||
| 1468 | Ga0105238_10191824 | |||
| 1469 | Ga0105249_10000911 | |||
| 1470 | Ga0105249_10014002 | |||
| 1471 | Ga0105249_10059437 | |||
| 1472 | Ga0105249_10094951 | |||
| 1473 | Ga0105249_10102443 | |||
| 1474 | Ga0105249_10105642 | |||
| 1475 | Ga0105249_10399727 | |||
| 1476 | Ga0105249_10448126 | |||
| 1477 | Ga0105249_10464415 | |||
| 1478 | Ga0105249_10559526 | |||
| 1479 | Ga0105249_11392722 | |||
| 1480 | Ga0105239_10000628 | |||
| 1481 | Ga0105239_10001099 | |||
| 1482 | Ga0105239_10002389 | |||
| 1483 | Ga0105239_10005474 | |||
| 1484 | Ga0105239_10031608 | |||
| 1485 | Ga0105239_10183305 | |||
| 1486 | Ga0105239_10205317 | |||
| 1487 | Ga0105239_10206398 | |||
| 1488 | Ga0105239_10451242 | |||
| 1489 | Ga0105239_10459382 | |||
| 1490 | Ga0105239_11419349 | |||
| 1491 | Ga0105246_10006786 | |||
| 1492 | Ga0105246_10025841 | |||
| 1493 | Ga0105246_10030904 | |||
| 1494 | Ga0105246_10202600 | |||
| 1495 | Ga0105246_10227029 | |||
| 1496 | Ga0157325_1013106 | |||
| 1497 | Ga0157339_1032814 | |||
| 1498 | Ga0157373_10013242 | |||
| 1499 | Ga0157373_10196141 | |||
| 1500 | Ga0157373_10258420 | |||
| 1501 | Ga0157373_10261860 | |||
| 1502 | Ga0157371_10024279 | |||
| 1503 | Ga0157371_10063383 | |||
| 1504 | Ga0157371_10261485 | |||
| 1505 | Ga0157370_10004027 | |||
| 1506 | Ga0157370_10008237 | |||
| 1507 | Ga0157370_10014566 | |||
| 1508 | Ga0157370_10378380 | |||
| 1509 | Ga0157369_10004023 | |||
| 1510 | Ga0157369_10039153 | |||
| 1511 | Ga0157369_10089290 | |||
| 1512 | Ga0157369_10133662 | |||
| 1513 | Ga0157374_10000027 | |||
| 1514 | Ga0157374_10011739 | |||
| 1515 | Ga0157374_10020540 | |||
| 1516 | Ga0157374_10248196 | |||
| 1517 | Ga0157374_10421973 | |||
| 1518 | Ga0157378_10001243 | |||
| 1519 | Ga0157378_10003796 | |||
| 1520 | Ga0157378_10017269 | |||
| 1521 | Ga0157378_10023553 | |||
| 1522 | Ga0157378_10026251 | |||
| 1523 | Ga0157378_10247973 | |||
| 1524 | Ga0157378_10261598 | |||
| 1525 | Ga0157378_10264251 | |||
| 1526 | Ga0157378_10303547 | |||
| 1527 | Ga0157378_10450110 | |||
| 1528 | Ga0157378_10569826 | |||
| 1529 | Ga0157378_10626895 | |||
| 1530 | Ga0157378_10933149 | |||
| 1531 | Ga0157378_11458145 | |||
| 1532 | Ga0163162_10000722 | |||
| 1533 | Ga0163162_10055403 | |||
| 1534 | Ga0163162_10184626 | |||
| 1535 | Ga0163162_10710167 | |||
| 1536 | Ga0163162_11525313 | |||
| 1537 | Ga0163162_11559007 | |||
| 1538 | Ga0157372_10001266 | |||
| 1539 | Ga0157372_10002206 | |||
| 1540 | Ga0157372_10025127 | |||
| 1541 | Ga0157372_10027244 | |||
| 1542 | Ga0157372_10042294 | |||
| 1543 | Ga0157372_10191750 | |||
| 1544 | Ga0157372_10465238 | |||
| 1545 | Ga0157372_10542150 | |||
| 1546 | Ga0157372_10603801 | |||
| 1547 | Ga0157372_10855055 | |||
| 1548 | Ga0157372_10913371 | |||
| 1549 | Ga0157372_11413211 | |||
| 1550 | Ga0157372_11869793 | |||
| 1551 | Ga0157372_12415098 | |||
| 1552 | Ga0157375_10015089 | |||
| 1553 | Ga0157375_10126515 | |||
| 1554 | Ga0157375_10159417 | |||
| 1555 | Ga0157375_10189293 | |||
| 1556 | Ga0157375_10265845 | |||
| 1557 | Ga0157375_10288357 | |||
| 1558 | Ga0157375_10371194 | |||
| 1559 | Ga0157375_10744611 | |||
| 1560 | Ga0157375_10874750 | |||
| 1561 | Ga0157375_10930105 | |||
| 1562 | Ga0163163_10059543 | |||
| 1563 | Ga0163163_10192411 | |||
| 1564 | Ga0163163_10234162 | |||
| 1565 | Ga0163163_10418196 | |||
| 1566 | Ga0163163_10441910 | |||
| 1567 | Ga0163163_10517481 | |||
| 1568 | Ga0163163_10592073 | |||
| 1569 | Ga0163163_11379723 | |||
| 1570 | Ga0157380_10003383 | |||
| 1571 | Ga0157380_10013238 | |||
| 1572 | Ga0157380_10284713 | |||
| 1573 | Ga0157380_10512076 | |||
| 1574 | Ga0157380_10744300 | |||
| 1575 | Ga0157380_11080625 | |||
| 1576 | Ga0157377_10021504 | |||
| 1577 | Ga0157377_10040540 | |||
| 1578 | Ga0157377_10310854 | |||
| 1579 | Ga0157377_10330490 | |||
| 1580 | Ga0157377_10359563 | |||
| 1581 | Ga0157379_10131221 | |||
| 1582 | Ga0157379_10172452 | |||
| 1583 | Ga0157379_10343194 | |||
| 1584 | Ga0157379_10515704 | |||
| 1585 | Ga0157379_11262786 | |||
| 1586 | Ga0157379_11362665 | |||
| 1587 | Ga0157376_10000304 | |||
| 1588 | Ga0157376_10001243 | |||
| 1589 | Ga0157376_10138281 | |||
| 1590 | Ga0157376_10747791 | |||
| 1591 | Ga0157376_10920300 | |||
| 1592 | Ga0157376_11193278 | |||
| 1593 | Ga0157376_11406348 | |||
| 1594 | Ga0157376_11441929 | |||
| 1595 | Ga0182005_1283711 | |||
| 1596 | Ga0163161_10030053 | |||
| 1597 | Ga0163161_10259246 | |||
| 1598 | Ga0163161_10940145 | |||
| 1599 | Ga0184599_107303 | |||
| 1600 | Ga0206352_10624817 | |||
| 1601 | Ga0209646_1002470 | |||
| 1602 | Ga0207666_1007756 | |||
| 1603 | Ga0207697_10123714 | |||
| 1604 | Ga0207656_10004462 | |||
| 1605 | Ga0207656_10023988 | |||
| 1606 | Ga0207656_10024644 | |||
| 1607 | Ga0207656_10291150 | |||
| 1608 | Ga0207682_10006822 | |||
| 1609 | Ga0207682_10030762 | |||
| 1610 | Ga0207642_10014031 | |||
| 1611 | Ga0207642_10315857 | |||
| 1612 | Ga0207642_10851484 | |||
| 1613 | Ga0207710_10001389 | |||
| 1614 | Ga0207710_10020943 | |||
| 1615 | Ga0207688_10009249 | |||
| 1616 | Ga0207688_10009990 | |||
| 1617 | Ga0207680_10000113 | |||
| 1618 | Ga0207680_10018056 | |||
| 1619 | Ga0207680_10133077 | |||
| 1620 | Ga0207680_10960669 | |||
| 1621 | Ga0207647_10035197 | |||
| 1622 | Ga0207647_10203390 | |||
| 1623 | Ga0207645_10000733 | |||
| 1624 | Ga0207645_10019738 | |||
| 1625 | Ga0207645_10035397 | |||
| 1626 | Ga0207645_10414862 | |||
| 1627 | Ga0207645_10780861 | |||
| 1628 | Ga0207643_10169908 | |||
| 1629 | Ga0207643_10502168 | |||
| 1630 | Ga0207643_10683874 | |||
| 1631 | Ga0207705_10109588 | |||
| 1632 | Ga0207705_10693816 | |||
| 1633 | Ga0207705_10906409 | |||
| 1634 | Ga0207654_10007676 | |||
| 1635 | Ga0207654_10009841 | |||
| 1636 | Ga0207654_10023175 | |||
| 1637 | Ga0207654_10067317 | |||
| 1638 | Ga0207654_10108370 | |||
| 1639 | Ga0207654_10531494 | |||
| 1640 | Ga0207707_10157806 | |||
| 1641 | Ga0207707_10165578 | |||
| 1642 | Ga0207695_10000087 | |||
| 1643 | Ga0207695_10000299 | |||
| 1644 | Ga0207695_10000676 | |||
| 1645 | Ga0207695_10002728 | |||
| 1646 | Ga0207695_10026034 | |||
| 1647 | Ga0207695_10037664 | |||
| 1648 | Ga0207695_10040779 | |||
| 1649 | Ga0207695_10314102 | |||
| 1650 | Ga0207695_10634855 | |||
| 1651 | Ga0207695_11222649 | |||
| 1652 | Ga0207671_10000965 | |||
| 1653 | Ga0207671_10001222 | |||
| 1654 | Ga0207671_10003407 | |||
| 1655 | Ga0207671_10009011 | |||
| 1656 | Ga0207671_10017027 | |||
| 1657 | Ga0207671_10085221 | |||
| 1658 | Ga0207663_11059169 | |||
| 1659 | Ga0207662_10015085 | |||
| 1660 | Ga0207662_10191046 | |||
| 1661 | Ga0207657_10001373 | |||
| 1662 | Ga0207657_10050779 | |||
| 1663 | Ga0207657_10747833 | |||
| 1664 | Ga0207652_10062132 | |||
| 1665 | Ga0207681_10010004 | |||
| 1666 | Ga0207681_10041427 | |||
| 1667 | Ga0207681_10079746 | |||
| 1668 | Ga0207681_10229826 | |||
| 1669 | Ga0207681_10346393 | |||
| 1670 | Ga0207694_10015300 | |||
| 1671 | Ga0207694_10038282 | |||
| 1672 | Ga0207694_10101719 | |||
| 1673 | Ga0207694_11100599 | |||
| 1674 | Ga0207650_10059459 | |||
| 1675 | Ga0207650_10116856 | |||
| 1676 | Ga0207650_10263481 | |||
| 1677 | Ga0207650_10289002 | |||
| 1678 | Ga0207650_10810329 | |||
| 1679 | Ga0207650_10915450 | |||
| 1680 | Ga0207650_11164017 | |||
| 1681 | Ga0207650_11658155 | |||
| 1682 | Ga0207659_10360295 | |||
| 1683 | Ga0207659_10501664 | |||
| 1684 | Ga0207687_10186070 | |||
| 1685 | Ga0207644_10100678 | |||
| 1686 | Ga0207644_10132991 | |||
| 1687 | Ga0207644_10210567 | |||
| 1688 | Ga0207690_10723990 | |||
| 1689 | Ga0207706_10005466 | |||
| 1690 | Ga0207706_10027139 | |||
| 1691 | Ga0207706_10066701 | |||
| 1692 | Ga0207706_10234127 | |||
| 1693 | Ga0207686_10007790 | |||
| 1694 | Ga0207686_10026021 | |||
| 1695 | Ga0207686_10060808 | |||
| 1696 | Ga0207686_10214760 | |||
| 1697 | Ga0207709_10324059 | |||
| 1698 | Ga0207709_10887322 | |||
| 1699 | Ga0207670_10015831 | |||
| 1700 | Ga0207670_10042643 | |||
| 1701 | Ga0207670_10283606 | |||
| 1702 | Ga0207670_10793623 | |||
| 1703 | Ga0207670_11209233 | |||
| 1704 | Ga0207669_10005474 | |||
| 1705 | Ga0207669_10061429 | |||
| 1706 | Ga0207669_10110638 | |||
| 1707 | Ga0207669_10178137 | |||
| 1708 | Ga0207669_10796232 | |||
| 1709 | Ga0207704_10059624 | |||
| 1710 | Ga0207704_10099775 | |||
| 1711 | Ga0207704_10767102 | |||
| 1712 | Ga0207691_10027475 | |||
| 1713 | Ga0207691_10027486 | |||
| 1714 | Ga0207691_10210104 | |||
| 1715 | Ga0207691_10211035 | |||
| 1716 | Ga0207691_10229673 | |||
| 1717 | Ga0207691_10475903 | |||
| 1718 | Ga0207691_10903771 | |||
| 1719 | Ga0207691_11484503 | |||
| 1720 | Ga0207689_10000380 | |||
| 1721 | Ga0207689_10001184 | |||
| 1722 | Ga0207689_10005168 | |||
| 1723 | Ga0207689_10012109 | |||
| 1724 | Ga0207689_10033947 | |||
| 1725 | Ga0207689_10147967 | |||
| 1726 | Ga0207689_10182040 | |||
| 1727 | Ga0207689_10560041 | |||
| 1728 | Ga0207689_10761143 | |||
| 1729 | Ga0207689_11361904 | |||
| 1730 | Ga0207661_10040403 | |||
| 1731 | Ga0207661_10350642 | |||
| 1732 | Ga0207661_10822963 | |||
| 1733 | Ga0207661_10867433 | |||
| 1734 | Ga0207679_10017159 | |||
| 1735 | Ga0207679_10035092 | |||
| 1736 | Ga0207679_10147399 | |||
| 1737 | Ga0207679_10201780 | |||
| 1738 | Ga0207679_10393809 | |||
| 1739 | Ga0207679_11064151 | |||
| 1740 | Ga0207679_11513051 | |||
| 1741 | Ga0207667_10000172 | |||
| 1742 | Ga0207667_10001462 | |||
| 1743 | Ga0207667_10001812 | |||
| 1744 | Ga0207667_10068944 | |||
| 1745 | Ga0207667_10423946 | |||
| 1746 | Ga0207651_10100448 | |||
| 1747 | Ga0207651_10112293 | |||
| 1748 | Ga0207651_10163621 | |||
| 1749 | Ga0207651_10212223 | |||
| 1750 | Ga0207651_11366085 | |||
| 1751 | Ga0207651_11693858 | |||
| 1752 | Ga0207712_10001901 | |||
| 1753 | Ga0207712_10002225 | |||
| 1754 | Ga0207712_10030178 | |||
| 1755 | Ga0207712_10293518 | |||
| 1756 | Ga0207668_10097215 | |||
| 1757 | Ga0207668_10125097 | |||
| 1758 | Ga0207668_10170188 | |||
| 1759 | Ga0207668_10263967 | |||
| 1760 | Ga0207640_10065994 | |||
| 1761 | Ga0207640_10165858 | |||
| 1762 | Ga0207640_10216350 | |||
| 1763 | Ga0207640_11467956 | |||
| 1764 | Ga0207640_11534398 | |||
| 1765 | Ga0207640_11558290 | |||
| 1766 | Ga0207658_10003708 | |||
| 1767 | Ga0207658_10061585 | |||
| 1768 | Ga0207658_10328443 | |||
| 1769 | Ga0207658_10492984 | |||
| 1770 | Ga0207658_10650425 | |||
| 1771 | Ga0207677_10031330 | |||
| 1772 | Ga0207677_10053742 | |||
| 1773 | Ga0207677_10110431 | |||
| 1774 | Ga0207677_10196790 | |||
| 1775 | Ga0207677_10213509 | |||
| 1776 | Ga0207677_10420161 | |||
| 1777 | Ga0207677_10689796 | |||
| 1778 | Ga0207703_10036407 | |||
| 1779 | Ga0207703_10154592 | |||
| 1780 | Ga0207703_10207737 | |||
| 1781 | Ga0207703_10272585 | |||
| 1782 | Ga0207703_10675601 | |||
| 1783 | Ga0207703_10738163 | |||
| 1784 | Ga0207703_11161920 | |||
| 1785 | Ga0207639_10003650 | |||
| 1786 | Ga0207639_10055525 | |||
| 1787 | Ga0207639_10179286 | |||
| 1788 | Ga0207639_10380949 | |||
| 1789 | Ga0207639_10452144 | |||
| 1790 | Ga0207639_10570713 | |||
| 1791 | Ga0207639_10595695 | |||
| 1792 | Ga0207639_10982125 | |||
| 1793 | Ga0207639_11004308 | |||
| 1794 | Ga0207639_11035430 | |||
| 1795 | Ga0207639_11534443 | |||
| 1796 | Ga0207678_10024931 | |||
| 1797 | Ga0207708_10106639 | |||
| 1798 | Ga0207708_10599568 | |||
| 1799 | Ga0207708_11000894 | |||
| 1800 | Ga0207702_10238519 | |||
| 1801 | Ga0207702_10747995 | |||
| 1802 | Ga0207641_10000184 | |||
| 1803 | Ga0207641_10058960 | |||
| 1804 | Ga0207641_10088428 | |||
| 1805 | Ga0207641_10102006 | |||
| 1806 | Ga0207641_10339822 | |||
| 1807 | Ga0207641_10475159 | |||
| 1808 | Ga0207648_10001353 | |||
| 1809 | Ga0207648_10003727 | |||
| 1810 | Ga0207648_10270402 | |||
| 1811 | Ga0207648_10823376 | |||
| 1812 | Ga0207648_10862061 | |||
| 1813 | Ga0207676_10001997 | |||
| 1814 | Ga0207676_10105182 | |||
| 1815 | Ga0207676_10116789 | |||
| 1816 | Ga0207676_10125290 | |||
| 1817 | Ga0207676_10200625 | |||
| 1818 | Ga0207674_10016309 | |||
| 1819 | Ga0207674_10016912 | |||
| 1820 | Ga0207674_10017831 | |||
| 1821 | Ga0207674_10017880 | |||
| 1822 | Ga0207674_10037545 | |||
| 1823 | Ga0207674_10199773 | |||
| 1824 | Ga0207674_10410623 | |||
| 1825 | Ga0207674_10484227 | |||
| 1826 | Ga0207674_10671071 | |||
| 1827 | Ga0207674_11903963 | |||
| 1828 | Ga0207675_100014073 | |||
| 1829 | Ga0207675_100027316 | |||
| 1830 | Ga0207675_100044779 | |||
| 1831 | Ga0207675_100190750 | |||
| 1832 | Ga0207675_100192283 | |||
| 1833 | Ga0207675_100213583 | |||
| 1834 | Ga0207675_100709255 | |||
| 1835 | Ga0207675_102330803 | |||
| 1836 | Ga0207683_10002586 | |||
| 1837 | Ga0207683_10034739 | |||
| 1838 | Ga0207683_10133808 | |||
| 1839 | Ga0207683_10358985 | |||
| 1840 | Ga0207698_10003372 | |||
| 1841 | Ga0207698_10069458 | |||
| 1842 | Ga0207698_10080184 | |||
| 1843 | Ga0207698_10112921 | |||
| 1844 | Ga0207698_10346137 | |||
| 1845 | Ga0207698_10404869 | |||
| 1846 | Ga0207698_10818463 | |||
| 1847 | Ga0207698_11128481 | |||
| 1848 | Ga0207698_11219734 | |||
| 1849 | Ga0207698_11806223 | |||
| 1850 | Ga0209995_1033985 | |||
| 1851 | Ga0268266_10000104 | |||
| 1852 | Ga0268266_10552442 | |||
| 1853 | Ga0268265_10029947 | |||
| 1854 | Ga0268265_10077127 | |||
| 1855 | Ga0268265_10267189 | |||
| 1856 | Ga0268265_10296879 | |||
| 1857 | Ga0268265_10785963 | |||
| 1858 | Ga0268265_11029131 | |||
| 1859 | Ga0268264_10012233 | |||
| 1860 | Ga0268264_10017697 | |||
| 1861 | Ga0268264_10022803 | |||
| 1862 | Ga0268264_10036688 | |||
| 1863 | Ga0268264_10118436 | |||
| 1864 | Ga0268264_10414387 | |||
| 1865 | Ga0268264_10564910 | |||
| 1866 | Ga0268264_10809682 | |||
| 1867 | Ga0268264_11126813 | |||
| 1868 | Ga0307517_10002234 | |||
| 1869 | Ga0307517_10258767 | |||
| 1870 | Ga0307517_10568992 | |||
| 1871 | Ga0307511_10000002 | |||
| 1872 | Ga0265327_10149322 | |||
| 1873 | Ga0307513_10106773 | |||
| 1874 | Ga0307513_10608136 | |||
| 1875 | Ga0307509_10030579 | |||
| 1876 | Ga0307509_10080126 | |||
| 1877 | Ga0307509_10162480 | |||
| 1878 | Ga0265313_10056037 | |||
| 1879 | Ga0265313_10083679 | |||
| 1880 | Ga0307508_10000969 | |||
| 1881 | Ga0307516_10000486 | |||
| 1882 | Ga0307516_10137106 | |||
| 1883 | Ga0307516_10272981 | |||
| 1884 | Ga0307413_10371435 | |||
| 1885 | Ga0307410_10012506 | |||
| 1886 | Ga0307410_10183522 | |||
| 1887 | Ga0307406_10153770 | |||
| 1888 | Ga0307412_10330224 | |||
| 1889 | Ga0307414_10067866 | |||
| 1890 | Ga0307414_10080824 | |||
| 1891 | Ga0307414_10095291 | |||
| 1892 | Ga0307411_10256316 | |||
| 1893 | Ga0307415_100451128 | |||
| 1894 | Ga0307510_10002428 | |||
| 1895 | Ga0373952_0099225 | |||
| 1896 | Ga0373931_0225963 | |||
| 1897 | Ga0373935_0545526 | |||
| 1898 | Ga0373947_0072118 | |||
| 1899 | Ga0373947_0537936 | |||
| 1900 | Ga0373937_0071372 | |||
| 1901 | Ga0373925_0441226 | |||
| 1902 | Ga0395900_0331586 | |||
| 1903 | Ga0395905_1168144 | |||
| 1904 | Ga0439436_0000137 | |||
| 1905 | Ga0439436_0029590 | |||
| 1906 | Ga0439465_0090303 | |||
| 1907 | Ga0451791_1067968 | |||
| 1908 | Ga0451791_1278243 | |||
| 1909 | Ga0451797_0540034 | |||
| 1910 | Ga0451798_0465207 | |||
| 1911 | Ga0451807_2273190 | |||
| 1912 | Ga0451835_0566391 | |||
| 1913 | Ga0451839_0589464 | |||
| 1914 | Ga0451849_1288791 | |||
| 1915 | Ga0439431_0018393 | |||
| 1916 | Ga0439441_004078 | |||
| 1917 | Ga0439442_021501 | |||
| 1918 | Ga0439443_013499 | |||
| 1919 | Ga0439445_0004845 | |||
| 1920 | Ga0439445_0041855 | |||
| 1921 | Ga0439449_0026441 | |||
| 1922 | Ga0439454_036926 | |||
| 1923 | Ga0439457_000860 | |||
| 1924 | Ga0439462_0003058 | |||
| 1925 | Ga0439462_0196415 | |||
| 1926 | Ga0450920_046578 | |||
| 1927 | Ga0450897_015515 | |||
| 1928 | Ga0450896_015092 | |||
| 1929 | Ga0450898_002958 | |||
| 1930 | Ga0450899_009552 | |||
| 1931 | Ga0439446_0128623 | |||
| 1932 | Ga0439434_0017033 | |||
| 1933 | Ga0450893_0054143 | |||
| 1934 | Ga0451577_0083254 | |||
| 1935 | Ga0466969_0000514 | |||
| 1936 | Ga0466969_0119554 | |||
| 1937 | Ga0466972_0001500 | |||
| 1938 | Ga0466972_0045477 | |||
| 1939 | Ga0466972_0086690 | |||
| 1940 | Ga0466966_0000242 | |||
| 1941 | Ga0466966_0473712 | |||
| 1942 | Ga0466961_0157131 | |||
| 1943 | Ga0466961_0303481 | |||
| 1944 | Ga0466964_0119378 | |||
| 1945 | Ga0453684_0323910 | |||
| 1946 | Ga0466971_0007611 | |||
| 1947 | Ga0466971_0277681 | |||
| 1948 | Ga0466968_0005140 | |||
| 1949 | Ga0466968_0224926 | |||
| 1950 | Ga0466957_0127759 | |||
| 1951 | Ga0466957_0676247 | |||
| 1952 | Ga0466960_0751461 | |||
| 1953 | Ga0466959_0000045 | |||
| 1954 | Ga0466959_0005062 | |||
| 1955 | Ga0495638_0523421 | |||
| 1956 | Ga0495650_0007919 | |||
| 1957 | Ga0495650_0103847 | |||
| 1958 | Ga0495606_0003901 | |||
| 1959 | Ga0495643_0034626 | |||
| 1960 | Ga0495648_0003009 | |||
| 1961 | Ga0495621_0097219 | |||
| 1962 | Ga0495668_0004365 | |||
| 1963 | Ga0495668_0485907 | |||
| 1964 | Ga0495611_0000065 | |||
| 1965 | Ga0495611_0329244 | |||
| 1966 | Ga0495625_0116120 | |||
| 1967 | Ga0495657_0711501 | |||
| 1968 | Ga0495646_0699034 | |||
| 1969 | Ga0495649_0144455 | |||
| 1970 | Ga0495649_0176604 | |||
| 1971 | Ga0495649_0636655 | |||
| 1972 | Ga0495672_0065528 | |||
| 1973 | Ga0495672_0365029 | |||
| 1974 | Ga0495687_000129 | |||
| 1975 | Ga0495686_0000005 | |||
| 1976 | Ga0495686_0022603 | |||
| 1977 | Ga0495686_0449759 | |||
| 1978 | Ga0496108_1061606 | |||
| 1979 | Ga0496110_0425840 | |||
| 1980 | Ga0496115_0292137 | |||
| 1981 | Ga0501296_068221 | |||
| 1982 | Ga0501315_023229 | |||
| 1983 | Ga0501336_016860 | |||
| 1984 | Ga0501032_0028617 | |||
| 1985 | Ga0501032_0186921 | |||
| 1986 | Ga0501032_0926497 | |||
| 1987 | Ga0501033_0800208 | |||
| 1988 | Ga0501034_0000937 | |||
| 1989 | Ga0501034_0019334 | |||
| 1990 | Ga0501034_0123084 | |||
| 1991 | Ga0501034_1139536 | |||
| 1992 | Ga0501036_0008894 | |||
| 1993 | Ga0501036_0308194 | |||
| 1994 | Ga0501037_0000718 | |||
| 1995 | Ga0501037_0008646 | |||
| 1996 | Ga0501037_0121290 | |||
| 1997 | Ga0501038_0005004 | |||
| 1998 | Ga0501038_0086961 | |||
| 1999 | Ga0501039_0038233 | |||
| 2000 | Ga0501043_0004294 | |||
| 2001 | Ga0501043_0041216 | |||
| 2002 | Ga0501043_0300355 | |||
| 2003 | Ga0501046_0073318 | |||
| 2004 | Ga0501046_0978880 | |||
| 2005 | Ga0501047_0003596 | |||
| 2006 | Ga0501047_0033530 | |||
| 2007 | Ga0501047_0548271 | |||
| 2008 | Ga0501071_1055186 | |||
| 2009 | Ga0501072_0188734 | |||
| 2010 | Ga0501206_030542 | |||
| 2011 | Ga0501207_046978 | |||
| 2012 | Ga0501209_257325 | |||
| 2013 | Ga0501217_043386 | |||
| 2014 | Ga0501217_057204 | |||
| 2015 | Ga0501217_059515 | |||
| 2016 | Ga0501228_006760 | |||
| 2017 | Ga0501230_067973 | |||
| 2018 | Ga0501233_043893 | |||
| 2019 | Ga0501240_008856 | |||
| 2020 | Ga0501257_085348 | |||
| 2021 | Ga0501259_090263 | |||
| 2022 | Ga0501219_000343 | |||
| 2023 | Ga0501221_074593 | |||
| 2024 | Ga0501225_0010764 | |||
| 2025 | Ga0501080_0464217 | |||
| 2026 | Ga0501035_0000916 | |||
| 2027 | Ga0501035_0278317 | |||
| 2028 | Ga0501044_0002695 | |||
| 2029 | Ga0501044_0003481 | |||
| 2030 | Ga0501044_0007349 | |||
| 2031 | Ga0501044_0119774 | |||
| 2032 | Ga0501044_0560823 | |||
| 2033 | Ga0501284_00007 | |||
| 2034 | nmdc:mga0k408_13393_c1 | |||
| 2035 | nmdc:mga0k408_155043_c1 | |||
| 2036 | nmdc:mga0k408_20773_c1 | |||
| 2037 | nmdc:mga0k408_305483_c1 | |||
| 2038 | nmdc:mga0k408_53167_c1 | |||
| 2039 | nmdc:mga0k408_66805_c1 | |||
| 2040 | nmdc:mga05p37_18486_c1 | |||
| 2041 | nmdc:mga05p37_26669_c1 | |||
| 2042 | nmdc:mga05p37_66791_c1 | |||
| 2043 | nmdc:mga09592_4549_c1 | |||
| 2044 | nmdc:mga0qj67_17410_c1 | |||
| 2045 | nmdc:mga0qj67_74104_c1 | |||
| 2046 | nmdc:mga06r32_188981_c1 | |||
| 2047 | nmdc:mga06r32_259487_c1 | |||
| 2048 | nmdc:mga06r32_6055_c1 | |||
| 2049 | nmdc:mga08y16_198056_c1 | |||
| 2050 | nmdc:mga08y16_311888_c1 | |||
| 2051 | nmdc:mga08y16_864603_c1 | |||
| 2052 | Ga0500578_0000026 | |||
| 2053 | Ga0500578_0045550 | |||
| 2054 | Ga0500578_0143837 | |||
| 2055 | Ga0500578_0381609 | |||
| 2056 | Ga0500646_0017575 | |||
| 2057 | Ga0500646_0018495 | |||
| 2058 | Ga0500646_0037505 | |||
| 2059 | Ga0500646_0048905 | |||
| 2060 | Ga0500583_0000001 | |||
| 2061 | Ga0500583_0000770 | |||
| 2062 | Ga0500583_0007230 | |||
| 2063 | Ga0500583_0021694 | |||
| 2064 | Ga0500650_0116018 | |||
| 2065 | Ga0500555_005151 | |||
| 2066 | Ga0500572_121816 | |||
| 2067 | Ga0500594_0130185 | |||
| 2068 | Ga0500642_0048455 | |||
| 2069 | Ga0500652_014603 | |||
| 2070 | Ga0500559_0165661 | |||
| 2071 | Ga0500559_0215070 | |||
| 2072 | Ga0500568_0000088 | |||
| 2073 | Ga0500577_0172052 | |||
| 2074 | Ga0500588_0113411 | |||
| 2075 | Ga0500588_0168463 | |||
| 2076 | Ga0500604_0000889 | |||
| 2077 | Ga0500604_0012386 | |||
| 2078 | Ga0500604_0101584 | |||
| 2079 | Ga0500622_0001195 | |||
| 2080 | Ga0500622_0090233 | |||
| 2081 | Ga0500622_0170848 | |||
| 2082 | Ga0500639_029716 | |||
| 2083 | Ga0500636_0237004 | |||
| 2084 | Ga0500637_0398215 | |||
| 2085 | Ga0500570_187542 | |||
| 2086 | Ga0500611_000038 | |||
| 2087 | Ga0500661_031858 | |||
| 2088 | Ga0466962_0019883 | |||
| 2089 | 2738725299 | |||
| 2090 | 2914762744 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8iuh-assembly1.cif.gz_O | rna polymerase iii pre-initiation complex open complex 1 | 0.9258 | 18 | 80 |
| 2xub-assembly1.cif.gz_A | human rpc62 subunit structure | 0.9144 | 18 | 79 |
| 2fu4-assembly1.cif.gz_A | crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) | 0.9041 | 6 | 80 |
| 5k1y-assembly1.cif.gz_B | p2(1) structure of pnob8 aspa-dna complex | 0.8954 | 19 | 81 |
| 4rs8-assembly1.cif.gz_B | apo structure of novel pnob8 plasmid centromere binding protein | 0.8931 | 17 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rb3D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9188 | 5 | 79 | 1.10.10.10 |
| af_O94553_12_71_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9149 | 21 | 78 | 1.10.10.10 |
| af_Q4DPL3_4_78_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9142 | 18 | 81 | 1.10.10.10 |
| 5fd6D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.914 | 5 | 78 | 1.10.10.10 |
| 4rb1A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9129 | 5 | 79 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537JH14-F1-model_v4 | Transcriptional repressor | 0.9833 | 1 | 137 |
GO:0000976
GO:0003700 GO:0005737 GO:0008270 GO:0045892 GO:1900376 |
| AF-A0A2T7Q837-F1-model_v4 | Fur family transcriptional regulator | 0.9788 | 1 | 136 |
GO:0000976
GO:0003700 GO:0005737 GO:0008270 GO:0045892 GO:1900376 |
| AF-A0A4Q5V220-F1-model_v4 | Transcriptional repressor | 0.9723 | 1 | 138 |
GO:0000976
GO:0003700 GO:0005737 GO:0008270 GO:0045892 GO:1900376 |
| AF-A0A537JH14-F1-model_v4 | Transcriptional repressor | 0.9693 | 1 | 137 |
GO:0000976
GO:0003700 GO:0005737 GO:0008270 GO:0045892 GO:1900376 |
| AF-A0A6C1QER7-F1-model_v4 | Transcriptional repressor | 0.9665 | 1 | 80 |
GO:0003700
GO:0005737 |