F488955

General Info

Members Datasets Scaffolds Average Seq Length
1046 550 2092 402

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10002142|Ga0075366_1000214210
Length 397
Sequence MSAALPLADLKVVELGTLIAGPYCARLLAEFGADVVKVETPGEGDPLRKWRVLHEGNSLWWYAQARNKKSVTVNLRVKEGQEIVRKLVREADILVENFRPGTLEKWGLSYEELARDNPKLVMVRLSGFGQTGPYKDRTGFGAIGESMGGMRYITGYADRAPVRVGISIGDSLAAMFGVIGALTAIHHRQTSGKGQVVDVALYEAVFAMMESMLPEYGMTGLVRERTGASLPGIVPSNTYLCGDGKYVVIGANGDSIFKRMMVSIGRQDLADDPSLANNAGRVRRTEELDRVIGEWTARHTLDDVLAVLEQAQVPSGKIYSIADIVADMQFQARQMVEAHKLGDGKDVLLPGIVPKLSATPGATRWIGPRLGEHTDEVLKALGYPDEERARLRAAGVI

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
112 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
169 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
179 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
193 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
196 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
197 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
198 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
202 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
203 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
204 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
205 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
206 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
207 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
208 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
209 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
210 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
225 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
281 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
308 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
309 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
316 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
317 2511231004 Pseudomonas sp. GM102 Isolate Nodule
318 2511231006 Pseudomonas sp. GM17 Isolate Nodule
319 2511231007 Pseudomonas sp. GM18 Isolate Nodule
320 2511231008 Pseudomonas sp. GM21 Isolate Nodule
321 2511231010 Pseudomonas sp. GM25 Isolate Nodule
322 2511231011 Pseudomonas sp. GM30 Isolate Nodule
323 2511231012 Pseudomonas sp. GM33 Isolate Nodule
324 2511231014 Pseudomonas sp. GM48 Isolate Nodule
325 2511231015 Pseudomonas sp. GM49 Isolate Nodule
326 2511231016 Pseudomonas sp. GM50 Isolate Nodule
327 2511231017 Pseudomonas sp. GM55 Isolate Nodule
328 2511231018 Pseudomonas sp. GM60 Isolate Nodule
329 2511231019 Pseudomonas sp. GM67 Isolate Nodule
330 2511231020 Pseudomonas sp. GM74 Isolate Nodule
331 2511231021 Pseudomonas sp. GM78 Isolate Nodule
332 2511231022 Pseudomonas sp. GM79 Isolate Nodule
333 2511231023 Pseudomonas sp. GM80 Isolate Nodule
334 2511231024 Pseudomonas sp. GM84 Isolate Nodule
335 2511231031 Pseudomonas sp. GM16 Isolate Nodule
336 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
337 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
338 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
339 2547132512 Azospira oryzae 6a3 Isolate Unclassified
340 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
341 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
342 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
343 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
344 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
345 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
346 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
347 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
348 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
349 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
350 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
351 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
352 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
353 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
354 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
355 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
356 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
357 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
358 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
359 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
360 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
361 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
362 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
363 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
364 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
365 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
366 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
367 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
368 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
369 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
370 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
371 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
372 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
373 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
374 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
375 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
376 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
377 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
378 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
379 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
380 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
381 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
382 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
383 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
384 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
385 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
386 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
387 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
388 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
389 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
390 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
391 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
392 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
393 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
394 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
395 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
396 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
397 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
398 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
399 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
400 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
401 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
402 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
403 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
404 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
405 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
406 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
407 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
408 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
409 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
410 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
411 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
412 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
413 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
414 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
415 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
416 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
417 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
418 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
419 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
420 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
421 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
422 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
423 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
424 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
425 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
426 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
427 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
428 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
429 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
430 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
431 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
432 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
433 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
434 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
435 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
436 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
437 2765235841 Pseudomonas putida AA7 Isolate Unclassified
438 2773857670 Pseudomonas sp. 478 Isolate Unclassified
439 2773857673 Pseudomonas sp. 443 Isolate Unclassified
440 2784132063 Pseudomonas sp. 424 Isolate Unclassified
441 2784132072 Pseudomonas sp. 460 Isolate Unclassified
442 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
443 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
444 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
445 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
446 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
447 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
448 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
449 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
450 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
451 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
452 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
453 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
454 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
455 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
456 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
457 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
458 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
459 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
460 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
461 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
462 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
463 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
464 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
465 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
466 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
467 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
468 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
469 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
470 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
471 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
472 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
473 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
474 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
475 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
476 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
477 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
478 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
479 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
480 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
481 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
482 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
483 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
484 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
485 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
486 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
487 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
488 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
489 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
490 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
491 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
492 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
493 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
494 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
495 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
496 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
497 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
498 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
499 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
500 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
501 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
502 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
503 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
504 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
505 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
506 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
507 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
508 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
509 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
510 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
511 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
512 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
513 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
514 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
515 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
516 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
517 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
518 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
519 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
520 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
521 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
522 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
523 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
524 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
525 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
526 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
527 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
528 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
529 8052494512 Pseudomonas putida LD6 Isolate Unclassified
530 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
531 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
532 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
533 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
534 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
535 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
536 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
537 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
538 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
539 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
540 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
541 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
542 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
543 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
544 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
545 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
546 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
547 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
548 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
549 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
550 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.63
Metatranscriptomes 0
Isolates 22.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 2.77
Rhizoplane 6.41
Rhizosphere 73.14
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10002142 3300006195 Bacteria 10048
2 MRS2a_Contig_782 2124908027 Bacteria 15632
3 SwRhRL2b_contig_1365810 2162886007 Bacteria 1828
4 SwRhRL2b_contig_3491391 2162886007 Bacteria 1701
5 JGI25162J39368_1000126 3300002737 Bacteria 84404
6 JGI25162J39368_1000257 3300002737 Bacteria 50817
7 JGI25163J39215_1000103 3300002771 Bacteria 35374
8 JGI25163J39215_1000331 3300002771 Bacteria 15725
9 JGI25164J39214_1000100 3300002772 Bacteria 84404
10 JGI25164J39214_1000202 3300002772 Bacteria 50817
11 JGI25165J46597_1000207 3300003214 Bacteria 84404
12 JGI25165J46597_1000361 3300003214 Bacteria 50817
13 Ga0055538_1000028 3300003751 Bacteria 215806
14 Ga0055539_1000037 3300003752 Bacteria 215806
15 Ga0055533_1000047 3300003756 Bacteria 215806
16 Ga0055532_1000129 3300003758 Bacteria 74882
17 Ga0055525_1000443 3300003759 Bacteria 23895
18 Ga0055536_1000305 3300003781 Bacteria 36930
19 Ga0055536_1000508 3300003781 Bacteria 26882
20 Ga0055536_1001255 3300003781 Bacteria 15613
21 Ga0055530_10000839 3300003791 Bacteria 25345
22 Ga0055530_10000961 3300003791 Bacteria 23411
23 Ga0055530_10001388 3300003791 Bacteria 17936
24 Ga0055540_1000576 3300003792 Bacteria 26893
25 Ga0055540_1000882 3300003792 Bacteria 19857
26 Ga0055540_1001025 3300003792 Bacteria 17936
27 Ga0055531_10004261 3300003794 Bacteria 8790
28 Ga0055541_1000025 3300003841 Bacteria 215806
29 Ga0065714_10000132 3300005288 Bacteria 9150
30 Ga0065714_10005553 3300005288 Bacteria 5099
31 Ga0065714_10005866 3300005288 Bacteria 3874
32 Ga0065714_10006337 3300005288 Bacteria 5135
33 Ga0065714_10011464 3300005288 Bacteria 3426
34 Ga0065714_10065605 3300005288 Bacteria 9222
35 Ga0065714_10065693 3300005288 Bacteria 8841
36 Ga0065714_10066074 3300005288 Bacteria 7683
37 Ga0065714_10072057 3300005288 Bacteria 3438
38 Ga0065714_10073300 3300005288 Bacteria 3186
39 Ga0065704_10001267 3300005289 Bacteria 8578
40 Ga0065704_10005830 3300005289 Bacteria 3028
41 Ga0065704_10009564 3300005289 Bacteria 2207
42 Ga0065704_10075747 3300005289 Bacteria 5439
43 Ga0065704_10086093 3300005289 Bacteria 3153
44 Ga0065704_10105239 3300005289 Bacteria 2102
45 Ga0065712_10000712 3300005290 Bacteria 8657
46 Ga0065712_10002348 3300005290 Bacteria 10512
47 Ga0070658_10078006 3300005327 Unclassified 2718
48 Ga0070683_100002978 3300005329 Bacteria 13582
49 Ga0070670_100002834 3300005331 Bacteria 14342
50 Ga0070670_100004830 3300005331 Bacteria 11325
51 Ga0070670_100011421 3300005331 Bacteria 7596
52 Ga0070677_10014734 3300005333 Unclassified 2758
53 Ga0070666_10049275 3300005335 Unclassified 2830
54 Ga0070680_100320711 3300005336 Bacteria 1315
55 Ga0068868_100001450 3300005338 Bacteria 16360
56 Ga0070687_100021860 3300005343 Bacteria 3015
57 Ga0070661_100000022 3300005344 Bacteria 127714
58 Ga0070661_100001365 3300005344 Bacteria 17047
59 Ga0070668_100167109 3300005347 Bacteria 1788
60 Ga0070669_100001703 3300005353 Bacteria 15924
61 Ga0070669_100036007 3300005353 Bacteria 3586
62 Ga0070675_100048464 3300005354 Unclassified 3484
63 Ga0070671_100012446 3300005355 Bacteria 6851
64 Ga0070674_100041038 3300005356 Unclassified 3133
65 Ga0070673_100000687 3300005364 Bacteria 18684
66 Ga0070673_100017690 3300005364 Bacteria 5076
67 Ga0070667_100071281 3300005367 Unclassified 2960
68 Ga0070700_100087480 3300005441 Bacteria 2025
69 Ga0070694_100038566 3300005444 Bacteria 3175
70 Ga0070708_100269572 3300005445 Bacteria 1601
71 Ga0070678_100000554 3300005456 Bacteria 18234
72 Ga0070662_100000041 3300005457 Bacteria 72879
73 Ga0070662_100017261 3300005457 Unclassified 4862
74 Ga0070681_10005132 3300005458 Bacteria 12632
75 Ga0070681_10009747 3300005458 Bacteria 9453
76 Ga0068867_100022758 3300005459 Bacteria 4483
77 Ga0068867_100155962 3300005459 Bacteria 1797
78 Ga0070685_10162537 3300005466 Bacteria 1424
79 Ga0070706_100283023 3300005467 Bacteria 1547
80 Ga0070707_100074438 3300005468 Bacteria 3275
81 Ga0070697_100220403 3300005536 Bacteria 1617
82 Ga0068853_100005399 3300005539 Bacteria 10011
83 Ga0070672_100006420 3300005543 Bacteria 7902
84 Ga0070686_100078621 3300005544 Bacteria 2178
85 Ga0070695_100029773 3300005545 Bacteria 3395
86 Ga0070695_100140535 3300005545 Bacteria 1674
87 Ga0070665_100065413 3300005548 Bacteria 3647
88 Ga0070665_100091254 3300005548 Bacteria 3052
89 Ga0068855_100155004 3300005563 Bacteria 2603
90 Ga0070664_100000646 3300005564 Bacteria 26728
91 Ga0070664_100002976 3300005564 Bacteria 13707
92 Ga0070664_100087817 3300005564 Bacteria 2689
93 Ga0068857_100085938 3300005577 Bacteria 2812
94 Ga0068852_100001172 3300005616 Bacteria 17355
95 Ga0068859_100063420 3300005617 Bacteria 3726
96 Ga0068864_100003416 3300005618 Bacteria 13134
97 Ga0068866_10036604 3300005718 Bacteria 2405
98 Ga0068851_10000044 3300005834 Bacteria 83228
99 Ga0068851_10000531 3300005834 Bacteria 16632
100 Ga0068863_100048109 3300005841 Bacteria 4044
101 Ga0075363_100104962 3300006048 Bacteria 1567
102 Ga0075364_10021002 3300006051 Bacteria 4112
103 Ga0075364_10049614 3300006051 Bacteria 2738
104 Ga0075432_10004390 3300006058 Bacteria 4803
105 Ga0075432_10008014 3300006058 Bacteria 3603
106 Ga0075432_10012043 3300006058 Bacteria 2938
107 Ga0075362_10027169 3300006177 Bacteria 2448
108 Ga0075366_10026616 3300006195 Bacteria 3389
109 Ga0097621_100002291 3300006237 Bacteria 13108
110 Ga0097621_100005368 3300006237 Bacteria 9031
111 Ga0068871_100001444 3300006358 Bacteria 15897
112 Ga0068871_100022645 3300006358 Bacteria 4847
113 Ga0075428_100002635 3300006844 Bacteria 19521
114 Ga0075431_100034988 3300006847 Bacteria 5174
115 Ga0075433_10117466 3300006852 Bacteria 2360
116 Ga0075429_100238703 3300006880 Bacteria 1592
117 Ga0075429_100300234 3300006880 Bacteria 1406
118 Ga0068865_100011198 3300006881 Bacteria 5607
119 Ga0075436_100118666 3300006914 Bacteria 1850
120 Ga0097620_100063421 3300006931 Bacteria 3726
121 Ga0099823_1000054 3300006944 Bacteria 55085
122 Ga0079104_1000414 3300006946 Bacteria 49214
123 Ga0079104_1000902 3300006946 Bacteria 24116
124 Ga0079104_1015454 3300006946 Bacteria 2262
125 Ga0099826_10003858 3300006948 Bacteria 10330
126 Ga0099794_10000077 3300007265 Bacteria 36156
127 Ga0105251_10001454 3300009011 Bacteria 20349
128 Ga0105251_10002538 3300009011 Bacteria 14210
129 Ga0105251_10003633 3300009011 Bacteria 11079
130 Ga0105251_10004210 3300009011 Bacteria 9953
131 Ga0105251_10007529 3300009011 Bacteria 6693
132 Ga0105251_10008536 3300009011 Bacteria 6147
133 Ga0105251_10011825 3300009011 Bacteria 4967
134 Ga0105251_10032356 3300009011 Bacteria 2607
135 Ga0105251_10046910 3300009011 Bacteria 2078
136 Ga0105244_10004672 3300009036 Bacteria 9337
137 Ga0105244_10004698 3300009036 Bacteria 9308
138 Ga0105244_10005205 3300009036 Bacteria 8705
139 Ga0105244_10006467 3300009036 Bacteria 7578
140 Ga0105244_10014809 3300009036 Bacteria 4495
141 Ga0105244_10024035 3300009036 Bacteria 3331
142 Ga0105244_10035122 3300009036 Bacteria 2635
143 Ga0105250_10002773 3300009092 Bacteria 8609
144 Ga0105250_10003059 3300009092 Bacteria 8070
145 Ga0111539_10004775 3300009094 Bacteria 17692
146 Ga0111539_10052830 3300009094 Bacteria 4836
147 Ga0105245_10374272 3300009098 Bacteria 1417
148 Ga0105243_10000312 3300009148 Bacteria 53545
149 Ga0105243_10002146 3300009148 Bacteria 16669
150 Ga0105243_10159483 3300009148 Bacteria 1944
151 Ga0105241_10027898 3300009174 Bacteria 4204
152 Ga0105242_10002134 3300009176 Bacteria 15610
153 Ga0105242_10027676 3300009176 Bacteria 4505
154 Ga0105242_10030641 3300009176 Bacteria 4296
155 Ga0105248_10026428 3300009177 Bacteria 6458
156 Ga0105248_10143438 3300009177 Bacteria 2695
157 Ga0105248_10186693 3300009177 Unclassified 2336
158 Ga0105237_10001243 3300009545 Bacteria 33994
159 Ga0105237_10027467 3300009545 Bacteria 5810
160 Ga0105238_10022892 3300009551 Bacteria 6369
161 Ga0105239_10203812 3300010375 Bacteria 2216
162 Ga0105246_10001031 3300011119 Bacteria 16018
163 Ga0105246_10014568 3300011119 Bacteria 4947
164 Ga0105246_10018673 3300011119 Bacteria 4421
165 Ga0105246_10107322 3300011119 Bacteria 2044
166 Ga0105246_10120480 3300011119 Bacteria 1943
167 Ga0157345_1000029 3300012498 Bacteria 35524
168 Ga0157373_10001975 3300013100 Bacteria 15547
169 Ga0157373_10004161 3300013100 Bacteria 10911
170 Ga0157373_10017134 3300013100 Bacteria 5276
171 Ga0157373_10018246 3300013100 Bacteria 5110
172 Ga0157373_10032739 3300013100 Bacteria 3741
173 Ga0157373_10033176 3300013100 Bacteria 3715
174 Ga0157373_10182539 3300013100 Bacteria 1478
175 Ga0157371_10001461 3300013102 Bacteria 24500
176 Ga0157371_10008227 3300013102 Bacteria 8336
177 Ga0157371_10015251 3300013102 Bacteria 5771
178 Ga0157370_10001727 3300013104 Bacteria 26898
179 Ga0157370_10032362 3300013104 Bacteria 5106
180 Ga0157369_10002202 3300013105 Bacteria 23480
181 Ga0157369_10066249 3300013105 Bacteria 3886
182 Ga0157369_10075608 3300013105 Bacteria 3610
183 Ga0157374_10001943 3300013296 Bacteria 17328
184 Ga0157378_10006978 3300013297 Bacteria 9854
185 Ga0163162_10005737 3300013306 Bacteria 12003
186 Ga0163162_10011467 3300013306 Bacteria 8645
187 Ga0163162_10022326 3300013306 Bacteria 6238
188 Ga0157372_10003985 3300013307 Bacteria 15853
189 Ga0157372_10014347 3300013307 Bacteria 8471
190 Ga0157375_10002545 3300013308 Bacteria 15823
191 Ga0157375_10022752 3300013308 Bacteria 5772
192 Ga0157375_10023884 3300013308 Bacteria 5648
193 Ga0157375_10034737 3300013308 Bacteria 4806
194 Ga0157375_10080848 3300013308 Bacteria 3289
195 Ga0163163_10077913 3300014325 Bacteria 3310
196 Ga0182008_10000323 3300014497 Bacteria 37661
197 Ga0182008_10001287 3300014497 Bacteria 17171
198 Ga0182008_10004782 3300014497 Bacteria 7832
199 Ga0182008_10005261 3300014497 Bacteria 7402
200 Ga0182008_10005950 3300014497 Bacteria 6878
201 Ga0182008_10007147 3300014497 Bacteria 6182
202 Ga0182008_10007981 3300014497 Bacteria 5805
203 Ga0182008_10091192 3300014497 Bacteria 1502
204 Ga0157377_10009990 3300014745 Unclassified 4681
205 Ga0157377_10047113 3300014745 Bacteria 2414
206 Ga0157379_10046791 3300014968 Bacteria 3860
207 Ga0157376_10010273 3300014969 Bacteria 6837
208 Ga0157376_10091377 3300014969 Bacteria 2637
209 Ga0182006_1002733 3300015261 Bacteria 9452
210 Ga0182006_1003909 3300015261 Bacteria 7464
211 Ga0182006_1004160 3300015261 Bacteria 7185
212 Ga0182006_1006692 3300015261 Bacteria 5332
213 Ga0182006_1029816 3300015261 Bacteria 2209
214 Ga0182006_1062755 3300015261 Bacteria 1397
215 Ga0182007_10002969 3300015262 Bacteria 8218
216 Ga0182007_10004412 3300015262 Bacteria 6376
217 Ga0182005_1000723 3300015265 Bacteria 15152
218 Ga0182005_1001625 3300015265 Bacteria 8769
219 Ga0163161_10013192 3300017792 Bacteria 5743
220 Ga0163161_10016286 3300017792 Bacteria 5189
221 Ga0163161_10026718 3300017792 Bacteria 4090
222 Ga0163161_10046961 3300017792 Bacteria 3117
223 Ga0163161_10075384 3300017792 Bacteria 2475
224 Ga0209435_100960 3300025206 Bacteria 4212
225 Ga0209760_100021 3300025207 Bacteria 163688
226 Ga0209760_100055 3300025207 Bacteria 100237
227 Ga0209784_100032 3300025224 Bacteria 314079
228 Ga0209566_100036 3300025225 Bacteria 314079
229 Ga0209674_100054 3300025226 Bacteria 314079
230 Ga0209147_100055 3300025229 Bacteria 262412
231 Ga0209563_100055 3300025230 Bacteria 314079
232 Ga0207427_100001 3300025231 Bacteria 1410763
233 Ga0207427_100004 3300025231 Bacteria 939600
234 Ga0209437_100003 3300025233 Bacteria 1517827
235 Ga0209437_100028 3300025233 Bacteria 540136
236 Ga0209258_100231 3300025242 Bacteria 104255
237 Ga0209646_1000331 3300025246 Bacteria 35689
238 Ga0209677_100033 3300025253 Bacteria 314079
239 Ga0209233_1000007 3300025261 Bacteria 1411234
240 Ga0209233_1000008 3300025261 Bacteria 1356712
241 Ga0209676_1000056 3300025292 Bacteria 361329
242 Ga0209676_1000101 3300025292 Bacteria 227976
243 Ga0209676_1000503 3300025292 Bacteria 61955
244 Ga0209676_1001307 3300025292 Bacteria 25371
245 Ga0209676_1009559 3300025292 Bacteria 4169
246 Ga0209676_1012648 3300025292 Bacteria 3295
247 Ga0209050_1000041 3300025298 Bacteria 408004
248 Ga0209050_1000060 3300025298 Bacteria 321699
249 Ga0209050_1000361 3300025298 Bacteria 87075
250 Ga0209050_1002054 3300025298 Bacteria 18548
251 Ga0209051_1000037 3300025303 Bacteria 321747
252 Ga0209051_1000061 3300025303 Bacteria 253485
253 Ga0209051_1000085 3300025303 Bacteria 189973
254 Ga0209257_1000635 3300025304 Bacteria 56286
255 Ga0207697_10013697 3300025315 Bacteria 3380
256 Ga0207656_10000022 3300025321 Bacteria 106345
257 Ga0207656_10022519 3300025321 Unclassified 2529
258 Ga0207696_1000032 3300025711 Bacteria 380071
259 Ga0207696_1000129 3300025711 Bacteria 133308
260 Ga0207696_1000262 3300025711 Bacteria 67626
261 Ga0207696_1003053 3300025711 Bacteria 7813
262 Ga0207696_1007660 3300025711 Bacteria 4206
263 Ga0207655_1000005 3300025728 Bacteria 917277
264 Ga0207655_1000015 3300025728 Bacteria 600662
265 Ga0207655_1000166 3300025728 Bacteria 119771
266 Ga0207655_1000357 3300025728 Bacteria 64976
267 Ga0207655_1000408 3300025728 Bacteria 59188
268 Ga0207655_1001002 3300025728 Bacteria 28722
269 Ga0207655_1001218 3300025728 Bacteria 24789
270 Ga0207655_1004877 3300025728 Bacteria 9308
271 Ga0207655_1005286 3300025728 Bacteria 8849
272 Ga0207655_1011306 3300025728 Bacteria 5323
273 Ga0207655_1017457 3300025728 Bacteria 3870
274 Ga0207655_1017539 3300025728 Bacteria 3855
275 Ga0207655_1053386 3300025728 Bacteria 1616
276 Ga0207713_1002613 3300025735 Bacteria 12975
277 Ga0207713_1002881 3300025735 Bacteria 12066
278 Ga0207713_1002896 3300025735 Bacteria 12021
279 Ga0207713_1003306 3300025735 Bacteria 11086
280 Ga0207713_1003614 3300025735 Bacteria 10417
281 Ga0207713_1004933 3300025735 Bacteria 8531
282 Ga0207713_1008401 3300025735 Bacteria 5954
283 Ga0207713_1009219 3300025735 Bacteria 5589
284 Ga0207713_1009521 3300025735 Bacteria 5467
285 Ga0207713_1033219 3300025735 Bacteria 2256
286 Ga0207682_10005007 3300025893 Bacteria 5434
287 Ga0207682_10020357 3300025893 Unclassified 2605
288 Ga0207688_10008168 3300025901 Bacteria 5688
289 Ga0207645_10003020 3300025907 Bacteria 13002
290 Ga0207643_10019424 3300025908 Bacteria 3724
291 Ga0207684_10280441 3300025910 Bacteria 1437
292 Ga0207707_10013303 3300025912 Bacteria 7172
293 Ga0207671_10000034 3300025914 Bacteria 245048
294 Ga0207671_10081121 3300025914 Bacteria 2432
295 Ga0207649_10000006 3300025920 Bacteria 349180
296 Ga0207649_10006645 3300025920 Bacteria 6285
297 Ga0207646_10040819 3300025922 Bacteria 4172
298 Ga0207681_10000978 3300025923 Bacteria 18677
299 Ga0207681_10012413 3300025923 Bacteria 5258
300 Ga0207650_10000092 3300025925 Bacteria 116489
301 Ga0207650_10002213 3300025925 Bacteria 13577
302 Ga0207650_10002270 3300025925 Bacteria 13421
303 Ga0207659_10047034 3300025926 Unclassified 3050
304 Ga0207700_10002511 3300025928 Bacteria 10523
305 Ga0207644_10125667 3300025931 Bacteria 1957
306 Ga0207706_10003133 3300025933 Bacteria 15889
307 Ga0207686_10047967 3300025934 Bacteria 2643
308 Ga0207709_10000134 3300025935 Bacteria 108529
309 Ga0207709_10000678 3300025935 Bacteria 27513
310 Ga0207709_10011829 3300025935 Bacteria 4812
311 Ga0207691_10002145 3300025940 Bacteria 19321
312 Ga0207711_10049864 3300025941 Bacteria 3584
313 Ga0207711_10080218 3300025941 Bacteria 2850
314 Ga0207689_10012165 3300025942 Bacteria 7365
315 Ga0207689_10038913 3300025942 Bacteria 3937
316 Ga0207661_10002649 3300025944 Bacteria 12316
317 Ga0207679_10000010 3300025945 Bacteria 349180
318 Ga0207667_10123563 3300025949 Bacteria 2667
319 Ga0207651_10000832 3300025960 Bacteria 13396
320 Ga0207658_10055038 3300025986 Unclassified 2946
321 Ga0207677_10000800 3300026023 Bacteria 18046
322 Ga0207639_10005905 3300026041 Bacteria 8298
323 Ga0207708_10001343 3300026075 Bacteria 18506
324 Ga0207708_10013845 3300026075 Bacteria 6027
325 Ga0207648_10010894 3300026089 Bacteria 8593
326 Ga0207648_10013748 3300026089 Bacteria 7514
327 Ga0207648_10099709 3300026089 Bacteria 2544
328 Ga0207676_10004537 3300026095 Bacteria 9826
329 Ga0207674_10104924 3300026116 Bacteria 2804
330 Ga0207675_100009090 3300026118 Bacteria 9324
331 Ga0207675_100255916 3300026118 Bacteria 1696
332 Ga0207683_10012662 3300026121 Bacteria 7193
333 Ga0207683_10023777 3300026121 Bacteria 5271
334 Ga0207698_10000853 3300026142 Bacteria 17708
335 Ga0209281_1000010 3300027111 Bacteria 726106
336 Ga0209281_1000049 3300027111 Bacteria 322274
337 Ga0209281_1007384 3300027111 Bacteria 2762
338 Ga0209389_1000002 3300027296 Bacteria 333932
339 Ga0209371_1000572 3300027312 Bacteria 33334
340 Ga0209995_1002923 3300027471 Bacteria 2711
341 Ga0209999_1004007 3300027543 Bacteria 2651
342 Ga0209983_1005804 3300027665 Bacteria 2549
343 Ga0209588_1000008 3300027671 Bacteria 177025
344 Ga0207428_10018896 3300027907 Bacteria 5878
345 Ga0207428_10024567 3300027907 Bacteria 5061
346 Ga0207428_10029635 3300027907 Bacteria 4533
347 Ga0207428_10050689 3300027907 Bacteria 3320
348 Ga0207428_10092373 3300027907 Bacteria 2349
349 Ga0268266_10075856 3300028379 Bacteria 2921
350 Ga0265323_10035030 3300028653 Bacteria 1852
351 Ga0268256_1000499 3300030500 Bacteria 33334
352 Ga0316178_1073272 3300030735 Bacteria 21829
353 Ga0316183_1093468 3300030742 Bacteria 5316
354 Ga0316183_1141541 3300030742 Bacteria 2166
355 Ga0265332_10000004 3300031238 Bacteria 426592
356 Ga0265332_10007136 3300031238 Bacteria 5061
357 Ga0265316_10017973 3300031344 Bacteria 6094
358 Ga0265316_10064765 3300031344 Bacteria 2831
359 Ga0307509_10001698 3300031507 Bacteria 36806
360 Ga0307509_10199971 3300031507 Bacteria 1837
361 Ga0307408_100001076 3300031548 Bacteria 20885
362 Ga0307408_100007882 3300031548 Bacteria 7042
363 Ga0307408_100019289 3300031548 Bacteria 4590
364 Ga0307408_100029500 3300031548 Bacteria 3801
365 Ga0307408_100300883 3300031548 Bacteria 1343
366 Ga0265314_10023451 3300031711 Bacteria 4704
367 Ga0307405_10002721 3300031731 Bacteria 7908
368 Ga0307405_10009155 3300031731 Bacteria 5064
369 Ga0307405_10017437 3300031731 Bacteria 3940
370 Ga0307405_10031126 3300031731 Bacteria 3137
371 Ga0307407_10010099 3300031903 Bacteria 4435
372 Ga0307412_10012578 3300031911 Bacteria 4938
373 Ga0307412_10037581 3300031911 Bacteria 3112
374 Ga0307412_10080411 3300031911 Bacteria 2251
375 Ga0307412_10106499 3300031911 Bacteria 1993
376 Ga0307412_10137847 3300031911 Bacteria 1782
377 Ga0307409_100068134 3300031995 Bacteria 2813
378 Ga0307416_100153613 3300032002 Bacteria 2115
379 Ga0307414_10010851 3300032004 Bacteria 5313
380 Ga0307414_10042546 3300032004 Bacteria 3087
381 Ga0307414_10086035 3300032004 Bacteria 2318
382 Ga0307414_10124919 3300032004 Bacteria 1986
383 Ga0307411_10015517 3300032005 Bacteria 4281
384 Ga0307510_10006155 3300033180 Bacteria 14302
385 Ga0373948_0014714 3300034817 Bacteria 1429
386 Ga0373925_0180932 3300037068 Bacteria 1669
387 Ga0237819_02230 3300038705 Bacteria 4076
388 Ga0439436_0008028 3300041404 Bacteria 3241
389 Ga0439438_000311 3300041405 Bacteria 21962
390 Ga0439438_001307 3300041405 Bacteria 11027
391 Ga0439438_003930 3300041405 Bacteria 5849
392 Ga0439438_005356 3300041405 Bacteria 4735
393 Ga0439438_005616 3300041405 Bacteria 4576
394 Ga0439438_006187 3300041405 Bacteria 4261
395 Ga0439438_007424 3300041405 Bacteria 3747
396 Ga0439438_009552 3300041405 Bacteria 3132
397 Ga0439447_001267 3300041407 Bacteria 9200
398 Ga0439447_004020 3300041407 Bacteria 5143
399 Ga0439447_005496 3300041407 Bacteria 4206
400 Ga0439447_010765 3300041407 Bacteria 2700
401 Ga0439466_0000511 3300041411 Bacteria 14707
402 Ga0439466_0001739 3300041411 Bacteria 8506
403 Ga0439466_0001862 3300041411 Bacteria 8261
404 Ga0439466_0013006 3300041411 Bacteria 3052
405 Ga0439466_0013844 3300041411 Bacteria 2947
406 Ga0439432_002461 3300042006 Bacteria 6978
407 Ga0439432_002654 3300042006 Bacteria 6691
408 Ga0439432_002747 3300042006 Bacteria 6575
409 Ga0439432_003054 3300042006 Bacteria 6232
410 Ga0439432_003222 3300042006 Bacteria 6072
411 Ga0439451_015800 3300042009 Bacteria 1521
412 Ga0439452_000382 3300042010 Bacteria 26524
413 Ga0439452_000510 3300042010 Bacteria 20967
414 Ga0439452_000646 3300042010 Bacteria 17421
415 Ga0439452_001226 3300042010 Bacteria 10941
416 Ga0439452_002237 3300042010 Bacteria 7260
417 Ga0439452_006184 3300042010 Bacteria 3771
418 Ga0439452_006751 3300042010 Bacteria 3570
419 Ga0439456_000096 3300042013 Bacteria 30407
420 Ga0439456_001898 3300042013 Bacteria 4209
421 Ga0439456_008684 3300042013 Bacteria 2097
422 Ga0439463_000222 3300042016 Bacteria 15649
423 Ga0439463_000585 3300042016 Bacteria 10191
424 Ga0439463_005709 3300042016 Bacteria 3090
425 Ga0450911_000096 3300042115 Bacteria 35766
426 Ga0450911_000238 3300042115 Bacteria 20920
427 Ga0450911_000755 3300042115 Bacteria 9217
428 Ga0450919_000450 3300042121 Bacteria 5101
429 Ga0450922_000238 3300042124 Bacteria 5927
430 Ga0450890_000202 3300042127 Bacteria 9083
431 Ga0450902_001384 3300042137 Bacteria 3297
432 Ga0450902_001967 3300042137 Bacteria 2866
433 Ga0450903_001289 3300042138 Bacteria 4684
434 Ga0450903_006830 3300042138 Bacteria 1888
435 Ga0450905_000442 3300042142 Bacteria 5095
436 Ga0450905_001386 3300042142 Bacteria 3082
437 Ga0450906_000574 3300042145 Bacteria 7783
438 Ga0450907_000062 3300042146 Bacteria 42194
439 Ga0450907_001660 3300042146 Bacteria 4661
440 Ga0439446_0001788 3300042156 Bacteria 5012
441 Ga0450909_000168 3300042185 Bacteria 7166
442 Ga0439434_0000411 3300042435 Bacteria 12197
443 Ga0439434_0005796 3300042435 Bacteria 3607
444 Ga0439464_0027861 3300042439 Bacteria 1572
445 Ga0439460_0000562 3300042461 Bacteria 8124
446 Ga0439460_0001729 3300042461 Bacteria 5183
447 Ga0439460_0007966 3300042461 Bacteria 2665
448 Ga0439460_0017953 3300042461 Bacteria 1901
449 Ga0450918_002614 3300042531 Bacteria 3400
450 Ga0451577_0062944 3300042876 Bacteria 3308
451 Ga0451577_0125031 3300042876 Bacteria 2304
452 Ga0439440_0011294 3300042993 Bacteria 1881
453 Ga0453684_0082317 3300044712 Bacteria 4010
454 Ga0451576_0000745 3300045051 Bacteria 64985
455 Ga0495617_000439 3300046452 Bacteria 22486
456 Ga0495617_005046 3300046452 Bacteria 4734
457 Ga0495617_009057 3300046452 Bacteria 3421
458 Ga0495627_001257 3300046453 Bacteria 15663
459 Ga0495627_006483 3300046453 Bacteria 4584
460 Ga0495627_029885 3300046453 Bacteria 1729
461 Ga0495627_054762 3300046453 Bacteria 1192
462 Ga0495603_0029386 3300046455 Bacteria 3314
463 Ga0495603_0100612 3300046455 Bacteria 1687
464 Ga0495590_0002161 3300046457 Bacteria 8242
465 Ga0495590_0002603 3300046457 Bacteria 7457
466 Ga0495590_0003983 3300046457 Bacteria 5998
467 Ga0495590_0005440 3300046457 Bacteria 5055
468 Ga0495590_0005866 3300046457 Bacteria 4823
469 Ga0495591_001543 3300046458 Bacteria 14127
470 Ga0495591_001609 3300046458 Bacteria 13659
471 Ga0495591_002816 3300046458 Bacteria 9370
472 Ga0495591_003923 3300046458 Bacteria 7493
473 Ga0495591_003967 3300046458 Bacteria 7415
474 Ga0495591_005851 3300046458 Bacteria 5584
475 Ga0495591_007471 3300046458 Bacteria 4641
476 Ga0495591_010877 3300046458 Bacteria 3485
477 Ga0495638_0004187 3300046460 Bacteria 10993
478 Ga0495638_0009880 3300046460 Bacteria 6660
479 Ga0495638_0010307 3300046460 Bacteria 6500
480 Ga0495638_0010874 3300046460 Bacteria 6294
481 Ga0495638_0016835 3300046460 Bacteria 4888
482 Ga0495638_0017674 3300046460 Bacteria 4748
483 Ga0495638_0050019 3300046460 Bacteria 2611
484 Ga0495638_0063306 3300046460 Bacteria 2280
485 Ga0495653_0008893 3300046463 Bacteria 8215
486 Ga0495653_0011668 3300046463 Bacteria 7170
487 Ga0495653_0045843 3300046463 Bacteria 3387
488 Ga0495653_0084734 3300046463 Bacteria 2333
489 Ga0495650_0010649 3300046471 Bacteria 5113
490 Ga0495650_0062776 3300046471 Bacteria 1483
491 Ga0495605_0000514 3300046474 Bacteria 33102
492 Ga0495605_0001162 3300046474 Bacteria 17465
493 Ga0495605_0009012 3300046474 Bacteria 5616
494 Ga0495605_0013040 3300046474 Bacteria 4595
495 Ga0495605_0020722 3300046474 Bacteria 3491
496 Ga0495605_0039526 3300046474 Bacteria 2362
497 Ga0495639_0001944 3300046475 Bacteria 9165
498 Ga0495584_0000651 3300046491 Bacteria 23165
499 Ga0495584_0002556 3300046491 Bacteria 10265
500 Ga0495584_0004775 3300046491 Bacteria 7247
501 Ga0495584_0005416 3300046491 Bacteria 6759
502 Ga0495584_0006353 3300046491 Bacteria 6190
503 Ga0495584_0016839 3300046491 Bacteria 3726
504 Ga0495584_0024846 3300046491 Bacteria 3037
505 Ga0495585_0002101 3300046492 Bacteria 14575
506 Ga0495585_0002862 3300046492 Bacteria 12003
507 Ga0495585_0005597 3300046492 Bacteria 7895
508 Ga0495585_0015538 3300046492 Bacteria 4424
509 Ga0495585_0034218 3300046492 Bacteria 2872
510 Ga0495596_0002132 3300046500 Bacteria 10817
511 Ga0495596_0015797 3300046500 Bacteria 3150
512 Ga0495607_0004028 3300046501 Bacteria 11018
513 Ga0495607_0004713 3300046501 Bacteria 9978
514 Ga0495607_0006276 3300046501 Bacteria 8379
515 Ga0495607_0011229 3300046501 Bacteria 5975
516 Ga0495607_0015797 3300046501 Bacteria 4883
517 Ga0495607_0031366 3300046501 Bacteria 3254
518 Ga0495607_0037304 3300046501 Bacteria 2920
519 Ga0495583_0004454 3300046506 Bacteria 10019
520 Ga0495583_0004497 3300046506 Bacteria 9953
521 Ga0495606_0000575 3300046507 Bacteria 58335
522 Ga0495606_0003310 3300046507 Bacteria 17199
523 Ga0495606_0003623 3300046507 Bacteria 16227
524 Ga0495606_0007478 3300046507 Bacteria 9762
525 Ga0495606_0009788 3300046507 Bacteria 8055
526 Ga0495606_0010800 3300046507 Bacteria 7525
527 Ga0495606_0015153 3300046507 Bacteria 5959
528 Ga0495606_0020697 3300046507 Bacteria 4840
529 Ga0495606_0020850 3300046507 Bacteria 4816
530 Ga0495610_0003606 3300046512 Bacteria 11955
531 Ga0495610_0004407 3300046512 Bacteria 10412
532 Ga0495610_0007496 3300046512 Bacteria 7250
533 Ga0495610_0007805 3300046512 Bacteria 7050
534 Ga0495610_0013547 3300046512 Bacteria 4839
535 Ga0495610_0014265 3300046512 Bacteria 4677
536 Ga0495610_0033145 3300046512 Bacteria 2673
537 Ga0495610_0080473 3300046512 Bacteria 1497
538 Ga0495616_0001150 3300046513 Bacteria 18699
539 Ga0495616_0002134 3300046513 Bacteria 13255
540 Ga0495616_0003784 3300046513 Bacteria 9649
541 Ga0495616_0006798 3300046513 Bacteria 6893
542 Ga0495616_0009231 3300046513 Bacteria 5783
543 Ga0495616_0010919 3300046513 Bacteria 5229
544 Ga0495620_0000003 3300046515 Bacteria 345923
545 Ga0495620_0001671 3300046515 Bacteria 13079
546 Ga0495620_0002532 3300046515 Bacteria 10581
547 Ga0495620_0006904 3300046515 Bacteria 6203
548 Ga0495620_0011962 3300046515 Bacteria 4507
549 Ga0495620_0047826 3300046515 Bacteria 1838
550 Ga0495631_0000224 3300046518 Bacteria 38891
551 Ga0495631_0002487 3300046518 Bacteria 10373
552 Ga0495631_0003213 3300046518 Bacteria 9001
553 Ga0495631_0013207 3300046518 Bacteria 4014
554 Ga0495632_0001301 3300046519 Bacteria 21124
555 Ga0495632_0003179 3300046519 Bacteria 11840
556 Ga0495632_0004423 3300046519 Bacteria 9552
557 Ga0495632_0007835 3300046519 Bacteria 6646
558 Ga0495632_0007843 3300046519 Bacteria 6644
559 Ga0495632_0024356 3300046519 Bacteria 3216
560 Ga0495632_0036309 3300046519 Bacteria 2507
561 Ga0495637_0000618 3300046520 Bacteria 25102
562 Ga0495637_0001387 3300046520 Bacteria 14468
563 Ga0495637_0001533 3300046520 Bacteria 13507
564 Ga0495637_0004838 3300046520 Bacteria 6931
565 Ga0495637_0004840 3300046520 Bacteria 6929
566 Ga0495637_0008746 3300046520 Bacteria 4962
567 Ga0495637_0009469 3300046520 Bacteria 4750
568 Ga0495637_0012841 3300046520 Bacteria 3994
569 Ga0495637_0012941 3300046520 Bacteria 3976
570 Ga0495637_0034373 3300046520 Bacteria 2220
571 Ga0495643_0000116 3300046522 Bacteria 130165
572 Ga0495643_0001999 3300046522 Bacteria 17004
573 Ga0495643_0003288 3300046522 Bacteria 11937
574 Ga0495643_0007210 3300046522 Bacteria 7207
575 Ga0495643_0008409 3300046522 Bacteria 6536
576 Ga0495643_0061432 3300046522 Bacteria 1992
577 Ga0495643_0061669 3300046522 Bacteria 1987
578 Ga0495644_0001169 3300046523 Bacteria 10773
579 Ga0495644_0004677 3300046523 Bacteria 5379
580 Ga0495644_0012534 3300046523 Bacteria 3259
581 Ga0495648_0002887 3300046524 Bacteria 15460
582 Ga0495648_0003903 3300046524 Bacteria 12925
583 Ga0495648_0003971 3300046524 Bacteria 12799
584 Ga0495648_0005915 3300046524 Bacteria 10066
585 Ga0495648_0010961 3300046524 Bacteria 6873
586 Ga0495648_0018105 3300046524 Bacteria 5007
587 Ga0495648_0029602 3300046524 Bacteria 3631
588 Ga0495648_0031945 3300046524 Bacteria 3462
589 Ga0495666_0005182 3300046526 Bacteria 6582
590 Ga0495666_0006948 3300046526 Bacteria 5688
591 Ga0495666_0066631 3300046526 Bacteria 1716
592 Ga0495642_0000755 3300046528 Bacteria 15893
593 Ga0495642_0001318 3300046528 Bacteria 11122
594 Ga0495642_0004141 3300046528 Bacteria 5658
595 Ga0495642_0044456 3300046528 Bacteria 1813
596 Ga0495654_0001647 3300046530 Bacteria 15116
597 Ga0495654_0003640 3300046530 Bacteria 9360
598 Ga0495654_0005070 3300046530 Bacteria 7708
599 Ga0495654_0005362 3300046530 Bacteria 7466
600 Ga0495654_0007126 3300046530 Bacteria 6283
601 Ga0495654_0007409 3300046530 Bacteria 6131
602 Ga0495654_0007656 3300046530 Bacteria 6012
603 Ga0495654_0011965 3300046530 Bacteria 4677
604 Ga0495654_0027342 3300046530 Bacteria 2925
605 Ga0495654_0056387 3300046530 Bacteria 1899
606 Ga0495587_0007965 3300046536 Bacteria 6845
607 Ga0495609_0003739 3300046538 Bacteria 8592
608 Ga0495609_0031721 3300046538 Bacteria 2400
609 Ga0495597_0004952 3300046542 Bacteria 7160
610 Ga0495597_0005985 3300046542 Bacteria 6344
611 Ga0495597_0006410 3300046542 Bacteria 6090
612 Ga0495597_0022758 3300046542 Bacteria 2904
613 Ga0495597_0025968 3300046542 Bacteria 2692
614 Ga0495622_0001403 3300046557 Bacteria 12217
615 Ga0495622_0001827 3300046557 Bacteria 10499
616 Ga0495622_0003204 3300046557 Bacteria 7751
617 Ga0495622_0017228 3300046557 Bacteria 3363
618 Ga0495622_0024888 3300046557 Bacteria 2795
619 Ga0495622_0047330 3300046557 Bacteria 1998
620 Ga0495633_0011010 3300046558 Bacteria 4908
621 Ga0495656_0004366 3300046615 Bacteria 4836
622 Ga0495668_0002475 3300046616 Bacteria 15184
623 Ga0495668_0003410 3300046616 Bacteria 11938
624 Ga0495634_0003166 3300046642 Bacteria 13318
625 Ga0495611_0000981 3300046648 Bacteria 15165
626 Ga0495625_0006599 3300046660 Bacteria 10303
627 Ga0495625_0026915 3300046660 Bacteria 4336
628 Ga0495625_0053000 3300046660 Bacteria 2903
629 Ga0495625_0098865 3300046660 Bacteria 2006
630 Ga0495625_0098963 3300046660 Bacteria 2005
631 Ga0495635_0018760 3300046663 Bacteria 4826
632 Ga0495635_0026215 3300046663 Bacteria 4059
633 Ga0495659_0000807 3300046664 Bacteria 11189
634 Ga0495659_0011186 3300046664 Bacteria 2890
635 Ga0495661_0004997 3300046665 Bacteria 9469
636 Ga0495661_0007855 3300046665 Bacteria 7421
637 Ga0495661_0065663 3300046665 Bacteria 2137
638 Ga0495661_0080877 3300046665 Bacteria 1874
639 Ga0495661_0103762 3300046665 Bacteria 1595
640 Ga0495588_0011374 3300046674 Bacteria 4173
641 Ga0495624_0002472 3300046690 Bacteria 14009
642 Ga0495670_0000886 3300046691 Bacteria 14510
643 Ga0495670_0001480 3300046691 Bacteria 11471
644 Ga0495670_0002624 3300046691 Bacteria 8877
645 Ga0495670_0008648 3300046691 Bacteria 5009
646 Ga0495670_0009932 3300046691 Bacteria 4678
647 Ga0495671_0000750 3300046692 Bacteria 23356
648 Ga0495671_0009315 3300046692 Bacteria 5486
649 Ga0495671_0009555 3300046692 Bacteria 5413
650 Ga0495671_0011262 3300046692 Bacteria 4931
651 Ga0495671_0013189 3300046692 Bacteria 4487
652 Ga0495671_0015763 3300046692 Bacteria 4043
653 Ga0495671_0030240 3300046692 Bacteria 2774
654 Ga0495671_0033866 3300046692 Bacteria 2600
655 Ga0495671_0042777 3300046692 Bacteria 2275
656 Ga0495671_0058831 3300046692 Bacteria 1900
657 Ga0495649_0000333 3300046694 Bacteria 40629
658 Ga0495649_0000406 3300046694 Bacteria 37419
659 Ga0495649_0002040 3300046694 Bacteria 14577
660 Ga0495649_0007189 3300046694 Bacteria 6829
661 Ga0495649_0009716 3300046694 Bacteria 5699
662 Ga0495649_0011856 3300046694 Bacteria 5096
663 Ga0495649_0016162 3300046694 Bacteria 4234
664 Ga0495649_0041868 3300046694 Bacteria 2503
665 Ga0495649_0060117 3300046694 Bacteria 2044
666 Ga0495589_0000769 3300046794 Bacteria 20491
667 Ga0495589_0001719 3300046794 Bacteria 12452
668 Ga0495589_0005836 3300046794 Bacteria 6497
669 Ga0495589_0006524 3300046794 Bacteria 6152
670 Ga0495589_0010289 3300046794 Bacteria 4861
671 Ga0495589_0010292 3300046794 Bacteria 4860
672 Ga0495589_0014537 3300046794 Bacteria 4051
673 Ga0495660_0008322 3300046810 Bacteria 6072
674 Ga0495660_0010608 3300046810 Bacteria 5359
675 Ga0495660_0018795 3300046810 Bacteria 3968
676 Ga0495660_0029456 3300046810 Bacteria 3097
677 Ga0495660_0043450 3300046810 Bacteria 2478
678 Ga0495660_0055382 3300046810 Bacteria 2147
679 Ga0495660_0095799 3300046810 Bacteria 1534
680 Ga0495604_0051202 3300047317 Bacteria 3202
681 Ga0495636_0006392 3300047318 Bacteria 4629
682 Ga0495674_0028934 3300047319 Bacteria 5047
683 Ga0495672_0001280 3300047320 Bacteria 25072
684 Ga0495672_0003260 3300047320 Bacteria 14062
685 Ga0495672_0003963 3300047320 Bacteria 12392
686 Ga0495672_0004654 3300047320 Bacteria 11129
687 Ga0495672_0004820 3300047320 Bacteria 10877
688 Ga0495672_0004863 3300047320 Bacteria 10809
689 Ga0495672_0005097 3300047320 Bacteria 10490
690 Ga0495672_0006765 3300047320 Bacteria 8787
691 Ga0495672_0007965 3300047320 Bacteria 7898
692 Ga0495672_0027802 3300047320 Bacteria 3589
693 Ga0495672_0049869 3300047320 Bacteria 2475
694 Ga0495676_0007897 3300047321 Bacteria 9755
695 Ga0495683_0001278 3300047323 Bacteria 17054
696 Ga0495683_0001496 3300047323 Bacteria 15251
697 Ga0495683_0006496 3300047323 Bacteria 6387
698 Ga0495683_0010675 3300047323 Bacteria 4847
699 Ga0495687_001318 3300047443 Bacteria 23203
700 Ga0495687_002198 3300047443 Bacteria 16164
701 Ga0495687_005828 3300047443 Bacteria 7723
702 Ga0495687_011160 3300047443 Bacteria 4853
703 Ga0495675_0009783 3300047444 Bacteria 5980
704 Ga0495677_0001558 3300047445 Bacteria 9246
705 Ga0495679_008195 3300047446 Bacteria 4273
706 Ga0495679_011134 3300047446 Bacteria 3491
707 Ga0495673_0001648 3300047469 Bacteria 17241
708 Ga0495673_0001922 3300047469 Bacteria 15486
709 Ga0495673_0003212 3300047469 Bacteria 10915
710 Ga0495673_0007907 3300047469 Bacteria 6038
711 Ga0495673_0008165 3300047469 Bacteria 5919
712 Ga0495673_0011998 3300047469 Bacteria 4624
713 Ga0495673_0021936 3300047469 Bacteria 3139
714 Ga0495673_0026775 3300047469 Bacteria 2751
715 Ga0495673_0028612 3300047469 Bacteria 2638
716 Ga0495673_0033154 3300047469 Bacteria 2399
717 Ga0495681_0000707 3300047470 Bacteria 25515
718 Ga0495681_0003046 3300047470 Bacteria 11775
719 Ga0495681_0003760 3300047470 Bacteria 10523
720 Ga0495681_0004427 3300047470 Bacteria 9577
721 Ga0495681_0005083 3300047470 Bacteria 8868
722 Ga0495681_0018049 3300047470 Bacteria 3898
723 Ga0495681_0035785 3300047470 Bacteria 2462
724 Ga0495686_0005886 3300047472 Bacteria 9558
725 Ga0495686_0015228 3300047472 Bacteria 5262
726 Ga0495686_0017064 3300047472 Bacteria 4901
727 Ga0495593_0011264 3300047673 Bacteria 5139
728 Ga0495593_0021904 3300047673 Bacteria 3565
729 Ga0495602_0030014 3300048088 Bacteria 5165
730 Ga0495626_0000658 3300048091 Bacteria 33195
731 Ga0495626_0001692 3300048091 Bacteria 16949
732 Ga0495626_0001697 3300048091 Bacteria 16933
733 Ga0495626_0003331 3300048091 Bacteria 10368
734 Ga0495626_0004081 3300048091 Bacteria 9091
735 Ga0495626_0004890 3300048091 Bacteria 8054
736 Ga0495626_0005353 3300048091 Bacteria 7542
737 Ga0496102_0003153 3300048905 Bacteria 13982
738 Ga0496106_0071209 3300048909 Bacteria 2657
739 Ga0496108_0029323 3300048911 Unclassified 4555
740 Ga0496109_0013168 3300048912 Bacteria 7158
741 Ga0496116_0000492 3300048919 Bacteria 54331
742 Ga0496116_0017628 3300048919 Bacteria 5534
743 Ga0496116_0019081 3300048919 Bacteria 5263
744 Ga0496117_0001334 3300048920 Bacteria 36300
745 Ga0496117_0003743 3300048920 Bacteria 17414
746 Ga0496117_0006594 3300048920 Bacteria 11670
747 Ga0496117_0010034 3300048920 Bacteria 8702
748 Ga0496117_0028183 3300048920 Bacteria 4353
749 Ga0496117_0056606 3300048920 Bacteria 2729
750 Ga0496117_0065362 3300048920 Bacteria 2474
751 Ga0496117_0086595 3300048920 Bacteria 2034
752 Ga0496117_0106819 3300048920 Bacteria 1755
753 Ga0496118_0002770 3300048921 Bacteria 22961
754 Ga0496118_0010803 3300048921 Bacteria 8995
755 Ga0496118_0016385 3300048921 Bacteria 6802
756 Ga0496118_0035872 3300048921 Bacteria 4017
757 Ga0496118_0065390 3300048921 Bacteria 2661
758 Ga0496118_0115907 3300048921 Bacteria 1762
759 Ga0496119_0000207 3300048922 Bacteria 83748
760 Ga0496119_0006721 3300048922 Bacteria 10568
761 Ga0496119_0048067 3300048922 Bacteria 2649
762 Ga0496120_0003397 3300048923 Bacteria 14561
763 Ga0496120_0005268 3300048923 Bacteria 10385
764 Ga0496121_0000921 3300048924 Bacteria 53187
765 Ga0496121_0025675 3300048924 Bacteria 5582
766 Ga0496121_0037143 3300048924 Bacteria 4330
767 Ga0496121_0039458 3300048924 Bacteria 4161
768 Ga0496122_0002533 3300048925 Bacteria 25730
769 Ga0496122_0006320 3300048925 Bacteria 13640
770 Ga0496123_0000387 3300048926 Bacteria 82706
771 Ga0496123_0001516 3300048926 Bacteria 32166
772 Ga0496123_0019807 3300048926 Bacteria 5285
773 Ga0496123_0081031 3300048926 Bacteria 1974
774 Ga0496124_0003921 3300048927 Bacteria 17770
775 Ga0496124_0007969 3300048927 Bacteria 11151
776 Ga0496124_0010730 3300048927 Bacteria 9237
777 Ga0496124_0013388 3300048927 Bacteria 8010
778 Ga0496124_0016920 3300048927 Bacteria 6908
779 Ga0496124_0018386 3300048927 Bacteria 6546
780 Ga0496124_0021340 3300048927 Bacteria 5968
781 Ga0496124_0024939 3300048927 Bacteria 5425
782 Ga0496124_0048868 3300048927 Bacteria 3611
783 Ga0496125_0003468 3300048928 Bacteria 19086
784 Ga0496125_0003963 3300048928 Bacteria 17442
785 Ga0496125_0011039 3300048928 Bacteria 9066
786 Ga0496125_0021596 3300048928 Bacteria 6000
787 Ga0496125_0022287 3300048928 Bacteria 5885
788 Ga0496125_0034870 3300048928 Bacteria 4427
789 Ga0496126_0016878 3300048929 Bacteria 7287
790 Ga0496126_0050203 3300048929 Bacteria 3803
791 Ga0496126_0084656 3300048929 Bacteria 2796
792 Ga0495678_001206 3300049459 Bacteria 21235
793 Ga0495678_004100 3300049459 Bacteria 8634
794 Ga0495678_007204 3300049459 Bacteria 5797
795 Ga0495678_009544 3300049459 Bacteria 4792
796 Ga0495678_021940 3300049459 Bacteria 2801
797 Ga0495678_030356 3300049459 Bacteria 2262
798 Ga0495682_0001922 3300049460 Bacteria 10343
799 Ga0495682_0003432 3300049460 Bacteria 7038
800 Ga0501034_0000370 3300049571 Bacteria 76588
801 Ga0501034_0121014 3300049571 Bacteria 2604
802 Ga0501039_0023003 3300049575 Bacteria 4780
803 Ga0501076_0021040 3300049592 Bacteria 4999
804 Ga0501209_013131 3300049656 Bacteria 1785
805 Ga0501226_000005 3300049853 Bacteria 271019
806 nmdc:mga03683_32130_c1 3300050489 Bacteria 2110
807 nmdc:mga0k408_18339_c1 3300050493 Bacteria 3397
808 nmdc:mga09592_310473_c1 3300050508 Bacteria 1367
809 nmdc:mga08y16_116170_c1 3300050511 Bacteria 2786
810 Ga0495619_0019399 3300053085 Bacteria 4322
811 Ga0500572_001966 3300053111 Bacteria 5157
812 Ga0500634_0005001 3300053161 Bacteria 6232
813 2511253971 2511231004 Bacteria 6669789
814 2511264135 2511231006 Bacteria 6794709
815 2511273591 2511231007 Bacteria 6306603
816 2511277060 2511231008 Bacteria 6624100
817 2511289995 2511231010 Bacteria 6373152
818 2511297634 2511231011 Bacteria 6149768
819 2511299851 2511231012 Bacteria 6738011
820 2511315606 2511231014 Bacteria 6462302
821 2511320481 2511231015 Bacteria 6598026
822 2511328848 2511231016 Bacteria 6704427
823 2511332365 2511231017 Bacteria 6503007
824 2511338695 2511231018 Bacteria 6436256
825 2511346043 2511231019 Bacteria 6520662
826 2511352776 2511231020 Bacteria 6115223
827 2511355806 2511231021 Bacteria 7302637
828 2511363789 2511231022 Bacteria 6719296
829 2511369113 2511231023 Bacteria 6808468
830 2511377711 2511231024 Bacteria 5835885
831 2511411086 2511231031 Bacteria 6558529
832 2511823056 2511231156 Bacteria 6845832
833 2512328342 2512047018 Bacteria 6663241
834 2526212174 2526164512 Bacteria 4025691
835 2548847580 2547132512 Bacteria 3416496
836 2555247766 2554235231 Bacteria 5215788
837 2555668072 2554235341 Bacteria 6867980
838 2583790513 2582580891 Bacteria 6800976
839 2597856286 2597489887 Bacteria 6666321
840 2597865769 2597489888 Bacteria 6179543
841 2597871585 2597489889 Bacteria 6297495
842 2599355071 2599185160 Bacteria 6844013
843 2599361105 2599185161 Bacteria 6960462
844 2599367427 2599185162 Bacteria 6957254
845 2599374217 2599185163 Bacteria 6995158
846 2599380177 2599185164 Bacteria 6841688
847 2599386624 2599185165 Bacteria 6843250
848 2599393075 2599185166 Bacteria 6959206
849 2599399874 2599185167 Bacteria 6353609
850 2599404842 2599185168 Bacteria 6997636
851 2599452657 2599185179 Bacteria 6611171
852 2599461905 2599185181 Bacteria 6844519
853 2599467052 2599185182 Bacteria 6883168
854 2599483458 2599185185 Bacteria 6652270
855 2599491002 2599185186 Bacteria 6831633
856 2599501164 2599185188 Bacteria 6164180
857 2599508254 2599185189 Bacteria 5862825
858 2599514328 2599185190 Bacteria 6285678
859 2599521548 2599185191 Bacteria 6297582
860 2599613877 2599185212 Bacteria 6765997
861 2599770767 2599185248 Bacteria 6696816
862 2599805364 2599185257 Bacteria 6492581
863 2599881923 2599185288 Bacteria 6666191
864 2599886645 2599185289 Bacteria 6778765
865 2599893704 2599185290 Bacteria 6289611
866 2599897014 2599185291 Bacteria 6775623
867 2599934718 2599185300 Bacteria 6062622
868 2599943016 2599185302 Bacteria 5954930
869 2599951696 2599185303 Bacteria 6512725
870 2599953945 2599185304 Bacteria 5951361
871 2599959455 2599185305 Bacteria 6748700
872 2599968024 2599185306 Bacteria 6637356
873 2599979253 2599185308 Bacteria 6621546
874 2599985312 2599185309 Bacteria 5969593
875 2599987236 2599185310 Bacteria 6014457
876 2599995454 2599185311 Bacteria 6354990
877 2599999935 2599185312 Bacteria 5912071
878 2600008806 2599185313 Bacteria 6658188
879 2600013138 2599185314 Bacteria 6621749
880 2600016650 2599185315 Bacteria 6771107
881 2600025329 2599185316 Bacteria 6320029
882 2600029615 2599185317 Bacteria 6435722
883 2600035493 2599185318 Bacteria 6961590
884 2600041340 2599185319 Bacteria 6637840
885 2600045563 2599185320 Bacteria 5963263
886 2600056620 2599185321 Bacteria 6764560
887 2600058469 2599185322 Bacteria 6763055
888 2600063861 2599185323 Bacteria 6688755
889 2600074146 2599185324 Bacteria 6590677
890 2600079826 2599185325 Bacteria 6324919
891 2600214527 2599185356 Bacteria 6843884
892 2600358293 2600254930 Bacteria 6431253
893 2600364069 2600254931 Bacteria 6734225
894 2601692784 2600255296 Bacteria 5784754
895 2601774768 2600255313 Bacteria 6842543
896 2601800102 2600255318 Bacteria 6383414
897 2606074633 2603880185 Bacteria 6379190
898 2606127496 2603880199 Bacteria 6377649
899 2608381262 2606217733 Bacteria 6360972
900 2621297765 2619619299 Bacteria 6649820
901 2624478849 2623620443 Bacteria 6427864
902 2624490371 2623620446 Bacteria 6500345
903 2643842455 2643221565 Bacteria 6216018
904 2643873654 2643221571 Bacteria 6228673
905 2643955316 2643221589 Bacteria 6250934
906 2644023668 2643221602 Bacteria 6249926
907 2644188155 2643221633 Bacteria 6733554
908 2644281563 2643221650 Bacteria 7029547
909 2644623448 2643221713 Bacteria 6554480
910 2652545745 2651869719 Bacteria 6047974
911 2671094487 2667528170 Bacteria 6786960
912 2671097672 2667528171 Bacteria 6900659
913 2671127900 2667528176 Bacteria 6724917
914 2671767901 2671180172 Bacteria 6495783
915 2677897932 2675903420 Bacteria 6247433
916 2678261588 2675903515 Bacteria 6580491
917 2715750785 2713897148 Bacteria 5883533
918 2715757566 2713897149 Bacteria 6506249
919 2718632735 2718217725 Bacteria 5758958
920 2723250501 2721755607 Bacteria 5841722
921 2738670883 2738541265 Bacteria 6594665
922 2738749277 2738541282 Bacteria 6593925
923 2738811295 2738541294 Bacteria 6925949
924 2738858318 2738541303 Bacteria 6591772
925 2738898655 2738541309 Bacteria 6926455
926 2739196590 2738543004 Bacteria 6381073
927 2739257568 2738543015 Bacteria 6750701
928 2739286495 2738543020 Bacteria 5718238
929 2739291808 2738543021 Bacteria 5718241
930 2739316455 2738543025 Bacteria 6600348
931 2743735696 2740892503 Bacteria 6855563
932 2745007937 2744054620 Bacteria 6551379
933 2765582258 2765235841 Bacteria 6137024
934 2774122192 2773857670 Bacteria 6407454
935 2774136672 2773857673 Bacteria 6513460
936 2784260424 2784132063 Bacteria 6262788
937 2784317551 2784132072 Bacteria 6596533
938 2794594386 2791355520 Bacteria 5948615
939 2807409872 2806310737 Bacteria 5751088
940 2807458220 2806310745 Bacteria 5742165
941 2808854109 2808606361 Bacteria 6136259
942 2808904920 2808606373 Bacteria 4423627
943 2808923400 2808606376 Bacteria 6248667
944 2808928729 2808606377 Bacteria 6646337
945 2808934141 2808606378 Bacteria 6177535
946 2808943039 2808606379 Bacteria 5022697
947 2808945325 2808606380 Bacteria 6248705
948 2808950850 2808606381 Bacteria 6646461
949 2808956652 2808606382 Bacteria 6841132
950 2808962458 2808606383 Bacteria 6138645
951 2808980200 2808606385 Bacteria 6711065
952 2808995977 2808606388 Bacteria 6706662
953 2808997501 2808606389 Bacteria 6138126
954 2809215788 2808606445 Bacteria 6057339
955 2812370915 2811994881 Bacteria 6298475
956 2817493101 2816332298 Bacteria 6852809
957 2819658406 2818991456 Bacteria 6123676
958 2819702755 2818991464 Bacteria 6907494
959 2825653689 2825651385 Bacteria 6715909
960 2834034198 2834028612 Bacteria 6354979
961 2842808864 2842805378 Bacteria 5385175
962 2842829726 2842826826 Bacteria 5974129
963 2842835681 2842832357 Bacteria 5959113
964 2842843202 2842837860 Bacteria 6066181
965 2842847429 2842843487 Bacteria 6004777
966 2842857244 2842854478 Bacteria 6143501
967 2844668569 2844665904 Bacteria 6817974
968 2852612514 2852612431 Bacteria 6885235
969 2852662716 2852657418 Bacteria 6472974
970 2852669750 2852667396 Bacteria 6885555
971 2860340610 2860339153 Bacteria 6846989
972 2878030813 2878029506 Bacteria 6418441
973 2880231728 2880230671 Bacteria 6140320
974 2904520763 2904518522 Bacteria 6068986
975 2904553087 2904550169 Bacteria 6221258
976 2908451692 2908446538 Bacteria 6829095
977 2912964912 2912963787 Bacteria 5646108
978 2913037928 2913036834 Bacteria 6704877
979 2917071833 2917070673 Bacteria 6868303
980 2919064681 2919063839 Bacteria 6302690
981 2919158856 2919155634 Bacteria 4860545
982 2919385865 2919385768 Bacteria 5897293
983 2919458255 2919456309 Bacteria 6586567
984 2919482835 2919481497 Bacteria 6907839
985 2919490650 2919487758 Bacteria 5929766
986 2919703704 2919697872 Bacteria 6553725
987 2923154705 2923153595 Bacteria 6870622
988 2923525020 2923519811 Bacteria 6298479
989 2923591760 2923586266 Bacteria 6565975
990 2929145380 2929144301 Bacteria 6622272
991 2929194300 2929189879 Bacteria 5930554
992 2931371280 2931369376 Bacteria 6847892
993 2931395574 2931390751 Bacteria 6273349
994 2931399487 2931396565 Bacteria 7251677
995 2935354006 2935353572 Unclassified 6955622
996 2939637056 2939636861 Bacteria 6297853
997 2939653269 2939651529 Bacteria 5895393
998 2945931756 2945928738 Bacteria 6053221
999 2945961396 2945961074 Bacteria 7342064
1000 2946007839 2946006987 Bacteria 6705746
1001 2947233539 2947233263 Bacteria 6439278
1002 2969305638 2969304461 Bacteria 6601805
1003 2974292732 2974289157 Bacteria 6080362
1004 2984291324 2984286254 Bacteria 6702062
1005 2988732924 2988728565 Bacteria 6124362
1006 2990200373 2990196909 Bacteria 4054280
1007 2998141079 2998139840 Bacteria 6073514
1008 3007400234 3007395558 Bacteria 6755444
1009 3007420716 3007419365 Bacteria 7026924
1010 3007512451 3007511990 Bacteria 6481491
1011 3007619683 3007614139 Bacteria 6053559
1012 3007620979 3007619802 Bacteria 6411688
1013 3007721441 3007718800 Bacteria 5971527
1014 3007808237 3007803356 Bacteria 5931491
1015 3007860960 3007855910 Bacteria 5637581
1016 3007863700 3007861166 Bacteria 6045338
1017 3007871278 3007866637 Bacteria 5899198
1018 3007873367 3007872151 Bacteria 5268868
1019 637318450 637000220 Bacteria 7074893
1020 8011354286 8011350971 Bacteria 6158957
1021 8015688941 8015687852 Bacteria 6613826
1022 8019773318 8019769354 Bacteria 6924660
1023 8019781854 8019775933 Bacteria 6858656
1024 8029999683 8029995093 Bacteria 5990776
1025 8052495709 8052494512 Bacteria 5765634
1026 8054286184 8054285046 Bacteria 6919322
1027 8054351149 8054347763 Bacteria 5901107
1028 8054508087 8054503363 Bacteria 6101651
1029 8054929518 8054929484 Bacteria 5599761
1030 8055772058 8055770955 Bacteria 6827675
1031 8055823040 8055817908 Bacteria 6609162
1032 8055883270 8055878733 Bacteria 5907058
1033 8056120221 8056115690 Bacteria 5527654
1034 8056121927 8056120720 Bacteria 5758328
1035 8056130789 8056125926 Bacteria 6228218
1036 8056136456 8056131705 Bacteria 6107031
1037 8056141848 8056137416 Bacteria 6147080
1038 8056147901 8056143049 Bacteria 6307666
1039 8056153505 8056148874 Bacteria 6479865
1040 8056159683 8056155041 Bacteria 6486948
1041 8056162708 8056161164 Bacteria 6106669
1042 8056169972 8056166840 Bacteria 5820959
1043 8056176105 8056172158 Bacteria 6133900
1044 8056183403 8056177738 Bacteria 6748268
1045 8056569730 8056569372 Bacteria 5997322
1046 8057803346 8057798959 Bacteria 6713499
1047 Ga0075366_10002142
1048 MRS2a_Contig_782
1049 SwRhRL2b_contig_1365810
1050 SwRhRL2b_contig_3491391
1051 JGI25162J39368_1000126
1052 JGI25162J39368_1000257
1053 JGI25163J39215_1000103
1054 JGI25163J39215_1000331
1055 JGI25164J39214_1000100
1056 JGI25164J39214_1000202
1057 JGI25165J46597_1000207
1058 JGI25165J46597_1000361
1059 Ga0055538_1000028
1060 Ga0055539_1000037
1061 Ga0055533_1000047
1062 Ga0055532_1000129
1063 Ga0055525_1000443
1064 Ga0055536_1000305
1065 Ga0055536_1000508
1066 Ga0055536_1001255
1067 Ga0055530_10000839
1068 Ga0055530_10000961
1069 Ga0055530_10001388
1070 Ga0055540_1000576
1071 Ga0055540_1000882
1072 Ga0055540_1001025
1073 Ga0055531_10004261
1074 Ga0055541_1000025
1075 Ga0065714_10000132
1076 Ga0065714_10005553
1077 Ga0065714_10005866
1078 Ga0065714_10006337
1079 Ga0065714_10011464
1080 Ga0065714_10065605
1081 Ga0065714_10065693
1082 Ga0065714_10066074
1083 Ga0065714_10072057
1084 Ga0065714_10073300
1085 Ga0065704_10001267
1086 Ga0065704_10005830
1087 Ga0065704_10009564
1088 Ga0065704_10075747
1089 Ga0065704_10086093
1090 Ga0065704_10105239
1091 Ga0065712_10000712
1092 Ga0065712_10002348
1093 Ga0070658_10078006
1094 Ga0070683_100002978
1095 Ga0070670_100002834
1096 Ga0070670_100004830
1097 Ga0070670_100011421
1098 Ga0070677_10014734
1099 Ga0070666_10049275
1100 Ga0070680_100320711
1101 Ga0068868_100001450
1102 Ga0070687_100021860
1103 Ga0070661_100000022
1104 Ga0070661_100001365
1105 Ga0070668_100167109
1106 Ga0070669_100001703
1107 Ga0070669_100036007
1108 Ga0070675_100048464
1109 Ga0070671_100012446
1110 Ga0070674_100041038
1111 Ga0070673_100000687
1112 Ga0070673_100017690
1113 Ga0070667_100071281
1114 Ga0070700_100087480
1115 Ga0070694_100038566
1116 Ga0070708_100269572
1117 Ga0070678_100000554
1118 Ga0070662_100000041
1119 Ga0070662_100017261
1120 Ga0070681_10005132
1121 Ga0070681_10009747
1122 Ga0068867_100022758
1123 Ga0068867_100155962
1124 Ga0070685_10162537
1125 Ga0070706_100283023
1126 Ga0070707_100074438
1127 Ga0070697_100220403
1128 Ga0068853_100005399
1129 Ga0070672_100006420
1130 Ga0070686_100078621
1131 Ga0070695_100029773
1132 Ga0070695_100140535
1133 Ga0070665_100065413
1134 Ga0070665_100091254
1135 Ga0068855_100155004
1136 Ga0070664_100000646
1137 Ga0070664_100002976
1138 Ga0070664_100087817
1139 Ga0068857_100085938
1140 Ga0068852_100001172
1141 Ga0068859_100063420
1142 Ga0068864_100003416
1143 Ga0068866_10036604
1144 Ga0068851_10000044
1145 Ga0068851_10000531
1146 Ga0068863_100048109
1147 Ga0075363_100104962
1148 Ga0075364_10021002
1149 Ga0075364_10049614
1150 Ga0075432_10004390
1151 Ga0075432_10008014
1152 Ga0075432_10012043
1153 Ga0075362_10027169
1154 Ga0075366_10026616
1155 Ga0097621_100002291
1156 Ga0097621_100005368
1157 Ga0068871_100001444
1158 Ga0068871_100022645
1159 Ga0075428_100002635
1160 Ga0075431_100034988
1161 Ga0075433_10117466
1162 Ga0075429_100238703
1163 Ga0075429_100300234
1164 Ga0068865_100011198
1165 Ga0075436_100118666
1166 Ga0097620_100063421
1167 Ga0099823_1000054
1168 Ga0079104_1000414
1169 Ga0079104_1000902
1170 Ga0079104_1015454
1171 Ga0099826_10003858
1172 Ga0099794_10000077
1173 Ga0105251_10001454
1174 Ga0105251_10002538
1175 Ga0105251_10003633
1176 Ga0105251_10004210
1177 Ga0105251_10007529
1178 Ga0105251_10008536
1179 Ga0105251_10011825
1180 Ga0105251_10032356
1181 Ga0105251_10046910
1182 Ga0105244_10004672
1183 Ga0105244_10004698
1184 Ga0105244_10005205
1185 Ga0105244_10006467
1186 Ga0105244_10014809
1187 Ga0105244_10024035
1188 Ga0105244_10035122
1189 Ga0105250_10002773
1190 Ga0105250_10003059
1191 Ga0111539_10004775
1192 Ga0111539_10052830
1193 Ga0105245_10374272
1194 Ga0105243_10000312
1195 Ga0105243_10002146
1196 Ga0105243_10159483
1197 Ga0105241_10027898
1198 Ga0105242_10002134
1199 Ga0105242_10027676
1200 Ga0105242_10030641
1201 Ga0105248_10026428
1202 Ga0105248_10143438
1203 Ga0105248_10186693
1204 Ga0105237_10001243
1205 Ga0105237_10027467
1206 Ga0105238_10022892
1207 Ga0105239_10203812
1208 Ga0105246_10001031
1209 Ga0105246_10014568
1210 Ga0105246_10018673
1211 Ga0105246_10107322
1212 Ga0105246_10120480
1213 Ga0157345_1000029
1214 Ga0157373_10001975
1215 Ga0157373_10004161
1216 Ga0157373_10017134
1217 Ga0157373_10018246
1218 Ga0157373_10032739
1219 Ga0157373_10033176
1220 Ga0157373_10182539
1221 Ga0157371_10001461
1222 Ga0157371_10008227
1223 Ga0157371_10015251
1224 Ga0157370_10001727
1225 Ga0157370_10032362
1226 Ga0157369_10002202
1227 Ga0157369_10066249
1228 Ga0157369_10075608
1229 Ga0157374_10001943
1230 Ga0157378_10006978
1231 Ga0163162_10005737
1232 Ga0163162_10011467
1233 Ga0163162_10022326
1234 Ga0157372_10003985
1235 Ga0157372_10014347
1236 Ga0157375_10002545
1237 Ga0157375_10022752
1238 Ga0157375_10023884
1239 Ga0157375_10034737
1240 Ga0157375_10080848
1241 Ga0163163_10077913
1242 Ga0182008_10000323
1243 Ga0182008_10001287
1244 Ga0182008_10004782
1245 Ga0182008_10005261
1246 Ga0182008_10005950
1247 Ga0182008_10007147
1248 Ga0182008_10007981
1249 Ga0182008_10091192
1250 Ga0157377_10009990
1251 Ga0157377_10047113
1252 Ga0157379_10046791
1253 Ga0157376_10010273
1254 Ga0157376_10091377
1255 Ga0182006_1002733
1256 Ga0182006_1003909
1257 Ga0182006_1004160
1258 Ga0182006_1006692
1259 Ga0182006_1029816
1260 Ga0182006_1062755
1261 Ga0182007_10002969
1262 Ga0182007_10004412
1263 Ga0182005_1000723
1264 Ga0182005_1001625
1265 Ga0163161_10013192
1266 Ga0163161_10016286
1267 Ga0163161_10026718
1268 Ga0163161_10046961
1269 Ga0163161_10075384
1270 Ga0209435_100960
1271 Ga0209760_100021
1272 Ga0209760_100055
1273 Ga0209784_100032
1274 Ga0209566_100036
1275 Ga0209674_100054
1276 Ga0209147_100055
1277 Ga0209563_100055
1278 Ga0207427_100001
1279 Ga0207427_100004
1280 Ga0209437_100003
1281 Ga0209437_100028
1282 Ga0209258_100231
1283 Ga0209646_1000331
1284 Ga0209677_100033
1285 Ga0209233_1000007
1286 Ga0209233_1000008
1287 Ga0209676_1000056
1288 Ga0209676_1000101
1289 Ga0209676_1000503
1290 Ga0209676_1001307
1291 Ga0209676_1009559
1292 Ga0209676_1012648
1293 Ga0209050_1000041
1294 Ga0209050_1000060
1295 Ga0209050_1000361
1296 Ga0209050_1002054
1297 Ga0209051_1000037
1298 Ga0209051_1000061
1299 Ga0209051_1000085
1300 Ga0209257_1000635
1301 Ga0207697_10013697
1302 Ga0207656_10000022
1303 Ga0207656_10022519
1304 Ga0207696_1000032
1305 Ga0207696_1000129
1306 Ga0207696_1000262
1307 Ga0207696_1003053
1308 Ga0207696_1007660
1309 Ga0207655_1000005
1310 Ga0207655_1000015
1311 Ga0207655_1000166
1312 Ga0207655_1000357
1313 Ga0207655_1000408
1314 Ga0207655_1001002
1315 Ga0207655_1001218
1316 Ga0207655_1004877
1317 Ga0207655_1005286
1318 Ga0207655_1011306
1319 Ga0207655_1017457
1320 Ga0207655_1017539
1321 Ga0207655_1053386
1322 Ga0207713_1002613
1323 Ga0207713_1002881
1324 Ga0207713_1002896
1325 Ga0207713_1003306
1326 Ga0207713_1003614
1327 Ga0207713_1004933
1328 Ga0207713_1008401
1329 Ga0207713_1009219
1330 Ga0207713_1009521
1331 Ga0207713_1033219
1332 Ga0207682_10005007
1333 Ga0207682_10020357
1334 Ga0207688_10008168
1335 Ga0207645_10003020
1336 Ga0207643_10019424
1337 Ga0207684_10280441
1338 Ga0207707_10013303
1339 Ga0207671_10000034
1340 Ga0207671_10081121
1341 Ga0207649_10000006
1342 Ga0207649_10006645
1343 Ga0207646_10040819
1344 Ga0207681_10000978
1345 Ga0207681_10012413
1346 Ga0207650_10000092
1347 Ga0207650_10002213
1348 Ga0207650_10002270
1349 Ga0207659_10047034
1350 Ga0207700_10002511
1351 Ga0207644_10125667
1352 Ga0207706_10003133
1353 Ga0207686_10047967
1354 Ga0207709_10000134
1355 Ga0207709_10000678
1356 Ga0207709_10011829
1357 Ga0207691_10002145
1358 Ga0207711_10049864
1359 Ga0207711_10080218
1360 Ga0207689_10012165
1361 Ga0207689_10038913
1362 Ga0207661_10002649
1363 Ga0207679_10000010
1364 Ga0207667_10123563
1365 Ga0207651_10000832
1366 Ga0207658_10055038
1367 Ga0207677_10000800
1368 Ga0207639_10005905
1369 Ga0207708_10001343
1370 Ga0207708_10013845
1371 Ga0207648_10010894
1372 Ga0207648_10013748
1373 Ga0207648_10099709
1374 Ga0207676_10004537
1375 Ga0207674_10104924
1376 Ga0207675_100009090
1377 Ga0207675_100255916
1378 Ga0207683_10012662
1379 Ga0207683_10023777
1380 Ga0207698_10000853
1381 Ga0209281_1000010
1382 Ga0209281_1000049
1383 Ga0209281_1007384
1384 Ga0209389_1000002
1385 Ga0209371_1000572
1386 Ga0209995_1002923
1387 Ga0209999_1004007
1388 Ga0209983_1005804
1389 Ga0209588_1000008
1390 Ga0207428_10018896
1391 Ga0207428_10024567
1392 Ga0207428_10029635
1393 Ga0207428_10050689
1394 Ga0207428_10092373
1395 Ga0268266_10075856
1396 Ga0265323_10035030
1397 Ga0268256_1000499
1398 Ga0316178_1073272
1399 Ga0316183_1093468
1400 Ga0316183_1141541
1401 Ga0265332_10000004
1402 Ga0265332_10007136
1403 Ga0265316_10017973
1404 Ga0265316_10064765
1405 Ga0307509_10001698
1406 Ga0307509_10199971
1407 Ga0307408_100001076
1408 Ga0307408_100007882
1409 Ga0307408_100019289
1410 Ga0307408_100029500
1411 Ga0307408_100300883
1412 Ga0265314_10023451
1413 Ga0307405_10002721
1414 Ga0307405_10009155
1415 Ga0307405_10017437
1416 Ga0307405_10031126
1417 Ga0307407_10010099
1418 Ga0307412_10012578
1419 Ga0307412_10037581
1420 Ga0307412_10080411
1421 Ga0307412_10106499
1422 Ga0307412_10137847
1423 Ga0307409_100068134
1424 Ga0307416_100153613
1425 Ga0307414_10010851
1426 Ga0307414_10042546
1427 Ga0307414_10086035
1428 Ga0307414_10124919
1429 Ga0307411_10015517
1430 Ga0307510_10006155
1431 Ga0373948_0014714
1432 Ga0373925_0180932
1433 Ga0237819_02230
1434 Ga0439436_0008028
1435 Ga0439438_000311
1436 Ga0439438_001307
1437 Ga0439438_003930
1438 Ga0439438_005356
1439 Ga0439438_005616
1440 Ga0439438_006187
1441 Ga0439438_007424
1442 Ga0439438_009552
1443 Ga0439447_001267
1444 Ga0439447_004020
1445 Ga0439447_005496
1446 Ga0439447_010765
1447 Ga0439466_0000511
1448 Ga0439466_0001739
1449 Ga0439466_0001862
1450 Ga0439466_0013006
1451 Ga0439466_0013844
1452 Ga0439432_002461
1453 Ga0439432_002654
1454 Ga0439432_002747
1455 Ga0439432_003054
1456 Ga0439432_003222
1457 Ga0439451_015800
1458 Ga0439452_000382
1459 Ga0439452_000510
1460 Ga0439452_000646
1461 Ga0439452_001226
1462 Ga0439452_002237
1463 Ga0439452_006184
1464 Ga0439452_006751
1465 Ga0439456_000096
1466 Ga0439456_001898
1467 Ga0439456_008684
1468 Ga0439463_000222
1469 Ga0439463_000585
1470 Ga0439463_005709
1471 Ga0450911_000096
1472 Ga0450911_000238
1473 Ga0450911_000755
1474 Ga0450919_000450
1475 Ga0450922_000238
1476 Ga0450890_000202
1477 Ga0450902_001384
1478 Ga0450902_001967
1479 Ga0450903_001289
1480 Ga0450903_006830
1481 Ga0450905_000442
1482 Ga0450905_001386
1483 Ga0450906_000574
1484 Ga0450907_000062
1485 Ga0450907_001660
1486 Ga0439446_0001788
1487 Ga0450909_000168
1488 Ga0439434_0000411
1489 Ga0439434_0005796
1490 Ga0439464_0027861
1491 Ga0439460_0000562
1492 Ga0439460_0001729
1493 Ga0439460_0007966
1494 Ga0439460_0017953
1495 Ga0450918_002614
1496 Ga0451577_0062944
1497 Ga0451577_0125031
1498 Ga0439440_0011294
1499 Ga0453684_0082317
1500 Ga0451576_0000745
1501 Ga0495617_000439
1502 Ga0495617_005046
1503 Ga0495617_009057
1504 Ga0495627_001257
1505 Ga0495627_006483
1506 Ga0495627_029885
1507 Ga0495627_054762
1508 Ga0495603_0029386
1509 Ga0495603_0100612
1510 Ga0495590_0002161
1511 Ga0495590_0002603
1512 Ga0495590_0003983
1513 Ga0495590_0005440
1514 Ga0495590_0005866
1515 Ga0495591_001543
1516 Ga0495591_001609
1517 Ga0495591_002816
1518 Ga0495591_003923
1519 Ga0495591_003967
1520 Ga0495591_005851
1521 Ga0495591_007471
1522 Ga0495591_010877
1523 Ga0495638_0004187
1524 Ga0495638_0009880
1525 Ga0495638_0010307
1526 Ga0495638_0010874
1527 Ga0495638_0016835
1528 Ga0495638_0017674
1529 Ga0495638_0050019
1530 Ga0495638_0063306
1531 Ga0495653_0008893
1532 Ga0495653_0011668
1533 Ga0495653_0045843
1534 Ga0495653_0084734
1535 Ga0495650_0010649
1536 Ga0495650_0062776
1537 Ga0495605_0000514
1538 Ga0495605_0001162
1539 Ga0495605_0009012
1540 Ga0495605_0013040
1541 Ga0495605_0020722
1542 Ga0495605_0039526
1543 Ga0495639_0001944
1544 Ga0495584_0000651
1545 Ga0495584_0002556
1546 Ga0495584_0004775
1547 Ga0495584_0005416
1548 Ga0495584_0006353
1549 Ga0495584_0016839
1550 Ga0495584_0024846
1551 Ga0495585_0002101
1552 Ga0495585_0002862
1553 Ga0495585_0005597
1554 Ga0495585_0015538
1555 Ga0495585_0034218
1556 Ga0495596_0002132
1557 Ga0495596_0015797
1558 Ga0495607_0004028
1559 Ga0495607_0004713
1560 Ga0495607_0006276
1561 Ga0495607_0011229
1562 Ga0495607_0015797
1563 Ga0495607_0031366
1564 Ga0495607_0037304
1565 Ga0495583_0004454
1566 Ga0495583_0004497
1567 Ga0495606_0000575
1568 Ga0495606_0003310
1569 Ga0495606_0003623
1570 Ga0495606_0007478
1571 Ga0495606_0009788
1572 Ga0495606_0010800
1573 Ga0495606_0015153
1574 Ga0495606_0020697
1575 Ga0495606_0020850
1576 Ga0495610_0003606
1577 Ga0495610_0004407
1578 Ga0495610_0007496
1579 Ga0495610_0007805
1580 Ga0495610_0013547
1581 Ga0495610_0014265
1582 Ga0495610_0033145
1583 Ga0495610_0080473
1584 Ga0495616_0001150
1585 Ga0495616_0002134
1586 Ga0495616_0003784
1587 Ga0495616_0006798
1588 Ga0495616_0009231
1589 Ga0495616_0010919
1590 Ga0495620_0000003
1591 Ga0495620_0001671
1592 Ga0495620_0002532
1593 Ga0495620_0006904
1594 Ga0495620_0011962
1595 Ga0495620_0047826
1596 Ga0495631_0000224
1597 Ga0495631_0002487
1598 Ga0495631_0003213
1599 Ga0495631_0013207
1600 Ga0495632_0001301
1601 Ga0495632_0003179
1602 Ga0495632_0004423
1603 Ga0495632_0007835
1604 Ga0495632_0007843
1605 Ga0495632_0024356
1606 Ga0495632_0036309
1607 Ga0495637_0000618
1608 Ga0495637_0001387
1609 Ga0495637_0001533
1610 Ga0495637_0004838
1611 Ga0495637_0004840
1612 Ga0495637_0008746
1613 Ga0495637_0009469
1614 Ga0495637_0012841
1615 Ga0495637_0012941
1616 Ga0495637_0034373
1617 Ga0495643_0000116
1618 Ga0495643_0001999
1619 Ga0495643_0003288
1620 Ga0495643_0007210
1621 Ga0495643_0008409
1622 Ga0495643_0061432
1623 Ga0495643_0061669
1624 Ga0495644_0001169
1625 Ga0495644_0004677
1626 Ga0495644_0012534
1627 Ga0495648_0002887
1628 Ga0495648_0003903
1629 Ga0495648_0003971
1630 Ga0495648_0005915
1631 Ga0495648_0010961
1632 Ga0495648_0018105
1633 Ga0495648_0029602
1634 Ga0495648_0031945
1635 Ga0495666_0005182
1636 Ga0495666_0006948
1637 Ga0495666_0066631
1638 Ga0495642_0000755
1639 Ga0495642_0001318
1640 Ga0495642_0004141
1641 Ga0495642_0044456
1642 Ga0495654_0001647
1643 Ga0495654_0003640
1644 Ga0495654_0005070
1645 Ga0495654_0005362
1646 Ga0495654_0007126
1647 Ga0495654_0007409
1648 Ga0495654_0007656
1649 Ga0495654_0011965
1650 Ga0495654_0027342
1651 Ga0495654_0056387
1652 Ga0495587_0007965
1653 Ga0495609_0003739
1654 Ga0495609_0031721
1655 Ga0495597_0004952
1656 Ga0495597_0005985
1657 Ga0495597_0006410
1658 Ga0495597_0022758
1659 Ga0495597_0025968
1660 Ga0495622_0001403
1661 Ga0495622_0001827
1662 Ga0495622_0003204
1663 Ga0495622_0017228
1664 Ga0495622_0024888
1665 Ga0495622_0047330
1666 Ga0495633_0011010
1667 Ga0495656_0004366
1668 Ga0495668_0002475
1669 Ga0495668_0003410
1670 Ga0495634_0003166
1671 Ga0495611_0000981
1672 Ga0495625_0006599
1673 Ga0495625_0026915
1674 Ga0495625_0053000
1675 Ga0495625_0098865
1676 Ga0495625_0098963
1677 Ga0495635_0018760
1678 Ga0495635_0026215
1679 Ga0495659_0000807
1680 Ga0495659_0011186
1681 Ga0495661_0004997
1682 Ga0495661_0007855
1683 Ga0495661_0065663
1684 Ga0495661_0080877
1685 Ga0495661_0103762
1686 Ga0495588_0011374
1687 Ga0495624_0002472
1688 Ga0495670_0000886
1689 Ga0495670_0001480
1690 Ga0495670_0002624
1691 Ga0495670_0008648
1692 Ga0495670_0009932
1693 Ga0495671_0000750
1694 Ga0495671_0009315
1695 Ga0495671_0009555
1696 Ga0495671_0011262
1697 Ga0495671_0013189
1698 Ga0495671_0015763
1699 Ga0495671_0030240
1700 Ga0495671_0033866
1701 Ga0495671_0042777
1702 Ga0495671_0058831
1703 Ga0495649_0000333
1704 Ga0495649_0000406
1705 Ga0495649_0002040
1706 Ga0495649_0007189
1707 Ga0495649_0009716
1708 Ga0495649_0011856
1709 Ga0495649_0016162
1710 Ga0495649_0041868
1711 Ga0495649_0060117
1712 Ga0495589_0000769
1713 Ga0495589_0001719
1714 Ga0495589_0005836
1715 Ga0495589_0006524
1716 Ga0495589_0010289
1717 Ga0495589_0010292
1718 Ga0495589_0014537
1719 Ga0495660_0008322
1720 Ga0495660_0010608
1721 Ga0495660_0018795
1722 Ga0495660_0029456
1723 Ga0495660_0043450
1724 Ga0495660_0055382
1725 Ga0495660_0095799
1726 Ga0495604_0051202
1727 Ga0495636_0006392
1728 Ga0495674_0028934
1729 Ga0495672_0001280
1730 Ga0495672_0003260
1731 Ga0495672_0003963
1732 Ga0495672_0004654
1733 Ga0495672_0004820
1734 Ga0495672_0004863
1735 Ga0495672_0005097
1736 Ga0495672_0006765
1737 Ga0495672_0007965
1738 Ga0495672_0027802
1739 Ga0495672_0049869
1740 Ga0495676_0007897
1741 Ga0495683_0001278
1742 Ga0495683_0001496
1743 Ga0495683_0006496
1744 Ga0495683_0010675
1745 Ga0495687_001318
1746 Ga0495687_002198
1747 Ga0495687_005828
1748 Ga0495687_011160
1749 Ga0495675_0009783
1750 Ga0495677_0001558
1751 Ga0495679_008195
1752 Ga0495679_011134
1753 Ga0495673_0001648
1754 Ga0495673_0001922
1755 Ga0495673_0003212
1756 Ga0495673_0007907
1757 Ga0495673_0008165
1758 Ga0495673_0011998
1759 Ga0495673_0021936
1760 Ga0495673_0026775
1761 Ga0495673_0028612
1762 Ga0495673_0033154
1763 Ga0495681_0000707
1764 Ga0495681_0003046
1765 Ga0495681_0003760
1766 Ga0495681_0004427
1767 Ga0495681_0005083
1768 Ga0495681_0018049
1769 Ga0495681_0035785
1770 Ga0495686_0005886
1771 Ga0495686_0015228
1772 Ga0495686_0017064
1773 Ga0495593_0011264
1774 Ga0495593_0021904
1775 Ga0495602_0030014
1776 Ga0495626_0000658
1777 Ga0495626_0001692
1778 Ga0495626_0001697
1779 Ga0495626_0003331
1780 Ga0495626_0004081
1781 Ga0495626_0004890
1782 Ga0495626_0005353
1783 Ga0496102_0003153
1784 Ga0496106_0071209
1785 Ga0496108_0029323
1786 Ga0496109_0013168
1787 Ga0496116_0000492
1788 Ga0496116_0017628
1789 Ga0496116_0019081
1790 Ga0496117_0001334
1791 Ga0496117_0003743
1792 Ga0496117_0006594
1793 Ga0496117_0010034
1794 Ga0496117_0028183
1795 Ga0496117_0056606
1796 Ga0496117_0065362
1797 Ga0496117_0086595
1798 Ga0496117_0106819
1799 Ga0496118_0002770
1800 Ga0496118_0010803
1801 Ga0496118_0016385
1802 Ga0496118_0035872
1803 Ga0496118_0065390
1804 Ga0496118_0115907
1805 Ga0496119_0000207
1806 Ga0496119_0006721
1807 Ga0496119_0048067
1808 Ga0496120_0003397
1809 Ga0496120_0005268
1810 Ga0496121_0000921
1811 Ga0496121_0025675
1812 Ga0496121_0037143
1813 Ga0496121_0039458
1814 Ga0496122_0002533
1815 Ga0496122_0006320
1816 Ga0496123_0000387
1817 Ga0496123_0001516
1818 Ga0496123_0019807
1819 Ga0496123_0081031
1820 Ga0496124_0003921
1821 Ga0496124_0007969
1822 Ga0496124_0010730
1823 Ga0496124_0013388
1824 Ga0496124_0016920
1825 Ga0496124_0018386
1826 Ga0496124_0021340
1827 Ga0496124_0024939
1828 Ga0496124_0048868
1829 Ga0496125_0003468
1830 Ga0496125_0003963
1831 Ga0496125_0011039
1832 Ga0496125_0021596
1833 Ga0496125_0022287
1834 Ga0496125_0034870
1835 Ga0496126_0016878
1836 Ga0496126_0050203
1837 Ga0496126_0084656
1838 Ga0495678_001206
1839 Ga0495678_004100
1840 Ga0495678_007204
1841 Ga0495678_009544
1842 Ga0495678_021940
1843 Ga0495678_030356
1844 Ga0495682_0001922
1845 Ga0495682_0003432
1846 Ga0501034_0000370
1847 Ga0501034_0121014
1848 Ga0501039_0023003
1849 Ga0501076_0021040
1850 Ga0501209_013131
1851 Ga0501226_000005
1852 nmdc:mga03683_32130_c1
1853 nmdc:mga0k408_18339_c1
1854 nmdc:mga09592_310473_c1
1855 nmdc:mga08y16_116170_c1
1856 Ga0495619_0019399
1857 Ga0500572_001966
1858 Ga0500634_0005001
1859 2511253971
1860 2511264135
1861 2511273591
1862 2511277060
1863 2511289995
1864 2511297634
1865 2511299851
1866 2511315606
1867 2511320481
1868 2511328848
1869 2511332365
1870 2511338695
1871 2511346043
1872 2511352776
1873 2511355806
1874 2511363789
1875 2511369113
1876 2511377711
1877 2511411086
1878 2511823056
1879 2512328342
1880 2526212174
1881 2548847580
1882 2555247766
1883 2555668072
1884 2583790513
1885 2597856286
1886 2597865769
1887 2597871585
1888 2599355071
1889 2599361105
1890 2599367427
1891 2599374217
1892 2599380177
1893 2599386624
1894 2599393075
1895 2599399874
1896 2599404842
1897 2599452657
1898 2599461905
1899 2599467052
1900 2599483458
1901 2599491002
1902 2599501164
1903 2599508254
1904 2599514328
1905 2599521548
1906 2599613877
1907 2599770767
1908 2599805364
1909 2599881923
1910 2599886645
1911 2599893704
1912 2599897014
1913 2599934718
1914 2599943016
1915 2599951696
1916 2599953945
1917 2599959455
1918 2599968024
1919 2599979253
1920 2599985312
1921 2599987236
1922 2599995454
1923 2599999935
1924 2600008806
1925 2600013138
1926 2600016650
1927 2600025329
1928 2600029615
1929 2600035493
1930 2600041340
1931 2600045563
1932 2600056620
1933 2600058469
1934 2600063861
1935 2600074146
1936 2600079826
1937 2600214527
1938 2600358293
1939 2600364069
1940 2601692784
1941 2601774768
1942 2601800102
1943 2606074633
1944 2606127496
1945 2608381262
1946 2621297765
1947 2624478849
1948 2624490371
1949 2643842455
1950 2643873654
1951 2643955316
1952 2644023668
1953 2644188155
1954 2644281563
1955 2644623448
1956 2652545745
1957 2671094487
1958 2671097672
1959 2671127900
1960 2671767901
1961 2677897932
1962 2678261588
1963 2715750785
1964 2715757566
1965 2718632735
1966 2723250501
1967 2738670883
1968 2738749277
1969 2738811295
1970 2738858318
1971 2738898655
1972 2739196590
1973 2739257568
1974 2739286495
1975 2739291808
1976 2739316455
1977 2743735696
1978 2745007937
1979 2765582258
1980 2774122192
1981 2774136672
1982 2784260424
1983 2784317551
1984 2794594386
1985 2807409872
1986 2807458220
1987 2808854109
1988 2808904920
1989 2808923400
1990 2808928729
1991 2808934141
1992 2808943039
1993 2808945325
1994 2808950850
1995 2808956652
1996 2808962458
1997 2808980200
1998 2808995977
1999 2808997501
2000 2809215788
2001 2812370915
2002 2817493101
2003 2819658406
2004 2819702755
2005 2825653689
2006 2834034198
2007 2842808864
2008 2842829726
2009 2842835681
2010 2842843202
2011 2842847429
2012 2842857244
2013 2844668569
2014 2852612514
2015 2852662716
2016 2852669750
2017 2860340610
2018 2878030813
2019 2880231728
2020 2904520763
2021 2904553087
2022 2908451692
2023 2912964912
2024 2913037928
2025 2917071833
2026 2919064681
2027 2919158856
2028 2919385865
2029 2919458255
2030 2919482835
2031 2919490650
2032 2919703704
2033 2923154705
2034 2923525020
2035 2923591760
2036 2929145380
2037 2929194300
2038 2931371280
2039 2931395574
2040 2931399487
2041 2935354006
2042 2939637056
2043 2939653269
2044 2945931756
2045 2945961396
2046 2946007839
2047 2947233539
2048 2969305638
2049 2974292732
2050 2984291324
2051 2988732924
2052 2990200373
2053 2998141079
2054 3007400234
2055 3007420716
2056 3007512451
2057 3007619683
2058 3007620979
2059 3007721441
2060 3007808237
2061 3007860960
2062 3007863700
2063 3007871278
2064 3007873367
2065 637318450
2066 8011354286
2067 8015688941
2068 8019773318
2069 8019781854
2070 8029999683
2071 8052495709
2072 8054286184
2073 8054351149
2074 8054508087
2075 8054929518
2076 8055772058
2077 8055823040
2078 8055883270
2079 8056120221
2080 8056121927
2081 8056130789
2082 8056136456
2083 8056141848
2084 8056147901
2085 8056153505
2086 8056159683
2087 8056162708
2088 8056169972
2089 8056176105
2090 8056183403
2091 8056569730
2092 8057803346

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

7

374

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.8978 34 411
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.8932 34 411
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8814 33 405
5yit-assembly3.cif.gz_E-2 crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8795 33 403
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8783 33 404
ID Description Score Start End Superfamily
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9097 258 344 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9026 255 347 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8937 255 347 3.30.1540.10
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.889 255 347 3.30.1540.10
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8814 258 344 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A6L4Z307-F1-model_v4 L-carnitine dehydratase/bile acid-inducible protein F 0.9751 33 154 GO:0008410
AF-A0A2N2T8D3-F1-model_v4 Formyl-CoA transferase 0.9673 35 128 GO:0008410
AF-A0A316PNQ3-F1-model_v4 CoA transferase 0.9612 33 164 GO:0008410
AF-A0A3M1RQL6-F1-model_v4 CoA transferase 0.9592 33 170 GO:0008410
AF-A0A0F9NUV7-F1-model_v4 Formyl-CoA transferase 0.9483 34 167 GO:0003824

Map