F488963

General Info

Members Datasets Scaffolds Average Seq Length
1046 443 2092 219

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0718923|Ga0451577_0718923_72_854
Length 260
Sequence LIDERAAEALSCAPGSRELARAMNLRRATMPNSHRQETTMQNTSRIFGPAIAAVLVLALAPAVHAQQSDMSFFVTSTPIGKGADLGGLDGADRHCQSLAAAAGAGGKTWHAYLSTQGAGAVNAKDRIGKGPWKNAKGVVIAKDVAELHGANNLTKQTALTEKGTVVNGRGDTPNMHDIVTGSQADGTAFPAGEDRTCGNYTKSDAGSVMLGHADRTGLDDSAAQKSWTTSHPSRGPGGGCSQDDLKSTGGNGLLYCFATN

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
143 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
144 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
164 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
165 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
256 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
257 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
266 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
267 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
279 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
300 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
303 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
304 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
305 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
306 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
307 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
332 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
339 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
372 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
373 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
374 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
375 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
394 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
395 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
396 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
408 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
409 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
412 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
413 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
414 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
415 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
416 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
419 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
420 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
421 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
422 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
425 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
428 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
429 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
430 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
431 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
432 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
433 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
434 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
435 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
436 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
437 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
438 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
440 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
441 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
442 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
443 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.38
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.74
Nodule 0
Rhizoplane 2.49
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 2.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0718923 3300042876 Bacteria 904
2 2214828542 2209111006 Bacteria 9284
3 ARcpr5oldR_c000138 3300000041 Bacteria 12428
4 ARSoilYngRDRAFT_c00004 3300000042 Bacteria 40941
5 ARcpr5yngRDRAFT_c000060 3300000043 Bacteria 17786
6 ARSoilOldRDRAFT_c000133 3300000044 Bacteria 13213
7 ARCol0oldRDRAFT_c00433 3300000045 Bacteria 3985
8 ARCol0yngRDRAFT_1000084 3300000652 Bacteria 17450
9 JGI24741J21665_1015598 3300001915 Bacteria 1252
10 JGI24747J21853_1013193 3300001978 Bacteria 851
11 JGI24737J22298_10000934 3300001990 Bacteria 10373
12 JGI24743J22301_10007855 3300001991 Bacteria 1859
13 JGI24735J21928_10028325 3300002067 Bacteria 1673
14 JGI24750J21931_1000032 3300002070 Bacteria 18759
15 JGI24748J21848_1000782 3300002074 Bacteria 3449
16 JGI24738J21930_10001211 3300002075 Bacteria 7234
17 JGI24749J21850_1003266 3300002076 Bacteria 2265
18 JGI24035J26624_1000066 3300002126 Bacteria 8330
19 JGI24033J26618_1000292 3300002155 Bacteria 5438
20 JGI24034J26672_10000075 3300002239 Bacteria 23231
21 JGI24742J22300_10000054 3300002244 Bacteria 16914
22 JGI24751J29686_10010139 3300002459 Bacteria 1942
23 JGI25152J39213_1005374 3300002773 Bacteria 3753
24 rootH1_10002881 3300003323 Bacteria 1145
25 Ga0055526_1015322 3300003771 Bacteria 3084
26 Ga0058859_11552955 3300004798 Unclassified 1976
27 Ga0058860_10052366 3300004801 Bacteria 2652
28 Ga0065717_1002020 3300005276 Bacteria 3534
29 Ga0065714_10180179 3300005288 Bacteria 966
30 Ga0065704_10072529 3300005289 Bacteria 8368
31 Ga0065715_10089082 3300005293 Bacteria 14764
32 Ga0065707_10127028 3300005295 Bacteria 1992
33 Ga0065707_10255063 3300005295 Bacteria 1113
34 Ga0070676_10000062 3300005328 Bacteria 35195
35 Ga0070683_100000259 3300005329 Bacteria 36454
36 Ga0070683_100069961 3300005329 Bacteria 3273
37 Ga0070683_100112039 3300005329 Bacteria 2574
38 Ga0070690_100001045 3300005330 Bacteria 14168
39 Ga0070690_100040233 3300005330 Bacteria 2956
40 Ga0070690_100175608 3300005330 Bacteria 1477
41 Ga0070690_100361168 3300005330 Bacteria 1057
42 Ga0070690_100375896 3300005330 Bacteria 1038
43 Ga0070670_100007548 3300005331 Bacteria 9229
44 Ga0070670_100008320 3300005331 Bacteria 8842
45 Ga0070670_100019991 3300005331 Bacteria 5749
46 Ga0070670_100054773 3300005331 Bacteria 3424
47 Ga0070670_100061705 3300005331 Bacteria 3218
48 Ga0070670_100102832 3300005331 Bacteria 2461
49 Ga0070677_10000077 3300005333 Bacteria 31203
50 Ga0070677_10000368 3300005333 Bacteria 15845
51 Ga0070677_10073698 3300005333 Bacteria 1443
52 Ga0068869_100000095 3300005334 Bacteria 41336
53 Ga0068869_100006240 3300005334 Bacteria 7548
54 Ga0068869_100159051 3300005334 Bacteria 1757
55 Ga0070666_10003027 3300005335 Bacteria 10196
56 Ga0070666_10032791 3300005335 Bacteria 3433
57 Ga0070666_10382206 3300005335 Bacteria 1011
58 Ga0070680_100001342 3300005336 Bacteria 17830
59 Ga0070680_100023963 3300005336 Bacteria 4872
60 Ga0070680_100102792 3300005336 Bacteria 2373
61 Ga0070680_100250387 3300005336 Bacteria 1498
62 Ga0070682_100000511 3300005337 Bacteria 24357
63 Ga0068868_100000824 3300005338 Bacteria 21004
64 Ga0068868_100009255 3300005338 Bacteria 7078
65 Ga0068868_100045718 3300005338 Bacteria 3426
66 Ga0068868_100376189 3300005338 Bacteria 1221
67 Ga0070660_100000871 3300005339 Bacteria 20136
68 Ga0070660_100057056 3300005339 Bacteria 3024
69 Ga0070660_100230869 3300005339 Bacteria 1506
70 Ga0070660_100355505 3300005339 Bacteria 1207
71 Ga0070689_100006542 3300005340 Bacteria 8077
72 Ga0070689_100081269 3300005340 Bacteria 2544
73 Ga0070689_100156508 3300005340 Bacteria 1840
74 Ga0070691_10014544 3300005341 Bacteria 3612
75 Ga0070687_100000489 3300005343 Bacteria 13206
76 Ga0070687_100091102 3300005343 Bacteria 1687
77 Ga0070661_100000912 3300005344 Bacteria 21210
78 Ga0070661_100001402 3300005344 Bacteria 16837
79 Ga0070661_100059933 3300005344 Bacteria 2792
80 Ga0070661_100251563 3300005344 Bacteria 1364
81 Ga0070692_10002749 3300005345 Bacteria 6920
82 Ga0070692_10132000 3300005345 Bacteria 1404
83 Ga0070668_100001817 3300005347 Bacteria 15523
84 Ga0070668_100004187 3300005347 Bacteria 10693
85 Ga0070668_100018430 3300005347 Bacteria 5241
86 Ga0070668_100039792 3300005347 Bacteria 3596
87 Ga0070668_100041387 3300005347 Bacteria 3530
88 Ga0070668_100087534 3300005347 Bacteria 2451
89 Ga0070668_100141893 3300005347 Bacteria 1937
90 Ga0070669_100000627 3300005353 Bacteria 26160
91 Ga0070669_100052561 3300005353 Bacteria 2981
92 Ga0070669_100059683 3300005353 Bacteria 2801
93 Ga0070669_100268259 3300005353 Bacteria 1364
94 Ga0070669_100632513 3300005353 Bacteria 899
95 Ga0070675_100000231 3300005354 Bacteria 35826
96 Ga0070675_100000524 3300005354 Bacteria 26172
97 Ga0070675_100011178 3300005354 Bacteria 7024
98 Ga0070675_100194073 3300005354 Bacteria 1760
99 Ga0070675_100346138 3300005354 Bacteria 1317
100 Ga0070671_100000689 3300005355 Bacteria 24261
101 Ga0070671_100000935 3300005355 Bacteria 21361
102 Ga0070671_100008470 3300005355 Bacteria 8241
103 Ga0070671_100023761 3300005355 Bacteria 5018
104 Ga0070671_100716796 3300005355 Bacteria 868
105 Ga0070674_100001658 3300005356 Bacteria 12014
106 Ga0070674_100002295 3300005356 Bacteria 10558
107 Ga0070674_100003262 3300005356 Bacteria 9061
108 Ga0070674_100012945 3300005356 Bacteria 5138
109 Ga0070673_100000144 3300005364 Bacteria 33872
110 Ga0070673_100002654 3300005364 Bacteria 10944
111 Ga0070673_100012746 3300005364 Bacteria 5783
112 Ga0070673_100060368 3300005364 Bacteria 3004
113 Ga0070673_100295331 3300005364 Bacteria 1425
114 Ga0070673_100307921 3300005364 Bacteria 1396
115 Ga0070688_100000524 3300005365 Bacteria 19410
116 Ga0070688_100118796 3300005365 Bacteria 1768
117 Ga0070688_100296014 3300005365 Bacteria 1168
118 Ga0070659_100001134 3300005366 Bacteria 19419
119 Ga0070659_100792638 3300005366 Bacteria 824
120 Ga0070667_100008892 3300005367 Bacteria 8313
121 Ga0070667_100071531 3300005367 Bacteria 2954
122 Ga0070667_100103969 3300005367 Bacteria 2456
123 Ga0070667_100154236 3300005367 Bacteria 2019
124 Ga0070667_100241346 3300005367 Bacteria 1613
125 Ga0070703_10003476 3300005406 Bacteria 4492
126 Ga0070714_100097015 3300005435 Bacteria 2591
127 Ga0070710_10141743 3300005437 Bacteria 1475
128 Ga0070701_10000059 3300005438 Bacteria 29115
129 Ga0070705_100000717 3300005440 Bacteria 18886
130 Ga0070705_100039696 3300005440 Bacteria 2672
131 Ga0070705_100214331 3300005440 Bacteria 1329
132 Ga0070705_100621343 3300005440 Bacteria 839
133 Ga0070700_100002047 3300005441 Bacteria 10242
134 Ga0070700_100149013 3300005441 Bacteria 1598
135 Ga0070700_100286538 3300005441 Bacteria 1196
136 Ga0070700_100310730 3300005441 Bacteria 1154
137 Ga0070694_100001020 3300005444 Bacteria 15907
138 Ga0070694_100105214 3300005444 Bacteria 2002
139 Ga0070694_100601952 3300005444 Bacteria 885
140 Ga0070708_100113828 3300005445 Bacteria 2488
141 Ga0070708_100276280 3300005445 Bacteria 1581
142 Ga0070663_100000339 3300005455 Bacteria 24358
143 Ga0070663_100097157 3300005455 Bacteria 2192
144 Ga0070678_100001198 3300005456 Bacteria 13787
145 Ga0070678_100005238 3300005456 Bacteria 7464
146 Ga0070678_100012230 3300005456 Bacteria 5326
147 Ga0070678_100040159 3300005456 Bacteria 3308
148 Ga0070678_100047325 3300005456 Bacteria 3089
149 Ga0070678_100099528 3300005456 Bacteria 2250
150 Ga0070678_100185416 3300005456 Bacteria 1707
151 Ga0070678_100191041 3300005456 Bacteria 1684
152 Ga0070662_100011568 3300005457 Bacteria 5823
153 Ga0070662_100058230 3300005457 Bacteria 2811
154 Ga0070662_100270900 3300005457 Bacteria 1371
155 Ga0070681_10002595 3300005458 Bacteria 16576
156 Ga0070681_10058787 3300005458 Bacteria 3824
157 Ga0070681_10105771 3300005458 Bacteria 2756
158 Ga0070681_10142015 3300005458 Bacteria 2330
159 Ga0070681_10435174 3300005458 Bacteria 1224
160 Ga0068867_100000325 3300005459 Bacteria 31413
161 Ga0068867_100001776 3300005459 Bacteria 14990
162 Ga0068867_100051479 3300005459 Bacteria 3037
163 Ga0068867_100287783 3300005459 Bacteria 1350
164 Ga0068867_100306259 3300005459 Bacteria 1311
165 Ga0070685_10002882 3300005466 Bacteria 8794
166 Ga0070706_100081665 3300005467 Bacteria 2994
167 Ga0070706_100168769 3300005467 Bacteria 2043
168 Ga0070706_100431386 3300005467 Bacteria 1226
169 Ga0070707_100878257 3300005468 Bacteria 861
170 Ga0070699_100275195 3300005518 Bacteria 1507
171 Ga0070679_100001410 3300005530 Bacteria 21239
172 Ga0070684_100000526 3300005535 Bacteria 26256
173 Ga0070684_100047686 3300005535 Bacteria 3713
174 Ga0070684_100079132 3300005535 Bacteria 2905
175 Ga0068853_100002423 3300005539 Bacteria 13938
176 Ga0068853_100018602 3300005539 Bacteria 5753
177 Ga0068853_100024074 3300005539 Bacteria 5104
178 Ga0068853_100426231 3300005539 Bacteria 1245
179 Ga0070672_100000358 3300005543 Bacteria 26306
180 Ga0070672_100000433 3300005543 Bacteria 24368
181 Ga0070672_100001907 3300005543 Bacteria 13071
182 Ga0070672_100004203 3300005543 Bacteria 9409
183 Ga0070672_100009042 3300005543 Bacteria 6849
184 Ga0070672_100009113 3300005543 Bacteria 6827
185 Ga0070686_100000704 3300005544 Bacteria 19403
186 Ga0070686_100091419 3300005544 Bacteria 2036
187 Ga0070695_100019851 3300005545 Bacteria 4098
188 Ga0070695_100058832 3300005545 Bacteria 2486
189 Ga0070695_100666978 3300005545 Bacteria 823
190 Ga0070696_100012571 3300005546 Bacteria 5684
191 Ga0070693_100017619 3300005547 Bacteria 3716
192 Ga0070693_100139929 3300005547 Bacteria 1522
193 Ga0070665_100288832 3300005548 Bacteria 1642
194 Ga0070665_100320009 3300005548 Bacteria 1555
195 Ga0070665_100541176 3300005548 Bacteria 1176
196 Ga0070665_100546888 3300005548 Bacteria 1170
197 Ga0070704_100000341 3300005549 Bacteria 21211
198 Ga0070704_100039605 3300005549 Bacteria 3237
199 Ga0070704_100225941 3300005549 Bacteria 1524
200 Ga0068855_100006286 3300005563 Bacteria 14478
201 Ga0068855_100013126 3300005563 Bacteria 9992
202 Ga0068855_100871674 3300005563 Bacteria 953
203 Ga0070664_100001370 3300005564 Bacteria 19408
204 Ga0070664_100072053 3300005564 Bacteria 2962
205 Ga0070664_100076766 3300005564 Bacteria 2871
206 Ga0070664_100096792 3300005564 Bacteria 2562
207 Ga0070664_100099808 3300005564 Bacteria 2523
208 Ga0070664_100240821 3300005564 Bacteria 1624
209 Ga0068857_100000521 3300005577 Bacteria 27715
210 Ga0068857_100000558 3300005577 Bacteria 27209
211 Ga0068857_100256915 3300005577 Bacteria 1603
212 Ga0068854_100000532 3300005578 Bacteria 23105
213 Ga0068854_100007092 3300005578 Bacteria 7154
214 Ga0068854_100344566 3300005578 Bacteria 1218
215 Ga0068856_100002364 3300005614 Bacteria 19400
216 Ga0068856_100061032 3300005614 Bacteria 3724
217 Ga0068856_100073582 3300005614 Bacteria 3383
218 Ga0070702_100000207 3300005615 Bacteria 19394
219 Ga0068852_100000954 3300005616 Bacteria 19044
220 Ga0068852_100006852 3300005616 Bacteria 8279
221 Ga0068852_100048811 3300005616 Bacteria 3618
222 Ga0068859_100002298 3300005617 Bacteria 19408
223 Ga0068859_100019725 3300005617 Bacteria 6770
224 Ga0068859_100284169 3300005617 Bacteria 1747
225 Ga0068859_100394422 3300005617 Bacteria 1480
226 Ga0068859_100620337 3300005617 Bacteria 1174
227 Ga0068859_100757944 3300005617 Bacteria 1059
228 Ga0068864_100003173 3300005618 Bacteria 13595
229 Ga0068864_100004967 3300005618 Bacteria 10906
230 Ga0068864_100048094 3300005618 Bacteria 3666
231 Ga0068864_100097466 3300005618 Bacteria 2603
232 Ga0068864_100281229 3300005618 Bacteria 1553
233 Ga0068864_100764493 3300005618 Bacteria 948
234 Ga0068864_100846264 3300005618 Unclassified 901
235 Ga0068866_10000912 3300005718 Bacteria 12955
236 Ga0068861_100000416 3300005719 Bacteria 24700
237 Ga0068861_100018282 3300005719 Bacteria 4992
238 Ga0068861_100127963 3300005719 Bacteria 2058
239 Ga0068861_100172952 3300005719 Bacteria 1791
240 Ga0068861_100674498 3300005719 Bacteria 958
241 Ga0068851_10037574 3300005834 Bacteria 2428
242 Ga0068851_10041248 3300005834 Bacteria 2320
243 Ga0068851_10048291 3300005834 Bacteria 2157
244 Ga0068851_10176076 3300005834 Bacteria 1183
245 Ga0068870_10000034 3300005840 Bacteria 43913
246 Ga0068870_10117303 3300005840 Bacteria 1528
247 Ga0068863_100002182 3300005841 Bacteria 19408
248 Ga0068863_100093442 3300005841 Bacteria 2854
249 Ga0068863_100097753 3300005841 Bacteria 2788
250 Ga0068863_100105059 3300005841 Bacteria 2687
251 Ga0068863_100792730 3300005841 Bacteria 945
252 Ga0068858_100004013 3300005842 Bacteria 14517
253 Ga0068858_100128549 3300005842 Bacteria 2374
254 Ga0068858_100620650 3300005842 Bacteria 1050
255 Ga0068860_100008063 3300005843 Bacteria 10495
256 Ga0068860_100048446 3300005843 Bacteria 4050
257 Ga0068860_100057315 3300005843 Bacteria 3703
258 Ga0068860_100069835 3300005843 Bacteria 3339
259 Ga0068860_100081432 3300005843 Bacteria 3078
260 Ga0068860_100322876 3300005843 Bacteria 1515
261 Ga0068860_100655696 3300005843 Bacteria 1058
262 Ga0068862_100001525 3300005844 Bacteria 21219
263 Ga0068862_100004818 3300005844 Bacteria 11361
264 Ga0068862_100053036 3300005844 Bacteria 3471
265 Ga0068862_100123082 3300005844 Bacteria 2288
266 Ga0068862_100218847 3300005844 Bacteria 1723
267 Ga0081455_10000204 3300005937 Bacteria 75793
268 Ga0081455_10005710 3300005937 Bacteria 13577
269 Ga0081538_10003120 3300005981 Bacteria 15750
270 Ga0081538_10043104 3300005981 Bacteria 2838
271 Ga0081540_1021931 3300005983 Bacteria 3783
272 Ga0081539_10003651 3300005985 Bacteria 18515
273 Ga0075365_10004100 3300006038 Bacteria 7659
274 Ga0075365_10074403 3300006038 Bacteria 2291
275 Ga0075365_10192936 3300006038 Bacteria 1426
276 Ga0075368_10001078 3300006042 Bacteria 8545
277 Ga0075368_10029548 3300006042 Bacteria 2119
278 Ga0075364_10068119 3300006051 Bacteria 2340
279 Ga0075364_10331685 3300006051 Bacteria 1036
280 Ga0075432_10002270 3300006058 Bacteria 6395
281 Ga0070712_100916821 3300006175 Bacteria 756
282 Ga0075362_10065976 3300006177 Bacteria 1644
283 Ga0075367_10028577 3300006178 Bacteria 3183
284 Ga0075367_10031593 3300006178 Bacteria 3041
285 Ga0075367_10034846 3300006178 Bacteria 2910
286 Ga0075367_10063896 3300006178 Bacteria 2201
287 Ga0075427_10002073 3300006194 Bacteria 2655
288 Ga0075366_10061603 3300006195 Bacteria 2230
289 Ga0075366_10329829 3300006195 Bacteria 935
290 Ga0097621_100000010 3300006237 Bacteria 112867
291 Ga0097621_100052380 3300006237 Bacteria 3325
292 Ga0075370_10015066 3300006353 Bacteria 4133
293 Ga0075370_10017847 3300006353 Bacteria 3839
294 Ga0068871_100000193 3300006358 Bacteria 41878
295 Ga0068871_100018026 3300006358 Bacteria 5358
296 Ga0068871_100054187 3300006358 Bacteria 3253
297 Ga0068871_100055683 3300006358 Bacteria 3211
298 Ga0068871_100055704 3300006358 Bacteria 3211
299 Ga0068871_100324958 3300006358 Bacteria 1356
300 Ga0075428_100021307 3300006844 Bacteria 7176
301 Ga0075428_100046620 3300006844 Bacteria 4760
302 Ga0075428_100153765 3300006844 Bacteria 2499
303 Ga0075428_100177449 3300006844 Bacteria 2307
304 Ga0075428_100185745 3300006844 Bacteria 2249
305 Ga0075430_100000112 3300006846 Bacteria 48871
306 Ga0075430_100026999 3300006846 Bacteria 4883
307 Ga0075430_100348418 3300006846 Bacteria 1223
308 Ga0075430_100364924 3300006846 Unclassified 1192
309 Ga0075431_100004280 3300006847 Bacteria 13986
310 Ga0075431_100168059 3300006847 Bacteria 2254
311 Ga0075431_100176379 3300006847 Bacteria 2195
312 Ga0075431_100205794 3300006847 Bacteria 2012
313 Ga0075431_100224512 3300006847 Bacteria 1915
314 Ga0075431_100307511 3300006847 Bacteria 1601
315 Ga0075431_100681393 3300006847 Bacteria 1007
316 Ga0075433_10000639 3300006852 Bacteria 23475
317 Ga0075433_10016732 3300006852 Bacteria 6054
318 Ga0075433_10028231 3300006852 Bacteria 4769
319 Ga0075433_10069403 3300006852 Bacteria 3096
320 Ga0075433_10830418 3300006852 Bacteria 807
321 Ga0075434_100000661 3300006871 Bacteria 26715
322 Ga0075434_100001173 3300006871 Bacteria 21711
323 Ga0075434_100015291 3300006871 Bacteria 7354
324 Ga0075434_100018111 3300006871 Bacteria 6796
325 Ga0075434_100280483 3300006871 Bacteria 1686
326 Ga0075429_100000479 3300006880 Bacteria 29848
327 Ga0075429_100010700 3300006880 Bacteria 7936
328 Ga0075429_100067370 3300006880 Bacteria 3115
329 Ga0075429_100126110 3300006880 Bacteria 2238
330 Ga0075429_100228267 3300006880 Bacteria 1631
331 Ga0068865_100000252 3300006881 Bacteria 29599
332 Ga0068865_100057899 3300006881 Bacteria 2705
333 Ga0075436_100058363 3300006914 Bacteria 2665
334 Ga0097620_100002298 3300006931 Bacteria 19408
335 Ga0097620_100019727 3300006931 Bacteria 6770
336 Ga0097620_100284156 3300006931 Bacteria 1747
337 Ga0097620_100394410 3300006931 Bacteria 1480
338 Ga0097620_100620307 3300006931 Bacteria 1174
339 Ga0097620_100757915 3300006931 Bacteria 1059
340 Ga0075435_100029917 3300007076 Bacteria 4278
341 Ga0075435_100048782 3300007076 Bacteria 3403
342 Ga0075435_100093896 3300007076 Bacteria 2479
343 Ga0075435_100154525 3300007076 Bacteria 1930
344 Ga0075435_100747087 3300007076 Bacteria 851
345 Ga0105240_10042779 3300009093 Bacteria 5770
346 Ga0105240_10289082 3300009093 Bacteria 1880
347 Ga0111539_10003320 3300009094 Bacteria 21239
348 Ga0111539_10004062 3300009094 Bacteria 19220
349 Ga0111539_10005715 3300009094 Bacteria 16085
350 Ga0111539_10088435 3300009094 Bacteria 3640
351 Ga0111539_10103969 3300009094 Bacteria 3333
352 Ga0105247_10001439 3300009101 Bacteria 17243
353 Ga0114129_10004085 3300009147 Bacteria 20622
354 Ga0114129_10010935 3300009147 Bacteria 12932
355 Ga0114129_10025348 3300009147 Bacteria 8403
356 Ga0114129_10055021 3300009147 Bacteria 5577
357 Ga0114129_10066913 3300009147 Bacteria 5010
358 Ga0114129_10129972 3300009147 Bacteria 3460
359 Ga0114129_10142943 3300009147 Bacteria 3278
360 Ga0114129_10437738 3300009147 Bacteria 1717
361 Ga0114129_10818454 3300009147 Bacteria 1187
362 Ga0105243_10002371 3300009148 Bacteria 15770
363 Ga0105241_10000770 3300009174 Bacteria 24359
364 Ga0105241_10252539 3300009174 Bacteria 1496
365 Ga0105242_10002422 3300009176 Bacteria 14653
366 Ga0105242_10934804 3300009176 Bacteria 870
367 Ga0105248_10002790 3300009177 Bacteria 19413
368 Ga0105248_10008272 3300009177 Bacteria 11429
369 Ga0105248_10093446 3300009177 Bacteria 3387
370 Ga0105248_10242071 3300009177 Bacteria 2031
371 Ga0105248_10277453 3300009177 Bacteria 1887
372 Ga0105237_10013310 3300009545 Bacteria 8629
373 Ga0105237_10149771 3300009545 Bacteria 2329
374 Ga0105237_10167776 3300009545 Bacteria 2195
375 Ga0105237_10234058 3300009545 Bacteria 1838
376 Ga0105238_10054770 3300009551 Bacteria 4005
377 Ga0105238_10104413 3300009551 Bacteria 2814
378 Ga0105249_10001686 3300009553 Bacteria 19382
379 Ga0105249_10048918 3300009553 Bacteria 3855
380 Ga0105249_10502274 3300009553 Bacteria 1258
381 Ga0099796_10018269 3300010159 Bacteria 2102
382 Ga0105239_10032940 3300010375 Bacteria 5693
383 Ga0105239_10297547 3300010375 Bacteria 1817
384 Ga0105246_10000081 3300011119 Bacteria 40525
385 Ga0105246_10379094 3300011119 Bacteria 1168
386 Ga0157344_1000345 3300012476 Bacteria 1741
387 Ga0157335_1001295 3300012492 Bacteria 1346
388 Ga0157341_1000159 3300012494 Bacteria 3005
389 Ga0157373_10012612 3300013100 Bacteria 6213
390 Ga0157373_10058688 3300013100 Bacteria 2727
391 Ga0157371_10020506 3300013102 Bacteria 4864
392 Ga0157371_10164913 3300013102 Bacteria 1582
393 Ga0157371_10198703 3300013102 Bacteria 1437
394 Ga0157370_10580206 3300013104 Bacteria 1027
395 Ga0157369_10002671 3300013105 Bacteria 21264
396 Ga0157374_10009607 3300013296 Bacteria 8309
397 Ga0157374_10027881 3300013296 Bacteria 5099
398 Ga0157374_10120006 3300013296 Bacteria 2536
399 Ga0157374_10455124 3300013296 Bacteria 1281
400 Ga0157378_10000990 3300013297 Bacteria 26013
401 Ga0157378_10091118 3300013297 Bacteria 2771
402 Ga0157378_10215132 3300013297 Bacteria 1824
403 Ga0157378_10575632 3300013297 Bacteria 1134
404 Ga0157378_10742239 3300013297 Bacteria 1004
405 Ga0157378_10814204 3300013297 Bacteria 960
406 Ga0163162_10005170 3300013306 Bacteria 12583
407 Ga0163162_10217636 3300013306 Bacteria 2040
408 Ga0163162_11619450 3300013306 Bacteria 739
409 Ga0157372_10012072 3300013307 Bacteria 9200
410 Ga0157372_10016190 3300013307 Bacteria 8000
411 Ga0157372_10132940 3300013307 Bacteria 2864
412 Ga0157375_10000944 3300013308 Bacteria 25192
413 Ga0157375_10002393 3300013308 Bacteria 16235
414 Ga0157375_10033432 3300013308 Bacteria 4887
415 Ga0157375_10108398 3300013308 Bacteria 2872
416 Ga0157375_10129377 3300013308 Bacteria 2643
417 Ga0157375_10180892 3300013308 Bacteria 2260
418 Ga0157375_10375468 3300013308 Bacteria 1588
419 Ga0157375_10949582 3300013308 Bacteria 1002
420 Ga0163163_10010654 3300014325 Bacteria 8286
421 Ga0163163_10032566 3300014325 Bacteria 5035
422 Ga0163163_10507948 3300014325 Bacteria 1267
423 Ga0163163_10586986 3300014325 Bacteria 1177
424 Ga0163163_10903823 3300014325 Bacteria 946
425 Ga0157380_10000321 3300014326 Bacteria 28973
426 Ga0157380_10097037 3300014326 Bacteria 2445
427 Ga0157380_10116040 3300014326 Bacteria 2259
428 Ga0182008_10101751 3300014497 Bacteria 1420
429 Ga0157379_10039887 3300014968 Bacteria 4190
430 Ga0157379_10118758 3300014968 Bacteria 2378
431 Ga0157379_10424071 3300014968 Bacteria 1225
432 Ga0157379_10905851 3300014968 Bacteria 837
433 Ga0157376_10000098 3300014969 Bacteria 63149
434 Ga0157376_10047593 3300014969 Bacteria 3541
435 Ga0157376_10098987 3300014969 Bacteria 2543
436 Ga0157376_10329793 3300014969 Bacteria 1454
437 Ga0163161_10000866 3300017792 Bacteria 23560
438 Ga0163161_10006805 3300017792 Bacteria 7904
439 Ga0163161_10025174 3300017792 Bacteria 4210
440 Ga0163161_10045283 3300017792 Bacteria 3172
441 Ga0206354_11042258 3300020081 Bacteria 1068
442 Ga0206353_12052891 3300020082 Bacteria 1136
443 Ga0213876_10155915 3300021384 Bacteria 1215
444 Ga0209129_1000326 3300025258 Bacteria 41836
445 Ga0209233_1023062 3300025261 Bacteria 1583
446 Ga0207666_1000027 3300025271 Bacteria 33321
447 Ga0209673_1051683 3300025273 Bacteria 1083
448 Ga0209564_1000057 3300025295 Bacteria 340400
449 Ga0209758_1000096 3300025297 Bacteria 231496
450 Ga0209758_1000174 3300025297 Bacteria 147347
451 Ga0209050_1016098 3300025298 Bacteria 3084
452 Ga0207697_10000553 3300025315 Bacteria 21216
453 Ga0207697_10043527 3300025315 Bacteria 1846
454 Ga0207697_10054565 3300025315 Bacteria 1656
455 Ga0207656_10129249 3300025321 Bacteria 1182
456 Ga0207653_10002753 3300025885 Bacteria 5592
457 Ga0207653_10093539 3300025885 Bacteria 1055
458 Ga0207682_10000006 3300025893 Bacteria 94953
459 Ga0207682_10000122 3300025893 Bacteria 35790
460 Ga0207682_10015241 3300025893 Bacteria 2992
461 Ga0207682_10113471 3300025893 Bacteria 1195
462 Ga0207642_10000107 3300025899 Bacteria 22438
463 Ga0207642_10008252 3300025899 Bacteria 3562
464 Ga0207710_10000632 3300025900 Bacteria 20218
465 Ga0207688_10000205 3300025901 Bacteria 26409
466 Ga0207680_10028658 3300025903 Bacteria 3118
467 Ga0207680_10076733 3300025903 Bacteria 2087
468 Ga0207680_10085030 3300025903 Bacteria 1997
469 Ga0207680_10108104 3300025903 Bacteria 1799
470 Ga0207647_10067576 3300025904 Bacteria 2166
471 Ga0207647_10117406 3300025904 Bacteria 1570
472 Ga0207647_10133908 3300025904 Bacteria 1455
473 Ga0207699_10019646 3300025906 Bacteria 3608
474 Ga0207645_10000023 3300025907 Bacteria 98724
475 Ga0207645_10000063 3300025907 Bacteria 76658
476 Ga0207645_10091642 3300025907 Bacteria 1955
477 Ga0207645_10131063 3300025907 Bacteria 1632
478 Ga0207643_10000007 3300025908 Bacteria 171706
479 Ga0207643_10006191 3300025908 Bacteria 6404
480 Ga0207643_10122334 3300025908 Bacteria 1542
481 Ga0207643_10156866 3300025908 Bacteria 1367
482 Ga0207705_10104709 3300025909 Bacteria 2085
483 Ga0207684_10020525 3300025910 Bacteria 5645
484 Ga0207684_10285449 3300025910 Bacteria 1423
485 Ga0207684_10290266 3300025910 Bacteria 1410
486 Ga0207684_10373988 3300025910 Bacteria 1226
487 Ga0207654_10001016 3300025911 Bacteria 15352
488 Ga0207707_10000786 3300025912 Bacteria 31086
489 Ga0207707_10026873 3300025912 Bacteria 5030
490 Ga0207707_10062947 3300025912 Bacteria 3229
491 Ga0207707_10130681 3300025912 Bacteria 2196
492 Ga0207707_10245998 3300025912 Bacteria 1554
493 Ga0207707_10376271 3300025912 Bacteria 1221
494 Ga0207695_10021722 3300025913 Bacteria 7315
495 Ga0207695_10070670 3300025913 Bacteria 3567
496 Ga0207671_10058655 3300025914 Bacteria 2854
497 Ga0207671_10194970 3300025914 Bacteria 1580
498 Ga0207671_10751091 3300025914 Unclassified 775
499 Ga0207660_10000058 3300025917 Bacteria 56791
500 Ga0207660_10057376 3300025917 Bacteria 2789
501 Ga0207660_10354010 3300025917 Bacteria 1177
502 Ga0207662_10000896 3300025918 Bacteria 13794
503 Ga0207662_10173270 3300025918 Bacteria 1385
504 Ga0207662_10190196 3300025918 Bacteria 1324
505 Ga0207657_10002630 3300025919 Bacteria 19398
506 Ga0207657_10059084 3300025919 Bacteria 3297
507 Ga0207657_10241770 3300025919 Bacteria 1441
508 Ga0207649_10000384 3300025920 Bacteria 33073
509 Ga0207649_10005635 3300025920 Bacteria 6776
510 Ga0207652_10000377 3300025921 Bacteria 46255
511 Ga0207681_10000100 3300025923 Bacteria 72913
512 Ga0207681_10001984 3300025923 Bacteria 13141
513 Ga0207681_10035031 3300025923 Bacteria 3306
514 Ga0207681_10126883 3300025923 Bacteria 1880
515 Ga0207681_10163502 3300025923 Bacteria 1680
516 Ga0207681_10169593 3300025923 Bacteria 1653
517 Ga0207694_10039684 3300025924 Bacteria 3623
518 Ga0207650_10000274 3300025925 Bacteria 54226
519 Ga0207650_10021279 3300025925 Bacteria 4584
520 Ga0207650_10038763 3300025925 Bacteria 3482
521 Ga0207650_10092631 3300025925 Bacteria 2312
522 Ga0207650_10159659 3300025925 Bacteria 1785
523 Ga0207650_10777379 3300025925 Bacteria 811
524 Ga0207659_10000044 3300025926 Bacteria 88759
525 Ga0207659_10001802 3300025926 Bacteria 12671
526 Ga0207659_10004273 3300025926 Bacteria 8637
527 Ga0207659_10203019 3300025926 Bacteria 1584
528 Ga0207687_10001241 3300025927 Bacteria 17449
529 Ga0207700_10126910 3300025928 Bacteria 2077
530 Ga0207664_10011801 3300025929 Bacteria 6228
531 Ga0207644_10000690 3300025931 Bacteria 21367
532 Ga0207644_10004596 3300025931 Bacteria 8977
533 Ga0207644_10014495 3300025931 Bacteria 5272
534 Ga0207644_10180703 3300025931 Bacteria 1653
535 Ga0207644_10756420 3300025931 Bacteria 812
536 Ga0207690_10000601 3300025932 Bacteria 23359
537 Ga0207690_10252935 3300025932 Bacteria 1362
538 Ga0207706_10001769 3300025933 Bacteria 21216
539 Ga0207706_10184470 3300025933 Bacteria 1832
540 Ga0207706_10210632 3300025933 Bacteria 1704
541 Ga0207706_10278191 3300025933 Bacteria 1460
542 Ga0207686_10000222 3300025934 Bacteria 43531
543 Ga0207709_10000154 3300025935 Bacteria 93456
544 Ga0207670_10000129 3300025936 Bacteria 49928
545 Ga0207670_10159585 3300025936 Bacteria 1682
546 Ga0207669_10000160 3300025937 Bacteria 32152
547 Ga0207669_10052574 3300025937 Bacteria 2448
548 Ga0207669_10132916 3300025937 Bacteria 1713
549 Ga0207669_10161723 3300025937 Bacteria 1582
550 Ga0207669_10191086 3300025937 Bacteria 1477
551 Ga0207704_10128918 3300025938 Bacteria 1747
552 Ga0207704_10497974 3300025938 Bacteria 981
553 Ga0207691_10000050 3300025940 Bacteria 94763
554 Ga0207691_10000405 3300025940 Bacteria 43134
555 Ga0207691_10000494 3300025940 Bacteria 39257
556 Ga0207691_10003496 3300025940 Bacteria 15284
557 Ga0207691_10023336 3300025940 Bacteria 5823
558 Ga0207691_10024298 3300025940 Bacteria 5699
559 Ga0207691_10096509 3300025940 Bacteria 2643
560 Ga0207711_10006895 3300025941 Bacteria 9539
561 Ga0207711_10038504 3300025941 Bacteria 4067
562 Ga0207711_10056663 3300025941 Bacteria 3368
563 Ga0207711_10274935 3300025941 Bacteria 1550
564 Ga0207711_10322428 3300025941 Bacteria 1428
565 Ga0207689_10000098 3300025942 Bacteria 69773
566 Ga0207689_10004462 3300025942 Bacteria 12690
567 Ga0207689_10146973 3300025942 Bacteria 1942
568 Ga0207689_10513950 3300025942 Bacteria 1004
569 Ga0207661_10000178 3300025944 Bacteria 41008
570 Ga0207661_10000576 3300025944 Bacteria 23427
571 Ga0207661_10079917 3300025944 Bacteria 2696
572 Ga0207661_10154952 3300025944 Bacteria 1983
573 Ga0207661_10484716 3300025944 Bacteria 1129
574 Ga0207679_10000029 3300025945 Bacteria 183002
575 Ga0207679_10002734 3300025945 Bacteria 10908
576 Ga0207679_10117306 3300025945 Bacteria 2112
577 Ga0207679_10141454 3300025945 Bacteria 1945
578 Ga0207667_10003212 3300025949 Bacteria 20183
579 Ga0207667_10049074 3300025949 Bacteria 4461
580 Ga0207667_10108943 3300025949 Bacteria 2857
581 Ga0207667_10440914 3300025949 Bacteria 1324
582 Ga0207651_10000031 3300025960 Bacteria 66688
583 Ga0207651_10001168 3300025960 Bacteria 11757
584 Ga0207651_10001963 3300025960 Bacteria 9673
585 Ga0207651_10007821 3300025960 Bacteria 5722
586 Ga0207712_10000129 3300025961 Bacteria 79246
587 Ga0207712_10031710 3300025961 Bacteria 3562
588 Ga0207712_10098538 3300025961 Bacteria 2168
589 Ga0207712_10110049 3300025961 Unclassified 2065
590 Ga0207668_10000158 3300025972 Bacteria 47189
591 Ga0207668_10011562 3300025972 Bacteria 5369
592 Ga0207668_10077299 3300025972 Bacteria 2399
593 Ga0207668_10085635 3300025972 Bacteria 2300
594 Ga0207668_10151481 3300025972 Bacteria 1796
595 Ga0207668_10657839 3300025972 Bacteria 917
596 Ga0207640_10000168 3300025981 Bacteria 47588
597 Ga0207640_10005748 3300025981 Bacteria 6758
598 Ga0207640_10182772 3300025981 Bacteria 1574
599 Ga0207640_10348715 3300025981 Bacteria 1189
600 Ga0207640_10445096 3300025981 Bacteria 1066
601 Ga0207658_10000655 3300025986 Bacteria 30194
602 Ga0207658_10009288 3300025986 Bacteria 6669
603 Ga0207658_10072411 3300025986 Bacteria 2612
604 Ga0207658_10105408 3300025986 Bacteria 2217
605 Ga0207658_10225789 3300025986 Bacteria 1578
606 Ga0207677_10000553 3300026023 Bacteria 23608
607 Ga0207677_10004591 3300026023 Bacteria 7428
608 Ga0207677_10333989 3300026023 Bacteria 1264
609 Ga0207677_10361291 3300026023 Bacteria 1220
610 Ga0207677_10602786 3300026023 Bacteria 964
611 Ga0207703_10000631 3300026035 Bacteria 35469
612 Ga0207703_10383940 3300026035 Bacteria 1300
613 Ga0207639_10001591 3300026041 Bacteria 15257
614 Ga0207639_10051592 3300026041 Bacteria 3129
615 Ga0207639_10055034 3300026041 Bacteria 3043
616 Ga0207639_10271729 3300026041 Bacteria 1487
617 Ga0207678_10001139 3300026067 Bacteria 24368
618 Ga0207678_10004837 3300026067 Bacteria 12095
619 Ga0207678_10470148 3300026067 Bacteria 1094
620 Ga0207708_10000660 3300026075 Bacteria 26442
621 Ga0207708_10031895 3300026075 Bacteria 4001
622 Ga0207708_10197342 3300026075 Bacteria 1604
623 Ga0207708_10285256 3300026075 Bacteria 1339
624 Ga0207702_10000404 3300026078 Bacteria 49177
625 Ga0207702_10014696 3300026078 Bacteria 6495
626 Ga0207702_10147535 3300026078 Bacteria 2136
627 Ga0207641_10000520 3300026088 Bacteria 43187
628 Ga0207641_10008171 3300026088 Bacteria 8660
629 Ga0207641_10010886 3300026088 Bacteria 7452
630 Ga0207641_10145849 3300026088 Bacteria 2140
631 Ga0207641_10294196 3300026088 Bacteria 1531
632 Ga0207648_10000072 3300026089 Bacteria 94957
633 Ga0207648_10047268 3300026089 Bacteria 3773
634 Ga0207648_10055433 3300026089 Bacteria 3460
635 Ga0207648_10096683 3300026089 Bacteria 2584
636 Ga0207648_10125504 3300026089 Bacteria 2258
637 Ga0207648_10179166 3300026089 Bacteria 1875
638 Ga0207676_10000180 3300026095 Bacteria 55634
639 Ga0207676_10043371 3300026095 Bacteria 3463
640 Ga0207676_10100932 3300026095 Bacteria 2392
641 Ga0207676_10268801 3300026095 Bacteria 1543
642 Ga0207676_10269596 3300026095 Bacteria 1541
643 Ga0207676_10552250 3300026095 Bacteria 1100
644 Ga0207676_10770313 3300026095 Unclassified 937
645 Ga0207674_10000049 3300026116 Bacteria 118784
646 Ga0207674_10003433 3300026116 Bacteria 19398
647 Ga0207674_10074109 3300026116 Bacteria 3417
648 Ga0207674_10113871 3300026116 Bacteria 2677
649 Ga0207674_10123631 3300026116 Bacteria 2553
650 Ga0207675_100021979 3300026118 Bacteria 5939
651 Ga0207675_100033128 3300026118 Bacteria 4814
652 Ga0207675_100052678 3300026118 Bacteria 3797
653 Ga0207675_100058840 3300026118 Bacteria 3586
654 Ga0207675_100124676 3300026118 Bacteria 2439
655 Ga0207675_100211395 3300026118 Bacteria 1866
656 Ga0207683_10000029 3300026121 Bacteria 109665
657 Ga0207683_10000521 3300026121 Bacteria 35599
658 Ga0207683_10005585 3300026121 Bacteria 10781
659 Ga0207683_10018977 3300026121 Bacteria 5868
660 Ga0207683_10055869 3300026121 Bacteria 3462
661 Ga0207683_10215857 3300026121 Bacteria 1747
662 Ga0207683_10537019 3300026121 Bacteria 1081
663 Ga0207698_10000682 3300026142 Bacteria 19692
664 Ga0207698_10002475 3300026142 Bacteria 10953
665 Ga0207698_10076422 3300026142 Bacteria 2680
666 Ga0210002_1000485 3300027617 Bacteria 5400
667 Ga0209588_1077418 3300027671 Bacteria 1075
668 Ga0209966_1008488 3300027695 Bacteria 1825
669 Ga0209966_1037871 3300027695 Bacteria 997
670 Ga0209998_10002969 3300027717 Bacteria 3784
671 Ga0209813_10001943 3300027866 Bacteria 4673
672 Ga0209813_10020110 3300027866 Bacteria 1864
673 Ga0209974_10030398 3300027876 Bacteria 1790
674 Ga0209974_10046169 3300027876 Bacteria 1456
675 Ga0207428_10000100 3300027907 Bacteria 119495
676 Ga0207428_10000124 3300027907 Bacteria 105795
677 Ga0207428_10000968 3300027907 Bacteria 31823
678 Ga0207428_10021134 3300027907 Bacteria 5513
679 Ga0268266_10008615 3300028379 Bacteria 9058
680 Ga0268266_10057152 3300028379 Bacteria 3357
681 Ga0268266_10181249 3300028379 Bacteria 1918
682 Ga0268266_10255085 3300028379 Bacteria 1623
683 Ga0268265_10000698 3300028380 Bacteria 32950
684 Ga0268265_10005564 3300028380 Bacteria 8599
685 Ga0268265_10333498 3300028380 Bacteria 1378
686 Ga0268264_10001558 3300028381 Bacteria 21254
687 Ga0268264_10046391 3300028381 Bacteria 3609
688 Ga0268264_10183495 3300028381 Bacteria 1902
689 Ga0268264_10285489 3300028381 Bacteria 1548
690 Ga0268264_10547190 3300028381 Bacteria 1135
691 Ga0265318_10006235 3300028577 Bacteria 5512
692 Ga0307517_10000644 3300028786 Bacteria 59773
693 Ga0307517_10137131 3300028786 Bacteria 1735
694 Ga0307515_10006527 3300028794 Bacteria 23330
695 Ga0307515_10176947 3300028794 Bacteria 2100
696 Ga0307515_10492371 3300028794 Bacteria 837
697 Ga0307512_10112651 3300030522 Bacteria 1784
698 Ga0265332_10063392 3300031238 Bacteria 1579
699 Ga0265328_10006421 3300031239 Unclassified 4984
700 Ga0265320_10023698 3300031240 Bacteria 3261
701 Ga0265325_10006840 3300031241 Bacteria 6892
702 Ga0265325_10073737 3300031241 Bacteria 1708
703 Ga0265329_10031811 3300031242 Bacteria 1712
704 Ga0265340_10040813 3300031247 Bacteria 2284
705 Ga0265340_10205686 3300031247 Bacteria 884
706 Ga0265339_10031699 3300031249 Bacteria 2986
707 Ga0265339_10064302 3300031249 Bacteria 1969
708 Ga0265331_10005867 3300031250 Bacteria 7351
709 Ga0265316_10082981 3300031344 Unclassified 2455
710 Ga0265316_10381201 3300031344 Bacteria 1017
711 Ga0307513_10171324 3300031456 Bacteria 2048
712 Ga0307509_10000041 3300031507 Bacteria 182302
713 Ga0307509_10003100 3300031507 Bacteria 25816
714 Ga0307509_10009112 3300031507 Bacteria 12477
715 Ga0265313_10026426 3300031595 Bacteria 3057
716 Ga0307508_10211428 3300031616 Bacteria 1540
717 Ga0307508_10316998 3300031616 Bacteria 1151
718 Ga0307514_10066812 3300031649 Bacteria 2717
719 Ga0307514_10195461 3300031649 Bacteria 1281
720 Ga0265314_10000992 3300031711 Bacteria 33381
721 Ga0265314_10150180 3300031711 Bacteria 1430
722 Ga0265342_10016326 3300031712 Bacteria 4858
723 Ga0265342_10023182 3300031712 Unclassified 3933
724 Ga0307516_10032420 3300031730 Bacteria 5262
725 Ga0307411_10464830 3300032005 Bacteria 1062
726 Ga0307507_10045329 3300033179 Bacteria 4328
727 Ga0307507_10205846 3300033179 Bacteria 1352
728 Ga0307510_10002283 3300033180 Bacteria 21628
729 Ga0307510_10009870 3300033180 Bacteria 11360
730 Ga0307510_10067350 3300033180 Bacteria 3605
731 Ga0307510_10100119 3300033180 Bacteria 2693
732 Ga0307510_10286362 3300033180 Bacteria 1115
733 Ga0373950_0001825 3300034818 Bacteria 2848
734 Ga0373950_0049201 3300034818 Bacteria 825
735 Ga0373938_0000494 3300034957 Bacteria 6354
736 Ga0373926_0186908 3300035083 Bacteria 795
737 Ga0373928_0009097 3300035084 Bacteria 1938
738 Ga0373929_0001228 3300035085 Bacteria 4958
739 Ga0373934_0010526 3300035086 Bacteria 3472
740 Ga0373940_0035624 3300035088 Bacteria 1348
741 Ga0373940_0081037 3300035088 Bacteria 959
742 Ga0373944_0013956 3300035089 Bacteria 2237
743 Ga0373949_0001228 3300035090 Bacteria 7565
744 Ga0373952_0001688 3300035092 Bacteria 4017
745 Ga0373923_0148735 3300035111 Bacteria 1062
746 Ga0373923_0248304 3300035111 Bacteria 832
747 Ga0373923_0267302 3300035111 Bacteria 804
748 Ga0373936_0068289 3300035113 Bacteria 1461
749 Ga0373939_0012040 3300035114 Bacteria 2197
750 Ga0373941_0015879 3300035115 Bacteria 2037
751 Ga0373953_0043817 3300035117 Bacteria 1787
752 Ga0373953_0109480 3300035117 Bacteria 1167
753 Ga0373954_0006658 3300035118 Bacteria 5042
754 Ga0373954_0029740 3300035118 Bacteria 2517
755 Ga0373954_0045779 3300035118 Bacteria 2044
756 Ga0373954_0281960 3300035118 Unclassified 819
757 Ga0373956_0004764 3300035119 Bacteria 5428
758 Ga0373956_0031015 3300035119 Bacteria 2339
759 Ga0373957_0031414 3300035120 Bacteria 1951
760 Ga0373946_0111546 3300035171 Unclassified 1238
761 Ga0373946_0252714 3300035171 Bacteria 860
762 Ga0373946_0255206 3300035171 Bacteria 856
763 Ga0373955_0022227 3300035172 Bacteria 3214
764 Ga0373942_0001685 3300035207 Bacteria 5598
765 Ga0373961_0014842 3300035241 Bacteria 1983
766 Ga0373962_0000138 3300035242 Bacteria 14991
767 Ga0373924_0101628 3300035410 Bacteria 1237
768 Ga0373931_0000239 3300035691 Bacteria 23413
769 Ga0373935_0039383 3300035692 Bacteria 2964
770 Ga0373935_0074833 3300035692 Bacteria 2190
771 Ga0373935_0134875 3300035692 Unclassified 1662
772 Ga0373927_0022826 3300035695 Unclassified 4099
773 Ga0373933_0114087 3300035724 Bacteria 1687
774 Ga0373933_0132460 3300035724 Bacteria 1568
775 Ga0373947_0345374 3300035725 Bacteria 998
776 Ga0373947_0391886 3300035725 Bacteria 936
777 Ga0373947_0570793 3300035725 Unclassified 770
778 Ga0373937_0051941 3300036401 Bacteria 3757
779 Ga0373937_0193468 3300036401 Bacteria 1911
780 Ga0373937_0226181 3300036401 Bacteria 1761
781 Ga0373937_0545123 3300036401 Bacteria 1102
782 Ga0373937_0687364 3300036401 Bacteria 969
783 Ga0373925_0030541 3300037068 Bacteria 3955
784 Ga0373925_0077575 3300037068 Bacteria 2522
785 Ga0373925_0095744 3300037068 Bacteria 2275
786 Ga0373925_0390326 3300037068 Unclassified 1134
787 Ga0395900_0003717 3300037418 Bacteria 16401
788 Ga0395898_0671469 3300037466 Bacteria 978
789 Ga0395905_0016990 3300037471 Bacteria 6909
790 Ga0395905_0058630 3300037471 Bacteria 3600
791 Ga0395905_0453243 3300037471 Bacteria 1181
792 Ga0395905_0827193 3300037471 Bacteria 829
793 Ga0436364_0517049 3300037853 Bacteria 1399
794 Ga0395901_0011964 3300038443 Bacteria 8799
795 Ga0436365_0019248 3300039437 Bacteria 1028
796 Ga0451802_2066676 3300041460 Bacteria 1399
797 Ga0439450_039217 3300042008 Bacteria 1094
798 Ga0439464_0069682 3300042439 Bacteria 1039
799 Ga0439460_0021573 3300042461 Bacteria 1761
800 Ga0453683_0002857 3300044673 Bacteria 13086
801 Ga0466967_0064520 3300045976 Bacteria 3257
802 Ga0495592_0001970 3300046454 Bacteria 14493
803 Ga0495592_0051483 3300046454 Bacteria 3058
804 Ga0495592_0057634 3300046454 Bacteria 2867
805 Ga0495592_0090135 3300046454 Bacteria 2200
806 Ga0495592_0128175 3300046454 Bacteria 1777
807 Ga0495590_0001111 3300046457 Bacteria 11827
808 Ga0495629_0151062 3300046459 Bacteria 1614
809 Ga0495629_0153427 3300046459 Bacteria 1601
810 Ga0495638_0116305 3300046460 Bacteria 1584
811 Ga0495641_0139804 3300046461 Bacteria 1081
812 Ga0495651_0046327 3300046462 Bacteria 3365
813 Ga0495651_0531080 3300046462 Bacteria 750
814 Ga0495653_0264103 3300046463 Bacteria 1136
815 Ga0495580_0000683 3300046472 Bacteria 28898
816 Ga0495580_0128872 3300046472 Bacteria 1755
817 Ga0495582_0104641 3300046473 Unclassified 1587
818 Ga0495605_0230228 3300046474 Bacteria 798
819 Ga0495639_0025312 3300046475 Bacteria 2616
820 Ga0495662_0025409 3300046476 Bacteria 2860
821 Ga0495664_0026882 3300046477 Bacteria 3353
822 Ga0495585_0282240 3300046492 Bacteria 821
823 Ga0495608_0024660 3300046511 Bacteria 4109
824 Ga0495608_0071301 3300046511 Bacteria 2267
825 Ga0495610_0037726 3300046512 Bacteria 2457
826 Ga0495618_0398466 3300046514 Unclassified 842
827 Ga0495628_0015428 3300046516 Bacteria 6378
828 Ga0495628_0018439 3300046516 Bacteria 5780
829 Ga0495628_0194020 3300046516 Bacteria 1533
830 Ga0495628_0312523 3300046516 Bacteria 1161
831 Ga0495628_0433060 3300046516 Unclassified 957
832 Ga0495630_0078045 3300046517 Bacteria 2497
833 Ga0495630_0094796 3300046517 Unclassified 2256
834 Ga0495630_0206881 3300046517 Unclassified 1498
835 Ga0495630_0283597 3300046517 Bacteria 1265
836 Ga0495632_0147584 3300046519 Bacteria 1088
837 Ga0495666_0189118 3300046526 Bacteria 949
838 Ga0495652_0018867 3300046529 Bacteria 6147
839 Ga0495652_0152169 3300046529 Bacteria 1806
840 Ga0495652_0191425 3300046529 Bacteria 1560
841 Ga0495640_0024230 3300046533 Bacteria 4415
842 Ga0495640_0060233 3300046533 Unclassified 2582
843 Ga0495586_0051513 3300046535 Bacteria 2228
844 Ga0495586_0250907 3300046535 Bacteria 1009
845 Ga0495587_0031018 3300046536 Bacteria 3239
846 Ga0495645_0025284 3300046543 Bacteria 4309
847 Ga0495622_0108936 3300046557 Bacteria 1268
848 Ga0495622_0271821 3300046557 Bacteria 742
849 Ga0495667_0036451 3300046559 Bacteria 3283
850 Ga0495667_0047951 3300046559 Bacteria 2821
851 Ga0495667_0050414 3300046559 Bacteria 2748
852 Ga0495634_0257114 3300046642 Bacteria 1066
853 Ga0495635_0050965 3300046663 Bacteria 2853
854 Ga0495635_0064172 3300046663 Bacteria 2522
855 Ga0495659_0020476 3300046664 Bacteria 2222
856 Ga0495657_0077848 3300046675 Bacteria 2150
857 Ga0495599_0037398 3300046678 Bacteria 3049
858 Ga0495646_0100828 3300046680 Bacteria 1656
859 Ga0495647_0023746 3300046681 Bacteria 2226
860 Ga0495658_0128525 3300046683 Bacteria 1540
861 Ga0495658_0135058 3300046683 Bacteria 1505
862 Ga0495669_0110227 3300046684 Bacteria 1285
863 Ga0495613_0066450 3300046689 Bacteria 2633
864 Ga0495624_0037607 3300046690 Bacteria 3112
865 Ga0495624_0429525 3300046690 Bacteria 792
866 Ga0495600_0220919 3300046809 Bacteria 1212
867 Ga0495660_0264306 3300046810 Bacteria 793
868 Ga0495674_0082122 3300047319 Bacteria 2763
869 Ga0495676_0078685 3300047321 Bacteria 2509
870 Ga0495680_0036557 3300047322 Bacteria 3941
871 Ga0495675_0124627 3300047444 Bacteria 1603
872 Ga0495675_0139732 3300047444 Bacteria 1502
873 Ga0495686_0221088 3300047472 Bacteria 1077
874 Ga0495593_0061448 3300047673 Bacteria 1965
875 Ga0495614_0266961 3300048089 Bacteria 786
876 Ga0496100_0002349 3300048903 Bacteria 9573
877 Ga0496101_0000187 3300048904 Bacteria 48785
878 Ga0496101_0014419 3300048904 Bacteria 5312
879 Ga0496102_0002906 3300048905 Bacteria 14522
880 Ga0496103_0000157 3300048906 Bacteria 71452
881 Ga0496104_0383570 3300048907 Bacteria 1318
882 Ga0496105_0250174 3300048908 Bacteria 1436
883 Ga0496106_0006890 3300048909 Bacteria 8407
884 Ga0496107_0000805 3300048910 Bacteria 18202
885 Ga0496108_0234055 3300048911 Bacteria 1597
886 Ga0496108_0805076 3300048911 Bacteria 811
887 Ga0496109_0000313 3300048912 Bacteria 45501
888 Ga0496109_0001125 3300048912 Bacteria 22254
889 Ga0496110_0096825 3300048913 Bacteria 2644
890 Ga0496111_0076468 3300048914 Bacteria 2440
891 Ga0496111_0083795 3300048914 Bacteria 2330
892 Ga0496112_0086476 3300048915 Bacteria 3102
893 Ga0496112_0105664 3300048915 Bacteria 2785
894 Ga0496112_0692166 3300048915 Bacteria 948
895 Ga0496113_0012990 3300048916 Bacteria 5619
896 Ga0496113_0018069 3300048916 Bacteria 4906
897 Ga0496113_0297226 3300048916 Bacteria 1293
898 Ga0496114_0005751 3300048917 Bacteria 9733
899 Ga0496114_0022185 3300048917 Bacteria 5172
900 Ga0496115_0001217 3300048918 Bacteria 18461
901 Ga0496118_0151636 3300048921 Bacteria 1450
902 Ga0496121_0003906 3300048924 Bacteria 20685
903 Ga0496123_0180276 3300048926 Bacteria 1104
904 Ga0496125_0000063 3300048928 Bacteria 250260
905 Ga0496125_0003433 3300048928 Bacteria 19212
906 Ga0496126_0051862 3300048929 Bacteria 3732
907 Ga0501031_0299947 3300049568 Bacteria 1041
908 Ga0501031_0415882 3300049568 Bacteria 869
909 Ga0501034_0010927 3300049571 Bacteria 9434
910 Ga0501038_0017675 3300049574 Bacteria 6446
911 Ga0501039_0084802 3300049575 Bacteria 2468
912 Ga0501040_0012090 3300049576 Bacteria 5652
913 Ga0501040_0012492 3300049576 Bacteria 5565
914 Ga0501041_0043939 3300049577 Bacteria 2716
915 Ga0501041_0073839 3300049577 Bacteria 2096
916 Ga0501042_0003421 3300049578 Bacteria 9968
917 Ga0501046_0350547 3300049580 Bacteria 1072
918 Ga0501048_0342264 3300049582 Bacteria 1066
919 Ga0501067_0089123 3300049583 Bacteria 1712
920 Ga0501068_0368546 3300049584 Bacteria 924
921 Ga0501068_0375390 3300049584 Bacteria 915
922 Ga0501069_0051380 3300049585 Bacteria 2294
923 Ga0501070_0192200 3300049586 Bacteria 1677
924 Ga0501071_0149658 3300049587 Bacteria 1741
925 Ga0501072_0007289 3300049588 Bacteria 8386
926 Ga0501072_0455892 3300049588 Bacteria 1012
927 Ga0501072_0617641 3300049588 Bacteria 854
928 Ga0501074_0158448 3300049590 Bacteria 1616
929 Ga0501074_0415371 3300049590 Bacteria 954
930 Ga0501075_0002401 3300049591 Bacteria 12446
931 Ga0501075_0059850 3300049591 Bacteria 2870
932 Ga0501075_0177917 3300049591 Bacteria 1623
933 Ga0501075_0384908 3300049591 Bacteria 1069
934 Ga0501076_0001488 3300049592 Bacteria 15703
935 Ga0501077_0074645 3300049593 Unclassified 2148
936 Ga0501077_0150832 3300049593 Bacteria 1475
937 Ga0501079_0006001 3300049741 Bacteria 9098
938 Ga0501079_0516427 3300049741 Bacteria 939
939 Ga0501080_0007934 3300049742 Bacteria 9615
940 Ga0501080_0337147 3300049742 Bacteria 1363
941 Ga0501080_0492636 3300049742 Bacteria 1096
942 Ga0501081_0377416 3300049743 Bacteria 1047
943 Ga0501083_0019458 3300049744 Bacteria 4730
944 nmdc:mga00v17_300694_c1 3300050491 Bacteria 1042
945 nmdc:mga00v17_58681_c1 3300050491 Bacteria 2359
946 nmdc:mga0yw44_48593_c1 3300050492 Bacteria 2558
947 nmdc:mga06z11_3482_c1 3300050494 Bacteria 6096
948 nmdc:mga06z11_4358_c1 3300050494 Bacteria 5566
949 nmdc:mga06z11_76410_c1 3300050494 Bacteria 1786
950 nmdc:mga04h51_18807_c1 3300050495 Bacteria 2040
951 nmdc:mga07m45_13302_c1 3300050496 Bacteria 4364
952 nmdc:mga07m45_139695_c1 3300050496 Bacteria 1403
953 nmdc:mga07m45_24947_c1 3300050496 Bacteria 3277
954 nmdc:mga05p37_10207_c1 3300050507 Bacteria 11151
955 nmdc:mga05p37_104271_c1 3300050507 Bacteria 2339
956 nmdc:mga05p37_13916_c1 3300050507 Bacteria 9642
957 nmdc:mga05p37_15856_c1 3300050507 Bacteria 9064
958 nmdc:mga05p37_164938_c1 3300050507 Bacteria 2704
959 nmdc:mga05p37_385834_c1 3300050507 Bacteria 1640
960 nmdc:mga05p37_39063_c1 3300050507 Bacteria 5824
961 nmdc:mga05p37_45_c1 3300050507 Bacteria 81140
962 nmdc:mga05p37_630292_c1 3300050507 Bacteria 1205
963 nmdc:mga05p37_85076_c1 3300050507 Bacteria 3897
964 nmdc:mga09592_169100_c1 3300050508 Bacteria 1890
965 nmdc:mga09592_182663_c1 3300050508 Bacteria 1815
966 nmdc:mga09592_47067_c1 3300050508 Bacteria 3634
967 nmdc:mga09592_5654_c1 3300050508 Bacteria 10199
968 nmdc:mga09592_58667_c1 3300050508 Bacteria 3255
969 nmdc:mga09592_7756_c1 3300050508 Bacteria 8725
970 nmdc:mga09592_81575_c1 3300050508 Bacteria 2756
971 nmdc:mga0qj67_1430_c1 3300050509 Bacteria 16714
972 nmdc:mga0qj67_160268_c1 3300050509 Bacteria 1826
973 nmdc:mga0qj67_348346_c1 3300050509 Unclassified 1198
974 nmdc:mga0qj67_58551_c1 3300050509 Bacteria 3054
975 nmdc:mga0qj67_67253_c1 3300050509 Bacteria 2855
976 nmdc:mga06r32_162043_c1 3300050510 Bacteria 2219
977 nmdc:mga06r32_203418_c1 3300050510 Bacteria 1968
978 nmdc:mga06r32_211300_c1 3300050510 Bacteria 1928
979 nmdc:mga06r32_35577_c1 3300050510 Bacteria 4699
980 nmdc:mga06r32_407_c1 3300050510 Bacteria 36327
981 nmdc:mga06r32_77499_c1 3300050510 Bacteria 3229
982 nmdc:mga08y16_2193_c1 3300050511 Bacteria 20044
983 nmdc:mga08y16_792_c1 3300050511 Bacteria 30185
984 nmdc:mga08y16_91943_c1 3300050511 Bacteria 3162
985 nmdc:mga0n895_1011_c1 3300050512 Bacteria 20432
986 nmdc:mga0n895_10668_c1 3300050512 Bacteria 8137
987 nmdc:mga0n895_15085_c1 3300050512 Bacteria 7042
988 nmdc:mga0n895_254415_c1 3300050512 Bacteria 1782
989 nmdc:mga0n895_8875_c1 3300050512 Bacteria 8753
990 nmdc:mga0rr50_104975_c1 3300050513 Bacteria 2227
991 nmdc:mga0rr50_107066_c1 3300050513 Bacteria 2207
992 nmdc:mga0rr50_135279_c1 3300050513 Bacteria 1978
993 nmdc:mga0rr50_142289_c1 3300050513 Bacteria 1931
994 nmdc:mga0rr50_235104_c1 3300050513 Bacteria 1517
995 nmdc:mga0rr50_43068_c1 3300050513 Bacteria 3301
996 nmdc:mga0rr50_918_c1 3300050513 Bacteria 15942
997 nmdc:mga08x19_170263_c1 3300050514 Bacteria 1483
998 nmdc:mga08x19_29952_c1 3300050514 Bacteria 3417
999 nmdc:mga08x19_63051_c1 3300050514 Bacteria 2404
1000 nmdc:mga0a205_1027039_c1 3300050515 Bacteria 671
1001 nmdc:mga0a205_22216_c1 3300050515 Bacteria 6007
1002 nmdc:mga0a205_242974_c1 3300050515 Unclassified 1681
1003 nmdc:mga0a205_6158_c1 3300050515 Bacteria 10825
1004 nmdc:mga0a205_6355_c1 3300050515 Bacteria 7369
1005 Ga0495601_0001636 3300053077 Bacteria 12353
1006 Ga0495601_0056964 3300053077 Bacteria 2475
1007 Ga0495601_0139901 3300053077 Bacteria 1578
1008 Ga0495595_0008204 3300053084 Bacteria 4287
1009 Ga0495595_0135150 3300053084 Bacteria 1207
1010 Ga0495619_0041195 3300053085 Bacteria 3020
1011 Ga0495619_0191701 3300053085 Unclassified 1415
1012 Ga0500578_0000236 3300053086 Bacteria 68048
1013 Ga0500578_0400015 3300053086 Bacteria 792
1014 Ga0500644_0003109 3300053088 Bacteria 4109
1015 Ga0500651_0023119 3300053093 Bacteria 3890
1016 Ga0500651_0102264 3300053093 Bacteria 1756
1017 Ga0500566_0158488 3300053094 Bacteria 1182
1018 Ga0500594_0017698 3300053118 Bacteria 1747
1019 Ga0500595_002989 3300053119 Bacteria 8040
1020 Ga0500595_010080 3300053119 Bacteria 3773
1021 Ga0500614_013998 3300053123 Bacteria 1770
1022 Ga0500652_000014 3300053131 Bacteria 147740
1023 Ga0500559_0000012 3300053136 Bacteria 164222
1024 Ga0500564_179043 3300053138 Bacteria 885
1025 Ga0500568_0057635 3300053139 Bacteria 1511
1026 Ga0500604_0014218 3300053151 Bacteria 2165
1027 Ga0500604_0014386 3300053151 Bacteria 2154
1028 Ga0500619_050551 3300053154 Bacteria 1344
1029 Ga0500622_0024833 3300053156 Bacteria 3169
1030 Ga0500627_0019136 3300053158 Bacteria 2723
1031 Ga0500636_0030839 3300053177 Bacteria 3173
1032 Ga0500645_025399 3300053730 Bacteria 1808
1033 Ga0500552_000373 3300053733 Bacteria 4171
1034 Ga0500587_022219 3300053739 Bacteria 833
1035 Ga0501084_0039843 3300054114 Bacteria 3929
1036 Ga0501084_0057776 3300054114 Bacteria 3246
1037 Ga0501082_0000007 3300060353 Bacteria 126506
1038 Ga0501082_0009692 3300060353 Bacteria 8293
1039 Ga0501082_0105127 3300060353 Bacteria 2443
1040 Ga0501082_0834466 3300060353 Bacteria 806
1041 Ga0530510_0000125 3300061734 Bacteria 44341
1042 Ga0530510_0070238 3300061734 Bacteria 2542
1043 2587734308 2585428058 Bacteria 6853932
1044 2588295242 2588253510 Bacteria 6901809
1045 2643755448 2643221547 Bacteria 4740017
1046 2644304114 2643221654 Bacteria 5273570
1047 Ga0451577_0718923
1048 2214828542
1049 ARcpr5oldR_c000138
1050 ARSoilYngRDRAFT_c00004
1051 ARcpr5yngRDRAFT_c000060
1052 ARSoilOldRDRAFT_c000133
1053 ARCol0oldRDRAFT_c00433
1054 ARCol0yngRDRAFT_1000084
1055 JGI24741J21665_1015598
1056 JGI24747J21853_1013193
1057 JGI24737J22298_10000934
1058 JGI24743J22301_10007855
1059 JGI24735J21928_10028325
1060 JGI24750J21931_1000032
1061 JGI24748J21848_1000782
1062 JGI24738J21930_10001211
1063 JGI24749J21850_1003266
1064 JGI24035J26624_1000066
1065 JGI24033J26618_1000292
1066 JGI24034J26672_10000075
1067 JGI24742J22300_10000054
1068 JGI24751J29686_10010139
1069 JGI25152J39213_1005374
1070 rootH1_10002881
1071 Ga0055526_1015322
1072 Ga0058859_11552955
1073 Ga0058860_10052366
1074 Ga0065717_1002020
1075 Ga0065714_10180179
1076 Ga0065704_10072529
1077 Ga0065715_10089082
1078 Ga0065707_10127028
1079 Ga0065707_10255063
1080 Ga0070676_10000062
1081 Ga0070683_100000259
1082 Ga0070683_100069961
1083 Ga0070683_100112039
1084 Ga0070690_100001045
1085 Ga0070690_100040233
1086 Ga0070690_100175608
1087 Ga0070690_100361168
1088 Ga0070690_100375896
1089 Ga0070670_100007548
1090 Ga0070670_100008320
1091 Ga0070670_100019991
1092 Ga0070670_100054773
1093 Ga0070670_100061705
1094 Ga0070670_100102832
1095 Ga0070677_10000077
1096 Ga0070677_10000368
1097 Ga0070677_10073698
1098 Ga0068869_100000095
1099 Ga0068869_100006240
1100 Ga0068869_100159051
1101 Ga0070666_10003027
1102 Ga0070666_10032791
1103 Ga0070666_10382206
1104 Ga0070680_100001342
1105 Ga0070680_100023963
1106 Ga0070680_100102792
1107 Ga0070680_100250387
1108 Ga0070682_100000511
1109 Ga0068868_100000824
1110 Ga0068868_100009255
1111 Ga0068868_100045718
1112 Ga0068868_100376189
1113 Ga0070660_100000871
1114 Ga0070660_100057056
1115 Ga0070660_100230869
1116 Ga0070660_100355505
1117 Ga0070689_100006542
1118 Ga0070689_100081269
1119 Ga0070689_100156508
1120 Ga0070691_10014544
1121 Ga0070687_100000489
1122 Ga0070687_100091102
1123 Ga0070661_100000912
1124 Ga0070661_100001402
1125 Ga0070661_100059933
1126 Ga0070661_100251563
1127 Ga0070692_10002749
1128 Ga0070692_10132000
1129 Ga0070668_100001817
1130 Ga0070668_100004187
1131 Ga0070668_100018430
1132 Ga0070668_100039792
1133 Ga0070668_100041387
1134 Ga0070668_100087534
1135 Ga0070668_100141893
1136 Ga0070669_100000627
1137 Ga0070669_100052561
1138 Ga0070669_100059683
1139 Ga0070669_100268259
1140 Ga0070669_100632513
1141 Ga0070675_100000231
1142 Ga0070675_100000524
1143 Ga0070675_100011178
1144 Ga0070675_100194073
1145 Ga0070675_100346138
1146 Ga0070671_100000689
1147 Ga0070671_100000935
1148 Ga0070671_100008470
1149 Ga0070671_100023761
1150 Ga0070671_100716796
1151 Ga0070674_100001658
1152 Ga0070674_100002295
1153 Ga0070674_100003262
1154 Ga0070674_100012945
1155 Ga0070673_100000144
1156 Ga0070673_100002654
1157 Ga0070673_100012746
1158 Ga0070673_100060368
1159 Ga0070673_100295331
1160 Ga0070673_100307921
1161 Ga0070688_100000524
1162 Ga0070688_100118796
1163 Ga0070688_100296014
1164 Ga0070659_100001134
1165 Ga0070659_100792638
1166 Ga0070667_100008892
1167 Ga0070667_100071531
1168 Ga0070667_100103969
1169 Ga0070667_100154236
1170 Ga0070667_100241346
1171 Ga0070703_10003476
1172 Ga0070714_100097015
1173 Ga0070710_10141743
1174 Ga0070701_10000059
1175 Ga0070705_100000717
1176 Ga0070705_100039696
1177 Ga0070705_100214331
1178 Ga0070705_100621343
1179 Ga0070700_100002047
1180 Ga0070700_100149013
1181 Ga0070700_100286538
1182 Ga0070700_100310730
1183 Ga0070694_100001020
1184 Ga0070694_100105214
1185 Ga0070694_100601952
1186 Ga0070708_100113828
1187 Ga0070708_100276280
1188 Ga0070663_100000339
1189 Ga0070663_100097157
1190 Ga0070678_100001198
1191 Ga0070678_100005238
1192 Ga0070678_100012230
1193 Ga0070678_100040159
1194 Ga0070678_100047325
1195 Ga0070678_100099528
1196 Ga0070678_100185416
1197 Ga0070678_100191041
1198 Ga0070662_100011568
1199 Ga0070662_100058230
1200 Ga0070662_100270900
1201 Ga0070681_10002595
1202 Ga0070681_10058787
1203 Ga0070681_10105771
1204 Ga0070681_10142015
1205 Ga0070681_10435174
1206 Ga0068867_100000325
1207 Ga0068867_100001776
1208 Ga0068867_100051479
1209 Ga0068867_100287783
1210 Ga0068867_100306259
1211 Ga0070685_10002882
1212 Ga0070706_100081665
1213 Ga0070706_100168769
1214 Ga0070706_100431386
1215 Ga0070707_100878257
1216 Ga0070699_100275195
1217 Ga0070679_100001410
1218 Ga0070684_100000526
1219 Ga0070684_100047686
1220 Ga0070684_100079132
1221 Ga0068853_100002423
1222 Ga0068853_100018602
1223 Ga0068853_100024074
1224 Ga0068853_100426231
1225 Ga0070672_100000358
1226 Ga0070672_100000433
1227 Ga0070672_100001907
1228 Ga0070672_100004203
1229 Ga0070672_100009042
1230 Ga0070672_100009113
1231 Ga0070686_100000704
1232 Ga0070686_100091419
1233 Ga0070695_100019851
1234 Ga0070695_100058832
1235 Ga0070695_100666978
1236 Ga0070696_100012571
1237 Ga0070693_100017619
1238 Ga0070693_100139929
1239 Ga0070665_100288832
1240 Ga0070665_100320009
1241 Ga0070665_100541176
1242 Ga0070665_100546888
1243 Ga0070704_100000341
1244 Ga0070704_100039605
1245 Ga0070704_100225941
1246 Ga0068855_100006286
1247 Ga0068855_100013126
1248 Ga0068855_100871674
1249 Ga0070664_100001370
1250 Ga0070664_100072053
1251 Ga0070664_100076766
1252 Ga0070664_100096792
1253 Ga0070664_100099808
1254 Ga0070664_100240821
1255 Ga0068857_100000521
1256 Ga0068857_100000558
1257 Ga0068857_100256915
1258 Ga0068854_100000532
1259 Ga0068854_100007092
1260 Ga0068854_100344566
1261 Ga0068856_100002364
1262 Ga0068856_100061032
1263 Ga0068856_100073582
1264 Ga0070702_100000207
1265 Ga0068852_100000954
1266 Ga0068852_100006852
1267 Ga0068852_100048811
1268 Ga0068859_100002298
1269 Ga0068859_100019725
1270 Ga0068859_100284169
1271 Ga0068859_100394422
1272 Ga0068859_100620337
1273 Ga0068859_100757944
1274 Ga0068864_100003173
1275 Ga0068864_100004967
1276 Ga0068864_100048094
1277 Ga0068864_100097466
1278 Ga0068864_100281229
1279 Ga0068864_100764493
1280 Ga0068864_100846264
1281 Ga0068866_10000912
1282 Ga0068861_100000416
1283 Ga0068861_100018282
1284 Ga0068861_100127963
1285 Ga0068861_100172952
1286 Ga0068861_100674498
1287 Ga0068851_10037574
1288 Ga0068851_10041248
1289 Ga0068851_10048291
1290 Ga0068851_10176076
1291 Ga0068870_10000034
1292 Ga0068870_10117303
1293 Ga0068863_100002182
1294 Ga0068863_100093442
1295 Ga0068863_100097753
1296 Ga0068863_100105059
1297 Ga0068863_100792730
1298 Ga0068858_100004013
1299 Ga0068858_100128549
1300 Ga0068858_100620650
1301 Ga0068860_100008063
1302 Ga0068860_100048446
1303 Ga0068860_100057315
1304 Ga0068860_100069835
1305 Ga0068860_100081432
1306 Ga0068860_100322876
1307 Ga0068860_100655696
1308 Ga0068862_100001525
1309 Ga0068862_100004818
1310 Ga0068862_100053036
1311 Ga0068862_100123082
1312 Ga0068862_100218847
1313 Ga0081455_10000204
1314 Ga0081455_10005710
1315 Ga0081538_10003120
1316 Ga0081538_10043104
1317 Ga0081540_1021931
1318 Ga0081539_10003651
1319 Ga0075365_10004100
1320 Ga0075365_10074403
1321 Ga0075365_10192936
1322 Ga0075368_10001078
1323 Ga0075368_10029548
1324 Ga0075364_10068119
1325 Ga0075364_10331685
1326 Ga0075432_10002270
1327 Ga0070712_100916821
1328 Ga0075362_10065976
1329 Ga0075367_10028577
1330 Ga0075367_10031593
1331 Ga0075367_10034846
1332 Ga0075367_10063896
1333 Ga0075427_10002073
1334 Ga0075366_10061603
1335 Ga0075366_10329829
1336 Ga0097621_100000010
1337 Ga0097621_100052380
1338 Ga0075370_10015066
1339 Ga0075370_10017847
1340 Ga0068871_100000193
1341 Ga0068871_100018026
1342 Ga0068871_100054187
1343 Ga0068871_100055683
1344 Ga0068871_100055704
1345 Ga0068871_100324958
1346 Ga0075428_100021307
1347 Ga0075428_100046620
1348 Ga0075428_100153765
1349 Ga0075428_100177449
1350 Ga0075428_100185745
1351 Ga0075430_100000112
1352 Ga0075430_100026999
1353 Ga0075430_100348418
1354 Ga0075430_100364924
1355 Ga0075431_100004280
1356 Ga0075431_100168059
1357 Ga0075431_100176379
1358 Ga0075431_100205794
1359 Ga0075431_100224512
1360 Ga0075431_100307511
1361 Ga0075431_100681393
1362 Ga0075433_10000639
1363 Ga0075433_10016732
1364 Ga0075433_10028231
1365 Ga0075433_10069403
1366 Ga0075433_10830418
1367 Ga0075434_100000661
1368 Ga0075434_100001173
1369 Ga0075434_100015291
1370 Ga0075434_100018111
1371 Ga0075434_100280483
1372 Ga0075429_100000479
1373 Ga0075429_100010700
1374 Ga0075429_100067370
1375 Ga0075429_100126110
1376 Ga0075429_100228267
1377 Ga0068865_100000252
1378 Ga0068865_100057899
1379 Ga0075436_100058363
1380 Ga0097620_100002298
1381 Ga0097620_100019727
1382 Ga0097620_100284156
1383 Ga0097620_100394410
1384 Ga0097620_100620307
1385 Ga0097620_100757915
1386 Ga0075435_100029917
1387 Ga0075435_100048782
1388 Ga0075435_100093896
1389 Ga0075435_100154525
1390 Ga0075435_100747087
1391 Ga0105240_10042779
1392 Ga0105240_10289082
1393 Ga0111539_10003320
1394 Ga0111539_10004062
1395 Ga0111539_10005715
1396 Ga0111539_10088435
1397 Ga0111539_10103969
1398 Ga0105247_10001439
1399 Ga0114129_10004085
1400 Ga0114129_10010935
1401 Ga0114129_10025348
1402 Ga0114129_10055021
1403 Ga0114129_10066913
1404 Ga0114129_10129972
1405 Ga0114129_10142943
1406 Ga0114129_10437738
1407 Ga0114129_10818454
1408 Ga0105243_10002371
1409 Ga0105241_10000770
1410 Ga0105241_10252539
1411 Ga0105242_10002422
1412 Ga0105242_10934804
1413 Ga0105248_10002790
1414 Ga0105248_10008272
1415 Ga0105248_10093446
1416 Ga0105248_10242071
1417 Ga0105248_10277453
1418 Ga0105237_10013310
1419 Ga0105237_10149771
1420 Ga0105237_10167776
1421 Ga0105237_10234058
1422 Ga0105238_10054770
1423 Ga0105238_10104413
1424 Ga0105249_10001686
1425 Ga0105249_10048918
1426 Ga0105249_10502274
1427 Ga0099796_10018269
1428 Ga0105239_10032940
1429 Ga0105239_10297547
1430 Ga0105246_10000081
1431 Ga0105246_10379094
1432 Ga0157344_1000345
1433 Ga0157335_1001295
1434 Ga0157341_1000159
1435 Ga0157373_10012612
1436 Ga0157373_10058688
1437 Ga0157371_10020506
1438 Ga0157371_10164913
1439 Ga0157371_10198703
1440 Ga0157370_10580206
1441 Ga0157369_10002671
1442 Ga0157374_10009607
1443 Ga0157374_10027881
1444 Ga0157374_10120006
1445 Ga0157374_10455124
1446 Ga0157378_10000990
1447 Ga0157378_10091118
1448 Ga0157378_10215132
1449 Ga0157378_10575632
1450 Ga0157378_10742239
1451 Ga0157378_10814204
1452 Ga0163162_10005170
1453 Ga0163162_10217636
1454 Ga0163162_11619450
1455 Ga0157372_10012072
1456 Ga0157372_10016190
1457 Ga0157372_10132940
1458 Ga0157375_10000944
1459 Ga0157375_10002393
1460 Ga0157375_10033432
1461 Ga0157375_10108398
1462 Ga0157375_10129377
1463 Ga0157375_10180892
1464 Ga0157375_10375468
1465 Ga0157375_10949582
1466 Ga0163163_10010654
1467 Ga0163163_10032566
1468 Ga0163163_10507948
1469 Ga0163163_10586986
1470 Ga0163163_10903823
1471 Ga0157380_10000321
1472 Ga0157380_10097037
1473 Ga0157380_10116040
1474 Ga0182008_10101751
1475 Ga0157379_10039887
1476 Ga0157379_10118758
1477 Ga0157379_10424071
1478 Ga0157379_10905851
1479 Ga0157376_10000098
1480 Ga0157376_10047593
1481 Ga0157376_10098987
1482 Ga0157376_10329793
1483 Ga0163161_10000866
1484 Ga0163161_10006805
1485 Ga0163161_10025174
1486 Ga0163161_10045283
1487 Ga0206354_11042258
1488 Ga0206353_12052891
1489 Ga0213876_10155915
1490 Ga0209129_1000326
1491 Ga0209233_1023062
1492 Ga0207666_1000027
1493 Ga0209673_1051683
1494 Ga0209564_1000057
1495 Ga0209758_1000096
1496 Ga0209758_1000174
1497 Ga0209050_1016098
1498 Ga0207697_10000553
1499 Ga0207697_10043527
1500 Ga0207697_10054565
1501 Ga0207656_10129249
1502 Ga0207653_10002753
1503 Ga0207653_10093539
1504 Ga0207682_10000006
1505 Ga0207682_10000122
1506 Ga0207682_10015241
1507 Ga0207682_10113471
1508 Ga0207642_10000107
1509 Ga0207642_10008252
1510 Ga0207710_10000632
1511 Ga0207688_10000205
1512 Ga0207680_10028658
1513 Ga0207680_10076733
1514 Ga0207680_10085030
1515 Ga0207680_10108104
1516 Ga0207647_10067576
1517 Ga0207647_10117406
1518 Ga0207647_10133908
1519 Ga0207699_10019646
1520 Ga0207645_10000023
1521 Ga0207645_10000063
1522 Ga0207645_10091642
1523 Ga0207645_10131063
1524 Ga0207643_10000007
1525 Ga0207643_10006191
1526 Ga0207643_10122334
1527 Ga0207643_10156866
1528 Ga0207705_10104709
1529 Ga0207684_10020525
1530 Ga0207684_10285449
1531 Ga0207684_10290266
1532 Ga0207684_10373988
1533 Ga0207654_10001016
1534 Ga0207707_10000786
1535 Ga0207707_10026873
1536 Ga0207707_10062947
1537 Ga0207707_10130681
1538 Ga0207707_10245998
1539 Ga0207707_10376271
1540 Ga0207695_10021722
1541 Ga0207695_10070670
1542 Ga0207671_10058655
1543 Ga0207671_10194970
1544 Ga0207671_10751091
1545 Ga0207660_10000058
1546 Ga0207660_10057376
1547 Ga0207660_10354010
1548 Ga0207662_10000896
1549 Ga0207662_10173270
1550 Ga0207662_10190196
1551 Ga0207657_10002630
1552 Ga0207657_10059084
1553 Ga0207657_10241770
1554 Ga0207649_10000384
1555 Ga0207649_10005635
1556 Ga0207652_10000377
1557 Ga0207681_10000100
1558 Ga0207681_10001984
1559 Ga0207681_10035031
1560 Ga0207681_10126883
1561 Ga0207681_10163502
1562 Ga0207681_10169593
1563 Ga0207694_10039684
1564 Ga0207650_10000274
1565 Ga0207650_10021279
1566 Ga0207650_10038763
1567 Ga0207650_10092631
1568 Ga0207650_10159659
1569 Ga0207650_10777379
1570 Ga0207659_10000044
1571 Ga0207659_10001802
1572 Ga0207659_10004273
1573 Ga0207659_10203019
1574 Ga0207687_10001241
1575 Ga0207700_10126910
1576 Ga0207664_10011801
1577 Ga0207644_10000690
1578 Ga0207644_10004596
1579 Ga0207644_10014495
1580 Ga0207644_10180703
1581 Ga0207644_10756420
1582 Ga0207690_10000601
1583 Ga0207690_10252935
1584 Ga0207706_10001769
1585 Ga0207706_10184470
1586 Ga0207706_10210632
1587 Ga0207706_10278191
1588 Ga0207686_10000222
1589 Ga0207709_10000154
1590 Ga0207670_10000129
1591 Ga0207670_10159585
1592 Ga0207669_10000160
1593 Ga0207669_10052574
1594 Ga0207669_10132916
1595 Ga0207669_10161723
1596 Ga0207669_10191086
1597 Ga0207704_10128918
1598 Ga0207704_10497974
1599 Ga0207691_10000050
1600 Ga0207691_10000405
1601 Ga0207691_10000494
1602 Ga0207691_10003496
1603 Ga0207691_10023336
1604 Ga0207691_10024298
1605 Ga0207691_10096509
1606 Ga0207711_10006895
1607 Ga0207711_10038504
1608 Ga0207711_10056663
1609 Ga0207711_10274935
1610 Ga0207711_10322428
1611 Ga0207689_10000098
1612 Ga0207689_10004462
1613 Ga0207689_10146973
1614 Ga0207689_10513950
1615 Ga0207661_10000178
1616 Ga0207661_10000576
1617 Ga0207661_10079917
1618 Ga0207661_10154952
1619 Ga0207661_10484716
1620 Ga0207679_10000029
1621 Ga0207679_10002734
1622 Ga0207679_10117306
1623 Ga0207679_10141454
1624 Ga0207667_10003212
1625 Ga0207667_10049074
1626 Ga0207667_10108943
1627 Ga0207667_10440914
1628 Ga0207651_10000031
1629 Ga0207651_10001168
1630 Ga0207651_10001963
1631 Ga0207651_10007821
1632 Ga0207712_10000129
1633 Ga0207712_10031710
1634 Ga0207712_10098538
1635 Ga0207712_10110049
1636 Ga0207668_10000158
1637 Ga0207668_10011562
1638 Ga0207668_10077299
1639 Ga0207668_10085635
1640 Ga0207668_10151481
1641 Ga0207668_10657839
1642 Ga0207640_10000168
1643 Ga0207640_10005748
1644 Ga0207640_10182772
1645 Ga0207640_10348715
1646 Ga0207640_10445096
1647 Ga0207658_10000655
1648 Ga0207658_10009288
1649 Ga0207658_10072411
1650 Ga0207658_10105408
1651 Ga0207658_10225789
1652 Ga0207677_10000553
1653 Ga0207677_10004591
1654 Ga0207677_10333989
1655 Ga0207677_10361291
1656 Ga0207677_10602786
1657 Ga0207703_10000631
1658 Ga0207703_10383940
1659 Ga0207639_10001591
1660 Ga0207639_10051592
1661 Ga0207639_10055034
1662 Ga0207639_10271729
1663 Ga0207678_10001139
1664 Ga0207678_10004837
1665 Ga0207678_10470148
1666 Ga0207708_10000660
1667 Ga0207708_10031895
1668 Ga0207708_10197342
1669 Ga0207708_10285256
1670 Ga0207702_10000404
1671 Ga0207702_10014696
1672 Ga0207702_10147535
1673 Ga0207641_10000520
1674 Ga0207641_10008171
1675 Ga0207641_10010886
1676 Ga0207641_10145849
1677 Ga0207641_10294196
1678 Ga0207648_10000072
1679 Ga0207648_10047268
1680 Ga0207648_10055433
1681 Ga0207648_10096683
1682 Ga0207648_10125504
1683 Ga0207648_10179166
1684 Ga0207676_10000180
1685 Ga0207676_10043371
1686 Ga0207676_10100932
1687 Ga0207676_10268801
1688 Ga0207676_10269596
1689 Ga0207676_10552250
1690 Ga0207676_10770313
1691 Ga0207674_10000049
1692 Ga0207674_10003433
1693 Ga0207674_10074109
1694 Ga0207674_10113871
1695 Ga0207674_10123631
1696 Ga0207675_100021979
1697 Ga0207675_100033128
1698 Ga0207675_100052678
1699 Ga0207675_100058840
1700 Ga0207675_100124676
1701 Ga0207675_100211395
1702 Ga0207683_10000029
1703 Ga0207683_10000521
1704 Ga0207683_10005585
1705 Ga0207683_10018977
1706 Ga0207683_10055869
1707 Ga0207683_10215857
1708 Ga0207683_10537019
1709 Ga0207698_10000682
1710 Ga0207698_10002475
1711 Ga0207698_10076422
1712 Ga0210002_1000485
1713 Ga0209588_1077418
1714 Ga0209966_1008488
1715 Ga0209966_1037871
1716 Ga0209998_10002969
1717 Ga0209813_10001943
1718 Ga0209813_10020110
1719 Ga0209974_10030398
1720 Ga0209974_10046169
1721 Ga0207428_10000100
1722 Ga0207428_10000124
1723 Ga0207428_10000968
1724 Ga0207428_10021134
1725 Ga0268266_10008615
1726 Ga0268266_10057152
1727 Ga0268266_10181249
1728 Ga0268266_10255085
1729 Ga0268265_10000698
1730 Ga0268265_10005564
1731 Ga0268265_10333498
1732 Ga0268264_10001558
1733 Ga0268264_10046391
1734 Ga0268264_10183495
1735 Ga0268264_10285489
1736 Ga0268264_10547190
1737 Ga0265318_10006235
1738 Ga0307517_10000644
1739 Ga0307517_10137131
1740 Ga0307515_10006527
1741 Ga0307515_10176947
1742 Ga0307515_10492371
1743 Ga0307512_10112651
1744 Ga0265332_10063392
1745 Ga0265328_10006421
1746 Ga0265320_10023698
1747 Ga0265325_10006840
1748 Ga0265325_10073737
1749 Ga0265329_10031811
1750 Ga0265340_10040813
1751 Ga0265340_10205686
1752 Ga0265339_10031699
1753 Ga0265339_10064302
1754 Ga0265331_10005867
1755 Ga0265316_10082981
1756 Ga0265316_10381201
1757 Ga0307513_10171324
1758 Ga0307509_10000041
1759 Ga0307509_10003100
1760 Ga0307509_10009112
1761 Ga0265313_10026426
1762 Ga0307508_10211428
1763 Ga0307508_10316998
1764 Ga0307514_10066812
1765 Ga0307514_10195461
1766 Ga0265314_10000992
1767 Ga0265314_10150180
1768 Ga0265342_10016326
1769 Ga0265342_10023182
1770 Ga0307516_10032420
1771 Ga0307411_10464830
1772 Ga0307507_10045329
1773 Ga0307507_10205846
1774 Ga0307510_10002283
1775 Ga0307510_10009870
1776 Ga0307510_10067350
1777 Ga0307510_10100119
1778 Ga0307510_10286362
1779 Ga0373950_0001825
1780 Ga0373950_0049201
1781 Ga0373938_0000494
1782 Ga0373926_0186908
1783 Ga0373928_0009097
1784 Ga0373929_0001228
1785 Ga0373934_0010526
1786 Ga0373940_0035624
1787 Ga0373940_0081037
1788 Ga0373944_0013956
1789 Ga0373949_0001228
1790 Ga0373952_0001688
1791 Ga0373923_0148735
1792 Ga0373923_0248304
1793 Ga0373923_0267302
1794 Ga0373936_0068289
1795 Ga0373939_0012040
1796 Ga0373941_0015879
1797 Ga0373953_0043817
1798 Ga0373953_0109480
1799 Ga0373954_0006658
1800 Ga0373954_0029740
1801 Ga0373954_0045779
1802 Ga0373954_0281960
1803 Ga0373956_0004764
1804 Ga0373956_0031015
1805 Ga0373957_0031414
1806 Ga0373946_0111546
1807 Ga0373946_0252714
1808 Ga0373946_0255206
1809 Ga0373955_0022227
1810 Ga0373942_0001685
1811 Ga0373961_0014842
1812 Ga0373962_0000138
1813 Ga0373924_0101628
1814 Ga0373931_0000239
1815 Ga0373935_0039383
1816 Ga0373935_0074833
1817 Ga0373935_0134875
1818 Ga0373927_0022826
1819 Ga0373933_0114087
1820 Ga0373933_0132460
1821 Ga0373947_0345374
1822 Ga0373947_0391886
1823 Ga0373947_0570793
1824 Ga0373937_0051941
1825 Ga0373937_0193468
1826 Ga0373937_0226181
1827 Ga0373937_0545123
1828 Ga0373937_0687364
1829 Ga0373925_0030541
1830 Ga0373925_0077575
1831 Ga0373925_0095744
1832 Ga0373925_0390326
1833 Ga0395900_0003717
1834 Ga0395898_0671469
1835 Ga0395905_0016990
1836 Ga0395905_0058630
1837 Ga0395905_0453243
1838 Ga0395905_0827193
1839 Ga0436364_0517049
1840 Ga0395901_0011964
1841 Ga0436365_0019248
1842 Ga0451802_2066676
1843 Ga0439450_039217
1844 Ga0439464_0069682
1845 Ga0439460_0021573
1846 Ga0453683_0002857
1847 Ga0466967_0064520
1848 Ga0495592_0001970
1849 Ga0495592_0051483
1850 Ga0495592_0057634
1851 Ga0495592_0090135
1852 Ga0495592_0128175
1853 Ga0495590_0001111
1854 Ga0495629_0151062
1855 Ga0495629_0153427
1856 Ga0495638_0116305
1857 Ga0495641_0139804
1858 Ga0495651_0046327
1859 Ga0495651_0531080
1860 Ga0495653_0264103
1861 Ga0495580_0000683
1862 Ga0495580_0128872
1863 Ga0495582_0104641
1864 Ga0495605_0230228
1865 Ga0495639_0025312
1866 Ga0495662_0025409
1867 Ga0495664_0026882
1868 Ga0495585_0282240
1869 Ga0495608_0024660
1870 Ga0495608_0071301
1871 Ga0495610_0037726
1872 Ga0495618_0398466
1873 Ga0495628_0015428
1874 Ga0495628_0018439
1875 Ga0495628_0194020
1876 Ga0495628_0312523
1877 Ga0495628_0433060
1878 Ga0495630_0078045
1879 Ga0495630_0094796
1880 Ga0495630_0206881
1881 Ga0495630_0283597
1882 Ga0495632_0147584
1883 Ga0495666_0189118
1884 Ga0495652_0018867
1885 Ga0495652_0152169
1886 Ga0495652_0191425
1887 Ga0495640_0024230
1888 Ga0495640_0060233
1889 Ga0495586_0051513
1890 Ga0495586_0250907
1891 Ga0495587_0031018
1892 Ga0495645_0025284
1893 Ga0495622_0108936
1894 Ga0495622_0271821
1895 Ga0495667_0036451
1896 Ga0495667_0047951
1897 Ga0495667_0050414
1898 Ga0495634_0257114
1899 Ga0495635_0050965
1900 Ga0495635_0064172
1901 Ga0495659_0020476
1902 Ga0495657_0077848
1903 Ga0495599_0037398
1904 Ga0495646_0100828
1905 Ga0495647_0023746
1906 Ga0495658_0128525
1907 Ga0495658_0135058
1908 Ga0495669_0110227
1909 Ga0495613_0066450
1910 Ga0495624_0037607
1911 Ga0495624_0429525
1912 Ga0495600_0220919
1913 Ga0495660_0264306
1914 Ga0495674_0082122
1915 Ga0495676_0078685
1916 Ga0495680_0036557
1917 Ga0495675_0124627
1918 Ga0495675_0139732
1919 Ga0495686_0221088
1920 Ga0495593_0061448
1921 Ga0495614_0266961
1922 Ga0496100_0002349
1923 Ga0496101_0000187
1924 Ga0496101_0014419
1925 Ga0496102_0002906
1926 Ga0496103_0000157
1927 Ga0496104_0383570
1928 Ga0496105_0250174
1929 Ga0496106_0006890
1930 Ga0496107_0000805
1931 Ga0496108_0234055
1932 Ga0496108_0805076
1933 Ga0496109_0000313
1934 Ga0496109_0001125
1935 Ga0496110_0096825
1936 Ga0496111_0076468
1937 Ga0496111_0083795
1938 Ga0496112_0086476
1939 Ga0496112_0105664
1940 Ga0496112_0692166
1941 Ga0496113_0012990
1942 Ga0496113_0018069
1943 Ga0496113_0297226
1944 Ga0496114_0005751
1945 Ga0496114_0022185
1946 Ga0496115_0001217
1947 Ga0496118_0151636
1948 Ga0496121_0003906
1949 Ga0496123_0180276
1950 Ga0496125_0000063
1951 Ga0496125_0003433
1952 Ga0496126_0051862
1953 Ga0501031_0299947
1954 Ga0501031_0415882
1955 Ga0501034_0010927
1956 Ga0501038_0017675
1957 Ga0501039_0084802
1958 Ga0501040_0012090
1959 Ga0501040_0012492
1960 Ga0501041_0043939
1961 Ga0501041_0073839
1962 Ga0501042_0003421
1963 Ga0501046_0350547
1964 Ga0501048_0342264
1965 Ga0501067_0089123
1966 Ga0501068_0368546
1967 Ga0501068_0375390
1968 Ga0501069_0051380
1969 Ga0501070_0192200
1970 Ga0501071_0149658
1971 Ga0501072_0007289
1972 Ga0501072_0455892
1973 Ga0501072_0617641
1974 Ga0501074_0158448
1975 Ga0501074_0415371
1976 Ga0501075_0002401
1977 Ga0501075_0059850
1978 Ga0501075_0177917
1979 Ga0501075_0384908
1980 Ga0501076_0001488
1981 Ga0501077_0074645
1982 Ga0501077_0150832
1983 Ga0501079_0006001
1984 Ga0501079_0516427
1985 Ga0501080_0007934
1986 Ga0501080_0337147
1987 Ga0501080_0492636
1988 Ga0501081_0377416
1989 Ga0501083_0019458
1990 nmdc:mga00v17_300694_c1
1991 nmdc:mga00v17_58681_c1
1992 nmdc:mga0yw44_48593_c1
1993 nmdc:mga06z11_3482_c1
1994 nmdc:mga06z11_4358_c1
1995 nmdc:mga06z11_76410_c1
1996 nmdc:mga04h51_18807_c1
1997 nmdc:mga07m45_13302_c1
1998 nmdc:mga07m45_139695_c1
1999 nmdc:mga07m45_24947_c1
2000 nmdc:mga05p37_10207_c1
2001 nmdc:mga05p37_104271_c1
2002 nmdc:mga05p37_13916_c1
2003 nmdc:mga05p37_15856_c1
2004 nmdc:mga05p37_164938_c1
2005 nmdc:mga05p37_385834_c1
2006 nmdc:mga05p37_39063_c1
2007 nmdc:mga05p37_45_c1
2008 nmdc:mga05p37_630292_c1
2009 nmdc:mga05p37_85076_c1
2010 nmdc:mga09592_169100_c1
2011 nmdc:mga09592_182663_c1
2012 nmdc:mga09592_47067_c1
2013 nmdc:mga09592_5654_c1
2014 nmdc:mga09592_58667_c1
2015 nmdc:mga09592_7756_c1
2016 nmdc:mga09592_81575_c1
2017 nmdc:mga0qj67_1430_c1
2018 nmdc:mga0qj67_160268_c1
2019 nmdc:mga0qj67_348346_c1
2020 nmdc:mga0qj67_58551_c1
2021 nmdc:mga0qj67_67253_c1
2022 nmdc:mga06r32_162043_c1
2023 nmdc:mga06r32_203418_c1
2024 nmdc:mga06r32_211300_c1
2025 nmdc:mga06r32_35577_c1
2026 nmdc:mga06r32_407_c1
2027 nmdc:mga06r32_77499_c1
2028 nmdc:mga08y16_2193_c1
2029 nmdc:mga08y16_792_c1
2030 nmdc:mga08y16_91943_c1
2031 nmdc:mga0n895_1011_c1
2032 nmdc:mga0n895_10668_c1
2033 nmdc:mga0n895_15085_c1
2034 nmdc:mga0n895_254415_c1
2035 nmdc:mga0n895_8875_c1
2036 nmdc:mga0rr50_104975_c1
2037 nmdc:mga0rr50_107066_c1
2038 nmdc:mga0rr50_135279_c1
2039 nmdc:mga0rr50_142289_c1
2040 nmdc:mga0rr50_235104_c1
2041 nmdc:mga0rr50_43068_c1
2042 nmdc:mga0rr50_918_c1
2043 nmdc:mga08x19_170263_c1
2044 nmdc:mga08x19_29952_c1
2045 nmdc:mga08x19_63051_c1
2046 nmdc:mga0a205_1027039_c1
2047 nmdc:mga0a205_22216_c1
2048 nmdc:mga0a205_242974_c1
2049 nmdc:mga0a205_6158_c1
2050 nmdc:mga0a205_6355_c1
2051 Ga0495601_0001636
2052 Ga0495601_0056964
2053 Ga0495601_0139901
2054 Ga0495595_0008204
2055 Ga0495595_0135150
2056 Ga0495619_0041195
2057 Ga0495619_0191701
2058 Ga0500578_0000236
2059 Ga0500578_0400015
2060 Ga0500644_0003109
2061 Ga0500651_0023119
2062 Ga0500651_0102264
2063 Ga0500566_0158488
2064 Ga0500594_0017698
2065 Ga0500595_002989
2066 Ga0500595_010080
2067 Ga0500614_013998
2068 Ga0500652_000014
2069 Ga0500559_0000012
2070 Ga0500564_179043
2071 Ga0500568_0057635
2072 Ga0500604_0014218
2073 Ga0500604_0014386
2074 Ga0500619_050551
2075 Ga0500622_0024833
2076 Ga0500627_0019136
2077 Ga0500636_0030839
2078 Ga0500645_025399
2079 Ga0500552_000373
2080 Ga0500587_022219
2081 Ga0501084_0039843
2082 Ga0501084_0057776
2083 Ga0501082_0000007
2084 Ga0501082_0009692
2085 Ga0501082_0105127
2086 Ga0501082_0834466
2087 Ga0530510_0000125
2088 Ga0530510_0070238
2089 2587734308
2090 2588295242
2091 2643755448
2092 2644304114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bnl-assembly1.cif.gz_A zinc dependent dimers observed in crystals of human endostatin 0.717 28 217
1dy0-assembly1.cif.gz_A murine endostatin, crystal form ii 0.711 30 217
1koe-assembly1.cif.gz_A endostatin 0.6885 29 217
1dy2-assembly1.cif.gz_A murine collagen alpha1(xv), endostatin domain 0.6842 29 217
1bnl-assembly1.cif.gz_A zinc dependent dimers observed in crystals of human endostatin 0.6827 28 217
ID Description Score Start End Superfamily
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7406 24 217 3.10.100.10
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7377 30 218 3.10.100.10
af_P39059_1210_1388_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7125 28 219 3.10.100.10
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7041 24 217 3.10.100.10
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.6935 30 218 3.10.100.10
ID Description Score Start End GO Terms
AF-A0A2V6TI47-F1-model_v4 Lectin 0.9855 16 219
AF-A0A1L3LXF0-F1-model_v4 Lectin 0.9663 29 219
AF-A0A528EI03-F1-model_v4 Lectin 0.9661 25 219
AF-A0A560B6C2-F1-model_v4 Lectin 0.9655 29 219
AF-A0A2V6TI47-F1-model_v4 Lectin 0.9621 16 219

Map