F488951

General Info

Members Datasets Scaffolds Average Seq Length
1046 300 2092 156

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100003911|Ga0070661_1000039118
Length 180
Sequence MPVGAGFPDVSHHPAGAGWARRFVFALPMNQIAELLPAAHVVLDVDVADKPALFARLGELFATSAGLSAATVAHSLAVREKLGSTGLGQGIAIPHGRLRGLKEAQGAFLRLAHAIPFDAPDGKPVSQVFVLLVPEHATDQHLQLLSELAQMFSEGAFRDRLAGATDVSGILSLIGAWQPE

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 2.58
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100003911 3300005344 Bacteria 10246
2 Ga0065715_10188279 3300005293 Bacteria 1431
3 Ga0070658_10031483 3300005327 Bacteria 4260
4 Ga0070658_10077907 3300005327 Bacteria 2719
5 Ga0070658_10369989 3300005327 Bacteria 1228
6 Ga0070676_10010995 3300005328 Bacteria 4916
7 Ga0070676_10014880 3300005328 Bacteria 4281
8 Ga0070676_10023779 3300005328 Bacteria 3445
9 Ga0070676_10085906 3300005328 Bacteria 1918
10 Ga0070676_10190251 3300005328 Bacteria 1339
11 Ga0070683_100072402 3300005329 Bacteria 3217
12 Ga0070690_100071816 3300005330 Bacteria 2249
13 Ga0070690_100115286 3300005330 Bacteria 1797
14 Ga0070690_100300902 3300005330 Unclassified 1150
15 Ga0070690_100318677 3300005330 Bacteria 1120
16 Ga0070690_100577606 3300005330 Bacteria 850
17 Ga0070690_100821884 3300005330 Bacteria 722
18 Ga0070670_100002786 3300005331 Bacteria 14457
19 Ga0070670_100005340 3300005331 Bacteria 10835
20 Ga0070670_100006511 3300005331 Bacteria 9888
21 Ga0070670_100139098 3300005331 Bacteria 2099
22 Ga0070670_100140538 3300005331 Bacteria 2088
23 Ga0070670_100196222 3300005331 Bacteria 1754
24 Ga0070670_100244679 3300005331 Bacteria 1562
25 Ga0070670_100467430 3300005331 Bacteria 1119
26 Ga0070670_100513286 3300005331 Bacteria 1067
27 Ga0070677_10000252 3300005333 Bacteria 18476
28 Ga0070677_10078884 3300005333 Bacteria 1404
29 Ga0070677_10140315 3300005333 Bacteria 1114
30 Ga0070677_10514672 3300005333 Bacteria 651
31 Ga0068869_100000356 3300005334 Bacteria 24579
32 Ga0068869_100017684 3300005334 Bacteria 4838
33 Ga0068869_100059995 3300005334 Bacteria 2786
34 Ga0068869_100636389 3300005334 Bacteria 904
35 Ga0070666_10001943 3300005335 Bacteria 12584
36 Ga0070666_10003411 3300005335 Bacteria 9626
37 Ga0070666_10053990 3300005335 Bacteria 2711
38 Ga0070666_10488360 3300005335 Bacteria 892
39 Ga0070666_10561472 3300005335 Unclassified 831
40 Ga0070680_100060710 3300005336 Bacteria 3094
41 Ga0070680_100096304 3300005336 Bacteria 2454
42 Ga0070682_100773487 3300005337 Unclassified 777
43 Ga0068868_100000799 3300005338 Bacteria 21312
44 Ga0068868_100005505 3300005338 Bacteria 8908
45 Ga0068868_100035532 3300005338 Bacteria 3852
46 Ga0068868_100127893 3300005338 Bacteria 2077
47 Ga0068868_100185071 3300005338 Bacteria 1730
48 Ga0068868_100194819 3300005338 Bacteria 1687
49 Ga0068868_100291409 3300005338 Bacteria 1384
50 Ga0068868_100336490 3300005338 Bacteria 1290
51 Ga0068868_101205883 3300005338 Bacteria 700
52 Ga0068868_101257481 3300005338 Bacteria 686
53 Ga0070660_100002638 3300005339 Bacteria 12331
54 Ga0070660_100444792 3300005339 Bacteria 1075
55 Ga0070689_100049799 3300005340 Bacteria 3235
56 Ga0070689_100181107 3300005340 Bacteria 1711
57 Ga0070689_100211701 3300005340 Bacteria 1587
58 Ga0070689_101275360 3300005340 Bacteria 661
59 Ga0070691_10294088 3300005341 Unclassified 885
60 Ga0070687_100028421 3300005343 Bacteria 2712
61 Ga0070687_100265858 3300005343 Bacteria 1073
62 Ga0070687_100630116 3300005343 Bacteria 740
63 Ga0070661_100007322 3300005344 Bacteria 7612
64 Ga0070661_100094469 3300005344 Bacteria 2216
65 Ga0070661_100797316 3300005344 Bacteria 775
66 Ga0070692_10124298 3300005345 Bacteria 1443
67 Ga0070692_10280049 3300005345 Bacteria 1010
68 Ga0070668_100001492 3300005347 Bacteria 16911
69 Ga0070668_100005665 3300005347 Bacteria 9256
70 Ga0070668_100006509 3300005347 Bacteria 8662
71 Ga0070668_100008798 3300005347 Bacteria 7499
72 Ga0070668_100012925 3300005347 Bacteria 6217
73 Ga0070668_100027856 3300005347 Bacteria 4289
74 Ga0070668_100091008 3300005347 Bacteria 2404
75 Ga0070668_100102887 3300005347 Bacteria 2265
76 Ga0070668_100232447 3300005347 Bacteria 1525
77 Ga0070668_100519634 3300005347 Bacteria 1033
78 Ga0070668_100768855 3300005347 Unclassified 854
79 Ga0070668_100870660 3300005347 Bacteria 804
80 Ga0070669_100002389 3300005353 Bacteria 13584
81 Ga0070669_100010868 3300005353 Bacteria 6462
82 Ga0070669_100041208 3300005353 Bacteria 3358
83 Ga0070669_100061451 3300005353 Bacteria 2760
84 Ga0070669_100197597 3300005353 Bacteria 1581
85 Ga0070669_100244239 3300005353 Bacteria 1427
86 Ga0070669_100383980 3300005353 Bacteria 1146
87 Ga0070669_100386343 3300005353 Bacteria 1142
88 Ga0070669_101135602 3300005353 Bacteria 674
89 Ga0070669_101630833 3300005353 Unclassified 562
90 Ga0070675_100000164 3300005354 Bacteria 40846
91 Ga0070675_100002499 3300005354 Bacteria 13762
92 Ga0070675_100029731 3300005354 Bacteria 4408
93 Ga0070675_100037600 3300005354 Bacteria 3944
94 Ga0070675_100038560 3300005354 Bacteria 3895
95 Ga0070675_100107562 3300005354 Bacteria 2355
96 Ga0070675_100170227 3300005354 Bacteria 1878
97 Ga0070675_100545198 3300005354 Bacteria 1048
98 Ga0070671_100007518 3300005355 Bacteria 8711
99 Ga0070671_100037323 3300005355 Bacteria 4029
100 Ga0070671_100037545 3300005355 Bacteria 4017
101 Ga0070671_100047540 3300005355 Bacteria 3568
102 Ga0070671_100367253 3300005355 Bacteria 1229
103 Ga0070671_100438183 3300005355 Unclassified 1120
104 Ga0070671_100796564 3300005355 Bacteria 823
105 Ga0070674_100011330 3300005356 Bacteria 5426
106 Ga0070674_100023059 3300005356 Bacteria 4022
107 Ga0070674_100049681 3300005356 Bacteria 2885
108 Ga0070674_100058876 3300005356 Bacteria 2672
109 Ga0070674_100084449 3300005356 Bacteria 2277
110 Ga0070674_100110955 3300005356 Bacteria 2014
111 Ga0070674_100260273 3300005356 Bacteria 1366
112 Ga0070674_100292894 3300005356 Bacteria 1295
113 Ga0070674_100332153 3300005356 Bacteria 1222
114 Ga0070673_100000332 3300005364 Bacteria 24730
115 Ga0070673_100010269 3300005364 Bacteria 6331
116 Ga0070673_100042339 3300005364 Bacteria 3511
117 Ga0070673_100102415 3300005364 Bacteria 2360
118 Ga0070673_100131285 3300005364 Bacteria 2102
119 Ga0070673_100146317 3300005364 Bacteria 1998
120 Ga0070673_100806956 3300005364 Bacteria 867
121 Ga0070673_100841579 3300005364 Bacteria 849
122 Ga0070673_101196797 3300005364 Bacteria 712
123 Ga0070688_100025305 3300005365 Bacteria 3514
124 Ga0070688_100069533 3300005365 Bacteria 2248
125 Ga0070688_100357996 3300005365 Bacteria 1070
126 Ga0070688_100478394 3300005365 Unclassified 936
127 Ga0070688_100493952 3300005365 Bacteria 922
128 Ga0070659_100007994 3300005366 Bacteria 7710
129 Ga0070659_100281382 3300005366 Bacteria 1384
130 Ga0070667_100001403 3300005367 Bacteria 21557
131 Ga0070667_100002052 3300005367 Bacteria 17830
132 Ga0070667_100059064 3300005367 Bacteria 3244
133 Ga0070667_100062152 3300005367 Bacteria 3163
134 Ga0070667_100063738 3300005367 Bacteria 3125
135 Ga0070703_10292480 3300005406 Unclassified 676
136 Ga0070714_100004021 3300005435 Bacteria 11053
137 Ga0070713_100000035 3300005436 Bacteria 86284
138 Ga0070713_100009798 3300005436 Bacteria 6887
139 Ga0070713_100604658 3300005436 Bacteria 1042
140 Ga0070701_10154080 3300005438 Bacteria 1326
141 Ga0070701_10208615 3300005438 Bacteria 1159
142 Ga0070711_100204511 3300005439 Bacteria 1526
143 Ga0070705_100143439 3300005440 Bacteria 1575
144 Ga0070705_100323094 3300005440 Bacteria 1115
145 Ga0070700_100276874 3300005441 Bacteria 1215
146 Ga0070700_100576541 3300005441 Bacteria 878
147 Ga0070700_100741202 3300005441 Bacteria 785
148 Ga0070700_101512113 3300005441 Bacteria 571
149 Ga0070694_100656177 3300005444 Bacteria 850
150 Ga0070708_100000226 3300005445 Bacteria 42003
151 Ga0070663_100464184 3300005455 Bacteria 1046
152 Ga0070663_100576702 3300005455 Unclassified 943
153 Ga0070663_100822108 3300005455 Bacteria 798
154 Ga0070663_101173569 3300005455 Bacteria 674
155 Ga0070663_101526701 3300005455 Bacteria 594
156 Ga0070678_100000720 3300005456 Bacteria 16434
157 Ga0070678_100016692 3300005456 Bacteria 4704
158 Ga0070678_100046163 3300005456 Bacteria 3121
159 Ga0070678_100153344 3300005456 Bacteria 1858
160 Ga0070678_100313641 3300005456 Bacteria 1337
161 Ga0070678_100325098 3300005456 Bacteria 1314
162 Ga0070678_100382448 3300005456 Bacteria 1218
163 Ga0070678_100647319 3300005456 Bacteria 948
164 Ga0070678_101105755 3300005456 Bacteria 732
165 Ga0070662_100023039 3300005457 Bacteria 4273
166 Ga0070662_100204089 3300005457 Bacteria 1570
167 Ga0070662_100283632 3300005457 Bacteria 1341
168 Ga0070681_10014655 3300005458 Bacteria 7797
169 Ga0070681_10018054 3300005458 Bacteria 7049
170 Ga0070681_10033854 3300005458 Bacteria 5130
171 Ga0070681_10047966 3300005458 Bacteria 4268
172 Ga0070681_10526151 3300005458 Bacteria 1096
173 Ga0068867_100002305 3300005459 Bacteria 13428
174 Ga0068867_100004418 3300005459 Bacteria 9887
175 Ga0068867_100042154 3300005459 Bacteria 3337
176 Ga0068867_100048467 3300005459 Bacteria 3125
177 Ga0068867_100125372 3300005459 Bacteria 1989
178 Ga0068867_100152288 3300005459 Bacteria 1818
179 Ga0068867_100256679 3300005459 Bacteria 1423
180 Ga0068867_100279004 3300005459 Bacteria 1370
181 Ga0068867_100284773 3300005459 Bacteria 1356
182 Ga0068867_100842567 3300005459 Bacteria 821
183 Ga0068867_101009958 3300005459 Bacteria 755
184 Ga0070685_10041658 3300005466 Bacteria 2618
185 Ga0070685_10043772 3300005466 Bacteria 2561
186 Ga0070685_10322697 3300005466 Bacteria 1047
187 Ga0070698_100131883 3300005471 Bacteria 2454
188 Ga0070698_100315212 3300005471 Bacteria 1495
189 Ga0070698_100925465 3300005471 Bacteria 818
190 Ga0070699_100699902 3300005518 Bacteria 926
191 Ga0070699_100715944 3300005518 Bacteria 915
192 Ga0070679_100008348 3300005530 Bacteria 9745
193 Ga0070679_100020030 3300005530 Bacteria 6519
194 Ga0070679_100020970 3300005530 Bacteria 6376
195 Ga0070679_100068758 3300005530 Bacteria 3533
196 Ga0070679_100088421 3300005530 Bacteria 3085
197 Ga0070679_100527909 3300005530 Bacteria 1124
198 Ga0070684_100046105 3300005535 Bacteria 3776
199 Ga0070697_100743404 3300005536 Bacteria 867
200 Ga0068853_100014883 3300005539 Bacteria 6388
201 Ga0068853_100019107 3300005539 Bacteria 5678
202 Ga0068853_100027612 3300005539 Bacteria 4768
203 Ga0068853_100054389 3300005539 Bacteria 3450
204 Ga0068853_100147877 3300005539 Bacteria 2113
205 Ga0068853_100182167 3300005539 Bacteria 1905
206 Ga0068853_100282641 3300005539 Bacteria 1530
207 Ga0068853_100414352 3300005539 Bacteria 1263
208 Ga0070672_100001776 3300005543 Bacteria 13480
209 Ga0070672_100003102 3300005543 Bacteria 10723
210 Ga0070672_100021936 3300005543 Bacteria 4681
211 Ga0070672_100031034 3300005543 Bacteria 4020
212 Ga0070672_100041023 3300005543 Bacteria 3555
213 Ga0070672_100051228 3300005543 Bacteria 3218
214 Ga0070672_100088729 3300005543 Bacteria 2490
215 Ga0070672_100231179 3300005543 Bacteria 1553
216 Ga0070672_100342651 3300005543 Bacteria 1273
217 Ga0070672_100510966 3300005543 Bacteria 1040
218 Ga0070672_100689354 3300005543 Bacteria 894
219 Ga0070686_100157109 3300005544 Bacteria 1598
220 Ga0070686_100310864 3300005544 Unclassified 1172
221 Ga0070686_100542798 3300005544 Unclassified 908
222 Ga0070686_100613442 3300005544 Bacteria 859
223 Ga0070696_100043500 3300005546 Bacteria 3107
224 Ga0070693_100000747 3300005547 Bacteria 14361
225 Ga0070693_100173541 3300005547 Bacteria 1382
226 Ga0070693_100370640 3300005547 Unclassified 985
227 Ga0070665_100009107 3300005548 Bacteria 10055
228 Ga0070665_100009205 3300005548 Bacteria 10002
229 Ga0070665_100055698 3300005548 Bacteria 3965
230 Ga0070665_100205343 3300005548 Bacteria 1971
231 Ga0070665_100298018 3300005548 Bacteria 1615
232 Ga0070665_100321780 3300005548 Bacteria 1551
233 Ga0070665_101208699 3300005548 Bacteria 767
234 Ga0070704_100145241 3300005549 Bacteria 1858
235 Ga0070704_100190839 3300005549 Bacteria 1647
236 Ga0070704_100234343 3300005549 Bacteria 1499
237 Ga0068855_100010886 3300005563 Bacteria 10979
238 Ga0068855_100070257 3300005563 Bacteria 4074
239 Ga0068855_100193023 3300005563 Bacteria 2296
240 Ga0068855_100380539 3300005563 Bacteria 1550
241 Ga0070664_100009154 3300005564 Bacteria 8040
242 Ga0070664_100023166 3300005564 Bacteria 5127
243 Ga0070664_100140695 3300005564 Bacteria 2125
244 Ga0070664_100222330 3300005564 Bacteria 1690
245 Ga0070664_100318727 3300005564 Bacteria 1408
246 Ga0070664_100952620 3300005564 Bacteria 806
247 Ga0068857_100000165 3300005577 Bacteria 41423
248 Ga0068857_100013438 3300005577 Bacteria 7132
249 Ga0068857_100021625 3300005577 Bacteria 5660
250 Ga0068857_100048230 3300005577 Bacteria 3782
251 Ga0068854_100036218 3300005578 Bacteria 3459
252 Ga0068854_100143251 3300005578 Bacteria 1836
253 Ga0068854_100162990 3300005578 Bacteria 1728
254 Ga0068854_100269245 3300005578 Bacteria 1367
255 Ga0068856_100000375 3300005614 Bacteria 49163
256 Ga0068856_100024471 3300005614 Bacteria 5879
257 Ga0068856_100156552 3300005614 Bacteria 2288
258 Ga0068856_100265018 3300005614 Bacteria 1734
259 Ga0070702_100105946 3300005615 Bacteria 1734
260 Ga0070702_100170627 3300005615 Bacteria 1415
261 Ga0070702_100262133 3300005615 Bacteria 1177
262 Ga0070702_100503284 3300005615 Unclassified 890
263 Ga0070702_101296709 3300005615 Unclassified 591
264 Ga0068852_100054676 3300005616 Bacteria 3442
265 Ga0068852_100060465 3300005616 Bacteria 3288
266 Ga0068852_100312972 3300005616 Bacteria 1523
267 Ga0068852_100460209 3300005616 Bacteria 1261
268 Ga0068852_100482535 3300005616 Bacteria 1232
269 Ga0068859_100000538 3300005617 Bacteria 37506
270 Ga0068859_100011296 3300005617 Bacteria 8986
271 Ga0068859_100012538 3300005617 Bacteria 8528
272 Ga0068859_100044827 3300005617 Bacteria 4444
273 Ga0068859_100081573 3300005617 Bacteria 3277
274 Ga0068859_100259784 3300005617 Bacteria 1828
275 Ga0068859_100405265 3300005617 Bacteria 1460
276 Ga0068859_100687926 3300005617 Bacteria 1114
277 Ga0068864_100000221 3300005618 Bacteria 51532
278 Ga0068864_100000981 3300005618 Bacteria 23881
279 Ga0068864_100001506 3300005618 Bacteria 19184
280 Ga0068864_100012071 3300005618 Bacteria 7135
281 Ga0068864_100187696 3300005618 Bacteria 1893
282 Ga0068864_100244742 3300005618 Bacteria 1663
283 Ga0068864_100246394 3300005618 Bacteria 1657
284 Ga0068864_100393704 3300005618 Bacteria 1315
285 Ga0068864_102000794 3300005618 Bacteria 585
286 Ga0068866_10035119 3300005718 Bacteria 2446
287 Ga0068866_10036846 3300005718 Bacteria 2399
288 Ga0068866_11056040 3300005718 Bacteria 580
289 Ga0068861_100027473 3300005719 Bacteria 4144
290 Ga0068861_100040493 3300005719 Bacteria 3485
291 Ga0068861_100043717 3300005719 Bacteria 3364
292 Ga0068861_100093488 3300005719 Bacteria 2378
293 Ga0068861_100149882 3300005719 Bacteria 1913
294 Ga0068861_100249186 3300005719 Bacteria 1515
295 Ga0068861_100278712 3300005719 Bacteria 1439
296 Ga0068861_101349395 3300005719 Bacteria 695
297 Ga0068851_10002560 3300005834 Bacteria 7999
298 Ga0068851_10018693 3300005834 Bacteria 3341
299 Ga0068851_10059112 3300005834 Bacteria 1961
300 Ga0068851_10071110 3300005834 Bacteria 1800
301 Ga0068851_10144977 3300005834 Bacteria 1294
302 Ga0068851_10251219 3300005834 Unclassified 1003
303 Ga0068870_10000918 3300005840 Bacteria 11535
304 Ga0068870_10105578 3300005840 Bacteria 1600
305 Ga0068870_10174463 3300005840 Bacteria 1285
306 Ga0068870_10463994 3300005840 Bacteria 837
307 Ga0068863_100004890 3300005841 Bacteria 13205
308 Ga0068863_100005274 3300005841 Bacteria 12758
309 Ga0068863_100005527 3300005841 Bacteria 12427
310 Ga0068863_100010987 3300005841 Bacteria 8780
311 Ga0068863_100087242 3300005841 Bacteria 2956
312 Ga0068863_100206012 3300005841 Bacteria 1893
313 Ga0068863_100261073 3300005841 Bacteria 1674
314 Ga0068863_100299770 3300005841 Bacteria 1559
315 Ga0068863_100441912 3300005841 Bacteria 1276
316 Ga0068863_100477356 3300005841 Bacteria 1226
317 Ga0068863_101513677 3300005841 Bacteria 680
318 Ga0068858_100001310 3300005842 Bacteria 25695
319 Ga0068858_100001946 3300005842 Bacteria 21056
320 Ga0068858_100080121 3300005842 Bacteria 3034
321 Ga0068858_100188361 3300005842 Bacteria 1949
322 Ga0068858_100523459 3300005842 Bacteria 1147
323 Ga0068858_100588631 3300005842 Bacteria 1079
324 Ga0068858_101091201 3300005842 Bacteria 783
325 Ga0068860_100015010 3300005843 Bacteria 7570
326 Ga0068860_100019102 3300005843 Bacteria 6654
327 Ga0068860_100021004 3300005843 Bacteria 6326
328 Ga0068860_100030695 3300005843 Bacteria 5168
329 Ga0068860_100064808 3300005843 Bacteria 3470
330 Ga0068860_100085219 3300005843 Bacteria 3006
331 Ga0068860_100092388 3300005843 Bacteria 2883
332 Ga0068860_100158208 3300005843 Bacteria 2184
333 Ga0068860_100166394 3300005843 Bacteria 2129
334 Ga0068860_100648122 3300005843 Bacteria 1064
335 Ga0068860_100821081 3300005843 Bacteria 944
336 Ga0068862_100002956 3300005844 Bacteria 14842
337 Ga0068862_100013364 3300005844 Bacteria 6793
338 Ga0068862_100033787 3300005844 Bacteria 4326
339 Ga0068862_100590477 3300005844 Bacteria 1065
340 Ga0068862_101082391 3300005844 Bacteria 796
341 Ga0081539_10010450 3300005985 Bacteria 7536
342 Ga0070717_10069659 3300006028 Bacteria 2930
343 Ga0070716_100017787 3300006173 Bacteria 3692
344 Ga0070716_100054372 3300006173 Bacteria 2287
345 Ga0070712_100299125 3300006175 Bacteria 1302
346 Ga0075367_10253051 3300006178 Bacteria 1105
347 Ga0075366_10000667 3300006195 Bacteria 16182
348 Ga0075366_10021104 3300006195 Bacteria 3786
349 Ga0075366_10066182 3300006195 Bacteria 2149
350 Ga0097621_100009813 3300006237 Bacteria 6969
351 Ga0097621_100035241 3300006237 Bacteria 3998
352 Ga0097621_100042002 3300006237 Bacteria 3683
353 Ga0097621_100051003 3300006237 Bacteria 3366
354 Ga0097621_100095410 3300006237 Bacteria 2494
355 Ga0097621_100149698 3300006237 Bacteria 2001
356 Ga0097621_100155569 3300006237 Bacteria 1962
357 Ga0097621_100167284 3300006237 Bacteria 1893
358 Ga0097621_100223642 3300006237 Bacteria 1641
359 Ga0097621_101272709 3300006237 Bacteria 694
360 Ga0068871_100004739 3300006358 Bacteria 9508
361 Ga0068871_100009527 3300006358 Bacteria 7045
362 Ga0068871_100053429 3300006358 Bacteria 3274
363 Ga0068871_100066519 3300006358 Bacteria 2954
364 Ga0068871_100200485 3300006358 Bacteria 1723
365 Ga0068871_100367854 3300006358 Bacteria 1275
366 Ga0068871_100600358 3300006358 Bacteria 1001
367 Ga0068871_100702427 3300006358 Bacteria 926
368 Ga0075428_100011836 3300006844 Bacteria 9708
369 Ga0075428_100120078 3300006844 Bacteria 2861
370 Ga0075433_10218148 3300006852 Bacteria 1695
371 Ga0075433_11094576 3300006852 Unclassified 693
372 Ga0075433_11403547 3300006852 Bacteria 604
373 Ga0075434_100043537 3300006871 Bacteria 4453
374 Ga0075434_100059321 3300006871 Bacteria 3804
375 Ga0075434_100090600 3300006871 Bacteria 3059
376 Ga0075429_100748779 3300006880 Bacteria 856
377 Ga0068865_100005835 3300006881 Bacteria 7486
378 Ga0068865_100042010 3300006881 Bacteria 3115
379 Ga0068865_100054222 3300006881 Bacteria 2785
380 Ga0068865_100081036 3300006881 Bacteria 2330
381 Ga0068865_100380116 3300006881 Bacteria 1151
382 Ga0068865_100409863 3300006881 Bacteria 1112
383 Ga0068865_100444129 3300006881 Bacteria 1071
384 Ga0068865_101437133 3300006881 Bacteria 616
385 Ga0075436_100002584 3300006914 Bacteria 12445
386 Ga0097620_100000538 3300006931 Bacteria 37506
387 Ga0097620_100011296 3300006931 Bacteria 8986
388 Ga0097620_100012537 3300006931 Bacteria 8528
389 Ga0097620_100044826 3300006931 Bacteria 4444
390 Ga0097620_100081575 3300006931 Bacteria 3277
391 Ga0097620_100259795 3300006931 Bacteria 1828
392 Ga0097620_100405266 3300006931 Bacteria 1460
393 Ga0097620_100687845 3300006931 Bacteria 1114
394 Ga0075435_100097246 3300007076 Bacteria 2436
395 Ga0075435_100194025 3300007076 Bacteria 1719
396 Ga0075435_100598786 3300007076 Bacteria 956
397 Ga0075435_100927372 3300007076 Bacteria 760
398 Ga0105240_10009321 3300009093 Bacteria 13916
399 Ga0105240_10094394 3300009093 Bacteria 3649
400 Ga0105240_10237197 3300009093 Bacteria 2116
401 Ga0111539_10001826 3300009094 Bacteria 28335
402 Ga0111539_10139346 3300009094 Bacteria 2840
403 Ga0111539_10292267 3300009094 Bacteria 1896
404 Ga0111539_10582224 3300009094 Bacteria 1303
405 Ga0105245_10285550 3300009098 Bacteria 1614
406 Ga0105245_10343606 3300009098 Bacteria 1476
407 Ga0105245_10635624 3300009098 Bacteria 1096
408 Ga0105245_10912224 3300009098 Bacteria 920
409 Ga0105247_10050084 3300009101 Bacteria 2570
410 Ga0105247_10060175 3300009101 Bacteria 2353
411 Ga0105247_10248583 3300009101 Bacteria 1215
412 Ga0105247_10311049 3300009101 Bacteria 1096
413 Ga0105247_10452290 3300009101 Bacteria 926
414 Ga0114129_10376326 3300009147 Bacteria 1876
415 Ga0105243_10029653 3300009148 Bacteria 4208
416 Ga0105243_11094895 3300009148 Unclassified 805
417 Ga0105243_11851308 3300009148 Bacteria 635
418 Ga0105241_10023794 3300009174 Bacteria 4545
419 Ga0105242_10013452 3300009176 Bacteria 6326
420 Ga0105242_10087341 3300009176 Bacteria 2618
421 Ga0105242_10382253 3300009176 Bacteria 1309
422 Ga0105242_10449499 3300009176 Bacteria 1214
423 Ga0105242_10797503 3300009176 Bacteria 935
424 Ga0105248_10001115 3300009177 Bacteria 29857
425 Ga0105248_10019911 3300009177 Bacteria 7428
426 Ga0105248_10048805 3300009177 Bacteria 4748
427 Ga0105248_10094105 3300009177 Bacteria 3374
428 Ga0105248_10203529 3300009177 Bacteria 2230
429 Ga0105248_10232001 3300009177 Bacteria 2078
430 Ga0105248_10461441 3300009177 Bacteria 1432
431 Ga0105248_10588413 3300009177 Bacteria 1256
432 Ga0105248_11189308 3300009177 Bacteria 862
433 Ga0105248_11230551 3300009177 Bacteria 847
434 Ga0105248_11281103 3300009177 Bacteria 829
435 Ga0105237_10053055 3300009545 Bacteria 4067
436 Ga0105238_10000556 3300009551 Bacteria 39015
437 Ga0105238_10022825 3300009551 Bacteria 6378
438 Ga0105249_10031053 3300009553 Bacteria 4830
439 Ga0105249_10052910 3300009553 Bacteria 3710
440 Ga0105249_10197483 3300009553 Bacteria 1967
441 Ga0105249_11523352 3300009553 Bacteria 741
442 Ga0105249_12594306 3300009553 Bacteria 579
443 Ga0105239_10279615 3300010375 Bacteria 1879
444 Ga0105246_10437648 3300011119 Bacteria 1095
445 Ga0157373_10005350 3300013100 Bacteria 9647
446 Ga0157373_10036681 3300013100 Bacteria 3517
447 Ga0157371_10380756 3300013102 Bacteria 1030
448 Ga0157370_10005207 3300013104 Bacteria 14653
449 Ga0157370_10005346 3300013104 Bacteria 14420
450 Ga0157370_10008837 3300013104 Bacteria 10828
451 Ga0157370_10009782 3300013104 Bacteria 10170
452 Ga0157370_10046744 3300013104 Bacteria 4150
453 Ga0157370_10277420 3300013104 Bacteria 1549
454 Ga0157370_11056762 3300013104 Bacteria 734
455 Ga0157369_10001573 3300013105 Bacteria 27941
456 Ga0157374_10094505 3300013296 Bacteria 2857
457 Ga0157374_10217126 3300013296 Bacteria 1876
458 Ga0157374_10250425 3300013296 Bacteria 1743
459 Ga0157374_10351564 3300013296 Bacteria 1464
460 Ga0157374_10557015 3300013296 Bacteria 1154
461 Ga0157378_10060235 3300013297 Bacteria 3388
462 Ga0157378_10065403 3300013297 Bacteria 3255
463 Ga0157378_10401164 3300013297 Bacteria 1351
464 Ga0157378_10432500 3300013297 Bacteria 1303
465 Ga0157378_10585285 3300013297 Bacteria 1125
466 Ga0157378_10906746 3300013297 Bacteria 912
467 Ga0163162_10007103 3300013306 Bacteria 10864
468 Ga0163162_10027368 3300013306 Bacteria 5638
469 Ga0163162_10046021 3300013306 Bacteria 4373
470 Ga0163162_10092447 3300013306 Bacteria 3109
471 Ga0163162_10109223 3300013306 Bacteria 2863
472 Ga0163162_10364695 3300013306 Bacteria 1577
473 Ga0163162_10379585 3300013306 Bacteria 1546
474 Ga0163162_10487135 3300013306 Bacteria 1364
475 Ga0163162_10518783 3300013306 Bacteria 1321
476 Ga0163162_10673301 3300013306 Bacteria 1157
477 Ga0163162_11565580 3300013306 Bacteria 751
478 Ga0163162_12279831 3300013306 Bacteria 622
479 Ga0157372_10018159 3300013307 Bacteria 7562
480 Ga0157372_10026804 3300013307 Bacteria 6273
481 Ga0157372_10045018 3300013307 Bacteria 4893
482 Ga0157372_10095742 3300013307 Bacteria 3383
483 Ga0157372_10163092 3300013307 Bacteria 2576
484 Ga0157372_10335132 3300013307 Bacteria 1762
485 Ga0157372_11283906 3300013307 Bacteria 845
486 Ga0157375_10001997 3300013308 Bacteria 17598
487 Ga0157375_10020193 3300013308 Bacteria 6080
488 Ga0157375_10033210 3300013308 Bacteria 4901
489 Ga0157375_10131940 3300013308 Bacteria 2618
490 Ga0157375_10139435 3300013308 Bacteria 2551
491 Ga0157375_10186932 3300013308 Bacteria 2225
492 Ga0157375_10356936 3300013308 Bacteria 1628
493 Ga0157375_10417219 3300013308 Bacteria 1508
494 Ga0157375_10785474 3300013308 Bacteria 1102
495 Ga0157375_11001820 3300013308 Bacteria 975
496 Ga0157375_11406417 3300013308 Bacteria 822
497 Ga0163163_10031719 3300014325 Bacteria 5101
498 Ga0163163_10041147 3300014325 Bacteria 4518
499 Ga0163163_10062054 3300014325 Bacteria 3703
500 Ga0163163_10435959 3300014325 Bacteria 1370
501 Ga0163163_10698352 3300014325 Bacteria 1078
502 Ga0157380_10001950 3300014326 Bacteria 13731
503 Ga0157380_10150877 3300014326 Bacteria 2009
504 Ga0157380_10463480 3300014326 Bacteria 1220
505 Ga0157380_10725973 3300014326 Bacteria 1002
506 Ga0157380_11071479 3300014326 Bacteria 843
507 Ga0157380_11276661 3300014326 Bacteria 781
508 Ga0157377_10164309 3300014745 Bacteria 1383
509 Ga0157377_10277736 3300014745 Bacteria 1097
510 Ga0157377_10568373 3300014745 Bacteria 804
511 Ga0157377_11219267 3300014745 Bacteria 583
512 Ga0157379_10005251 3300014968 Bacteria 11123
513 Ga0157379_10005730 3300014968 Bacteria 10684
514 Ga0157379_10008738 3300014968 Bacteria 8830
515 Ga0157379_10033534 3300014968 Bacteria 4578
516 Ga0157379_10075839 3300014968 Bacteria 3011
517 Ga0157379_10820828 3300014968 Bacteria 879
518 Ga0157379_11190682 3300014968 Bacteria 732
519 Ga0157376_10013094 3300014969 Bacteria 6177
520 Ga0157376_10154076 3300014969 Bacteria 2075
521 Ga0157376_10264642 3300014969 Bacteria 1613
522 Ga0157376_10265889 3300014969 Bacteria 1609
523 Ga0157376_10939154 3300014969 Unclassified 885
524 Ga0157376_10964426 3300014969 Bacteria 874
525 Ga0157376_10987454 3300014969 Bacteria 864
526 Ga0157376_12089949 3300014969 Unclassified 605
527 Ga0163161_10005854 3300017792 Bacteria 8522
528 Ga0163161_10008961 3300017792 Bacteria 6919
529 Ga0163161_10021874 3300017792 Bacteria 4497
530 Ga0163161_10124399 3300017792 Bacteria 1940
531 Ga0163161_10194826 3300017792 Bacteria 1559
532 Ga0163161_10504695 3300017792 Bacteria 985
533 Ga0163161_10900543 3300017792 Bacteria 749
534 Ga0213876_10109332 3300021384 Bacteria 1467
535 Ga0207697_10010293 3300025315 Bacteria 4004
536 Ga0207697_10021292 3300025315 Bacteria 2654
537 Ga0207656_10000665 3300025321 Bacteria 11258
538 Ga0207656_10003476 3300025321 Bacteria 5421
539 Ga0207656_10079233 3300025321 Bacteria 1473
540 Ga0207656_10086923 3300025321 Bacteria 1414
541 Ga0207656_10131712 3300025321 Bacteria 1172
542 Ga0207682_10000112 3300025893 Bacteria 37354
543 Ga0207682_10041649 3300025893 Bacteria 1875
544 Ga0207682_10208784 3300025893 Bacteria 900
545 Ga0207682_10255743 3300025893 Bacteria 816
546 Ga0207692_10206357 3300025898 Bacteria 1158
547 Ga0207642_10004139 3300025899 Bacteria 4656
548 Ga0207710_10050401 3300025900 Bacteria 1868
549 Ga0207710_10210926 3300025900 Bacteria 961
550 Ga0207688_10030378 3300025901 Bacteria 2979
551 Ga0207688_10060868 3300025901 Bacteria 2128
552 Ga0207680_10002142 3300025903 Bacteria 9255
553 Ga0207680_10034361 3300025903 Bacteria 2901
554 Ga0207680_10038627 3300025903 Bacteria 2764
555 Ga0207680_10062464 3300025903 Bacteria 2276
556 Ga0207680_10446411 3300025903 Bacteria 918
557 Ga0207699_10013459 3300025906 Bacteria 4189
558 Ga0207645_10000353 3300025907 Bacteria 38206
559 Ga0207645_10002067 3300025907 Bacteria 16065
560 Ga0207645_10012164 3300025907 Bacteria 5845
561 Ga0207645_10064415 3300025907 Bacteria 2342
562 Ga0207645_10074018 3300025907 Bacteria 2181
563 Ga0207645_10080288 3300025907 Bacteria 2091
564 Ga0207645_10693978 3300025907 Bacteria 692
565 Ga0207643_10002333 3300025908 Bacteria 10326
566 Ga0207643_10039743 3300025908 Bacteria 2646
567 Ga0207643_10088917 3300025908 Bacteria 1798
568 Ga0207643_10099266 3300025908 Bacteria 1706
569 Ga0207643_10157082 3300025908 Bacteria 1366
570 Ga0207705_10033975 3300025909 Bacteria 3645
571 Ga0207705_10556604 3300025909 Bacteria 891
572 Ga0207707_10009511 3300025912 Bacteria 8432
573 Ga0207707_10012172 3300025912 Bacteria 7478
574 Ga0207707_10021505 3300025912 Bacteria 5639
575 Ga0207707_10105652 3300025912 Bacteria 2461
576 Ga0207695_10017185 3300025913 Bacteria 8430
577 Ga0207695_10219783 3300025913 Bacteria 1808
578 Ga0207671_10017689 3300025914 Bacteria 5491
579 Ga0207693_10122236 3300025915 Bacteria 2045
580 Ga0207693_10943906 3300025915 Bacteria 660
581 Ga0207660_10095750 3300025917 Bacteria 2209
582 Ga0207662_10345159 3300025918 Bacteria 998
583 Ga0207662_10427615 3300025918 Bacteria 902
584 Ga0207662_10492008 3300025918 Bacteria 844
585 Ga0207657_10037894 3300025919 Bacteria 4299
586 Ga0207657_10105831 3300025919 Bacteria 2328
587 Ga0207657_10306434 3300025919 Bacteria 1257
588 Ga0207657_10618916 3300025919 Bacteria 844
589 Ga0207649_10006554 3300025920 Bacteria 6325
590 Ga0207649_10007733 3300025920 Bacteria 5847
591 Ga0207652_10006935 3300025921 Bacteria 9126
592 Ga0207652_10007646 3300025921 Bacteria 8696
593 Ga0207652_10010251 3300025921 Bacteria 7541
594 Ga0207652_10097132 3300025921 Bacteria 2596
595 Ga0207646_10439592 3300025922 Bacteria 1177
596 Ga0207681_10001647 3300025923 Bacteria 14388
597 Ga0207681_10034893 3300025923 Bacteria 3311
598 Ga0207681_10041533 3300025923 Bacteria 3067
599 Ga0207681_10055567 3300025923 Bacteria 2697
600 Ga0207681_10070572 3300025923 Bacteria 2433
601 Ga0207681_10073194 3300025923 Bacteria 2396
602 Ga0207681_10156833 3300025923 Bacteria 1711
603 Ga0207681_10637028 3300025923 Bacteria 883
604 Ga0207694_10005707 3300025924 Bacteria 9538
605 Ga0207650_10002173 3300025925 Bacteria 13703
606 Ga0207650_10028013 3300025925 Bacteria 4037
607 Ga0207650_10035261 3300025925 Bacteria 3631
608 Ga0207650_10054229 3300025925 Bacteria 2973
609 Ga0207650_10140560 3300025925 Bacteria 1898
610 Ga0207650_10155901 3300025925 Bacteria 1806
611 Ga0207650_10225226 3300025925 Bacteria 1510
612 Ga0207650_10496115 3300025925 Bacteria 1020
613 Ga0207650_10567381 3300025925 Bacteria 952
614 Ga0207650_10585796 3300025925 Bacteria 937
615 Ga0207659_10023112 3300025926 Bacteria 4146
616 Ga0207659_10044416 3300025926 Bacteria 3126
617 Ga0207659_10119284 3300025926 Bacteria 2019
618 Ga0207659_10223215 3300025926 Bacteria 1516
619 Ga0207659_10294446 3300025926 Bacteria 1331
620 Ga0207659_10318641 3300025926 Bacteria 1282
621 Ga0207659_10489267 3300025926 Bacteria 1040
622 Ga0207700_10000023 3300025928 Bacteria 152285
623 Ga0207700_10250582 3300025928 Bacteria 1513
624 Ga0207700_10282921 3300025928 Bacteria 1427
625 Ga0207664_10005947 3300025929 Bacteria 8352
626 Ga0207664_10338678 3300025929 Bacteria 1330
627 Ga0207644_10003890 3300025931 Bacteria 9676
628 Ga0207644_10006077 3300025931 Bacteria 7874
629 Ga0207644_10009728 3300025931 Bacteria 6322
630 Ga0207644_10144276 3300025931 Bacteria 1836
631 Ga0207644_10193481 3300025931 Bacteria 1600
632 Ga0207644_10478779 3300025931 Bacteria 1025
633 Ga0207644_10767124 3300025931 Unclassified 806
634 Ga0207644_10851250 3300025931 Bacteria 763
635 Ga0207690_10004550 3300025932 Bacteria 8191
636 Ga0207690_10941418 3300025932 Bacteria 717
637 Ga0207706_10017758 3300025933 Bacteria 6407
638 Ga0207706_10129173 3300025933 Bacteria 2222
639 Ga0207706_10259376 3300025933 Bacteria 1518
640 Ga0207706_10302708 3300025933 Bacteria 1393
641 Ga0207686_10006269 3300025934 Bacteria 6398
642 Ga0207686_10273498 3300025934 Bacteria 1244
643 Ga0207686_10495913 3300025934 Bacteria 947
644 Ga0207670_10012516 3300025936 Bacteria 4967
645 Ga0207670_10014182 3300025936 Bacteria 4722
646 Ga0207670_10064119 3300025936 Bacteria 2517
647 Ga0207670_10207561 3300025936 Bacteria 1492
648 Ga0207670_10964045 3300025936 Bacteria 716
649 Ga0207669_10009607 3300025937 Bacteria 4620
650 Ga0207669_10063183 3300025937 Bacteria 2284
651 Ga0207669_10069558 3300025937 Bacteria 2203
652 Ga0207669_10075558 3300025937 Bacteria 2135
653 Ga0207669_10202169 3300025937 Bacteria 1443
654 Ga0207669_10202765 3300025937 Bacteria 1441
655 Ga0207669_10571333 3300025937 Bacteria 915
656 Ga0207669_10687964 3300025937 Unclassified 839
657 Ga0207704_10016763 3300025938 Bacteria 3775
658 Ga0207704_10263698 3300025938 Bacteria 1300
659 Ga0207704_10443752 3300025938 Bacteria 1034
660 Ga0207704_11005984 3300025938 Bacteria 705
661 Ga0207665_10113160 3300025939 Bacteria 1909
662 Ga0207665_10124907 3300025939 Bacteria 1821
663 Ga0207691_10000153 3300025940 Bacteria 64312
664 Ga0207691_10000663 3300025940 Bacteria 33984
665 Ga0207691_10018917 3300025940 Bacteria 6525
666 Ga0207691_10037551 3300025940 Bacteria 4485
667 Ga0207691_10092766 3300025940 Bacteria 2704
668 Ga0207691_10290635 3300025940 Bacteria 1405
669 Ga0207691_10395049 3300025940 Bacteria 1180
670 Ga0207691_10448523 3300025940 Bacteria 1098
671 Ga0207691_10586321 3300025940 Bacteria 944
672 Ga0207711_10021962 3300025941 Bacteria 5332
673 Ga0207711_10090611 3300025941 Bacteria 2688
674 Ga0207711_10144765 3300025941 Bacteria 2140
675 Ga0207711_10206816 3300025941 Bacteria 1792
676 Ga0207711_10837337 3300025941 Bacteria 856
677 Ga0207711_10966836 3300025941 Bacteria 791
678 Ga0207689_10001242 3300025942 Bacteria 24579
679 Ga0207689_10001481 3300025942 Bacteria 22457
680 Ga0207689_10002580 3300025942 Bacteria 16786
681 Ga0207689_10168657 3300025942 Bacteria 1804
682 Ga0207689_10357681 3300025942 Bacteria 1214
683 Ga0207689_10363643 3300025942 Bacteria 1203
684 Ga0207661_10049797 3300025944 Bacteria 3336
685 Ga0207661_10420351 3300025944 Bacteria 1214
686 Ga0207679_10184631 3300025945 Bacteria 1728
687 Ga0207679_10230800 3300025945 Bacteria 1562
688 Ga0207679_10255847 3300025945 Bacteria 1491
689 Ga0207679_10369699 3300025945 Bacteria 1255
690 Ga0207667_10014858 3300025949 Bacteria 8855
691 Ga0207667_10019355 3300025949 Bacteria 7602
692 Ga0207667_10056095 3300025949 Bacteria 4139
693 Ga0207667_10206617 3300025949 Bacteria 2013
694 Ga0207667_11142070 3300025949 Bacteria 761
695 Ga0207667_11781199 3300025949 Bacteria 580
696 Ga0207651_10003230 3300025960 Bacteria 7977
697 Ga0207651_10027821 3300025960 Bacteria 3557
698 Ga0207651_10041257 3300025960 Bacteria 3062
699 Ga0207651_10094883 3300025960 Bacteria 2195
700 Ga0207651_10100827 3300025960 Bacteria 2141
701 Ga0207651_10122974 3300025960 Bacteria 1971
702 Ga0207651_10175473 3300025960 Bacteria 1695
703 Ga0207651_10382654 3300025960 Bacteria 1193
704 Ga0207651_10584761 3300025960 Bacteria 974
705 Ga0207651_10837940 3300025960 Bacteria 817
706 Ga0207651_11111527 3300025960 Bacteria 708
707 Ga0207712_10064785 3300025961 Bacteria 2606
708 Ga0207712_10104476 3300025961 Bacteria 2112
709 Ga0207668_10001215 3300025972 Bacteria 15298
710 Ga0207668_10004590 3300025972 Bacteria 8124
711 Ga0207668_10007939 3300025972 Bacteria 6313
712 Ga0207668_10010698 3300025972 Bacteria 5552
713 Ga0207668_10030173 3300025972 Bacteria 3561
714 Ga0207668_10205579 3300025972 Bacteria 1571
715 Ga0207668_10207910 3300025972 Bacteria 1563
716 Ga0207668_10311330 3300025972 Bacteria 1303
717 Ga0207668_10548564 3300025972 Unclassified 1001
718 Ga0207668_10633711 3300025972 Bacteria 934
719 Ga0207640_10001692 3300025981 Bacteria 11821
720 Ga0207640_10255776 3300025981 Unclassified 1362
721 Ga0207640_10280838 3300025981 Bacteria 1308
722 Ga0207640_11752971 3300025981 Bacteria 561
723 Ga0207658_10006990 3300025986 Bacteria 7682
724 Ga0207658_10007512 3300025986 Bacteria 7426
725 Ga0207658_10008205 3300025986 Bacteria 7115
726 Ga0207658_10031200 3300025986 Bacteria 3782
727 Ga0207658_10038754 3300025986 Bacteria 3436
728 Ga0207658_10047370 3300025986 Bacteria 3146
729 Ga0207658_10079019 3300025986 Bacteria 2515
730 Ga0207658_10180390 3300025986 Bacteria 1747
731 Ga0207658_10337957 3300025986 Bacteria 1308
732 Ga0207677_10003737 3300026023 Bacteria 8081
733 Ga0207677_10028988 3300026023 Bacteria 3511
734 Ga0207677_10073510 3300026023 Bacteria 2421
735 Ga0207677_10112684 3300026023 Bacteria 2029
736 Ga0207677_10129855 3300026023 Bacteria 1911
737 Ga0207677_10618957 3300026023 Bacteria 952
738 Ga0207677_10699950 3300026023 Bacteria 899
739 Ga0207703_10004283 3300026035 Bacteria 11738
740 Ga0207703_10012045 3300026035 Bacteria 6736
741 Ga0207703_10102564 3300026035 Bacteria 2428
742 Ga0207703_10133671 3300026035 Bacteria 2145
743 Ga0207703_10402387 3300026035 Bacteria 1270
744 Ga0207703_11006823 3300026035 Bacteria 799
745 Ga0207639_10020129 3300026041 Bacteria 4774
746 Ga0207639_10021692 3300026041 Bacteria 4616
747 Ga0207639_10033544 3300026041 Bacteria 3788
748 Ga0207639_10117238 3300026041 Bacteria 2182
749 Ga0207678_10104231 3300026067 Bacteria 2420
750 Ga0207678_10150272 3300026067 Bacteria 1988
751 Ga0207678_10323022 3300026067 Bacteria 1328
752 Ga0207678_10741186 3300026067 Bacteria 866
753 Ga0207678_11008142 3300026067 Bacteria 737
754 Ga0207708_10301104 3300026075 Bacteria 1304
755 Ga0207708_10552326 3300026075 Bacteria 971
756 Ga0207702_10008016 3300026078 Bacteria 8943
757 Ga0207702_10025538 3300026078 Bacteria 4904
758 Ga0207702_10102183 3300026078 Bacteria 2533
759 Ga0207702_10349287 3300026078 Bacteria 1415
760 Ga0207641_10005782 3300026088 Bacteria 10505
761 Ga0207641_10013438 3300026088 Bacteria 6714
762 Ga0207641_10014474 3300026088 Bacteria 6462
763 Ga0207641_10055937 3300026088 Bacteria 3351
764 Ga0207641_10058051 3300026088 Bacteria 3292
765 Ga0207641_10145284 3300026088 Bacteria 2144
766 Ga0207641_10186255 3300026088 Bacteria 1904
767 Ga0207641_10235958 3300026088 Bacteria 1702
768 Ga0207641_10252317 3300026088 Bacteria 1648
769 Ga0207641_10332248 3300026088 Bacteria 1444
770 Ga0207641_10419288 3300026088 Bacteria 1288
771 Ga0207641_10753123 3300026088 Bacteria 962
772 Ga0207641_11030782 3300026088 Bacteria 820
773 Ga0207641_11820821 3300026088 Unclassified 610
774 Ga0207648_10000306 3300026089 Bacteria 53612
775 Ga0207648_10004210 3300026089 Bacteria 14867
776 Ga0207648_10004471 3300026089 Bacteria 14345
777 Ga0207648_10016667 3300026089 Bacteria 6705
778 Ga0207648_10037366 3300026089 Bacteria 4277
779 Ga0207648_10048501 3300026089 Bacteria 3717
780 Ga0207648_10076203 3300026089 Bacteria 2924
781 Ga0207648_10112348 3300026089 Bacteria 2392
782 Ga0207648_10171437 3300026089 Bacteria 1918
783 Ga0207676_10006304 3300026095 Bacteria 8377
784 Ga0207676_10008349 3300026095 Bacteria 7361
785 Ga0207676_10010399 3300026095 Bacteria 6627
786 Ga0207676_10075776 3300026095 Bacteria 2715
787 Ga0207676_10091972 3300026095 Bacteria 2493
788 Ga0207676_10171442 3300026095 Bacteria 1891
789 Ga0207676_10172690 3300026095 Bacteria 1885
790 Ga0207676_10334335 3300026095 Bacteria 1395
791 Ga0207676_11129261 3300026095 Bacteria 775
792 Ga0207674_10000180 3300026116 Bacteria 77710
793 Ga0207674_10005717 3300026116 Bacteria 14740
794 Ga0207674_10081841 3300026116 Bacteria 3230
795 Ga0207675_100003390 3300026118 Bacteria 15571
796 Ga0207675_100017874 3300026118 Bacteria 6613
797 Ga0207675_100020501 3300026118 Bacteria 6162
798 Ga0207675_100023617 3300026118 Bacteria 5720
799 Ga0207675_100057843 3300026118 Bacteria 3618
800 Ga0207675_100065227 3300026118 Bacteria 3403
801 Ga0207675_100150864 3300026118 Bacteria 2212
802 Ga0207675_100374197 3300026118 Bacteria 1400
803 Ga0207675_100479836 3300026118 Bacteria 1236
804 Ga0207683_10000140 3300026121 Bacteria 59648
805 Ga0207683_10001329 3300026121 Bacteria 22302
806 Ga0207683_10011489 3300026121 Bacteria 7558
807 Ga0207683_10011502 3300026121 Bacteria 7554
808 Ga0207683_10066165 3300026121 Bacteria 3187
809 Ga0207683_10155733 3300026121 Bacteria 2064
810 Ga0207683_10324481 3300026121 Bacteria 1411
811 Ga0207683_10407635 3300026121 Bacteria 1251
812 Ga0207683_10853297 3300026121 Bacteria 845
813 Ga0207698_10120570 3300026142 Bacteria 2219
814 Ga0207698_10342278 3300026142 Bacteria 1409
815 Ga0207698_10509396 3300026142 Bacteria 1172
816 Ga0207698_11490697 3300026142 Bacteria 692
817 Ga0207698_11557436 3300026142 Bacteria 676
818 Ga0268266_10007303 3300028379 Bacteria 9985
819 Ga0268266_10107189 3300028379 Bacteria 2470
820 Ga0268266_10322053 3300028379 Bacteria 1447
821 Ga0268266_10776544 3300028379 Bacteria 925
822 Ga0268266_10825451 3300028379 Bacteria 896
823 Ga0268265_10007626 3300028380 Bacteria 7300
824 Ga0268265_10070392 3300028380 Bacteria 2720
825 Ga0268265_10257555 3300028380 Bacteria 1549
826 Ga0268265_12037275 3300028380 Bacteria 581
827 Ga0268264_10000599 3300028381 Bacteria 43601
828 Ga0268264_10046825 3300028381 Bacteria 3594
829 Ga0268264_10051114 3300028381 Bacteria 3443
830 Ga0268264_10051202 3300028381 Bacteria 3440
831 Ga0268264_10133034 3300028381 Bacteria 2208
832 Ga0268264_10283817 3300028381 Bacteria 1552
833 Ga0268264_10299934 3300028381 Bacteria 1512
834 Ga0268264_10362514 3300028381 Bacteria 1383
835 Ga0268264_10470212 3300028381 Bacteria 1221
836 Ga0268264_10660938 3300028381 Bacteria 1035
837 Ga0268264_10710242 3300028381 Bacteria 999
838 Ga0268264_10799929 3300028381 Unclassified 942
839 Ga0268264_10809739 3300028381 Bacteria 936
840 Ga0268264_11084073 3300028381 Bacteria 809
841 Ga0268264_11611770 3300028381 Bacteria 660
842 Ga0265330_10002138 3300031235 Bacteria 10894
843 Ga0265332_10001350 3300031238 Bacteria 13902
844 Ga0265325_10012087 3300031241 Bacteria 4945
845 Ga0265339_10070060 3300031249 Bacteria 1871
846 Ga0265339_10330409 3300031249 Bacteria 722
847 Ga0265331_10000485 3300031250 Bacteria 38062
848 Ga0265327_10001001 3300031251 Bacteria 40152
849 Ga0265316_10080535 3300031344 Bacteria 2497
850 Ga0307408_100361392 3300031548 Bacteria 1235
851 Ga0307408_101359427 3300031548 Bacteria 667
852 Ga0265314_10009940 3300031711 Bacteria 7977
853 Ga0265314_10474187 3300031711 Bacteria 663
854 Ga0265342_10029881 3300031712 Bacteria 3381
855 Ga0307405_10002193 3300031731 Bacteria 8535
856 Ga0307405_10235718 3300031731 Bacteria 1352
857 Ga0307405_10750336 3300031731 Bacteria 813
858 Ga0307405_12055982 3300031731 Bacteria 512
859 Ga0307413_10024401 3300031824 Bacteria 3296
860 Ga0307413_10749934 3300031824 Bacteria 816
861 Ga0307413_10871560 3300031824 Bacteria 762
862 Ga0307410_10029349 3300031852 Bacteria 3502
863 Ga0307410_10142211 3300031852 Bacteria 1776
864 Ga0307406_10025498 3300031901 Bacteria 3540
865 Ga0307407_10000212 3300031903 Bacteria 17550
866 Ga0307412_10024475 3300031911 Bacteria 3727
867 Ga0307412_10079185 3300031911 Bacteria 2266
868 Ga0307412_10335066 3300031911 Bacteria 1209
869 Ga0307409_100005538 3300031995 Bacteria 7288
870 Ga0307409_100030920 3300031995 Bacteria 3855
871 Ga0307409_100057213 3300031995 Bacteria 3020
872 Ga0307409_100679804 3300031995 Bacteria 1026
873 Ga0307416_100006878 3300032002 Bacteria 7160
874 Ga0307416_100279764 3300032002 Bacteria 1644
875 Ga0307416_100373264 3300032002 Bacteria 1453
876 Ga0307416_100567627 3300032002 Bacteria 1210
877 Ga0307416_100995770 3300032002 Bacteria 941
878 Ga0307414_10023076 3300032004 Bacteria 3938
879 Ga0307411_10127048 3300032005 Bacteria 1856
880 Ga0307411_10162797 3300032005 Bacteria 1673
881 Ga0307411_10556711 3300032005 Bacteria 979
882 Ga0307415_100427671 3300032126 Bacteria 1138
883 Ga0307415_100475356 3300032126 Bacteria 1087
884 Ga0373939_0206846 3300035114 Bacteria 745
885 Ga0373945_0267510 3300035116 Bacteria 726
886 Ga0373956_0191195 3300035119 Bacteria 969
887 Ga0373943_0327113 3300035170 Bacteria 875
888 Ga0373955_0308203 3300035172 Bacteria 955
889 Ga0373955_0476386 3300035172 Bacteria 762
890 Ga0373942_0205882 3300035207 Bacteria 654
891 Ga0373962_0099138 3300035242 Bacteria 907
892 Ga0373924_0172991 3300035410 Bacteria 949
893 Ga0373931_0112434 3300035691 Bacteria 1547
894 Ga0373931_0179574 3300035691 Bacteria 1253
895 Ga0373935_0048668 3300035692 Bacteria 2685
896 Ga0373935_0095789 3300035692 Bacteria 1950
897 Ga0373933_0038822 3300035724 Bacteria 2799
898 Ga0373937_0049030 3300036401 Bacteria 3867
899 Ga0373937_0073819 3300036401 Bacteria 3147
900 Ga0373937_0657036 3300036401 Bacteria 994
901 Ga0436365_0156624 3300039437 Bacteria 1917
902 Ga0436361_0372154 3300039447 Bacteria 1847
903 Ga0451793_1922151 3300041452 Bacteria 1083
904 Ga0451800_0856952 3300041459 Bacteria 1251
905 Ga0451807_1470547 3300041486 Bacteria 1605
906 Ga0451839_0580464 3300041496 Bacteria 697
907 Ga0451853_0166656 3300041512 Bacteria 2036
908 Ga0451853_0600167 3300041512 Unclassified 881
909 Ga0451853_2506226 3300041512 Bacteria 773
910 Ga0439448_0106461 3300042005 Bacteria 956
911 Ga0439459_0033645 3300042438 Bacteria 1056
912 Ga0451577_0894151 3300042876 Bacteria 800
913 Ga0453683_0551851 3300044673 Bacteria 750
914 Ga0451576_0046846 3300045051 Bacteria 4550
915 Ga0451576_0452060 3300045051 Bacteria 1349
916 Ga0451576_0630732 3300045051 Bacteria 1126
917 Ga0495592_0156310 3300046454 Bacteria 1572
918 Ga0495603_0106783 3300046455 Bacteria 1634
919 Ga0495651_0021771 3300046462 Bacteria 4984
920 Ga0495653_0021896 3300046463 Bacteria 5175
921 Ga0495664_0162679 3300046477 Bacteria 1354
922 Ga0495608_0005629 3300046511 Bacteria 8947
923 Ga0495618_0135895 3300046514 Bacteria 1573
924 Ga0495587_0020735 3300046536 Bacteria 4054
925 Ga0495598_0266452 3300046537 Bacteria 639
926 Ga0495621_0081329 3300046539 Bacteria 1208
927 Ga0495645_0002022 3300046543 Bacteria 13815
928 Ga0495645_0171030 3300046543 Bacteria 1496
929 Ga0495633_0067944 3300046558 Bacteria 1664
930 Ga0495667_0014939 3300046559 Bacteria 5246
931 Ga0495634_0413874 3300046642 Bacteria 799
932 Ga0495635_0025547 3300046663 Bacteria 4115
933 Ga0495657_0008468 3300046675 Bacteria 7869
934 Ga0495599_0006839 3300046678 Bacteria 6895
935 Ga0495623_0005020 3300046679 Bacteria 8678
936 Ga0495658_0227542 3300046683 Bacteria 1169
937 Ga0495658_0757602 3300046683 Bacteria 622
938 Ga0495670_0190852 3300046691 Bacteria 1083
939 Ga0495600_0524518 3300046809 Bacteria 726
940 Ga0495680_0602212 3300047322 Bacteria 735
941 Ga0495675_0094924 3300047444 Bacteria 1870
942 Ga0495684_0021543 3300047471 Bacteria 4962
943 Ga0495602_0131750 3300048088 Bacteria 1993
944 Ga0496100_0200281 3300048903 Bacteria 1455
945 Ga0496101_0266536 3300048904 Bacteria 1337
946 Ga0496102_0017096 3300048905 Bacteria 6350
947 Ga0496103_0158258 3300048906 Bacteria 1452
948 Ga0496104_0623362 3300048907 Bacteria 988
949 Ga0496105_1011563 3300048908 Bacteria 621
950 Ga0496106_0416087 3300048909 Bacteria 1080
951 Ga0496106_0562071 3300048909 Bacteria 915
952 Ga0496107_0421154 3300048910 Bacteria 993
953 Ga0496108_0105060 3300048911 Bacteria 2411
954 Ga0496108_0200195 3300048911 Bacteria 1733
955 Ga0496108_0243291 3300048911 Bacteria 1565
956 Ga0496108_1182845 3300048911 Bacteria 647
957 Ga0496109_0014914 3300048912 Bacteria 6764
958 Ga0496109_0095991 3300048912 Bacteria 2746
959 Ga0496109_0189560 3300048912 Bacteria 1932
960 Ga0496109_0962201 3300048912 Bacteria 792
961 Ga0496110_0284439 3300048913 Bacteria 1506
962 Ga0496110_0403173 3300048913 Bacteria 1247
963 Ga0496111_0396986 3300048914 Bacteria 1019
964 Ga0496112_0004213 3300048915 Bacteria 12130
965 Ga0496112_0372568 3300048915 Bacteria 1369
966 Ga0496114_0086358 3300048917 Bacteria 2659
967 Ga0496115_0234817 3300048918 Bacteria 1512
968 Ga0501291_114215 3300049514 Bacteria 579
969 Ga0501034_0055322 3300049571 Bacteria 3993
970 Ga0501034_0281353 3300049571 Bacteria 1603
971 Ga0501037_0000686 3300049573 Bacteria 25818
972 Ga0501037_0003202 3300049573 Bacteria 11874
973 Ga0501037_0338859 3300049573 Unclassified 1039
974 Ga0501038_0005232 3300049574 Bacteria 12062
975 Ga0501046_0190850 3300049580 Bacteria 1528
976 Ga0501046_0420166 3300049580 Bacteria 964
977 Ga0501047_0015991 3300049581 Bacteria 7154
978 Ga0501047_0026629 3300049581 Bacteria 5565
979 Ga0501047_0647396 3300049581 Unclassified 876
980 Ga0501047_0723096 3300049581 Unclassified 812
981 Ga0501048_0330384 3300049582 Bacteria 1086
982 Ga0501067_0038826 3300049583 Bacteria 2643
983 Ga0501068_0045822 3300049584 Bacteria 2635
984 Ga0501068_0452954 3300049584 Bacteria 830
985 Ga0501069_0036684 3300049585 Bacteria 2704
986 Ga0501069_0042505 3300049585 Bacteria 2514
987 Ga0501070_0002025 3300049586 Bacteria 17809
988 Ga0501070_0012613 3300049586 Bacteria 7129
989 Ga0501070_0018709 3300049586 Bacteria 5811
990 Ga0501070_0021608 3300049586 Bacteria 5397
991 Ga0501070_0042823 3300049586 Bacteria 3770
992 Ga0501070_0655665 3300049586 Bacteria 833
993 Ga0501071_0073631 3300049587 Bacteria 2492
994 Ga0501072_0007090 3300049588 Bacteria 8505
995 Ga0501072_0056512 3300049588 Bacteria 3092
996 Ga0501073_0013481 3300049589 Bacteria 5945
997 Ga0501073_0031079 3300049589 Bacteria 3811
998 Ga0501074_0002139 3300049590 Bacteria 13659
999 Ga0501074_0014501 3300049590 Bacteria 5734
1000 Ga0501075_0069021 3300049591 Bacteria 2671
1001 Ga0501075_0617163 3300049591 Bacteria 827
1002 Ga0501076_0451028 3300049592 Bacteria 1059
1003 Ga0501076_1138895 3300049592 Bacteria 642
1004 Ga0501079_0006766 3300049741 Bacteria 8623
1005 Ga0501079_0568926 3300049741 Bacteria 891
1006 Ga0501080_0007158 3300049742 Bacteria 10067
1007 Ga0501080_0070520 3300049742 Bacteria 3250
1008 Ga0501080_0103936 3300049742 Bacteria 2634
1009 Ga0501080_0202603 3300049742 Bacteria 1821
1010 Ga0501080_0642714 3300049742 Bacteria 939
1011 Ga0501083_0058688 3300049744 Bacteria 2574
1012 Ga0501083_0124021 3300049744 Bacteria 1693
1013 Ga0501083_0126215 3300049744 Bacteria 1677
1014 Ga0501035_0440210 3300049822 Bacteria 1079
1015 Ga0501044_0025553 3300049823 Bacteria 6261
1016 Ga0501044_0295839 3300049823 Bacteria 1549
1017 Ga0501044_1255847 3300049823 Bacteria 608
1018 nmdc:mga0k408_165272_c1 3300050493 Bacteria 1319
1019 nmdc:mga0k408_182601_c1 3300050493 Bacteria 851
1020 nmdc:mga0k408_914_c1 3300050493 Bacteria 16138
1021 nmdc:mga07m45_476589_c1 3300050496 Bacteria 723
1022 nmdc:mga07m45_485771_c1 3300050496 Bacteria 715
1023 nmdc:mga05p37_516695_c1 3300050507 Bacteria 1367
1024 nmdc:mga08y16_1055627_c1 3300050511 Bacteria 790
1025 nmdc:mga08y16_140441_c1 3300050511 Bacteria 2511
1026 nmdc:mga08y16_611920_c1 3300050511 Bacteria 1097
1027 nmdc:mga0n895_122913_c1 3300050512 Bacteria 2617
1028 nmdc:mga0n895_317164_c1 3300050512 Bacteria 1580
1029 nmdc:mga0n895_386863_c1 3300050512 Unclassified 1415
1030 nmdc:mga0rr50_102569_c1 3300050513 Bacteria 2250
1031 nmdc:mga0rr50_179914_c1 3300050513 Bacteria 1728
1032 nmdc:mga0rr50_188412_c1 3300050513 Bacteria 1689
1033 nmdc:mga0rr50_375493_c1 3300050513 Bacteria 1198
1034 nmdc:mga0rr50_925887_c1 3300050513 Bacteria 743
1035 nmdc:mga08x19_3628_c1 3300050514 Bacteria 9188
1036 nmdc:mga0a205_187220_c1 3300050515 Bacteria 1962
1037 nmdc:mga0a205_201645_c1 3300050515 Bacteria 1880
1038 Ga0495601_0003501 3300053077 Bacteria 9016
1039 Ga0495601_0268625 3300053077 Bacteria 1113
1040 Ga0495601_0300411 3300053077 Bacteria 1046
1041 Ga0495595_0055842 3300053084 Bacteria 1839
1042 Ga0495595_0219451 3300053084 Bacteria 949
1043 Ga0495619_0155259 3300053085 Bacteria 1579
1044 Ga0501084_0172336 3300054114 Bacteria 1826
1045 Ga0501084_0226984 3300054114 Bacteria 1576
1046 Ga0501082_0035541 3300060353 Bacteria 4295
1047 Ga0070661_100003911
1048 Ga0065715_10188279
1049 Ga0070658_10031483
1050 Ga0070658_10077907
1051 Ga0070658_10369989
1052 Ga0070676_10010995
1053 Ga0070676_10014880
1054 Ga0070676_10023779
1055 Ga0070676_10085906
1056 Ga0070676_10190251
1057 Ga0070683_100072402
1058 Ga0070690_100071816
1059 Ga0070690_100115286
1060 Ga0070690_100300902
1061 Ga0070690_100318677
1062 Ga0070690_100577606
1063 Ga0070690_100821884
1064 Ga0070670_100002786
1065 Ga0070670_100005340
1066 Ga0070670_100006511
1067 Ga0070670_100139098
1068 Ga0070670_100140538
1069 Ga0070670_100196222
1070 Ga0070670_100244679
1071 Ga0070670_100467430
1072 Ga0070670_100513286
1073 Ga0070677_10000252
1074 Ga0070677_10078884
1075 Ga0070677_10140315
1076 Ga0070677_10514672
1077 Ga0068869_100000356
1078 Ga0068869_100017684
1079 Ga0068869_100059995
1080 Ga0068869_100636389
1081 Ga0070666_10001943
1082 Ga0070666_10003411
1083 Ga0070666_10053990
1084 Ga0070666_10488360
1085 Ga0070666_10561472
1086 Ga0070680_100060710
1087 Ga0070680_100096304
1088 Ga0070682_100773487
1089 Ga0068868_100000799
1090 Ga0068868_100005505
1091 Ga0068868_100035532
1092 Ga0068868_100127893
1093 Ga0068868_100185071
1094 Ga0068868_100194819
1095 Ga0068868_100291409
1096 Ga0068868_100336490
1097 Ga0068868_101205883
1098 Ga0068868_101257481
1099 Ga0070660_100002638
1100 Ga0070660_100444792
1101 Ga0070689_100049799
1102 Ga0070689_100181107
1103 Ga0070689_100211701
1104 Ga0070689_101275360
1105 Ga0070691_10294088
1106 Ga0070687_100028421
1107 Ga0070687_100265858
1108 Ga0070687_100630116
1109 Ga0070661_100007322
1110 Ga0070661_100094469
1111 Ga0070661_100797316
1112 Ga0070692_10124298
1113 Ga0070692_10280049
1114 Ga0070668_100001492
1115 Ga0070668_100005665
1116 Ga0070668_100006509
1117 Ga0070668_100008798
1118 Ga0070668_100012925
1119 Ga0070668_100027856
1120 Ga0070668_100091008
1121 Ga0070668_100102887
1122 Ga0070668_100232447
1123 Ga0070668_100519634
1124 Ga0070668_100768855
1125 Ga0070668_100870660
1126 Ga0070669_100002389
1127 Ga0070669_100010868
1128 Ga0070669_100041208
1129 Ga0070669_100061451
1130 Ga0070669_100197597
1131 Ga0070669_100244239
1132 Ga0070669_100383980
1133 Ga0070669_100386343
1134 Ga0070669_101135602
1135 Ga0070669_101630833
1136 Ga0070675_100000164
1137 Ga0070675_100002499
1138 Ga0070675_100029731
1139 Ga0070675_100037600
1140 Ga0070675_100038560
1141 Ga0070675_100107562
1142 Ga0070675_100170227
1143 Ga0070675_100545198
1144 Ga0070671_100007518
1145 Ga0070671_100037323
1146 Ga0070671_100037545
1147 Ga0070671_100047540
1148 Ga0070671_100367253
1149 Ga0070671_100438183
1150 Ga0070671_100796564
1151 Ga0070674_100011330
1152 Ga0070674_100023059
1153 Ga0070674_100049681
1154 Ga0070674_100058876
1155 Ga0070674_100084449
1156 Ga0070674_100110955
1157 Ga0070674_100260273
1158 Ga0070674_100292894
1159 Ga0070674_100332153
1160 Ga0070673_100000332
1161 Ga0070673_100010269
1162 Ga0070673_100042339
1163 Ga0070673_100102415
1164 Ga0070673_100131285
1165 Ga0070673_100146317
1166 Ga0070673_100806956
1167 Ga0070673_100841579
1168 Ga0070673_101196797
1169 Ga0070688_100025305
1170 Ga0070688_100069533
1171 Ga0070688_100357996
1172 Ga0070688_100478394
1173 Ga0070688_100493952
1174 Ga0070659_100007994
1175 Ga0070659_100281382
1176 Ga0070667_100001403
1177 Ga0070667_100002052
1178 Ga0070667_100059064
1179 Ga0070667_100062152
1180 Ga0070667_100063738
1181 Ga0070703_10292480
1182 Ga0070714_100004021
1183 Ga0070713_100000035
1184 Ga0070713_100009798
1185 Ga0070713_100604658
1186 Ga0070701_10154080
1187 Ga0070701_10208615
1188 Ga0070711_100204511
1189 Ga0070705_100143439
1190 Ga0070705_100323094
1191 Ga0070700_100276874
1192 Ga0070700_100576541
1193 Ga0070700_100741202
1194 Ga0070700_101512113
1195 Ga0070694_100656177
1196 Ga0070708_100000226
1197 Ga0070663_100464184
1198 Ga0070663_100576702
1199 Ga0070663_100822108
1200 Ga0070663_101173569
1201 Ga0070663_101526701
1202 Ga0070678_100000720
1203 Ga0070678_100016692
1204 Ga0070678_100046163
1205 Ga0070678_100153344
1206 Ga0070678_100313641
1207 Ga0070678_100325098
1208 Ga0070678_100382448
1209 Ga0070678_100647319
1210 Ga0070678_101105755
1211 Ga0070662_100023039
1212 Ga0070662_100204089
1213 Ga0070662_100283632
1214 Ga0070681_10014655
1215 Ga0070681_10018054
1216 Ga0070681_10033854
1217 Ga0070681_10047966
1218 Ga0070681_10526151
1219 Ga0068867_100002305
1220 Ga0068867_100004418
1221 Ga0068867_100042154
1222 Ga0068867_100048467
1223 Ga0068867_100125372
1224 Ga0068867_100152288
1225 Ga0068867_100256679
1226 Ga0068867_100279004
1227 Ga0068867_100284773
1228 Ga0068867_100842567
1229 Ga0068867_101009958
1230 Ga0070685_10041658
1231 Ga0070685_10043772
1232 Ga0070685_10322697
1233 Ga0070698_100131883
1234 Ga0070698_100315212
1235 Ga0070698_100925465
1236 Ga0070699_100699902
1237 Ga0070699_100715944
1238 Ga0070679_100008348
1239 Ga0070679_100020030
1240 Ga0070679_100020970
1241 Ga0070679_100068758
1242 Ga0070679_100088421
1243 Ga0070679_100527909
1244 Ga0070684_100046105
1245 Ga0070697_100743404
1246 Ga0068853_100014883
1247 Ga0068853_100019107
1248 Ga0068853_100027612
1249 Ga0068853_100054389
1250 Ga0068853_100147877
1251 Ga0068853_100182167
1252 Ga0068853_100282641
1253 Ga0068853_100414352
1254 Ga0070672_100001776
1255 Ga0070672_100003102
1256 Ga0070672_100021936
1257 Ga0070672_100031034
1258 Ga0070672_100041023
1259 Ga0070672_100051228
1260 Ga0070672_100088729
1261 Ga0070672_100231179
1262 Ga0070672_100342651
1263 Ga0070672_100510966
1264 Ga0070672_100689354
1265 Ga0070686_100157109
1266 Ga0070686_100310864
1267 Ga0070686_100542798
1268 Ga0070686_100613442
1269 Ga0070696_100043500
1270 Ga0070693_100000747
1271 Ga0070693_100173541
1272 Ga0070693_100370640
1273 Ga0070665_100009107
1274 Ga0070665_100009205
1275 Ga0070665_100055698
1276 Ga0070665_100205343
1277 Ga0070665_100298018
1278 Ga0070665_100321780
1279 Ga0070665_101208699
1280 Ga0070704_100145241
1281 Ga0070704_100190839
1282 Ga0070704_100234343
1283 Ga0068855_100010886
1284 Ga0068855_100070257
1285 Ga0068855_100193023
1286 Ga0068855_100380539
1287 Ga0070664_100009154
1288 Ga0070664_100023166
1289 Ga0070664_100140695
1290 Ga0070664_100222330
1291 Ga0070664_100318727
1292 Ga0070664_100952620
1293 Ga0068857_100000165
1294 Ga0068857_100013438
1295 Ga0068857_100021625
1296 Ga0068857_100048230
1297 Ga0068854_100036218
1298 Ga0068854_100143251
1299 Ga0068854_100162990
1300 Ga0068854_100269245
1301 Ga0068856_100000375
1302 Ga0068856_100024471
1303 Ga0068856_100156552
1304 Ga0068856_100265018
1305 Ga0070702_100105946
1306 Ga0070702_100170627
1307 Ga0070702_100262133
1308 Ga0070702_100503284
1309 Ga0070702_101296709
1310 Ga0068852_100054676
1311 Ga0068852_100060465
1312 Ga0068852_100312972
1313 Ga0068852_100460209
1314 Ga0068852_100482535
1315 Ga0068859_100000538
1316 Ga0068859_100011296
1317 Ga0068859_100012538
1318 Ga0068859_100044827
1319 Ga0068859_100081573
1320 Ga0068859_100259784
1321 Ga0068859_100405265
1322 Ga0068859_100687926
1323 Ga0068864_100000221
1324 Ga0068864_100000981
1325 Ga0068864_100001506
1326 Ga0068864_100012071
1327 Ga0068864_100187696
1328 Ga0068864_100244742
1329 Ga0068864_100246394
1330 Ga0068864_100393704
1331 Ga0068864_102000794
1332 Ga0068866_10035119
1333 Ga0068866_10036846
1334 Ga0068866_11056040
1335 Ga0068861_100027473
1336 Ga0068861_100040493
1337 Ga0068861_100043717
1338 Ga0068861_100093488
1339 Ga0068861_100149882
1340 Ga0068861_100249186
1341 Ga0068861_100278712
1342 Ga0068861_101349395
1343 Ga0068851_10002560
1344 Ga0068851_10018693
1345 Ga0068851_10059112
1346 Ga0068851_10071110
1347 Ga0068851_10144977
1348 Ga0068851_10251219
1349 Ga0068870_10000918
1350 Ga0068870_10105578
1351 Ga0068870_10174463
1352 Ga0068870_10463994
1353 Ga0068863_100004890
1354 Ga0068863_100005274
1355 Ga0068863_100005527
1356 Ga0068863_100010987
1357 Ga0068863_100087242
1358 Ga0068863_100206012
1359 Ga0068863_100261073
1360 Ga0068863_100299770
1361 Ga0068863_100441912
1362 Ga0068863_100477356
1363 Ga0068863_101513677
1364 Ga0068858_100001310
1365 Ga0068858_100001946
1366 Ga0068858_100080121
1367 Ga0068858_100188361
1368 Ga0068858_100523459
1369 Ga0068858_100588631
1370 Ga0068858_101091201
1371 Ga0068860_100015010
1372 Ga0068860_100019102
1373 Ga0068860_100021004
1374 Ga0068860_100030695
1375 Ga0068860_100064808
1376 Ga0068860_100085219
1377 Ga0068860_100092388
1378 Ga0068860_100158208
1379 Ga0068860_100166394
1380 Ga0068860_100648122
1381 Ga0068860_100821081
1382 Ga0068862_100002956
1383 Ga0068862_100013364
1384 Ga0068862_100033787
1385 Ga0068862_100590477
1386 Ga0068862_101082391
1387 Ga0081539_10010450
1388 Ga0070717_10069659
1389 Ga0070716_100017787
1390 Ga0070716_100054372
1391 Ga0070712_100299125
1392 Ga0075367_10253051
1393 Ga0075366_10000667
1394 Ga0075366_10021104
1395 Ga0075366_10066182
1396 Ga0097621_100009813
1397 Ga0097621_100035241
1398 Ga0097621_100042002
1399 Ga0097621_100051003
1400 Ga0097621_100095410
1401 Ga0097621_100149698
1402 Ga0097621_100155569
1403 Ga0097621_100167284
1404 Ga0097621_100223642
1405 Ga0097621_101272709
1406 Ga0068871_100004739
1407 Ga0068871_100009527
1408 Ga0068871_100053429
1409 Ga0068871_100066519
1410 Ga0068871_100200485
1411 Ga0068871_100367854
1412 Ga0068871_100600358
1413 Ga0068871_100702427
1414 Ga0075428_100011836
1415 Ga0075428_100120078
1416 Ga0075433_10218148
1417 Ga0075433_11094576
1418 Ga0075433_11403547
1419 Ga0075434_100043537
1420 Ga0075434_100059321
1421 Ga0075434_100090600
1422 Ga0075429_100748779
1423 Ga0068865_100005835
1424 Ga0068865_100042010
1425 Ga0068865_100054222
1426 Ga0068865_100081036
1427 Ga0068865_100380116
1428 Ga0068865_100409863
1429 Ga0068865_100444129
1430 Ga0068865_101437133
1431 Ga0075436_100002584
1432 Ga0097620_100000538
1433 Ga0097620_100011296
1434 Ga0097620_100012537
1435 Ga0097620_100044826
1436 Ga0097620_100081575
1437 Ga0097620_100259795
1438 Ga0097620_100405266
1439 Ga0097620_100687845
1440 Ga0075435_100097246
1441 Ga0075435_100194025
1442 Ga0075435_100598786
1443 Ga0075435_100927372
1444 Ga0105240_10009321
1445 Ga0105240_10094394
1446 Ga0105240_10237197
1447 Ga0111539_10001826
1448 Ga0111539_10139346
1449 Ga0111539_10292267
1450 Ga0111539_10582224
1451 Ga0105245_10285550
1452 Ga0105245_10343606
1453 Ga0105245_10635624
1454 Ga0105245_10912224
1455 Ga0105247_10050084
1456 Ga0105247_10060175
1457 Ga0105247_10248583
1458 Ga0105247_10311049
1459 Ga0105247_10452290
1460 Ga0114129_10376326
1461 Ga0105243_10029653
1462 Ga0105243_11094895
1463 Ga0105243_11851308
1464 Ga0105241_10023794
1465 Ga0105242_10013452
1466 Ga0105242_10087341
1467 Ga0105242_10382253
1468 Ga0105242_10449499
1469 Ga0105242_10797503
1470 Ga0105248_10001115
1471 Ga0105248_10019911
1472 Ga0105248_10048805
1473 Ga0105248_10094105
1474 Ga0105248_10203529
1475 Ga0105248_10232001
1476 Ga0105248_10461441
1477 Ga0105248_10588413
1478 Ga0105248_11189308
1479 Ga0105248_11230551
1480 Ga0105248_11281103
1481 Ga0105237_10053055
1482 Ga0105238_10000556
1483 Ga0105238_10022825
1484 Ga0105249_10031053
1485 Ga0105249_10052910
1486 Ga0105249_10197483
1487 Ga0105249_11523352
1488 Ga0105249_12594306
1489 Ga0105239_10279615
1490 Ga0105246_10437648
1491 Ga0157373_10005350
1492 Ga0157373_10036681
1493 Ga0157371_10380756
1494 Ga0157370_10005207
1495 Ga0157370_10005346
1496 Ga0157370_10008837
1497 Ga0157370_10009782
1498 Ga0157370_10046744
1499 Ga0157370_10277420
1500 Ga0157370_11056762
1501 Ga0157369_10001573
1502 Ga0157374_10094505
1503 Ga0157374_10217126
1504 Ga0157374_10250425
1505 Ga0157374_10351564
1506 Ga0157374_10557015
1507 Ga0157378_10060235
1508 Ga0157378_10065403
1509 Ga0157378_10401164
1510 Ga0157378_10432500
1511 Ga0157378_10585285
1512 Ga0157378_10906746
1513 Ga0163162_10007103
1514 Ga0163162_10027368
1515 Ga0163162_10046021
1516 Ga0163162_10092447
1517 Ga0163162_10109223
1518 Ga0163162_10364695
1519 Ga0163162_10379585
1520 Ga0163162_10487135
1521 Ga0163162_10518783
1522 Ga0163162_10673301
1523 Ga0163162_11565580
1524 Ga0163162_12279831
1525 Ga0157372_10018159
1526 Ga0157372_10026804
1527 Ga0157372_10045018
1528 Ga0157372_10095742
1529 Ga0157372_10163092
1530 Ga0157372_10335132
1531 Ga0157372_11283906
1532 Ga0157375_10001997
1533 Ga0157375_10020193
1534 Ga0157375_10033210
1535 Ga0157375_10131940
1536 Ga0157375_10139435
1537 Ga0157375_10186932
1538 Ga0157375_10356936
1539 Ga0157375_10417219
1540 Ga0157375_10785474
1541 Ga0157375_11001820
1542 Ga0157375_11406417
1543 Ga0163163_10031719
1544 Ga0163163_10041147
1545 Ga0163163_10062054
1546 Ga0163163_10435959
1547 Ga0163163_10698352
1548 Ga0157380_10001950
1549 Ga0157380_10150877
1550 Ga0157380_10463480
1551 Ga0157380_10725973
1552 Ga0157380_11071479
1553 Ga0157380_11276661
1554 Ga0157377_10164309
1555 Ga0157377_10277736
1556 Ga0157377_10568373
1557 Ga0157377_11219267
1558 Ga0157379_10005251
1559 Ga0157379_10005730
1560 Ga0157379_10008738
1561 Ga0157379_10033534
1562 Ga0157379_10075839
1563 Ga0157379_10820828
1564 Ga0157379_11190682
1565 Ga0157376_10013094
1566 Ga0157376_10154076
1567 Ga0157376_10264642
1568 Ga0157376_10265889
1569 Ga0157376_10939154
1570 Ga0157376_10964426
1571 Ga0157376_10987454
1572 Ga0157376_12089949
1573 Ga0163161_10005854
1574 Ga0163161_10008961
1575 Ga0163161_10021874
1576 Ga0163161_10124399
1577 Ga0163161_10194826
1578 Ga0163161_10504695
1579 Ga0163161_10900543
1580 Ga0213876_10109332
1581 Ga0207697_10010293
1582 Ga0207697_10021292
1583 Ga0207656_10000665
1584 Ga0207656_10003476
1585 Ga0207656_10079233
1586 Ga0207656_10086923
1587 Ga0207656_10131712
1588 Ga0207682_10000112
1589 Ga0207682_10041649
1590 Ga0207682_10208784
1591 Ga0207682_10255743
1592 Ga0207692_10206357
1593 Ga0207642_10004139
1594 Ga0207710_10050401
1595 Ga0207710_10210926
1596 Ga0207688_10030378
1597 Ga0207688_10060868
1598 Ga0207680_10002142
1599 Ga0207680_10034361
1600 Ga0207680_10038627
1601 Ga0207680_10062464
1602 Ga0207680_10446411
1603 Ga0207699_10013459
1604 Ga0207645_10000353
1605 Ga0207645_10002067
1606 Ga0207645_10012164
1607 Ga0207645_10064415
1608 Ga0207645_10074018
1609 Ga0207645_10080288
1610 Ga0207645_10693978
1611 Ga0207643_10002333
1612 Ga0207643_10039743
1613 Ga0207643_10088917
1614 Ga0207643_10099266
1615 Ga0207643_10157082
1616 Ga0207705_10033975
1617 Ga0207705_10556604
1618 Ga0207707_10009511
1619 Ga0207707_10012172
1620 Ga0207707_10021505
1621 Ga0207707_10105652
1622 Ga0207695_10017185
1623 Ga0207695_10219783
1624 Ga0207671_10017689
1625 Ga0207693_10122236
1626 Ga0207693_10943906
1627 Ga0207660_10095750
1628 Ga0207662_10345159
1629 Ga0207662_10427615
1630 Ga0207662_10492008
1631 Ga0207657_10037894
1632 Ga0207657_10105831
1633 Ga0207657_10306434
1634 Ga0207657_10618916
1635 Ga0207649_10006554
1636 Ga0207649_10007733
1637 Ga0207652_10006935
1638 Ga0207652_10007646
1639 Ga0207652_10010251
1640 Ga0207652_10097132
1641 Ga0207646_10439592
1642 Ga0207681_10001647
1643 Ga0207681_10034893
1644 Ga0207681_10041533
1645 Ga0207681_10055567
1646 Ga0207681_10070572
1647 Ga0207681_10073194
1648 Ga0207681_10156833
1649 Ga0207681_10637028
1650 Ga0207694_10005707
1651 Ga0207650_10002173
1652 Ga0207650_10028013
1653 Ga0207650_10035261
1654 Ga0207650_10054229
1655 Ga0207650_10140560
1656 Ga0207650_10155901
1657 Ga0207650_10225226
1658 Ga0207650_10496115
1659 Ga0207650_10567381
1660 Ga0207650_10585796
1661 Ga0207659_10023112
1662 Ga0207659_10044416
1663 Ga0207659_10119284
1664 Ga0207659_10223215
1665 Ga0207659_10294446
1666 Ga0207659_10318641
1667 Ga0207659_10489267
1668 Ga0207700_10000023
1669 Ga0207700_10250582
1670 Ga0207700_10282921
1671 Ga0207664_10005947
1672 Ga0207664_10338678
1673 Ga0207644_10003890
1674 Ga0207644_10006077
1675 Ga0207644_10009728
1676 Ga0207644_10144276
1677 Ga0207644_10193481
1678 Ga0207644_10478779
1679 Ga0207644_10767124
1680 Ga0207644_10851250
1681 Ga0207690_10004550
1682 Ga0207690_10941418
1683 Ga0207706_10017758
1684 Ga0207706_10129173
1685 Ga0207706_10259376
1686 Ga0207706_10302708
1687 Ga0207686_10006269
1688 Ga0207686_10273498
1689 Ga0207686_10495913
1690 Ga0207670_10012516
1691 Ga0207670_10014182
1692 Ga0207670_10064119
1693 Ga0207670_10207561
1694 Ga0207670_10964045
1695 Ga0207669_10009607
1696 Ga0207669_10063183
1697 Ga0207669_10069558
1698 Ga0207669_10075558
1699 Ga0207669_10202169
1700 Ga0207669_10202765
1701 Ga0207669_10571333
1702 Ga0207669_10687964
1703 Ga0207704_10016763
1704 Ga0207704_10263698
1705 Ga0207704_10443752
1706 Ga0207704_11005984
1707 Ga0207665_10113160
1708 Ga0207665_10124907
1709 Ga0207691_10000153
1710 Ga0207691_10000663
1711 Ga0207691_10018917
1712 Ga0207691_10037551
1713 Ga0207691_10092766
1714 Ga0207691_10290635
1715 Ga0207691_10395049
1716 Ga0207691_10448523
1717 Ga0207691_10586321
1718 Ga0207711_10021962
1719 Ga0207711_10090611
1720 Ga0207711_10144765
1721 Ga0207711_10206816
1722 Ga0207711_10837337
1723 Ga0207711_10966836
1724 Ga0207689_10001242
1725 Ga0207689_10001481
1726 Ga0207689_10002580
1727 Ga0207689_10168657
1728 Ga0207689_10357681
1729 Ga0207689_10363643
1730 Ga0207661_10049797
1731 Ga0207661_10420351
1732 Ga0207679_10184631
1733 Ga0207679_10230800
1734 Ga0207679_10255847
1735 Ga0207679_10369699
1736 Ga0207667_10014858
1737 Ga0207667_10019355
1738 Ga0207667_10056095
1739 Ga0207667_10206617
1740 Ga0207667_11142070
1741 Ga0207667_11781199
1742 Ga0207651_10003230
1743 Ga0207651_10027821
1744 Ga0207651_10041257
1745 Ga0207651_10094883
1746 Ga0207651_10100827
1747 Ga0207651_10122974
1748 Ga0207651_10175473
1749 Ga0207651_10382654
1750 Ga0207651_10584761
1751 Ga0207651_10837940
1752 Ga0207651_11111527
1753 Ga0207712_10064785
1754 Ga0207712_10104476
1755 Ga0207668_10001215
1756 Ga0207668_10004590
1757 Ga0207668_10007939
1758 Ga0207668_10010698
1759 Ga0207668_10030173
1760 Ga0207668_10205579
1761 Ga0207668_10207910
1762 Ga0207668_10311330
1763 Ga0207668_10548564
1764 Ga0207668_10633711
1765 Ga0207640_10001692
1766 Ga0207640_10255776
1767 Ga0207640_10280838
1768 Ga0207640_11752971
1769 Ga0207658_10006990
1770 Ga0207658_10007512
1771 Ga0207658_10008205
1772 Ga0207658_10031200
1773 Ga0207658_10038754
1774 Ga0207658_10047370
1775 Ga0207658_10079019
1776 Ga0207658_10180390
1777 Ga0207658_10337957
1778 Ga0207677_10003737
1779 Ga0207677_10028988
1780 Ga0207677_10073510
1781 Ga0207677_10112684
1782 Ga0207677_10129855
1783 Ga0207677_10618957
1784 Ga0207677_10699950
1785 Ga0207703_10004283
1786 Ga0207703_10012045
1787 Ga0207703_10102564
1788 Ga0207703_10133671
1789 Ga0207703_10402387
1790 Ga0207703_11006823
1791 Ga0207639_10020129
1792 Ga0207639_10021692
1793 Ga0207639_10033544
1794 Ga0207639_10117238
1795 Ga0207678_10104231
1796 Ga0207678_10150272
1797 Ga0207678_10323022
1798 Ga0207678_10741186
1799 Ga0207678_11008142
1800 Ga0207708_10301104
1801 Ga0207708_10552326
1802 Ga0207702_10008016
1803 Ga0207702_10025538
1804 Ga0207702_10102183
1805 Ga0207702_10349287
1806 Ga0207641_10005782
1807 Ga0207641_10013438
1808 Ga0207641_10014474
1809 Ga0207641_10055937
1810 Ga0207641_10058051
1811 Ga0207641_10145284
1812 Ga0207641_10186255
1813 Ga0207641_10235958
1814 Ga0207641_10252317
1815 Ga0207641_10332248
1816 Ga0207641_10419288
1817 Ga0207641_10753123
1818 Ga0207641_11030782
1819 Ga0207641_11820821
1820 Ga0207648_10000306
1821 Ga0207648_10004210
1822 Ga0207648_10004471
1823 Ga0207648_10016667
1824 Ga0207648_10037366
1825 Ga0207648_10048501
1826 Ga0207648_10076203
1827 Ga0207648_10112348
1828 Ga0207648_10171437
1829 Ga0207676_10006304
1830 Ga0207676_10008349
1831 Ga0207676_10010399
1832 Ga0207676_10075776
1833 Ga0207676_10091972
1834 Ga0207676_10171442
1835 Ga0207676_10172690
1836 Ga0207676_10334335
1837 Ga0207676_11129261
1838 Ga0207674_10000180
1839 Ga0207674_10005717
1840 Ga0207674_10081841
1841 Ga0207675_100003390
1842 Ga0207675_100017874
1843 Ga0207675_100020501
1844 Ga0207675_100023617
1845 Ga0207675_100057843
1846 Ga0207675_100065227
1847 Ga0207675_100150864
1848 Ga0207675_100374197
1849 Ga0207675_100479836
1850 Ga0207683_10000140
1851 Ga0207683_10001329
1852 Ga0207683_10011489
1853 Ga0207683_10011502
1854 Ga0207683_10066165
1855 Ga0207683_10155733
1856 Ga0207683_10324481
1857 Ga0207683_10407635
1858 Ga0207683_10853297
1859 Ga0207698_10120570
1860 Ga0207698_10342278
1861 Ga0207698_10509396
1862 Ga0207698_11490697
1863 Ga0207698_11557436
1864 Ga0268266_10007303
1865 Ga0268266_10107189
1866 Ga0268266_10322053
1867 Ga0268266_10776544
1868 Ga0268266_10825451
1869 Ga0268265_10007626
1870 Ga0268265_10070392
1871 Ga0268265_10257555
1872 Ga0268265_12037275
1873 Ga0268264_10000599
1874 Ga0268264_10046825
1875 Ga0268264_10051114
1876 Ga0268264_10051202
1877 Ga0268264_10133034
1878 Ga0268264_10283817
1879 Ga0268264_10299934
1880 Ga0268264_10362514
1881 Ga0268264_10470212
1882 Ga0268264_10660938
1883 Ga0268264_10710242
1884 Ga0268264_10799929
1885 Ga0268264_10809739
1886 Ga0268264_11084073
1887 Ga0268264_11611770
1888 Ga0265330_10002138
1889 Ga0265332_10001350
1890 Ga0265325_10012087
1891 Ga0265339_10070060
1892 Ga0265339_10330409
1893 Ga0265331_10000485
1894 Ga0265327_10001001
1895 Ga0265316_10080535
1896 Ga0307408_100361392
1897 Ga0307408_101359427
1898 Ga0265314_10009940
1899 Ga0265314_10474187
1900 Ga0265342_10029881
1901 Ga0307405_10002193
1902 Ga0307405_10235718
1903 Ga0307405_10750336
1904 Ga0307405_12055982
1905 Ga0307413_10024401
1906 Ga0307413_10749934
1907 Ga0307413_10871560
1908 Ga0307410_10029349
1909 Ga0307410_10142211
1910 Ga0307406_10025498
1911 Ga0307407_10000212
1912 Ga0307412_10024475
1913 Ga0307412_10079185
1914 Ga0307412_10335066
1915 Ga0307409_100005538
1916 Ga0307409_100030920
1917 Ga0307409_100057213
1918 Ga0307409_100679804
1919 Ga0307416_100006878
1920 Ga0307416_100279764
1921 Ga0307416_100373264
1922 Ga0307416_100567627
1923 Ga0307416_100995770
1924 Ga0307414_10023076
1925 Ga0307411_10127048
1926 Ga0307411_10162797
1927 Ga0307411_10556711
1928 Ga0307415_100427671
1929 Ga0307415_100475356
1930 Ga0373939_0206846
1931 Ga0373945_0267510
1932 Ga0373956_0191195
1933 Ga0373943_0327113
1934 Ga0373955_0308203
1935 Ga0373955_0476386
1936 Ga0373942_0205882
1937 Ga0373962_0099138
1938 Ga0373924_0172991
1939 Ga0373931_0112434
1940 Ga0373931_0179574
1941 Ga0373935_0048668
1942 Ga0373935_0095789
1943 Ga0373933_0038822
1944 Ga0373937_0049030
1945 Ga0373937_0073819
1946 Ga0373937_0657036
1947 Ga0436365_0156624
1948 Ga0436361_0372154
1949 Ga0451793_1922151
1950 Ga0451800_0856952
1951 Ga0451807_1470547
1952 Ga0451839_0580464
1953 Ga0451853_0166656
1954 Ga0451853_0600167
1955 Ga0451853_2506226
1956 Ga0439448_0106461
1957 Ga0439459_0033645
1958 Ga0451577_0894151
1959 Ga0453683_0551851
1960 Ga0451576_0046846
1961 Ga0451576_0452060
1962 Ga0451576_0630732
1963 Ga0495592_0156310
1964 Ga0495603_0106783
1965 Ga0495651_0021771
1966 Ga0495653_0021896
1967 Ga0495664_0162679
1968 Ga0495608_0005629
1969 Ga0495618_0135895
1970 Ga0495587_0020735
1971 Ga0495598_0266452
1972 Ga0495621_0081329
1973 Ga0495645_0002022
1974 Ga0495645_0171030
1975 Ga0495633_0067944
1976 Ga0495667_0014939
1977 Ga0495634_0413874
1978 Ga0495635_0025547
1979 Ga0495657_0008468
1980 Ga0495599_0006839
1981 Ga0495623_0005020
1982 Ga0495658_0227542
1983 Ga0495658_0757602
1984 Ga0495670_0190852
1985 Ga0495600_0524518
1986 Ga0495680_0602212
1987 Ga0495675_0094924
1988 Ga0495684_0021543
1989 Ga0495602_0131750
1990 Ga0496100_0200281
1991 Ga0496101_0266536
1992 Ga0496102_0017096
1993 Ga0496103_0158258
1994 Ga0496104_0623362
1995 Ga0496105_1011563
1996 Ga0496106_0416087
1997 Ga0496106_0562071
1998 Ga0496107_0421154
1999 Ga0496108_0105060
2000 Ga0496108_0200195
2001 Ga0496108_0243291
2002 Ga0496108_1182845
2003 Ga0496109_0014914
2004 Ga0496109_0095991
2005 Ga0496109_0189560
2006 Ga0496109_0962201
2007 Ga0496110_0284439
2008 Ga0496110_0403173
2009 Ga0496111_0396986
2010 Ga0496112_0004213
2011 Ga0496112_0372568
2012 Ga0496114_0086358
2013 Ga0496115_0234817
2014 Ga0501291_114215
2015 Ga0501034_0055322
2016 Ga0501034_0281353
2017 Ga0501037_0000686
2018 Ga0501037_0003202
2019 Ga0501037_0338859
2020 Ga0501038_0005232
2021 Ga0501046_0190850
2022 Ga0501046_0420166
2023 Ga0501047_0015991
2024 Ga0501047_0026629
2025 Ga0501047_0647396
2026 Ga0501047_0723096
2027 Ga0501048_0330384
2028 Ga0501067_0038826
2029 Ga0501068_0045822
2030 Ga0501068_0452954
2031 Ga0501069_0036684
2032 Ga0501069_0042505
2033 Ga0501070_0002025
2034 Ga0501070_0012613
2035 Ga0501070_0018709
2036 Ga0501070_0021608
2037 Ga0501070_0042823
2038 Ga0501070_0655665
2039 Ga0501071_0073631
2040 Ga0501072_0007090
2041 Ga0501072_0056512
2042 Ga0501073_0013481
2043 Ga0501073_0031079
2044 Ga0501074_0002139
2045 Ga0501074_0014501
2046 Ga0501075_0069021
2047 Ga0501075_0617163
2048 Ga0501076_0451028
2049 Ga0501076_1138895
2050 Ga0501079_0006766
2051 Ga0501079_0568926
2052 Ga0501080_0007158
2053 Ga0501080_0070520
2054 Ga0501080_0103936
2055 Ga0501080_0202603
2056 Ga0501080_0642714
2057 Ga0501083_0058688
2058 Ga0501083_0124021
2059 Ga0501083_0126215
2060 Ga0501035_0440210
2061 Ga0501044_0025553
2062 Ga0501044_0295839
2063 Ga0501044_1255847
2064 nmdc:mga0k408_165272_c1
2065 nmdc:mga0k408_182601_c1
2066 nmdc:mga0k408_914_c1
2067 nmdc:mga07m45_476589_c1
2068 nmdc:mga07m45_485771_c1
2069 nmdc:mga05p37_516695_c1
2070 nmdc:mga08y16_1055627_c1
2071 nmdc:mga08y16_140441_c1
2072 nmdc:mga08y16_611920_c1
2073 nmdc:mga0n895_122913_c1
2074 nmdc:mga0n895_317164_c1
2075 nmdc:mga0n895_386863_c1
2076 nmdc:mga0rr50_102569_c1
2077 nmdc:mga0rr50_179914_c1
2078 nmdc:mga0rr50_188412_c1
2079 nmdc:mga0rr50_375493_c1
2080 nmdc:mga0rr50_925887_c1
2081 nmdc:mga08x19_3628_c1
2082 nmdc:mga0a205_187220_c1
2083 nmdc:mga0a205_201645_c1
2084 Ga0495601_0003501
2085 Ga0495601_0268625
2086 Ga0495601_0300411
2087 Ga0495595_0055842
2088 Ga0495595_0219451
2089 Ga0495619_0155259
2090 Ga0501084_0172336
2091 Ga0501084_0226984
2092 Ga0501082_0035541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00359

PTS_EIIA_2

Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2

34

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3urr-assembly1.cif.gz_A structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.9673 1 151
4gqx-assembly1.cif.gz_B crystal structure of eiia(ntr) from burkholderia pseudomallei 0.9631 1 151
3urr-assembly1.cif.gz_B structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.9609 1 151
4gqx-assembly1.cif.gz_B crystal structure of eiia(ntr) from burkholderia pseudomallei 0.9569 1 151
1a6j-assembly1.cif.gz_A-2 nitrogen regulatory bacterial protein iia-nitrogen 0.9485 4 145
ID Description Score Start End Superfamily
3urrA00 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9673 1 151 3.40.930.10
af_P69829_1_163_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9516 3 148 3.40.930.10
af_P32155_2_148_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9271 9 146 3.40.930.10
af_Q2G239_1_154_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9225 4 146 3.40.930.10
af_Q2FUX0_504_650_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9163 5 149 3.40.930.10
ID Description Score Start End GO Terms
AF-A0A1H9BCW7-F1-model_v4 PTS IIA-like nitrogen-regulatory protein PtsN (Phosphotransferase IIA-like nitrogen-regulatory protein PtsN) 0.9857 1 151 GO:0016740
GO:0030295
AF-A0A5E4ZDD7-F1-model_v4 PTS sugar transporter subunit IIA 0.9853 1 151 GO:0008982
GO:0009401
GO:0030295
AF-A0A0C5K9R5-F1-model_v4 deleted 0.9846 1 151
AF-A0A1I2DC92-F1-model_v4 PTS system, nitrogen regulatory IIA component 0.9842 1 151 GO:0030295
AF-A0A1G5H4W1-F1-model_v4 PTS IIA-like nitrogen-regulatory protein PtsN 0.9838 1 151 GO:0030295

Map