F488964
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1046 | 489 | 2092 | 336 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0043517|Ga0466966_0043517_843_1931 |
| Length | 362 |
| Sequence | VDKRNWNYGPDGARDFSKFVKVGAAMGHESRKAGTRVLVTGGTGFIGQHLVAALVARDRKVRVLDRRPPVCAAPGVEYLSGSVLDTGLVDESLRDADEVYHLAGLPGMWLPDKDDFHAVNFKGTEIVIGAARKRGIARFLHCSTESILFRPASSQKDSGEPSLLPPEQMPGVYTRSKMLAEQSAAQAAAAGFPLVIGTPTMPIGPHDHNLTPPTAMLRQFLHGRVQMYLDFIVNLVDVRDVATGLILAMERGQIGQRYILGGESISLKKILKLMASISGRHTFAIPVPGKIAEIAAGVLEFISDHLTHTPPSGTAEGVRIALRATELSIEKAQRELGYAPRPIEPALRDTIAYLLSQSKPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 18 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 22 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 244 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 246 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 254 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 255 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 257 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 258 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 259 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 276 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 287 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 288 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 289 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 299 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 300 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 301 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 302 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 303 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 304 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 305 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 390 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 391 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 392 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 393 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 394 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 395 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 399 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 400 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 401 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 409 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 410 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 411 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 439 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 440 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 441 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 449 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 452 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 453 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 454 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 455 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 456 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 457 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 460 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 462 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 463 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 466 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 467 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 468 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 469 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 472 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 473 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 474 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 475 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 476 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 477 | 2791355199 | |||
| 478 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 479 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 480 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 481 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 482 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 483 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 484 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 485 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 486 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 487 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 488 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 489 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 0 |
| Isolates | 1.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.3 |
| Nodule | 1.15 |
| Rhizoplane | 5.07 |
| Rhizosphere | 84.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466966_0043517 | 3300044684 | Bacteria | 2878 |
| 2 | 2214544922 | 2209111006 | Bacteria | 19930 |
| 3 | ARcpr5oldR_c000056 | 3300000041 | Bacteria | 20790 |
| 4 | ARSoilYngRDRAFT_c00038 | 3300000042 | Bacteria | 20556 |
| 5 | ARcpr5yngRDRAFT_c000037 | 3300000043 | Bacteria | 20897 |
| 6 | ARSoilOldRDRAFT_c000060 | 3300000044 | Bacteria | 22426 |
| 7 | ARCol0oldRDRAFT_c00065 | 3300000045 | Bacteria | 8499 |
| 8 | CNAas_1002143 | 3300000532 | Bacteria | 1463 |
| 9 | ARCol0yngRDRAFT_1000262 | 3300000652 | Bacteria | 8470 |
| 10 | JGI24736J21556_1008999 | 3300001904 | Bacteria | 1654 |
| 11 | JGI24752J21851_1004571 | 3300001976 | Bacteria | 1813 |
| 12 | JGI24746J21847_1000770 | 3300001977 | Bacteria | 4927 |
| 13 | JGI24747J21853_1001345 | 3300001978 | Bacteria | 1822 |
| 14 | JGI24739J22299_10001705 | 3300001989 | Bacteria | 8356 |
| 15 | JGI24737J22298_10000400 | 3300001990 | Bacteria | 14807 |
| 16 | JGI24737J22298_10002365 | 3300001990 | Bacteria | 6723 |
| 17 | JGI24743J22301_10008225 | 3300001991 | Bacteria | 1826 |
| 18 | JGI24750J21931_1000217 | 3300002070 | Bacteria | 9762 |
| 19 | JGI24745J21846_1000133 | 3300002073 | Bacteria | 5710 |
| 20 | JGI24748J21848_1002725 | 3300002074 | Bacteria | 2009 |
| 21 | JGI24738J21930_10000277 | 3300002075 | Bacteria | 14047 |
| 22 | JGI24744J21845_10000893 | 3300002077 | Bacteria | 5635 |
| 23 | JGI24035J26624_1000096 | 3300002126 | Bacteria | 7440 |
| 24 | JGI24742J22300_10000345 | 3300002244 | Bacteria | 6819 |
| 25 | JGI24751J29686_10004930 | 3300002459 | Bacteria | 2719 |
| 26 | JGI25153J46596_10003096 | 3300003215 | Bacteria | 9375 |
| 27 | rootH2_10164564 | 3300003320 | Bacteria | 2357 |
| 28 | JGI25405J52794_10001360 | 3300003911 | Bacteria | 4015 |
| 29 | JGI25405J52794_10002356 | 3300003911 | Bacteria | 3244 |
| 30 | Ga0065704_10077082 | 3300005289 | Bacteria | 4839 |
| 31 | Ga0065712_10006696 | 3300005290 | Bacteria | 4601 |
| 32 | Ga0065712_10071749 | 3300005290 | Bacteria | 5082 |
| 33 | Ga0065712_10098936 | 3300005290 | Bacteria | 2087 |
| 34 | Ga0065715_10001161 | 3300005293 | Bacteria | 10533 |
| 35 | Ga0065715_10131782 | 3300005293 | Bacteria | 2002 |
| 36 | Ga0070658_10174508 | 3300005327 | Bacteria | 1807 |
| 37 | Ga0070658_10210823 | 3300005327 | Bacteria | 1641 |
| 38 | Ga0070676_10000813 | 3300005328 | Bacteria | 15426 |
| 39 | Ga0070683_100000240 | 3300005329 | Bacteria | 37588 |
| 40 | Ga0070683_100066349 | 3300005329 | Bacteria | 3362 |
| 41 | Ga0070683_100327347 | 3300005329 | Bacteria | 1459 |
| 42 | Ga0070690_100000428 | 3300005330 | Bacteria | 21329 |
| 43 | Ga0070690_100028240 | 3300005330 | Bacteria | 3474 |
| 44 | Ga0070690_100077522 | 3300005330 | Unclassified | 2170 |
| 45 | Ga0070670_100048534 | 3300005331 | Bacteria | 3653 |
| 46 | Ga0070677_10000294 | 3300005333 | Bacteria | 17512 |
| 47 | Ga0068869_100000189 | 3300005334 | Bacteria | 31886 |
| 48 | Ga0068869_100019911 | 3300005334 | Bacteria | 4594 |
| 49 | Ga0068869_100021975 | 3300005334 | Bacteria | 4391 |
| 50 | Ga0070666_10017675 | 3300005335 | Bacteria | 4575 |
| 51 | Ga0070666_10269350 | 3300005335 | Unclassified | 1208 |
| 52 | Ga0070680_100025642 | 3300005336 | Bacteria | 4713 |
| 53 | Ga0070680_100046905 | 3300005336 | Bacteria | 3516 |
| 54 | Ga0070680_100064986 | 3300005336 | Bacteria | 2990 |
| 55 | Ga0070682_100000202 | 3300005337 | Bacteria | 44018 |
| 56 | Ga0070682_100175815 | 3300005337 | Bacteria | 1491 |
| 57 | Ga0068868_100000614 | 3300005338 | Bacteria | 23959 |
| 58 | Ga0068868_100049205 | 3300005338 | Bacteria | 3308 |
| 59 | Ga0070660_100000223 | 3300005339 | Bacteria | 37464 |
| 60 | Ga0070660_100011233 | 3300005339 | Bacteria | 6357 |
| 61 | Ga0070660_100027221 | 3300005339 | Bacteria | 4265 |
| 62 | Ga0070660_100131688 | 3300005339 | Bacteria | 2001 |
| 63 | Ga0070660_100319570 | 3300005339 | Bacteria | 1275 |
| 64 | Ga0070689_100000187 | 3300005340 | Bacteria | 37473 |
| 65 | Ga0070691_10003410 | 3300005341 | Bacteria | 7145 |
| 66 | Ga0070691_10027437 | 3300005341 | Bacteria | 2657 |
| 67 | Ga0070691_10061506 | 3300005341 | Bacteria | 1807 |
| 68 | Ga0070687_100000200 | 3300005343 | Bacteria | 20836 |
| 69 | Ga0070661_100000298 | 3300005344 | Bacteria | 40083 |
| 70 | Ga0070692_10000016 | 3300005345 | Bacteria | 34456 |
| 71 | Ga0070668_100051691 | 3300005347 | Bacteria | 3167 |
| 72 | Ga0070668_100056874 | 3300005347 | Bacteria | 3021 |
| 73 | Ga0070668_100088836 | 3300005347 | Bacteria | 2433 |
| 74 | Ga0070668_100127841 | 3300005347 | Bacteria | 2037 |
| 75 | Ga0070669_100001525 | 3300005353 | Bacteria | 16755 |
| 76 | Ga0070675_100000215 | 3300005354 | Bacteria | 37364 |
| 77 | Ga0070675_100387630 | 3300005354 | Bacteria | 1245 |
| 78 | Ga0070671_100000402 | 3300005355 | Bacteria | 29873 |
| 79 | Ga0070671_100100481 | 3300005355 | Bacteria | 2427 |
| 80 | Ga0070674_100000511 | 3300005356 | Bacteria | 19453 |
| 81 | Ga0070674_100049852 | 3300005356 | Bacteria | 2881 |
| 82 | Ga0070673_100000035 | 3300005364 | Bacteria | 57163 |
| 83 | Ga0070673_100243554 | 3300005364 | Bacteria | 1564 |
| 84 | Ga0070688_100000130 | 3300005365 | Bacteria | 40342 |
| 85 | Ga0070688_100000837 | 3300005365 | Bacteria | 15251 |
| 86 | Ga0070659_100000583 | 3300005366 | Bacteria | 26638 |
| 87 | Ga0070659_100064239 | 3300005366 | Bacteria | 2905 |
| 88 | Ga0070659_100104482 | 3300005366 | Bacteria | 2282 |
| 89 | Ga0070667_100000712 | 3300005367 | Bacteria | 32083 |
| 90 | Ga0070667_100381390 | 3300005367 | Bacteria | 1280 |
| 91 | Ga0070703_10004424 | 3300005406 | Bacteria | 3954 |
| 92 | Ga0070709_10000625 | 3300005434 | Bacteria | 20227 |
| 93 | Ga0070709_10001920 | 3300005434 | Bacteria | 11296 |
| 94 | Ga0070714_100008485 | 3300005435 | Bacteria | 8029 |
| 95 | Ga0070713_100008487 | 3300005436 | Bacteria | 7289 |
| 96 | Ga0070713_100216547 | 3300005436 | Bacteria | 1736 |
| 97 | Ga0070710_10000834 | 3300005437 | Bacteria | 14840 |
| 98 | Ga0070710_10006043 | 3300005437 | Bacteria | 5786 |
| 99 | Ga0070710_10071343 | 3300005437 | Bacteria | 2003 |
| 100 | Ga0070701_10000081 | 3300005438 | Bacteria | 26416 |
| 101 | Ga0070701_10005239 | 3300005438 | Bacteria | 5336 |
| 102 | Ga0070701_10149198 | 3300005438 | Bacteria | 1345 |
| 103 | Ga0070711_100000773 | 3300005439 | Bacteria | 16663 |
| 104 | Ga0070711_100002593 | 3300005439 | Bacteria | 10353 |
| 105 | Ga0070705_100002491 | 3300005440 | Bacteria | 9254 |
| 106 | Ga0070700_100027063 | 3300005441 | Bacteria | 3396 |
| 107 | Ga0070694_100000129 | 3300005444 | Bacteria | 37699 |
| 108 | Ga0070694_100031644 | 3300005444 | Bacteria | 3469 |
| 109 | Ga0070694_100042284 | 3300005444 | Bacteria | 3044 |
| 110 | Ga0070694_100151364 | 3300005444 | Bacteria | 1695 |
| 111 | Ga0070663_100016592 | 3300005455 | Bacteria | 4788 |
| 112 | Ga0070663_100041781 | 3300005455 | Bacteria | 3219 |
| 113 | Ga0070663_100042996 | 3300005455 | Bacteria | 3177 |
| 114 | Ga0070678_100023973 | 3300005456 | Bacteria | 4076 |
| 115 | Ga0070662_100000933 | 3300005457 | Bacteria | 17890 |
| 116 | Ga0070662_100024884 | 3300005457 | Bacteria | 4130 |
| 117 | Ga0070662_100037881 | 3300005457 | Bacteria | 3421 |
| 118 | Ga0070662_100202938 | 3300005457 | Bacteria | 1574 |
| 119 | Ga0070662_100219442 | 3300005457 | Bacteria | 1517 |
| 120 | Ga0070681_10001286 | 3300005458 | Bacteria | 21879 |
| 121 | Ga0068867_100000369 | 3300005459 | Bacteria | 29980 |
| 122 | Ga0068867_100203912 | 3300005459 | Bacteria | 1585 |
| 123 | Ga0070706_100033904 | 3300005467 | Bacteria | 4713 |
| 124 | Ga0070698_100020555 | 3300005471 | Bacteria | 6922 |
| 125 | Ga0070698_100352531 | 3300005471 | Bacteria | 1403 |
| 126 | Ga0070699_100000003 | 3300005518 | Bacteria | 418047 |
| 127 | Ga0070699_100157602 | 3300005518 | Bacteria | 2009 |
| 128 | Ga0070679_100000553 | 3300005530 | Bacteria | 31683 |
| 129 | Ga0070679_100012149 | 3300005530 | Bacteria | 8226 |
| 130 | Ga0070679_100148843 | 3300005530 | Bacteria | 2318 |
| 131 | Ga0070684_100000246 | 3300005535 | Bacteria | 37600 |
| 132 | Ga0070684_100004778 | 3300005535 | Bacteria | 10350 |
| 133 | Ga0070684_100067615 | 3300005535 | Bacteria | 3139 |
| 134 | Ga0070697_100050991 | 3300005536 | Bacteria | 3362 |
| 135 | Ga0068853_100000243 | 3300005539 | Bacteria | 38327 |
| 136 | Ga0068853_100053503 | 3300005539 | Bacteria | 3476 |
| 137 | Ga0070672_100000157 | 3300005543 | Bacteria | 37598 |
| 138 | Ga0070672_100026481 | 3300005543 | Bacteria | 4316 |
| 139 | Ga0070672_100030913 | 3300005543 | Bacteria | 4027 |
| 140 | Ga0070686_100000260 | 3300005544 | Bacteria | 36083 |
| 141 | Ga0070686_100070937 | 3300005544 | Bacteria | 2279 |
| 142 | Ga0070686_100186981 | 3300005544 | Bacteria | 1476 |
| 143 | Ga0070686_100229675 | 3300005544 | Bacteria | 1345 |
| 144 | Ga0070695_100001653 | 3300005545 | Bacteria | 12525 |
| 145 | Ga0070695_100024912 | 3300005545 | Bacteria | 3690 |
| 146 | Ga0070695_100111657 | 3300005545 | Bacteria | 1856 |
| 147 | Ga0070696_100006359 | 3300005546 | Bacteria | 7905 |
| 148 | Ga0070696_100017316 | 3300005546 | Bacteria | 4865 |
| 149 | Ga0070696_100244732 | 3300005546 | Bacteria | 1354 |
| 150 | Ga0070693_100005607 | 3300005547 | Bacteria | 6051 |
| 151 | Ga0070665_100007892 | 3300005548 | Bacteria | 10798 |
| 152 | Ga0070665_100014837 | 3300005548 | Bacteria | 7820 |
| 153 | Ga0070665_100096914 | 3300005548 | Bacteria | 2954 |
| 154 | Ga0070704_100000171 | 3300005549 | Bacteria | 25774 |
| 155 | Ga0070704_100005236 | 3300005549 | Bacteria | 7551 |
| 156 | Ga0068855_100001637 | 3300005563 | Bacteria | 28084 |
| 157 | Ga0068855_100005012 | 3300005563 | Bacteria | 16165 |
| 158 | Ga0068855_100163498 | 3300005563 | Unclassified | 2525 |
| 159 | Ga0068855_100208345 | 3300005563 | Bacteria | 2198 |
| 160 | Ga0068855_100305002 | 3300005563 | Bacteria | 1763 |
| 161 | Ga0070664_100000269 | 3300005564 | Bacteria | 37475 |
| 162 | Ga0070664_100290171 | 3300005564 | Bacteria | 1477 |
| 163 | Ga0068857_100000174 | 3300005577 | Bacteria | 40766 |
| 164 | Ga0068857_100027809 | 3300005577 | Bacteria | 4987 |
| 165 | Ga0068854_100000211 | 3300005578 | Bacteria | 39059 |
| 166 | Ga0068854_100044425 | 3300005578 | Bacteria | 3153 |
| 167 | Ga0068854_100145194 | 3300005578 | Bacteria | 1824 |
| 168 | Ga0068856_100000600 | 3300005614 | Bacteria | 39415 |
| 169 | Ga0068856_100421857 | 3300005614 | Bacteria | 1354 |
| 170 | Ga0070702_100000312 | 3300005615 | Bacteria | 16802 |
| 171 | Ga0070702_100027299 | 3300005615 | Bacteria | 3078 |
| 172 | Ga0068852_100003615 | 3300005616 | Bacteria | 10822 |
| 173 | Ga0068852_100015387 | 3300005616 | Bacteria | 5931 |
| 174 | Ga0068852_100060621 | 3300005616 | Bacteria | 3285 |
| 175 | Ga0068852_100267487 | 3300005616 | Bacteria | 1644 |
| 176 | Ga0068859_100000894 | 3300005617 | Bacteria | 30361 |
| 177 | Ga0068859_100076274 | 3300005617 | Bacteria | 3393 |
| 178 | Ga0068859_100104579 | 3300005617 | Unclassified | 2890 |
| 179 | Ga0068859_100135028 | 3300005617 | Bacteria | 2540 |
| 180 | Ga0068864_100000329 | 3300005618 | Bacteria | 41801 |
| 181 | Ga0068864_100016060 | 3300005618 | Bacteria | 6229 |
| 182 | Ga0068866_10000177 | 3300005718 | Bacteria | 29851 |
| 183 | Ga0068861_100000329 | 3300005719 | Bacteria | 26778 |
| 184 | Ga0068861_100022570 | 3300005719 | Bacteria | 4535 |
| 185 | Ga0068861_100065282 | 3300005719 | Bacteria | 2803 |
| 186 | Ga0068861_100094617 | 3300005719 | Bacteria | 2364 |
| 187 | Ga0068861_100122970 | 3300005719 | Bacteria | 2096 |
| 188 | Ga0068851_10002336 | 3300005834 | Bacteria | 8351 |
| 189 | Ga0068851_10020010 | 3300005834 | Bacteria | 3237 |
| 190 | Ga0068851_10035065 | 3300005834 | Bacteria | 2507 |
| 191 | Ga0068870_10000056 | 3300005840 | Bacteria | 36039 |
| 192 | Ga0068863_100000278 | 3300005841 | Bacteria | 53024 |
| 193 | Ga0068863_100324847 | 3300005841 | Bacteria | 1495 |
| 194 | Ga0068858_100001048 | 3300005842 | Bacteria | 28582 |
| 195 | Ga0068858_100061574 | 3300005842 | Bacteria | 3469 |
| 196 | Ga0068858_100076154 | 3300005842 | Bacteria | 3116 |
| 197 | Ga0068858_100152128 | 3300005842 | Bacteria | 2176 |
| 198 | Ga0068860_100000149 | 3300005843 | Bacteria | 113068 |
| 199 | Ga0068860_100000985 | 3300005843 | Bacteria | 31478 |
| 200 | Ga0068860_100030464 | 3300005843 | Bacteria | 5189 |
| 201 | Ga0068860_100092315 | 3300005843 | Bacteria | 2885 |
| 202 | Ga0068862_100000593 | 3300005844 | Bacteria | 37703 |
| 203 | Ga0068862_100016002 | 3300005844 | Bacteria | 6236 |
| 204 | Ga0068862_100039915 | 3300005844 | Bacteria | 3988 |
| 205 | Ga0081455_10001601 | 3300005937 | Bacteria | 27658 |
| 206 | Ga0081455_10001818 | 3300005937 | Bacteria | 25693 |
| 207 | Ga0081455_10004887 | 3300005937 | Bacteria | 14853 |
| 208 | Ga0081455_10006854 | 3300005937 | Bacteria | 12135 |
| 209 | Ga0081455_10020372 | 3300005937 | Bacteria | 6247 |
| 210 | Ga0081455_10058657 | 3300005937 | Bacteria | 3255 |
| 211 | Ga0081538_10038173 | 3300005981 | Bacteria | 3104 |
| 212 | Ga0081540_1002358 | 3300005983 | Bacteria | 15431 |
| 213 | Ga0081540_1002564 | 3300005983 | Bacteria | 14745 |
| 214 | Ga0081540_1007041 | 3300005983 | Bacteria | 8086 |
| 215 | Ga0081540_1019943 | 3300005983 | Bacteria | 4052 |
| 216 | Ga0081540_1023695 | 3300005983 | Bacteria | 3583 |
| 217 | Ga0081540_1050507 | 3300005983 | Bacteria | 2065 |
| 218 | Ga0081539_10034119 | 3300005985 | Bacteria | 3086 |
| 219 | Ga0070717_10004617 | 3300006028 | Bacteria | 9981 |
| 220 | Ga0075368_10011454 | 3300006042 | Bacteria | 3227 |
| 221 | Ga0075368_10011795 | 3300006042 | Bacteria | 3187 |
| 222 | Ga0075363_100030366 | 3300006048 | Bacteria | 2797 |
| 223 | Ga0075364_10044632 | 3300006051 | Bacteria | 2883 |
| 224 | Ga0070715_10000830 | 3300006163 | Bacteria | 8479 |
| 225 | Ga0070716_100002010 | 3300006173 | Bacteria | 9287 |
| 226 | Ga0070716_100023686 | 3300006173 | Bacteria | 3258 |
| 227 | Ga0070716_100038710 | 3300006173 | Bacteria | 2642 |
| 228 | Ga0070712_100060074 | 3300006175 | Bacteria | 2679 |
| 229 | Ga0070712_100141188 | 3300006175 | Bacteria | 1838 |
| 230 | Ga0070712_100166059 | 3300006175 | Bacteria | 1709 |
| 231 | Ga0075362_10018572 | 3300006177 | Bacteria | 2880 |
| 232 | Ga0075367_10009757 | 3300006178 | Bacteria | 5028 |
| 233 | Ga0075367_10019907 | 3300006178 | Bacteria | 3729 |
| 234 | Ga0075367_10062759 | 3300006178 | Bacteria | 2220 |
| 235 | Ga0075369_10025683 | 3300006186 | Bacteria | 2451 |
| 236 | Ga0097621_100000504 | 3300006237 | Bacteria | 27335 |
| 237 | Ga0097621_100216422 | 3300006237 | Bacteria | 1668 |
| 238 | Ga0068871_100000815 | 3300006358 | Bacteria | 20895 |
| 239 | Ga0068871_100123836 | 3300006358 | Bacteria | 2186 |
| 240 | Ga0075433_10011448 | 3300006852 | Bacteria | 7145 |
| 241 | Ga0075434_100000244 | 3300006871 | Bacteria | 38039 |
| 242 | Ga0075434_100056527 | 3300006871 | Unclassified | 3900 |
| 243 | Ga0068865_100000332 | 3300006881 | Bacteria | 26180 |
| 244 | Ga0068865_100242097 | 3300006881 | Bacteria | 1420 |
| 245 | Ga0097620_100000894 | 3300006931 | Bacteria | 30361 |
| 246 | Ga0097620_100076272 | 3300006931 | Bacteria | 3393 |
| 247 | Ga0097620_100104582 | 3300006931 | Unclassified | 2890 |
| 248 | Ga0097620_100135034 | 3300006931 | Bacteria | 2540 |
| 249 | Ga0099794_10007686 | 3300007265 | Bacteria | 4442 |
| 250 | Ga0099794_10009781 | 3300007265 | Bacteria | 4048 |
| 251 | Ga0099795_10005073 | 3300007788 | Bacteria | 3466 |
| 252 | Ga0099795_10007212 | 3300007788 | Bacteria | 3087 |
| 253 | Ga0105251_10029811 | 3300009011 | Bacteria | 2745 |
| 254 | Ga0105250_10014671 | 3300009092 | Bacteria | 3216 |
| 255 | Ga0105240_10169358 | 3300009093 | Bacteria | 2588 |
| 256 | Ga0105240_10314210 | 3300009093 | Bacteria | 1788 |
| 257 | Ga0111539_10001076 | 3300009094 | Bacteria | 36048 |
| 258 | Ga0111539_10004346 | 3300009094 | Bacteria | 18556 |
| 259 | Ga0111539_10018601 | 3300009094 | Bacteria | 8607 |
| 260 | Ga0111539_10037099 | 3300009094 | Bacteria | 5889 |
| 261 | Ga0105245_10000451 | 3300009098 | Bacteria | 37705 |
| 262 | Ga0105245_10010020 | 3300009098 | Bacteria | 8252 |
| 263 | Ga0105247_10001016 | 3300009101 | Bacteria | 21159 |
| 264 | Ga0105247_10015146 | 3300009101 | Bacteria | 4623 |
| 265 | Ga0105247_10041969 | 3300009101 | Bacteria | 2800 |
| 266 | Ga0105247_10115949 | 3300009101 | Bacteria | 1729 |
| 267 | Ga0114129_10067676 | 3300009147 | Bacteria | 4981 |
| 268 | Ga0105243_10002173 | 3300009148 | Bacteria | 16567 |
| 269 | Ga0105243_10028538 | 3300009148 | Bacteria | 4284 |
| 270 | Ga0105241_10001549 | 3300009174 | Bacteria | 17620 |
| 271 | Ga0105241_10003089 | 3300009174 | Bacteria | 12402 |
| 272 | Ga0105241_10033060 | 3300009174 | Bacteria | 3881 |
| 273 | Ga0105241_10095469 | 3300009174 | Unclassified | 2354 |
| 274 | Ga0105242_10000947 | 3300009176 | Bacteria | 22652 |
| 275 | Ga0105242_10079700 | 3300009176 | Bacteria | 2735 |
| 276 | Ga0105248_10000837 | 3300009177 | Bacteria | 34570 |
| 277 | Ga0105248_10019175 | 3300009177 | Bacteria | 7568 |
| 278 | Ga0105248_10102973 | 3300009177 | Bacteria | 3217 |
| 279 | Ga0105248_10399841 | 3300009177 | Bacteria | 1547 |
| 280 | Ga0105237_10007227 | 3300009545 | Bacteria | 12185 |
| 281 | Ga0105237_10013803 | 3300009545 | Bacteria | 8455 |
| 282 | Ga0105237_10068310 | 3300009545 | Bacteria | 3547 |
| 283 | Ga0105237_10098472 | 3300009545 | Bacteria | 2915 |
| 284 | Ga0105237_10245793 | 3300009545 | Unclassified | 1791 |
| 285 | Ga0105238_10002126 | 3300009551 | Bacteria | 20001 |
| 286 | Ga0105238_10008316 | 3300009551 | Bacteria | 10376 |
| 287 | Ga0105238_10047126 | 3300009551 | Bacteria | 4347 |
| 288 | Ga0105249_10000976 | 3300009553 | Bacteria | 25338 |
| 289 | Ga0105249_10002863 | 3300009553 | Bacteria | 14901 |
| 290 | Ga0105249_10032554 | 3300009553 | Bacteria | 4717 |
| 291 | Ga0105249_10077505 | 3300009553 | Bacteria | 3082 |
| 292 | Ga0105249_10391717 | 3300009553 | Bacteria | 1418 |
| 293 | Ga0099796_10024353 | 3300010159 | Bacteria | 1900 |
| 294 | Ga0099796_10057587 | 3300010159 | Bacteria | 1367 |
| 295 | Ga0105239_10040227 | 3300010375 | Bacteria | 5123 |
| 296 | Ga0105239_10049131 | 3300010375 | Bacteria | 4626 |
| 297 | Ga0105239_10049768 | 3300010375 | Bacteria | 4595 |
| 298 | Ga0105239_10050199 | 3300010375 | Bacteria | 4576 |
| 299 | Ga0105239_10055969 | 3300010375 | Bacteria | 4327 |
| 300 | Ga0105239_10111085 | 3300010375 | Bacteria | 3038 |
| 301 | Ga0105239_10143485 | 3300010375 | Bacteria | 2662 |
| 302 | Ga0105239_10386026 | 3300010375 | Bacteria | 1584 |
| 303 | Ga0105239_10441185 | 3300010375 | Bacteria | 1476 |
| 304 | Ga0105246_10000100 | 3300011119 | Bacteria | 37689 |
| 305 | Ga0105246_10005103 | 3300011119 | Bacteria | 7987 |
| 306 | Ga0157373_10138365 | 3300013100 | Bacteria | 1712 |
| 307 | Ga0157371_10001676 | 3300013102 | Bacteria | 22625 |
| 308 | Ga0157370_10035405 | 3300013104 | Bacteria | 4852 |
| 309 | Ga0157374_10000956 | 3300013296 | Bacteria | 25071 |
| 310 | Ga0157374_10084181 | 3300013296 | Bacteria | 3023 |
| 311 | Ga0157378_10001544 | 3300013297 | Bacteria | 20818 |
| 312 | Ga0157378_10050788 | 3300013297 | Bacteria | 3689 |
| 313 | Ga0157378_10214547 | 3300013297 | Bacteria | 1826 |
| 314 | Ga0157378_10297262 | 3300013297 | Bacteria | 1561 |
| 315 | Ga0157378_10337345 | 3300013297 | Bacteria | 1469 |
| 316 | Ga0163162_10001003 | 3300013306 | Bacteria | 26222 |
| 317 | Ga0163162_10027342 | 3300013306 | Bacteria | 5641 |
| 318 | Ga0163162_10133725 | 3300013306 | Bacteria | 2590 |
| 319 | Ga0163162_10239709 | 3300013306 | Bacteria | 1944 |
| 320 | Ga0157372_10003782 | 3300013307 | Bacteria | 16248 |
| 321 | Ga0157375_10000464 | 3300013308 | Bacteria | 36915 |
| 322 | Ga0163163_10003318 | 3300014325 | Bacteria | 13651 |
| 323 | Ga0163163_10003907 | 3300014325 | Bacteria | 12711 |
| 324 | Ga0163163_10010710 | 3300014325 | Bacteria | 8266 |
| 325 | Ga0163163_10088226 | 3300014325 | Bacteria | 3113 |
| 326 | Ga0157380_10000145 | 3300014326 | Bacteria | 40211 |
| 327 | Ga0182008_10044170 | 3300014497 | Bacteria | 2217 |
| 328 | Ga0157377_10000179 | 3300014745 | Bacteria | 36682 |
| 329 | Ga0157379_10000067 | 3300014968 | Bacteria | 66051 |
| 330 | Ga0157379_10012965 | 3300014968 | Bacteria | 7293 |
| 331 | Ga0157376_10023037 | 3300014969 | Unclassified | 4866 |
| 332 | Ga0163161_10001462 | 3300017792 | Bacteria | 17455 |
| 333 | Ga0213876_10003374 | 3300021384 | Bacteria | 9140 |
| 334 | Ga0209677_101310 | 3300025253 | Bacteria | 11029 |
| 335 | Ga0209148_1003403 | 3300025254 | Bacteria | 4426 |
| 336 | Ga0209233_1007754 | 3300025261 | Bacteria | 3373 |
| 337 | Ga0207666_1000002 | 3300025271 | Bacteria | 62717 |
| 338 | Ga0207666_1000947 | 3300025271 | Bacteria | 3443 |
| 339 | Ga0209455_1005530 | 3300025272 | Bacteria | 3883 |
| 340 | Ga0209758_1007162 | 3300025297 | Bacteria | 7694 |
| 341 | Ga0207697_10000113 | 3300025315 | Bacteria | 37772 |
| 342 | Ga0207697_10053399 | 3300025315 | Bacteria | 1674 |
| 343 | Ga0207653_10001270 | 3300025885 | Bacteria | 8227 |
| 344 | Ga0207682_10000094 | 3300025893 | Bacteria | 41188 |
| 345 | Ga0207692_10000538 | 3300025898 | Bacteria | 13413 |
| 346 | Ga0207692_10001089 | 3300025898 | Bacteria | 9953 |
| 347 | Ga0207692_10041923 | 3300025898 | Bacteria | 2269 |
| 348 | Ga0207642_10014853 | 3300025899 | Bacteria | 2885 |
| 349 | Ga0207642_10049816 | 3300025899 | Bacteria | 1885 |
| 350 | Ga0207642_10151026 | 3300025899 | Bacteria | 1236 |
| 351 | Ga0207710_10000795 | 3300025900 | Bacteria | 17144 |
| 352 | Ga0207710_10022769 | 3300025900 | Bacteria | 2689 |
| 353 | Ga0207710_10023206 | 3300025900 | Bacteria | 2666 |
| 354 | Ga0207688_10000074 | 3300025901 | Bacteria | 37681 |
| 355 | Ga0207688_10019408 | 3300025901 | Bacteria | 3704 |
| 356 | Ga0207688_10141845 | 3300025901 | Bacteria | 1414 |
| 357 | Ga0207680_10010896 | 3300025903 | Bacteria | 4570 |
| 358 | Ga0207647_10000218 | 3300025904 | Bacteria | 46963 |
| 359 | Ga0207647_10015942 | 3300025904 | Bacteria | 5137 |
| 360 | Ga0207647_10025737 | 3300025904 | Bacteria | 3860 |
| 361 | Ga0207647_10048560 | 3300025904 | Bacteria | 2635 |
| 362 | Ga0207685_10013726 | 3300025905 | Bacteria | 2514 |
| 363 | Ga0207699_10000984 | 3300025906 | Bacteria | 13541 |
| 364 | Ga0207699_10001601 | 3300025906 | Bacteria | 10746 |
| 365 | Ga0207645_10000247 | 3300025907 | Bacteria | 44983 |
| 366 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 367 | Ga0207705_10148064 | 3300025909 | Bacteria | 1757 |
| 368 | Ga0207684_10019778 | 3300025910 | Bacteria | 5759 |
| 369 | Ga0207684_10228828 | 3300025910 | Unclassified | 1604 |
| 370 | Ga0207654_10000152 | 3300025911 | Bacteria | 43823 |
| 371 | Ga0207707_10000618 | 3300025912 | Bacteria | 35350 |
| 372 | Ga0207707_10008271 | 3300025912 | Bacteria | 9028 |
| 373 | Ga0207707_10377474 | 3300025912 | Bacteria | 1219 |
| 374 | Ga0207695_10003119 | 3300025913 | Bacteria | 23708 |
| 375 | Ga0207695_10019340 | 3300025913 | Bacteria | 7842 |
| 376 | Ga0207695_10045656 | 3300025913 | Bacteria | 4649 |
| 377 | Ga0207671_10010899 | 3300025914 | Bacteria | 7448 |
| 378 | Ga0207671_10014218 | 3300025914 | Bacteria | 6300 |
| 379 | Ga0207693_10000633 | 3300025915 | Bacteria | 31452 |
| 380 | Ga0207693_10008274 | 3300025915 | Bacteria | 8517 |
| 381 | Ga0207693_10072976 | 3300025915 | Bacteria | 2687 |
| 382 | Ga0207663_10010136 | 3300025916 | Bacteria | 5002 |
| 383 | Ga0207663_10021758 | 3300025916 | Bacteria | 3656 |
| 384 | Ga0207660_10000741 | 3300025917 | Bacteria | 21651 |
| 385 | Ga0207660_10006792 | 3300025917 | Bacteria | 7412 |
| 386 | Ga0207662_10000119 | 3300025918 | Bacteria | 37770 |
| 387 | Ga0207662_10002690 | 3300025918 | Bacteria | 8961 |
| 388 | Ga0207657_10000316 | 3300025919 | Bacteria | 51145 |
| 389 | Ga0207657_10059870 | 3300025919 | Bacteria | 3270 |
| 390 | Ga0207657_10133039 | 3300025919 | Bacteria | 2037 |
| 391 | Ga0207649_10000090 | 3300025920 | Bacteria | 75387 |
| 392 | Ga0207652_10000847 | 3300025921 | Bacteria | 29115 |
| 393 | Ga0207652_10046491 | 3300025921 | Bacteria | 3703 |
| 394 | Ga0207652_10154122 | 3300025921 | Bacteria | 2058 |
| 395 | Ga0207652_10338806 | 3300025921 | Unclassified | 1357 |
| 396 | Ga0207681_10000370 | 3300025923 | Bacteria | 31836 |
| 397 | Ga0207681_10037300 | 3300025923 | Bacteria | 3212 |
| 398 | Ga0207681_10077875 | 3300025923 | Bacteria | 2332 |
| 399 | Ga0207694_10000106 | 3300025924 | Bacteria | 88467 |
| 400 | Ga0207694_10110720 | 3300025924 | Bacteria | 2184 |
| 401 | Ga0207694_10124010 | 3300025924 | Bacteria | 2065 |
| 402 | Ga0207650_10017812 | 3300025925 | Bacteria | 4976 |
| 403 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 404 | Ga0207687_10000784 | 3300025927 | Bacteria | 21392 |
| 405 | Ga0207687_10022557 | 3300025927 | Bacteria | 4191 |
| 406 | Ga0207700_10048583 | 3300025928 | Bacteria | 3152 |
| 407 | Ga0207664_10014626 | 3300025929 | Bacteria | 5675 |
| 408 | Ga0207644_10001053 | 3300025931 | Bacteria | 17640 |
| 409 | Ga0207644_10055397 | 3300025931 | Bacteria | 2858 |
| 410 | Ga0207690_10000239 | 3300025932 | Bacteria | 39850 |
| 411 | Ga0207706_10000424 | 3300025933 | Bacteria | 45410 |
| 412 | Ga0207706_10045250 | 3300025933 | Bacteria | 3900 |
| 413 | Ga0207706_10078566 | 3300025933 | Bacteria | 2902 |
| 414 | Ga0207706_10123181 | 3300025933 | Bacteria | 2281 |
| 415 | Ga0207686_10001203 | 3300025934 | Bacteria | 15007 |
| 416 | Ga0207709_10000379 | 3300025935 | Bacteria | 44189 |
| 417 | Ga0207709_10004757 | 3300025935 | Bacteria | 7792 |
| 418 | Ga0207709_10010467 | 3300025935 | Bacteria | 5105 |
| 419 | Ga0207670_10000176 | 3300025936 | Bacteria | 42483 |
| 420 | Ga0207669_10000165 | 3300025937 | Bacteria | 31741 |
| 421 | Ga0207669_10018298 | 3300025937 | Bacteria | 3618 |
| 422 | Ga0207704_10001709 | 3300025938 | Bacteria | 9819 |
| 423 | Ga0207665_10003827 | 3300025939 | Bacteria | 10058 |
| 424 | Ga0207665_10004109 | 3300025939 | Bacteria | 9707 |
| 425 | Ga0207665_10022548 | 3300025939 | Bacteria | 4143 |
| 426 | Ga0207691_10000358 | 3300025940 | Bacteria | 46095 |
| 427 | Ga0207691_10044524 | 3300025940 | Bacteria | 4084 |
| 428 | Ga0207691_10045591 | 3300025940 | Bacteria | 4029 |
| 429 | Ga0207691_10117883 | 3300025940 | Bacteria | 2355 |
| 430 | Ga0207711_10000780 | 3300025941 | Bacteria | 31295 |
| 431 | Ga0207711_10043524 | 3300025941 | Unclassified | 3831 |
| 432 | Ga0207711_10148884 | 3300025941 | Bacteria | 2111 |
| 433 | Ga0207689_10000479 | 3300025942 | Bacteria | 37696 |
| 434 | Ga0207689_10022242 | 3300025942 | Bacteria | 5331 |
| 435 | Ga0207689_10057913 | 3300025942 | Bacteria | 3187 |
| 436 | Ga0207689_10192610 | 3300025942 | Bacteria | 1682 |
| 437 | Ga0207689_10341529 | 3300025942 | Bacteria | 1244 |
| 438 | Ga0207661_10000604 | 3300025944 | Bacteria | 22956 |
| 439 | Ga0207661_10088670 | 3300025944 | Bacteria | 2572 |
| 440 | Ga0207661_10092221 | 3300025944 | Bacteria | 2525 |
| 441 | Ga0207679_10000139 | 3300025945 | Bacteria | 59804 |
| 442 | Ga0207679_10135058 | 3300025945 | Bacteria | 1985 |
| 443 | Ga0207679_10159170 | 3300025945 | Bacteria | 1847 |
| 444 | Ga0207667_10003492 | 3300025949 | Bacteria | 19417 |
| 445 | Ga0207667_10011749 | 3300025949 | Bacteria | 10153 |
| 446 | Ga0207667_10034706 | 3300025949 | Bacteria | 5414 |
| 447 | Ga0207667_10095670 | 3300025949 | Bacteria | 3065 |
| 448 | Ga0207667_10121867 | 3300025949 | Unclassified | 2687 |
| 449 | Ga0207667_10223546 | 3300025949 | Bacteria | 1929 |
| 450 | Ga0207667_10233633 | 3300025949 | Bacteria | 1882 |
| 451 | Ga0207651_10000072 | 3300025960 | Bacteria | 46009 |
| 452 | Ga0207712_10000588 | 3300025961 | Bacteria | 29188 |
| 453 | Ga0207712_10038903 | 3300025961 | Bacteria | 3255 |
| 454 | Ga0207668_10000168 | 3300025972 | Bacteria | 45205 |
| 455 | Ga0207668_10019110 | 3300025972 | Bacteria | 4325 |
| 456 | Ga0207668_10066608 | 3300025972 | Bacteria | 2553 |
| 457 | Ga0207668_10068636 | 3300025972 | Plasmid | 2521 |
| 458 | Ga0207668_10235129 | 3300025972 | Bacteria | 1479 |
| 459 | Ga0207640_10000242 | 3300025981 | Bacteria | 37007 |
| 460 | Ga0207658_10000667 | 3300025986 | Bacteria | 29975 |
| 461 | Ga0207677_10004440 | 3300026023 | Bacteria | 7533 |
| 462 | Ga0207677_10076780 | 3300026023 | Bacteria | 2380 |
| 463 | Ga0207703_10000463 | 3300026035 | Bacteria | 42725 |
| 464 | Ga0207703_10219227 | 3300026035 | Bacteria | 1700 |
| 465 | Ga0207703_10222606 | 3300026035 | Bacteria | 1688 |
| 466 | Ga0207639_10000745 | 3300026041 | Bacteria | 22238 |
| 467 | Ga0207639_10047187 | 3300026041 | Bacteria | 3254 |
| 468 | Ga0207639_10088492 | 3300026041 | Bacteria | 2471 |
| 469 | Ga0207639_10109237 | 3300026041 | Bacteria | 2250 |
| 470 | Ga0207639_10308800 | 3300026041 | Bacteria | 1400 |
| 471 | Ga0207678_10000447 | 3300026067 | Bacteria | 37597 |
| 472 | Ga0207678_10033426 | 3300026067 | Bacteria | 4481 |
| 473 | Ga0207708_10000293 | 3300026075 | Bacteria | 39298 |
| 474 | Ga0207708_10001642 | 3300026075 | Bacteria | 16642 |
| 475 | Ga0207708_10053637 | 3300026075 | Bacteria | 3072 |
| 476 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 477 | Ga0207702_10007213 | 3300026078 | Bacteria | 9510 |
| 478 | Ga0207702_10358044 | 3300026078 | Bacteria | 1398 |
| 479 | Ga0207641_10000724 | 3300026088 | Bacteria | 35413 |
| 480 | Ga0207648_10000223 | 3300026089 | Bacteria | 61064 |
| 481 | Ga0207648_10248151 | 3300026089 | Bacteria | 1587 |
| 482 | Ga0207676_10000392 | 3300026095 | Bacteria | 37207 |
| 483 | Ga0207674_10000955 | 3300026116 | Bacteria | 37769 |
| 484 | Ga0207674_10015429 | 3300026116 | Bacteria | 8393 |
| 485 | Ga0207674_10038075 | 3300026116 | Bacteria | 4997 |
| 486 | Ga0207674_10043252 | 3300026116 | Bacteria | 4645 |
| 487 | Ga0207675_100000364 | 3300026118 | Bacteria | 43420 |
| 488 | Ga0207675_100015329 | 3300026118 | Bacteria | 7152 |
| 489 | Ga0207675_100019492 | 3300026118 | Bacteria | 6330 |
| 490 | Ga0207675_100024249 | 3300026118 | Bacteria | 5642 |
| 491 | Ga0207675_100038369 | 3300026118 | Bacteria | 4470 |
| 492 | Ga0207675_100094123 | 3300026118 | Bacteria | 2818 |
| 493 | Ga0207675_100236859 | 3300026118 | Bacteria | 1762 |
| 494 | Ga0207683_10000397 | 3300026121 | Bacteria | 39911 |
| 495 | Ga0207698_10003705 | 3300026142 | Bacteria | 9239 |
| 496 | Ga0207698_10007410 | 3300026142 | Bacteria | 6873 |
| 497 | Ga0207698_10132253 | 3300026142 | Bacteria | 2134 |
| 498 | Ga0207698_10157066 | 3300026142 | Bacteria | 1983 |
| 499 | Ga0209984_1002742 | 3300027424 | Unclassified | 1982 |
| 500 | Ga0209179_1001356 | 3300027512 | Bacteria | 2970 |
| 501 | Ga0209588_1010276 | 3300027671 | Bacteria | 2812 |
| 502 | Ga0209998_10000535 | 3300027717 | Bacteria | 10223 |
| 503 | Ga0209998_10012119 | 3300027717 | Bacteria | 1789 |
| 504 | Ga0209998_10012410 | 3300027717 | Bacteria | 1769 |
| 505 | Ga0209974_10001185 | 3300027876 | Bacteria | 9317 |
| 506 | Ga0209974_10039574 | 3300027876 | Unclassified | 1568 |
| 507 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 508 | Ga0207428_10000439 | 3300027907 | Bacteria | 50911 |
| 509 | Ga0268266_10001331 | 3300028379 | Bacteria | 29945 |
| 510 | Ga0268266_10001870 | 3300028379 | Bacteria | 23767 |
| 511 | Ga0268266_10008599 | 3300028379 | Bacteria | 9068 |
| 512 | Ga0268266_10094578 | 3300028379 | Bacteria | 2623 |
| 513 | Ga0268265_10001307 | 3300028380 | Bacteria | 21379 |
| 514 | Ga0268265_10016028 | 3300028380 | Bacteria | 5142 |
| 515 | Ga0268265_10016324 | 3300028380 | Bacteria | 5098 |
| 516 | Ga0268265_10052521 | 3300028380 | Bacteria | 3083 |
| 517 | Ga0268265_10300383 | 3300028380 | Bacteria | 1445 |
| 518 | Ga0268264_10000084 | 3300028381 | Bacteria | 242128 |
| 519 | Ga0268264_10000890 | 3300028381 | Bacteria | 31465 |
| 520 | Ga0268264_10055833 | 3300028381 | Bacteria | 3300 |
| 521 | Ga0268264_10120126 | 3300028381 | Bacteria | 2315 |
| 522 | Ga0265334_10036455 | 3300028573 | Bacteria | 1942 |
| 523 | Ga0265336_10005233 | 3300028666 | Bacteria | 4808 |
| 524 | Ga0307515_10260329 | 3300028794 | Bacteria | 1472 |
| 525 | Ga0265338_10000328 | 3300028800 | Bacteria | 86546 |
| 526 | Ga0307511_10091324 | 3300030521 | Bacteria | 2061 |
| 527 | Ga0265330_10007778 | 3300031235 | Bacteria | 5203 |
| 528 | Ga0265340_10005751 | 3300031247 | Bacteria | 6852 |
| 529 | Ga0265339_10008893 | 3300031249 | Bacteria | 6359 |
| 530 | Ga0265339_10039873 | 3300031249 | Bacteria | 2612 |
| 531 | Ga0307513_10208314 | 3300031456 | Bacteria | 1789 |
| 532 | Ga0307509_10022959 | 3300031507 | Bacteria | 7015 |
| 533 | Ga0307509_10033098 | 3300031507 | Bacteria | 5691 |
| 534 | Ga0307508_10000105 | 3300031616 | Bacteria | 99107 |
| 535 | Ga0265342_10050824 | 3300031712 | Bacteria | 2475 |
| 536 | Ga0307516_10006693 | 3300031730 | Bacteria | 13466 |
| 537 | Ga0307516_10029708 | 3300031730 | Bacteria | 5523 |
| 538 | Ga0307516_10117785 | 3300031730 | Bacteria | 2450 |
| 539 | Ga0307416_100169867 | 3300032002 | Bacteria | 2028 |
| 540 | Ga0307507_10041585 | 3300033179 | Bacteria | 4596 |
| 541 | Ga0307510_10021386 | 3300033180 | Bacteria | 7538 |
| 542 | Ga0373930_0000249 | 3300034816 | Bacteria | 6839 |
| 543 | Ga0373950_0000554 | 3300034818 | Bacteria | 4574 |
| 544 | Ga0373958_0000184 | 3300034819 | Bacteria | 7209 |
| 545 | Ga0373958_0000847 | 3300034819 | Bacteria | 3931 |
| 546 | Ga0373938_0007981 | 3300034957 | Unclassified | 1879 |
| 547 | Ga0373928_0000961 | 3300035084 | Bacteria | 5654 |
| 548 | Ga0373928_0014002 | 3300035084 | Bacteria | 1616 |
| 549 | Ga0373934_0013639 | 3300035086 | Bacteria | 3076 |
| 550 | Ga0373940_0000149 | 3300035088 | Bacteria | 9064 |
| 551 | Ga0373940_0009491 | 3300035088 | Bacteria | 2264 |
| 552 | Ga0373944_0002242 | 3300035089 | Bacteria | 4916 |
| 553 | Ga0373949_0000476 | 3300035090 | Bacteria | 13682 |
| 554 | Ga0373949_0006745 | 3300035090 | Bacteria | 2520 |
| 555 | Ga0373951_0000556 | 3300035091 | Bacteria | 10428 |
| 556 | Ga0373952_0000375 | 3300035092 | Bacteria | 7612 |
| 557 | Ga0373952_0000491 | 3300035092 | Bacteria | 6857 |
| 558 | Ga0373923_0001200 | 3300035111 | Bacteria | 7251 |
| 559 | Ga0373923_0004465 | 3300035111 | Bacteria | 4644 |
| 560 | Ga0373932_0000419 | 3300035112 | Bacteria | 12972 |
| 561 | Ga0373936_0002403 | 3300035113 | Bacteria | 7009 |
| 562 | Ga0373936_0010433 | 3300035113 | Bacteria | 3505 |
| 563 | Ga0373939_0000671 | 3300035114 | Bacteria | 8492 |
| 564 | Ga0373939_0001011 | 3300035114 | Bacteria | 6955 |
| 565 | Ga0373941_0000283 | 3300035115 | Bacteria | 9807 |
| 566 | Ga0373941_0002421 | 3300035115 | Bacteria | 4103 |
| 567 | Ga0373945_0013151 | 3300035116 | Bacteria | 2758 |
| 568 | Ga0373953_0000986 | 3300035117 | Bacteria | 7999 |
| 569 | Ga0373953_0013697 | 3300035117 | Bacteria | 2901 |
| 570 | Ga0373953_0017919 | 3300035117 | Bacteria | 2611 |
| 571 | Ga0373953_0097070 | 3300035117 | Bacteria | 1237 |
| 572 | Ga0373953_0108640 | 3300035117 | Bacteria | 1172 |
| 573 | Ga0373954_0000377 | 3300035118 | Bacteria | 16536 |
| 574 | Ga0373954_0034619 | 3300035118 | Bacteria | 2340 |
| 575 | Ga0373956_0002477 | 3300035119 | Bacteria | 7510 |
| 576 | Ga0373956_0007446 | 3300035119 | Bacteria | 4411 |
| 577 | Ga0373956_0044890 | 3300035119 | Bacteria | 1971 |
| 578 | Ga0373956_0046690 | 3300035119 | Bacteria | 1936 |
| 579 | Ga0373957_0000292 | 3300035120 | Bacteria | 12522 |
| 580 | Ga0373960_0000720 | 3300035121 | Bacteria | 6888 |
| 581 | Ga0373960_0001077 | 3300035121 | Bacteria | 5890 |
| 582 | Ga0373943_0001653 | 3300035170 | Bacteria | 10127 |
| 583 | Ga0373943_0004339 | 3300035170 | Bacteria | 6436 |
| 584 | Ga0373943_0005625 | 3300035170 | Bacteria | 5622 |
| 585 | Ga0373943_0019645 | 3300035170 | Bacteria | 3108 |
| 586 | Ga0373946_0014033 | 3300035171 | Bacteria | 3017 |
| 587 | Ga0373946_0017711 | 3300035171 | Bacteria | 2728 |
| 588 | Ga0373955_0000348 | 3300035172 | Bacteria | 19454 |
| 589 | Ga0373955_0066110 | 3300035172 | Bacteria | 2009 |
| 590 | Ga0373955_0096554 | 3300035172 | Bacteria | 1691 |
| 591 | Ga0373955_0099978 | 3300035172 | Unclassified | 1663 |
| 592 | Ga0373942_0002656 | 3300035207 | Bacteria | 4298 |
| 593 | Ga0373961_0001332 | 3300035241 | Bacteria | 7449 |
| 594 | Ga0373962_0005337 | 3300035242 | Bacteria | 3109 |
| 595 | Ga0373962_0014338 | 3300035242 | Bacteria | 2019 |
| 596 | Ga0373924_0014135 | 3300035410 | Bacteria | 3012 |
| 597 | Ga0373924_0034063 | 3300035410 | Bacteria | 2060 |
| 598 | Ga0373931_0000089 | 3300035691 | Bacteria | 42136 |
| 599 | Ga0373931_0003734 | 3300035691 | Bacteria | 6889 |
| 600 | Ga0373931_0046094 | 3300035691 | Bacteria | 2304 |
| 601 | Ga0373935_0007646 | 3300035692 | Bacteria | 6476 |
| 602 | Ga0373935_0008907 | 3300035692 | Bacteria | 6004 |
| 603 | Ga0373935_0032361 | 3300035692 | Bacteria | 3250 |
| 604 | Ga0373935_0064740 | 3300035692 | Bacteria | 2345 |
| 605 | Ga0373935_0086918 | 3300035692 | Bacteria | 2041 |
| 606 | Ga0373927_0000990 | 3300035695 | Bacteria | 21639 |
| 607 | Ga0373927_0008010 | 3300035695 | Bacteria | 7132 |
| 608 | Ga0373927_0066789 | 3300035695 | Bacteria | 2327 |
| 609 | Ga0373927_0152087 | 3300035695 | Bacteria | 1515 |
| 610 | Ga0373933_0004936 | 3300035724 | Bacteria | 7273 |
| 611 | Ga0373933_0034036 | 3300035724 | Bacteria | 2967 |
| 612 | Ga0373933_0048919 | 3300035724 | Bacteria | 2519 |
| 613 | Ga0373933_0096607 | 3300035724 | Bacteria | 1829 |
| 614 | Ga0373933_0220365 | 3300035724 | Bacteria | 1217 |
| 615 | Ga0373947_0001990 | 3300035725 | Bacteria | 12497 |
| 616 | Ga0373947_0038205 | 3300035725 | Bacteria | 2850 |
| 617 | Ga0373947_0106761 | 3300035725 | Bacteria | 1765 |
| 618 | Ga0373947_0109252 | 3300035725 | Bacteria | 1746 |
| 619 | Ga0373947_0272258 | 3300035725 | Bacteria | 1124 |
| 620 | Ga0373937_0006630 | 3300036401 | Bacteria | 9995 |
| 621 | Ga0373937_0061646 | 3300036401 | Bacteria | 3448 |
| 622 | Ga0373937_0089832 | 3300036401 | Bacteria | 2845 |
| 623 | Ga0373937_0134577 | 3300036401 | Bacteria | 2310 |
| 624 | Ga0373937_0156945 | 3300036401 | Bacteria | 2133 |
| 625 | Ga0373925_0000863 | 3300037068 | Bacteria | 27740 |
| 626 | Ga0373925_0004100 | 3300037068 | Bacteria | 11056 |
| 627 | Ga0373925_0046571 | 3300037068 | Bacteria | 3225 |
| 628 | Ga0373925_0074250 | 3300037068 | Bacteria | 2575 |
| 629 | Ga0373925_0078861 | 3300037068 | Bacteria | 2501 |
| 630 | Ga0395898_0441057 | 3300037466 | Bacteria | 1240 |
| 631 | Ga0395905_0170975 | 3300037471 | Bacteria | 2041 |
| 632 | Ga0395905_0332748 | 3300037471 | Bacteria | 1409 |
| 633 | Ga0436365_0245719 | 3300039437 | Bacteria | 27624 |
| 634 | Ga0436361_0192460 | 3300039447 | Bacteria | 2916 |
| 635 | Ga0436363_0021603 | 3300039450 | Bacteria | 2025 |
| 636 | Ga0436362_0125439 | 3300039453 | Bacteria | 8541 |
| 637 | Ga0451789_0437480 | 3300041443 | Bacteria | 1671 |
| 638 | Ga0451802_0821672 | 3300041460 | Bacteria | 1688 |
| 639 | Ga0451802_1192777 | 3300041460 | Bacteria | 1431 |
| 640 | Ga0439448_0033854 | 3300042005 | Unclassified | 1631 |
| 641 | Ga0439455_0005262 | 3300042012 | Bacteria | 2616 |
| 642 | Ga0466969_0129318 | 3300044656 | Bacteria | 1171 |
| 643 | Ga0453683_0012196 | 3300044673 | Bacteria | 5638 |
| 644 | Ga0466957_0062115 | 3300044842 | Bacteria | 2294 |
| 645 | Ga0451576_0153537 | 3300045051 | Bacteria | 2401 |
| 646 | Ga0495617_009150 | 3300046452 | Bacteria | 3407 |
| 647 | Ga0495627_068260 | 3300046453 | Bacteria | 1042 |
| 648 | Ga0495592_0001421 | 3300046454 | Bacteria | 16615 |
| 649 | Ga0495592_0049016 | 3300046454 | Bacteria | 3140 |
| 650 | Ga0495592_0051951 | 3300046454 | Bacteria | 3044 |
| 651 | Ga0495592_0058218 | 3300046454 | Bacteria | 2850 |
| 652 | Ga0495592_0061171 | 3300046454 | Bacteria | 2768 |
| 653 | Ga0495603_0000091 | 3300046455 | Bacteria | 41074 |
| 654 | Ga0495603_0007129 | 3300046455 | Bacteria | 6709 |
| 655 | Ga0495603_0042395 | 3300046455 | Bacteria | 2720 |
| 656 | Ga0495603_0156822 | 3300046455 | Bacteria | 1321 |
| 657 | Ga0495629_0000011 | 3300046459 | Bacteria | 268675 |
| 658 | Ga0495629_0000583 | 3300046459 | Bacteria | 29653 |
| 659 | Ga0495629_0002565 | 3300046459 | Bacteria | 13924 |
| 660 | Ga0495629_0029527 | 3300046459 | Bacteria | 3887 |
| 661 | Ga0495629_0062559 | 3300046459 | Bacteria | 2599 |
| 662 | Ga0495638_0019825 | 3300046460 | Bacteria | 4446 |
| 663 | Ga0495641_0003388 | 3300046461 | Bacteria | 11954 |
| 664 | Ga0495641_0016919 | 3300046461 | Bacteria | 3820 |
| 665 | Ga0495651_0012272 | 3300046462 | Bacteria | 6603 |
| 666 | Ga0495651_0017917 | 3300046462 | Bacteria | 5484 |
| 667 | Ga0495651_0057255 | 3300046462 | Bacteria | 2992 |
| 668 | Ga0495651_0232807 | 3300046462 | Bacteria | 1268 |
| 669 | Ga0495653_0021441 | 3300046463 | Bacteria | 5234 |
| 670 | Ga0495653_0021760 | 3300046463 | Bacteria | 5192 |
| 671 | Ga0495653_0051973 | 3300046463 | Bacteria | 3143 |
| 672 | Ga0495653_0120600 | 3300046463 | Bacteria | 1870 |
| 673 | Ga0495580_0009686 | 3300046472 | Bacteria | 7560 |
| 674 | Ga0495580_0019072 | 3300046472 | Bacteria | 5099 |
| 675 | Ga0495582_0000049 | 3300046473 | Bacteria | 59194 |
| 676 | Ga0495582_0010994 | 3300046473 | Bacteria | 4982 |
| 677 | Ga0495582_0054597 | 3300046473 | Bacteria | 2203 |
| 678 | Ga0495582_0253854 | 3300046473 | Bacteria | 1009 |
| 679 | Ga0495605_0044201 | 3300046474 | Bacteria | 2204 |
| 680 | Ga0495605_0089094 | 3300046474 | Bacteria | 1432 |
| 681 | Ga0495605_0095109 | 3300046474 | Bacteria | 1375 |
| 682 | Ga0495639_0000303 | 3300046475 | Bacteria | 23998 |
| 683 | Ga0495639_0000815 | 3300046475 | Bacteria | 14292 |
| 684 | Ga0495639_0026553 | 3300046475 | Bacteria | 2560 |
| 685 | Ga0495639_0052876 | 3300046475 | Bacteria | 1849 |
| 686 | Ga0495662_0000387 | 3300046476 | Bacteria | 19598 |
| 687 | Ga0495662_0015027 | 3300046476 | Bacteria | 3761 |
| 688 | Ga0495662_0134505 | 3300046476 | Unclassified | 1216 |
| 689 | Ga0495664_0002459 | 3300046477 | Bacteria | 9973 |
| 690 | Ga0495664_0009480 | 3300046477 | Bacteria | 5449 |
| 691 | Ga0495584_0021432 | 3300046491 | Bacteria | 3283 |
| 692 | Ga0495584_0027251 | 3300046491 | Bacteria | 2895 |
| 693 | Ga0495584_0152203 | 3300046491 | Bacteria | 1175 |
| 694 | Ga0495585_0004147 | 3300046492 | Bacteria | 9483 |
| 695 | Ga0495585_0057680 | 3300046492 | Bacteria | 2142 |
| 696 | Ga0495585_0159766 | 3300046492 | Bacteria | 1170 |
| 697 | Ga0495594_0000641 | 3300046499 | Bacteria | 18022 |
| 698 | Ga0495594_0020339 | 3300046499 | Bacteria | 3535 |
| 699 | Ga0495594_0026882 | 3300046499 | Bacteria | 3098 |
| 700 | Ga0495607_0022202 | 3300046501 | Bacteria | 3990 |
| 701 | Ga0495583_0038379 | 3300046506 | Bacteria | 2263 |
| 702 | Ga0495583_0107340 | 3300046506 | Bacteria | 1186 |
| 703 | Ga0495608_0011931 | 3300046511 | Bacteria | 6042 |
| 704 | Ga0495608_0012258 | 3300046511 | Bacteria | 5954 |
| 705 | Ga0495608_0061334 | 3300046511 | Bacteria | 2473 |
| 706 | Ga0495610_0047845 | 3300046512 | Bacteria | 2102 |
| 707 | Ga0495616_0016601 | 3300046513 | Bacteria | 4072 |
| 708 | Ga0495616_0061922 | 3300046513 | Bacteria | 1834 |
| 709 | Ga0495618_0017431 | 3300046514 | Bacteria | 4404 |
| 710 | Ga0495618_0269276 | 3300046514 | Unclassified | 1065 |
| 711 | Ga0495628_0012236 | 3300046516 | Bacteria | 7233 |
| 712 | Ga0495628_0053918 | 3300046516 | Bacteria | 3171 |
| 713 | Ga0495628_0155743 | 3300046516 | Unclassified | 1738 |
| 714 | Ga0495630_0045453 | 3300046517 | Bacteria | 3281 |
| 715 | Ga0495631_0033478 | 3300046518 | Bacteria | 2308 |
| 716 | Ga0495632_0051846 | 3300046519 | Bacteria | 2018 |
| 717 | Ga0495643_0081441 | 3300046522 | Bacteria | 1683 |
| 718 | Ga0495644_0002015 | 3300046523 | Bacteria | 8171 |
| 719 | Ga0495648_0000436 | 3300046524 | Bacteria | 45329 |
| 720 | Ga0495648_0053962 | 3300046524 | Bacteria | 2431 |
| 721 | Ga0495648_0091052 | 3300046524 | Bacteria | 1707 |
| 722 | Ga0495663_0013129 | 3300046525 | Bacteria | 2315 |
| 723 | Ga0495666_0001631 | 3300046526 | Bacteria | 11046 |
| 724 | Ga0495666_0017973 | 3300046526 | Bacteria | 3521 |
| 725 | Ga0495652_0055002 | 3300046529 | Bacteria | 3386 |
| 726 | Ga0495652_0067614 | 3300046529 | Bacteria | 2995 |
| 727 | Ga0495652_0078831 | 3300046529 | Bacteria | 2725 |
| 728 | Ga0495652_0096797 | 3300046529 | Bacteria | 2402 |
| 729 | Ga0495665_0000101 | 3300046531 | Bacteria | 40147 |
| 730 | Ga0495640_0003445 | 3300046533 | Bacteria | 12727 |
| 731 | Ga0495640_0016301 | 3300046533 | Bacteria | 5562 |
| 732 | Ga0495640_0048081 | 3300046533 | Bacteria | 2950 |
| 733 | Ga0495640_0050502 | 3300046533 | Bacteria | 2865 |
| 734 | Ga0495640_0098440 | 3300046533 | Bacteria | 1922 |
| 735 | Ga0495640_0254266 | 3300046533 | Bacteria | 1099 |
| 736 | Ga0495586_0000755 | 3300046535 | Bacteria | 18590 |
| 737 | Ga0495587_0013085 | 3300046536 | Bacteria | 5217 |
| 738 | Ga0495587_0016782 | 3300046536 | Bacteria | 4552 |
| 739 | Ga0495587_0075499 | 3300046536 | Bacteria | 1957 |
| 740 | Ga0495598_0006129 | 3300046537 | Bacteria | 2701 |
| 741 | Ga0495598_0019419 | 3300046537 | Bacteria | 1782 |
| 742 | Ga0495609_0094471 | 3300046538 | Bacteria | 1298 |
| 743 | Ga0495645_0002559 | 3300046543 | Bacteria | 12352 |
| 744 | Ga0495645_0004167 | 3300046543 | Bacteria | 9882 |
| 745 | Ga0495622_0004249 | 3300046557 | Bacteria | 6671 |
| 746 | Ga0495622_0007367 | 3300046557 | Bacteria | 5105 |
| 747 | Ga0495622_0059416 | 3300046557 | Bacteria | 1770 |
| 748 | Ga0495633_0080437 | 3300046558 | Bacteria | 1516 |
| 749 | Ga0495667_0013983 | 3300046559 | Bacteria | 5419 |
| 750 | Ga0495667_0020621 | 3300046559 | Bacteria | 4446 |
| 751 | Ga0495667_0035233 | 3300046559 | Bacteria | 3345 |
| 752 | Ga0495667_0066122 | 3300046559 | Bacteria | 2364 |
| 753 | Ga0495656_0000562 | 3300046615 | Bacteria | 12127 |
| 754 | Ga0495656_0168225 | 3300046615 | Bacteria | 1070 |
| 755 | Ga0495668_0023571 | 3300046616 | Bacteria | 3507 |
| 756 | Ga0495668_0085540 | 3300046616 | Bacteria | 1729 |
| 757 | Ga0495668_0229152 | 3300046616 | Bacteria | 1017 |
| 758 | Ga0495634_0000267 | 3300046642 | Bacteria | 49323 |
| 759 | Ga0495634_0150493 | 3300046642 | Unclassified | 1472 |
| 760 | Ga0495611_0004220 | 3300046648 | Bacteria | 6257 |
| 761 | Ga0495611_0070779 | 3300046648 | Bacteria | 1594 |
| 762 | Ga0495611_0077025 | 3300046648 | Bacteria | 1529 |
| 763 | Ga0495625_0042249 | 3300046660 | Bacteria | 3314 |
| 764 | Ga0495625_0114974 | 3300046660 | Bacteria | 1836 |
| 765 | Ga0495625_0172313 | 3300046660 | Bacteria | 1444 |
| 766 | Ga0495635_0000084 | 3300046663 | Bacteria | 56456 |
| 767 | Ga0495635_0006470 | 3300046663 | Bacteria | 8168 |
| 768 | Ga0495635_0009263 | 3300046663 | Bacteria | 6877 |
| 769 | Ga0495635_0015264 | 3300046663 | Bacteria | 5373 |
| 770 | Ga0495635_0015655 | 3300046663 | Bacteria | 5297 |
| 771 | Ga0495635_0092474 | 3300046663 | Bacteria | 2068 |
| 772 | Ga0495659_0029506 | 3300046664 | Bacteria | 1905 |
| 773 | Ga0495661_0054221 | 3300046665 | Bacteria | 2408 |
| 774 | Ga0495588_0004581 | 3300046674 | Bacteria | 6109 |
| 775 | Ga0495657_0017064 | 3300046675 | Bacteria | 5276 |
| 776 | Ga0495657_0084392 | 3300046675 | Unclassified | 2049 |
| 777 | Ga0495657_0136886 | 3300046675 | Bacteria | 1530 |
| 778 | Ga0495599_0035912 | 3300046678 | Bacteria | 3110 |
| 779 | Ga0495599_0043703 | 3300046678 | Bacteria | 2812 |
| 780 | Ga0495599_0092688 | 3300046678 | Bacteria | 1885 |
| 781 | Ga0495623_0014573 | 3300046679 | Bacteria | 5085 |
| 782 | Ga0495623_0200844 | 3300046679 | Bacteria | 1146 |
| 783 | Ga0495646_0006452 | 3300046680 | Bacteria | 7439 |
| 784 | Ga0495646_0009027 | 3300046680 | Bacteria | 6323 |
| 785 | Ga0495646_0023402 | 3300046680 | Bacteria | 3890 |
| 786 | Ga0495646_0024146 | 3300046680 | Bacteria | 3829 |
| 787 | Ga0495647_0003483 | 3300046681 | Bacteria | 5034 |
| 788 | Ga0495647_0007118 | 3300046681 | Bacteria | 3736 |
| 789 | Ga0495647_0076376 | 3300046681 | Bacteria | 1350 |
| 790 | Ga0495658_0000173 | 3300046683 | Bacteria | 36536 |
| 791 | Ga0495658_0057813 | 3300046683 | Bacteria | 2216 |
| 792 | Ga0495669_0024503 | 3300046684 | Bacteria | 2627 |
| 793 | Ga0495613_0005231 | 3300046689 | Bacteria | 9747 |
| 794 | Ga0495613_0011762 | 3300046689 | Bacteria | 6504 |
| 795 | Ga0495613_0025072 | 3300046689 | Bacteria | 4444 |
| 796 | Ga0495613_0128414 | 3300046689 | Bacteria | 1816 |
| 797 | Ga0495624_0001263 | 3300046690 | Bacteria | 19959 |
| 798 | Ga0495624_0078806 | 3300046690 | Bacteria | 2043 |
| 799 | Ga0495670_0006473 | 3300046691 | Bacteria | 5755 |
| 800 | Ga0495670_0032727 | 3300046691 | Bacteria | 2586 |
| 801 | Ga0495670_0100940 | 3300046691 | Bacteria | 1486 |
| 802 | Ga0495671_0036879 | 3300046692 | Bacteria | 2475 |
| 803 | Ga0495671_0108984 | 3300046692 | Bacteria | 1352 |
| 804 | Ga0495649_0108048 | 3300046694 | Bacteria | 1476 |
| 805 | Ga0495589_0071633 | 3300046794 | Bacteria | 1693 |
| 806 | Ga0495589_0075273 | 3300046794 | Bacteria | 1646 |
| 807 | Ga0495600_0007694 | 3300046809 | Bacteria | 6599 |
| 808 | Ga0495600_0040507 | 3300046809 | Bacteria | 3034 |
| 809 | Ga0495600_0074224 | 3300046809 | Bacteria | 2221 |
| 810 | Ga0495600_0197010 | 3300046809 | Bacteria | 1294 |
| 811 | Ga0495660_0084157 | 3300046810 | Bacteria | 1664 |
| 812 | Ga0495660_0145671 | 3300046810 | Bacteria | 1174 |
| 813 | Ga0495581_0000864 | 3300047315 | Bacteria | 16170 |
| 814 | Ga0495581_0008649 | 3300047315 | Bacteria | 5897 |
| 815 | Ga0495581_0188756 | 3300047315 | Unclassified | 1205 |
| 816 | Ga0495604_0010756 | 3300047317 | Bacteria | 7265 |
| 817 | Ga0495604_0015977 | 3300047317 | Bacteria | 5993 |
| 818 | Ga0495604_0045948 | 3300047317 | Bacteria | 3406 |
| 819 | Ga0495674_0049391 | 3300047319 | Bacteria | 3718 |
| 820 | Ga0495674_0118586 | 3300047319 | Bacteria | 2237 |
| 821 | Ga0495672_0063988 | 3300047320 | Bacteria | 2108 |
| 822 | Ga0495676_0004982 | 3300047321 | Bacteria | 12177 |
| 823 | Ga0495676_0016365 | 3300047321 | Bacteria | 6586 |
| 824 | Ga0495676_0029827 | 3300047321 | Bacteria | 4638 |
| 825 | Ga0495676_0062408 | 3300047321 | Bacteria | 2909 |
| 826 | Ga0495676_0126239 | 3300047321 | Bacteria | 1854 |
| 827 | Ga0495680_0001934 | 3300047322 | Bacteria | 21789 |
| 828 | Ga0495680_0018136 | 3300047322 | Bacteria | 5985 |
| 829 | Ga0495680_0020444 | 3300047322 | Bacteria | 5570 |
| 830 | Ga0495680_0029773 | 3300047322 | Bacteria | 4467 |
| 831 | Ga0495680_0054136 | 3300047322 | Bacteria | 3117 |
| 832 | Ga0495680_0186033 | 3300047322 | Unclassified | 1496 |
| 833 | Ga0495680_0227149 | 3300047322 | Bacteria | 1330 |
| 834 | Ga0495683_0144769 | 3300047323 | Bacteria | 1111 |
| 835 | Ga0495675_0000862 | 3300047444 | Bacteria | 18517 |
| 836 | Ga0495675_0044349 | 3300047444 | Unclassified | 2833 |
| 837 | Ga0495675_0142250 | 3300047444 | Bacteria | 1486 |
| 838 | Ga0495675_0249785 | 3300047444 | Bacteria | 1066 |
| 839 | Ga0495679_011605 | 3300047446 | Bacteria | 3389 |
| 840 | Ga0495681_0075638 | 3300047470 | Bacteria | 1515 |
| 841 | Ga0495684_0000701 | 3300047471 | Bacteria | 26925 |
| 842 | Ga0495684_0041413 | 3300047471 | Bacteria | 3530 |
| 843 | Ga0495684_0145506 | 3300047471 | Bacteria | 1775 |
| 844 | Ga0495593_0000016 | 3300047673 | Bacteria | 80178 |
| 845 | Ga0495593_0026325 | 3300047673 | Bacteria | 3212 |
| 846 | Ga0495593_0060225 | 3300047673 | Unclassified | 1988 |
| 847 | Ga0495602_0011145 | 3300048088 | Bacteria | 9305 |
| 848 | Ga0495602_0022469 | 3300048088 | Bacteria | 6173 |
| 849 | Ga0495602_0152802 | 3300048088 | Bacteria | 1812 |
| 850 | Ga0495614_0071916 | 3300048089 | Bacteria | 1491 |
| 851 | Ga0496100_0000200 | 3300048903 | Bacteria | 32909 |
| 852 | Ga0496100_0060876 | 3300048903 | Bacteria | 2486 |
| 853 | Ga0496100_0337258 | 3300048903 | Bacteria | 1136 |
| 854 | Ga0496101_0000339 | 3300048904 | Bacteria | 31619 |
| 855 | Ga0496102_0000729 | 3300048905 | Bacteria | 32340 |
| 856 | Ga0496102_0016911 | 3300048905 | Bacteria | 6383 |
| 857 | Ga0496102_0032117 | 3300048905 | Bacteria | 4716 |
| 858 | Ga0496102_0054713 | 3300048905 | Bacteria | 3640 |
| 859 | Ga0496102_0290402 | 3300048905 | Bacteria | 1541 |
| 860 | Ga0496102_0336808 | 3300048905 | Bacteria | 1421 |
| 861 | Ga0496103_0001639 | 3300048906 | Bacteria | 14682 |
| 862 | Ga0496104_0002526 | 3300048907 | Bacteria | 15766 |
| 863 | Ga0496104_0330946 | 3300048907 | Bacteria | 1436 |
| 864 | Ga0496104_0482350 | 3300048907 | Bacteria | 1151 |
| 865 | Ga0496105_0044036 | 3300048908 | Bacteria | 3680 |
| 866 | Ga0496105_0233258 | 3300048908 | Bacteria | 1495 |
| 867 | Ga0496106_0000202 | 3300048909 | Bacteria | 41819 |
| 868 | Ga0496106_0005687 | 3300048909 | Bacteria | 9220 |
| 869 | Ga0496106_0064478 | 3300048909 | Bacteria | 2787 |
| 870 | Ga0496106_0072449 | 3300048909 | Bacteria | 2635 |
| 871 | Ga0496106_0188979 | 3300048909 | Bacteria | 1637 |
| 872 | Ga0496106_0394675 | 3300048909 | Bacteria | 1112 |
| 873 | Ga0496107_0000066 | 3300048910 | Bacteria | 52207 |
| 874 | Ga0496107_0010112 | 3300048910 | Bacteria | 6545 |
| 875 | Ga0496108_0009303 | 3300048911 | Bacteria | 7954 |
| 876 | Ga0496108_0011418 | 3300048911 | Bacteria | 7221 |
| 877 | Ga0496108_0015918 | 3300048911 | Bacteria | 6130 |
| 878 | Ga0496108_0043555 | 3300048911 | Bacteria | 3749 |
| 879 | Ga0496109_0000595 | 3300048912 | Bacteria | 30262 |
| 880 | Ga0496109_0020680 | 3300048912 | Bacteria | 5814 |
| 881 | Ga0496109_0038245 | 3300048912 | Bacteria | 4337 |
| 882 | Ga0496109_0099281 | 3300048912 | Bacteria | 2700 |
| 883 | Ga0496109_0143391 | 3300048912 | Bacteria | 2234 |
| 884 | Ga0496110_0064886 | 3300048913 | Bacteria | 3228 |
| 885 | Ga0496110_0253987 | 3300048913 | Unclassified | 1600 |
| 886 | Ga0496111_0016577 | 3300048914 | Bacteria | 5080 |
| 887 | Ga0496112_0005122 | 3300048915 | Bacteria | 11265 |
| 888 | Ga0496112_0007966 | 3300048915 | Bacteria | 9447 |
| 889 | Ga0496112_0013236 | 3300048915 | Bacteria | 7612 |
| 890 | Ga0496112_0043635 | 3300048915 | Unclassified | 4390 |
| 891 | Ga0496112_0205776 | 3300048915 | Bacteria | 1926 |
| 892 | Ga0496113_0008065 | 3300048916 | Bacteria | 6834 |
| 893 | Ga0496113_0041677 | 3300048916 | Bacteria | 3389 |
| 894 | Ga0496113_0420805 | 3300048916 | Bacteria | 1073 |
| 895 | Ga0496114_0023336 | 3300048917 | Bacteria | 5048 |
| 896 | Ga0496114_0248749 | 3300048917 | Bacteria | 1564 |
| 897 | Ga0496115_0001197 | 3300048918 | Bacteria | 18589 |
| 898 | Ga0496115_0022519 | 3300048918 | Bacteria | 4883 |
| 899 | Ga0496115_0058265 | 3300048918 | Bacteria | 3108 |
| 900 | Ga0496115_0102550 | 3300048918 | Bacteria | 2347 |
| 901 | Ga0496116_0151268 | 3300048919 | Bacteria | 1289 |
| 902 | Ga0496117_0035051 | 3300048920 | Bacteria | 3773 |
| 903 | Ga0496118_0002112 | 3300048921 | Bacteria | 27854 |
| 904 | Ga0496118_0052143 | 3300048921 | Bacteria | 3124 |
| 905 | Ga0496118_0071969 | 3300048921 | Bacteria | 2486 |
| 906 | Ga0496118_0180623 | 3300048921 | Bacteria | 1275 |
| 907 | Ga0496121_0000077 | 3300048924 | Bacteria | 235293 |
| 908 | Ga0496121_0030446 | 3300048924 | Bacteria | 4956 |
| 909 | Ga0496121_0048141 | 3300048924 | Bacteria | 3630 |
| 910 | Ga0496121_0081538 | 3300048924 | Bacteria | 2560 |
| 911 | Ga0496121_0089776 | 3300048924 | Bacteria | 2404 |
| 912 | Ga0496121_0098951 | 3300048924 | Bacteria | 2255 |
| 913 | Ga0496121_0173892 | 3300048924 | Bacteria | 1561 |
| 914 | Ga0496122_0035498 | 3300048925 | Bacteria | 4054 |
| 915 | Ga0496124_0002375 | 3300048927 | Bacteria | 24818 |
| 916 | Ga0496124_0121758 | 3300048927 | Bacteria | 2084 |
| 917 | Ga0496125_0048124 | 3300048928 | Bacteria | 3559 |
| 918 | Ga0496125_0062411 | 3300048928 | Bacteria | 2980 |
| 919 | Ga0496125_0154636 | 3300048928 | Bacteria | 1569 |
| 920 | Ga0496126_0006024 | 3300048929 | Bacteria | 13609 |
| 921 | Ga0496126_0018133 | 3300048929 | Bacteria | 6986 |
| 922 | Ga0496126_0026244 | 3300048929 | Bacteria | 5588 |
| 923 | Ga0496126_0034951 | 3300048929 | Bacteria | 4713 |
| 924 | Ga0496126_0051994 | 3300048929 | Bacteria | 3727 |
| 925 | Ga0496126_0155440 | 3300048929 | Bacteria | 1958 |
| 926 | Ga0496126_0180962 | 3300048929 | Bacteria | 1791 |
| 927 | Ga0496126_0203176 | 3300048929 | Bacteria | 1672 |
| 928 | Ga0496126_0408124 | 3300048929 | Bacteria | 1100 |
| 929 | Ga0501031_0038357 | 3300049568 | Bacteria | 3126 |
| 930 | Ga0501031_0139413 | 3300049568 | Bacteria | 1585 |
| 931 | Ga0501031_0192239 | 3300049568 | Bacteria | 1333 |
| 932 | Ga0501032_0093040 | 3300049569 | Bacteria | 1999 |
| 933 | Ga0501033_0030031 | 3300049570 | Bacteria | 4084 |
| 934 | Ga0501034_0032996 | 3300049571 | Bacteria | 5257 |
| 935 | Ga0501037_0014466 | 3300049573 | Bacteria | 5807 |
| 936 | Ga0501037_0049800 | 3300049573 | Bacteria | 3067 |
| 937 | Ga0501038_0012458 | 3300049574 | Bacteria | 7772 |
| 938 | Ga0501039_0008471 | 3300049575 | Bacteria | 7840 |
| 939 | Ga0501039_0078299 | 3300049575 | Bacteria | 2571 |
| 940 | Ga0501040_0006582 | 3300049576 | Bacteria | 7539 |
| 941 | Ga0501040_0077037 | 3300049576 | Bacteria | 2307 |
| 942 | Ga0501042_0014951 | 3300049578 | Bacteria | 5306 |
| 943 | Ga0501043_0067091 | 3300049579 | Bacteria | 2817 |
| 944 | Ga0501047_0092278 | 3300049581 | Bacteria | 2906 |
| 945 | Ga0501048_0010834 | 3300049582 | Bacteria | 6796 |
| 946 | Ga0501067_0003500 | 3300049583 | Bacteria | 8633 |
| 947 | Ga0501067_0014400 | 3300049583 | Bacteria | 4379 |
| 948 | Ga0501067_0048239 | 3300049583 | Bacteria | 2362 |
| 949 | Ga0501068_0005171 | 3300049584 | Bacteria | 7117 |
| 950 | Ga0501068_0127201 | 3300049584 | Bacteria | 1592 |
| 951 | Ga0501069_0032536 | 3300049585 | Bacteria | 2871 |
| 952 | Ga0501069_0044001 | 3300049585 | Bacteria | 2472 |
| 953 | Ga0501070_0021264 | 3300049586 | Bacteria | 5445 |
| 954 | Ga0501070_0021894 | 3300049586 | Bacteria | 5356 |
| 955 | Ga0501071_0268885 | 3300049587 | Bacteria | 1288 |
| 956 | Ga0501072_0030261 | 3300049588 | Bacteria | 4234 |
| 957 | Ga0501073_0000701 | 3300049589 | Bacteria | 23621 |
| 958 | Ga0501073_0014223 | 3300049589 | Bacteria | 5779 |
| 959 | Ga0501074_0088728 | 3300049590 | Bacteria | 2215 |
| 960 | Ga0501075_0075879 | 3300049591 | Bacteria | 2542 |
| 961 | Ga0501077_0075666 | 3300049593 | Unclassified | 2132 |
| 962 | Ga0501079_0022790 | 3300049741 | Bacteria | 4807 |
| 963 | Ga0501079_0070801 | 3300049741 | Bacteria | 2693 |
| 964 | Ga0501079_0374500 | 3300049741 | Bacteria | 1116 |
| 965 | Ga0501080_0149095 | 3300049742 | Bacteria | 2162 |
| 966 | Ga0501083_0031342 | 3300049744 | Bacteria | 3649 |
| 967 | Ga0501083_0061060 | 3300049744 | Unclassified | 2517 |
| 968 | Ga0501044_0103701 | 3300049823 | Bacteria | 2858 |
| 969 | Ga0501045_0002697 | 3300049824 | Bacteria | 12118 |
| 970 | nmdc:mga03n38_6006_c1 | 3300050490 | Bacteria | 4186 |
| 971 | nmdc:mga06z11_121961_c1 | 3300050494 | Bacteria | 1455 |
| 972 | nmdc:mga06z11_13965_c1 | 3300050494 | Bacteria | 3542 |
| 973 | nmdc:mga06z11_15652_c1 | 3300050494 | Bacteria | 3391 |
| 974 | nmdc:mga07m45_62937_c1 | 3300050496 | Bacteria | 2104 |
| 975 | nmdc:mga05p37_124219_c1 | 3300050507 | Bacteria | 3170 |
| 976 | nmdc:mga05p37_272266_c1 | 3300050507 | Bacteria | 2022 |
| 977 | nmdc:mga08y16_214543_c1 | 3300050511 | Bacteria | 1993 |
| 978 | nmdc:mga08y16_2489_c1 | 3300050511 | Bacteria | 18925 |
| 979 | nmdc:mga08y16_3164_c1 | 3300050511 | Bacteria | 17060 |
| 980 | nmdc:mga08y16_56024_c1 | 3300050511 | Unclassified | 4120 |
| 981 | nmdc:mga08y16_8401_c1 | 3300050511 | Bacteria | 10806 |
| 982 | nmdc:mga0n895_275928_c1 | 3300050512 | Bacteria | 1705 |
| 983 | nmdc:mga0n895_381_c1 | 3300050512 | Bacteria | 30014 |
| 984 | nmdc:mga0a205_2432_c1 | 3300050515 | Bacteria | 16422 |
| 985 | nmdc:mga0a205_472178_c1 | 3300050515 | Unclassified | 1113 |
| 986 | nmdc:mga0a205_49895_c1 | 3300050515 | Bacteria | 4041 |
| 987 | nmdc:mga0sz30_20613_c2 | 3300050516 | Bacteria | 1507 |
| 988 | Ga0495601_0005443 | 3300053077 | Bacteria | 7417 |
| 989 | Ga0495601_0007975 | 3300053077 | Bacteria | 6235 |
| 990 | Ga0495601_0340549 | 3300053077 | Bacteria | 975 |
| 991 | Ga0495612_0013688 | 3300053078 | Bacteria | 3267 |
| 992 | Ga0495612_0013901 | 3300053078 | Bacteria | 3243 |
| 993 | Ga0500635_0004635 | 3300053080 | Bacteria | 3549 |
| 994 | Ga0500635_0010920 | 3300053080 | Bacteria | 2567 |
| 995 | Ga0500635_0022158 | 3300053080 | Bacteria | 1966 |
| 996 | Ga0495595_0001767 | 3300053084 | Bacteria | 8441 |
| 997 | Ga0495595_0003811 | 3300053084 | Bacteria | 6003 |
| 998 | Ga0495595_0006384 | 3300053084 | Bacteria | 4806 |
| 999 | Ga0495619_0000308 | 3300053085 | Bacteria | 34461 |
| 1000 | Ga0495619_0016450 | 3300053085 | Bacteria | 4682 |
| 1001 | Ga0495619_0043597 | 3300053085 | Bacteria | 2941 |
| 1002 | Ga0495619_0175450 | 3300053085 | Bacteria | 1482 |
| 1003 | Ga0500646_0010209 | 3300053090 | Bacteria | 2408 |
| 1004 | Ga0500566_0069485 | 3300053094 | Bacteria | 1979 |
| 1005 | Ga0500641_0002055 | 3300053096 | Bacteria | 7147 |
| 1006 | Ga0500650_0079712 | 3300053098 | Bacteria | 1531 |
| 1007 | Ga0500554_000935 | 3300053102 | Bacteria | 5693 |
| 1008 | Ga0500556_0026238 | 3300053104 | Bacteria | 1934 |
| 1009 | Ga0500572_000056 | 3300053111 | Bacteria | 34105 |
| 1010 | Ga0500595_043425 | 3300053119 | Bacteria | 1431 |
| 1011 | Ga0500655_006959 | 3300053133 | Bacteria | 2033 |
| 1012 | Ga0500658_0044292 | 3300053134 | Bacteria | 1795 |
| 1013 | Ga0500559_0000423 | 3300053136 | Bacteria | 30084 |
| 1014 | Ga0500588_0029484 | 3300053146 | Bacteria | 1565 |
| 1015 | Ga0500603_032165 | 3300053150 | Bacteria | 1359 |
| 1016 | Ga0500634_0066796 | 3300053161 | Bacteria | 1893 |
| 1017 | Ga0500639_009475 | 3300053163 | Bacteria | 5091 |
| 1018 | Ga0500637_0054269 | 3300053178 | Bacteria | 2287 |
| 1019 | Ga0500637_0096258 | 3300053178 | Bacteria | 1715 |
| 1020 | Ga0500637_0136517 | 3300053178 | Bacteria | 1420 |
| 1021 | Ga0500645_009336 | 3300053730 | Bacteria | 3297 |
| 1022 | Ga0500596_000256 | 3300053735 | Bacteria | 9337 |
| 1023 | Ga0500596_000710 | 3300053735 | Bacteria | 6513 |
| 1024 | Ga0501084_0034204 | 3300054114 | Bacteria | 4249 |
| 1025 | Ga0501082_0054566 | 3300060353 | Bacteria | 3444 |
| 1026 | Ga0501082_0176206 | 3300060353 | Bacteria | 1859 |
| 1027 | Ga0501082_0299150 | 3300060353 | Unclassified | 1401 |
| 1028 | Ga0466962_0160947 | 3300061719 | Bacteria | 1091 |
| 1029 | Ga0530510_0032958 | 3300061734 | Bacteria | 3728 |
| 1030 | 2513673985 | 2513237098 | Bacteria | 9902361 |
| 1031 | 2513696000 | 2513237101 | Bacteria | 7952346 |
| 1032 | 2524470026 | 2524023210 | Bacteria | 9029266 |
| 1033 | 2723846234 | 2721755755 | Bacteria | 8322773 |
| 1034 | 2793080550 | |||
| 1035 | 2874610805 | 2874604998 | Bacteria | 7834745 |
| 1036 | 2879118885 | 2879110137 | Bacteria | 8907982 |
| 1037 | 2885386359 | 2885383462 | Bacteria | 9473874 |
| 1038 | 2889039323 | 2889033259 | Bacteria | 9099371 |
| 1039 | 2903771403 | 2903768456 | Bacteria | 9749579 |
| 1040 | 2922362035 | 2922361189 | Bacteria | 7436256 |
| 1041 | 2922389810 | 2922386360 | Bacteria | 7017218 |
| 1042 | 8006964608 | 8006964411 | Bacteria | 8966052 |
| 1043 | 8006991236 | 8006984368 | Bacteria | 9651211 |
| 1044 | 8006999975 | 8006994254 | Bacteria | 8309700 |
| 1045 | 8056680387 | 8056673599 | Bacteria | 7871253 |
| 1046 | 8056683137 | 8056681323 | Bacteria | 8472857 |
| 1047 | Ga0466966_0043517 | |||
| 1048 | 2214544922 | |||
| 1049 | ARcpr5oldR_c000056 | |||
| 1050 | ARSoilYngRDRAFT_c00038 | |||
| 1051 | ARcpr5yngRDRAFT_c000037 | |||
| 1052 | ARSoilOldRDRAFT_c000060 | |||
| 1053 | ARCol0oldRDRAFT_c00065 | |||
| 1054 | CNAas_1002143 | |||
| 1055 | ARCol0yngRDRAFT_1000262 | |||
| 1056 | JGI24736J21556_1008999 | |||
| 1057 | JGI24752J21851_1004571 | |||
| 1058 | JGI24746J21847_1000770 | |||
| 1059 | JGI24747J21853_1001345 | |||
| 1060 | JGI24739J22299_10001705 | |||
| 1061 | JGI24737J22298_10000400 | |||
| 1062 | JGI24737J22298_10002365 | |||
| 1063 | JGI24743J22301_10008225 | |||
| 1064 | JGI24750J21931_1000217 | |||
| 1065 | JGI24745J21846_1000133 | |||
| 1066 | JGI24748J21848_1002725 | |||
| 1067 | JGI24738J21930_10000277 | |||
| 1068 | JGI24744J21845_10000893 | |||
| 1069 | JGI24035J26624_1000096 | |||
| 1070 | JGI24742J22300_10000345 | |||
| 1071 | JGI24751J29686_10004930 | |||
| 1072 | JGI25153J46596_10003096 | |||
| 1073 | rootH2_10164564 | |||
| 1074 | JGI25405J52794_10001360 | |||
| 1075 | JGI25405J52794_10002356 | |||
| 1076 | Ga0065704_10077082 | |||
| 1077 | Ga0065712_10006696 | |||
| 1078 | Ga0065712_10071749 | |||
| 1079 | Ga0065712_10098936 | |||
| 1080 | Ga0065715_10001161 | |||
| 1081 | Ga0065715_10131782 | |||
| 1082 | Ga0070658_10174508 | |||
| 1083 | Ga0070658_10210823 | |||
| 1084 | Ga0070676_10000813 | |||
| 1085 | Ga0070683_100000240 | |||
| 1086 | Ga0070683_100066349 | |||
| 1087 | Ga0070683_100327347 | |||
| 1088 | Ga0070690_100000428 | |||
| 1089 | Ga0070690_100028240 | |||
| 1090 | Ga0070690_100077522 | |||
| 1091 | Ga0070670_100048534 | |||
| 1092 | Ga0070677_10000294 | |||
| 1093 | Ga0068869_100000189 | |||
| 1094 | Ga0068869_100019911 | |||
| 1095 | Ga0068869_100021975 | |||
| 1096 | Ga0070666_10017675 | |||
| 1097 | Ga0070666_10269350 | |||
| 1098 | Ga0070680_100025642 | |||
| 1099 | Ga0070680_100046905 | |||
| 1100 | Ga0070680_100064986 | |||
| 1101 | Ga0070682_100000202 | |||
| 1102 | Ga0070682_100175815 | |||
| 1103 | Ga0068868_100000614 | |||
| 1104 | Ga0068868_100049205 | |||
| 1105 | Ga0070660_100000223 | |||
| 1106 | Ga0070660_100011233 | |||
| 1107 | Ga0070660_100027221 | |||
| 1108 | Ga0070660_100131688 | |||
| 1109 | Ga0070660_100319570 | |||
| 1110 | Ga0070689_100000187 | |||
| 1111 | Ga0070691_10003410 | |||
| 1112 | Ga0070691_10027437 | |||
| 1113 | Ga0070691_10061506 | |||
| 1114 | Ga0070687_100000200 | |||
| 1115 | Ga0070661_100000298 | |||
| 1116 | Ga0070692_10000016 | |||
| 1117 | Ga0070668_100051691 | |||
| 1118 | Ga0070668_100056874 | |||
| 1119 | Ga0070668_100088836 | |||
| 1120 | Ga0070668_100127841 | |||
| 1121 | Ga0070669_100001525 | |||
| 1122 | Ga0070675_100000215 | |||
| 1123 | Ga0070675_100387630 | |||
| 1124 | Ga0070671_100000402 | |||
| 1125 | Ga0070671_100100481 | |||
| 1126 | Ga0070674_100000511 | |||
| 1127 | Ga0070674_100049852 | |||
| 1128 | Ga0070673_100000035 | |||
| 1129 | Ga0070673_100243554 | |||
| 1130 | Ga0070688_100000130 | |||
| 1131 | Ga0070688_100000837 | |||
| 1132 | Ga0070659_100000583 | |||
| 1133 | Ga0070659_100064239 | |||
| 1134 | Ga0070659_100104482 | |||
| 1135 | Ga0070667_100000712 | |||
| 1136 | Ga0070667_100381390 | |||
| 1137 | Ga0070703_10004424 | |||
| 1138 | Ga0070709_10000625 | |||
| 1139 | Ga0070709_10001920 | |||
| 1140 | Ga0070714_100008485 | |||
| 1141 | Ga0070713_100008487 | |||
| 1142 | Ga0070713_100216547 | |||
| 1143 | Ga0070710_10000834 | |||
| 1144 | Ga0070710_10006043 | |||
| 1145 | Ga0070710_10071343 | |||
| 1146 | Ga0070701_10000081 | |||
| 1147 | Ga0070701_10005239 | |||
| 1148 | Ga0070701_10149198 | |||
| 1149 | Ga0070711_100000773 | |||
| 1150 | Ga0070711_100002593 | |||
| 1151 | Ga0070705_100002491 | |||
| 1152 | Ga0070700_100027063 | |||
| 1153 | Ga0070694_100000129 | |||
| 1154 | Ga0070694_100031644 | |||
| 1155 | Ga0070694_100042284 | |||
| 1156 | Ga0070694_100151364 | |||
| 1157 | Ga0070663_100016592 | |||
| 1158 | Ga0070663_100041781 | |||
| 1159 | Ga0070663_100042996 | |||
| 1160 | Ga0070678_100023973 | |||
| 1161 | Ga0070662_100000933 | |||
| 1162 | Ga0070662_100024884 | |||
| 1163 | Ga0070662_100037881 | |||
| 1164 | Ga0070662_100202938 | |||
| 1165 | Ga0070662_100219442 | |||
| 1166 | Ga0070681_10001286 | |||
| 1167 | Ga0068867_100000369 | |||
| 1168 | Ga0068867_100203912 | |||
| 1169 | Ga0070706_100033904 | |||
| 1170 | Ga0070698_100020555 | |||
| 1171 | Ga0070698_100352531 | |||
| 1172 | Ga0070699_100000003 | |||
| 1173 | Ga0070699_100157602 | |||
| 1174 | Ga0070679_100000553 | |||
| 1175 | Ga0070679_100012149 | |||
| 1176 | Ga0070679_100148843 | |||
| 1177 | Ga0070684_100000246 | |||
| 1178 | Ga0070684_100004778 | |||
| 1179 | Ga0070684_100067615 | |||
| 1180 | Ga0070697_100050991 | |||
| 1181 | Ga0068853_100000243 | |||
| 1182 | Ga0068853_100053503 | |||
| 1183 | Ga0070672_100000157 | |||
| 1184 | Ga0070672_100026481 | |||
| 1185 | Ga0070672_100030913 | |||
| 1186 | Ga0070686_100000260 | |||
| 1187 | Ga0070686_100070937 | |||
| 1188 | Ga0070686_100186981 | |||
| 1189 | Ga0070686_100229675 | |||
| 1190 | Ga0070695_100001653 | |||
| 1191 | Ga0070695_100024912 | |||
| 1192 | Ga0070695_100111657 | |||
| 1193 | Ga0070696_100006359 | |||
| 1194 | Ga0070696_100017316 | |||
| 1195 | Ga0070696_100244732 | |||
| 1196 | Ga0070693_100005607 | |||
| 1197 | Ga0070665_100007892 | |||
| 1198 | Ga0070665_100014837 | |||
| 1199 | Ga0070665_100096914 | |||
| 1200 | Ga0070704_100000171 | |||
| 1201 | Ga0070704_100005236 | |||
| 1202 | Ga0068855_100001637 | |||
| 1203 | Ga0068855_100005012 | |||
| 1204 | Ga0068855_100163498 | |||
| 1205 | Ga0068855_100208345 | |||
| 1206 | Ga0068855_100305002 | |||
| 1207 | Ga0070664_100000269 | |||
| 1208 | Ga0070664_100290171 | |||
| 1209 | Ga0068857_100000174 | |||
| 1210 | Ga0068857_100027809 | |||
| 1211 | Ga0068854_100000211 | |||
| 1212 | Ga0068854_100044425 | |||
| 1213 | Ga0068854_100145194 | |||
| 1214 | Ga0068856_100000600 | |||
| 1215 | Ga0068856_100421857 | |||
| 1216 | Ga0070702_100000312 | |||
| 1217 | Ga0070702_100027299 | |||
| 1218 | Ga0068852_100003615 | |||
| 1219 | Ga0068852_100015387 | |||
| 1220 | Ga0068852_100060621 | |||
| 1221 | Ga0068852_100267487 | |||
| 1222 | Ga0068859_100000894 | |||
| 1223 | Ga0068859_100076274 | |||
| 1224 | Ga0068859_100104579 | |||
| 1225 | Ga0068859_100135028 | |||
| 1226 | Ga0068864_100000329 | |||
| 1227 | Ga0068864_100016060 | |||
| 1228 | Ga0068866_10000177 | |||
| 1229 | Ga0068861_100000329 | |||
| 1230 | Ga0068861_100022570 | |||
| 1231 | Ga0068861_100065282 | |||
| 1232 | Ga0068861_100094617 | |||
| 1233 | Ga0068861_100122970 | |||
| 1234 | Ga0068851_10002336 | |||
| 1235 | Ga0068851_10020010 | |||
| 1236 | Ga0068851_10035065 | |||
| 1237 | Ga0068870_10000056 | |||
| 1238 | Ga0068863_100000278 | |||
| 1239 | Ga0068863_100324847 | |||
| 1240 | Ga0068858_100001048 | |||
| 1241 | Ga0068858_100061574 | |||
| 1242 | Ga0068858_100076154 | |||
| 1243 | Ga0068858_100152128 | |||
| 1244 | Ga0068860_100000149 | |||
| 1245 | Ga0068860_100000985 | |||
| 1246 | Ga0068860_100030464 | |||
| 1247 | Ga0068860_100092315 | |||
| 1248 | Ga0068862_100000593 | |||
| 1249 | Ga0068862_100016002 | |||
| 1250 | Ga0068862_100039915 | |||
| 1251 | Ga0081455_10001601 | |||
| 1252 | Ga0081455_10001818 | |||
| 1253 | Ga0081455_10004887 | |||
| 1254 | Ga0081455_10006854 | |||
| 1255 | Ga0081455_10020372 | |||
| 1256 | Ga0081455_10058657 | |||
| 1257 | Ga0081538_10038173 | |||
| 1258 | Ga0081540_1002358 | |||
| 1259 | Ga0081540_1002564 | |||
| 1260 | Ga0081540_1007041 | |||
| 1261 | Ga0081540_1019943 | |||
| 1262 | Ga0081540_1023695 | |||
| 1263 | Ga0081540_1050507 | |||
| 1264 | Ga0081539_10034119 | |||
| 1265 | Ga0070717_10004617 | |||
| 1266 | Ga0075368_10011454 | |||
| 1267 | Ga0075368_10011795 | |||
| 1268 | Ga0075363_100030366 | |||
| 1269 | Ga0075364_10044632 | |||
| 1270 | Ga0070715_10000830 | |||
| 1271 | Ga0070716_100002010 | |||
| 1272 | Ga0070716_100023686 | |||
| 1273 | Ga0070716_100038710 | |||
| 1274 | Ga0070712_100060074 | |||
| 1275 | Ga0070712_100141188 | |||
| 1276 | Ga0070712_100166059 | |||
| 1277 | Ga0075362_10018572 | |||
| 1278 | Ga0075367_10009757 | |||
| 1279 | Ga0075367_10019907 | |||
| 1280 | Ga0075367_10062759 | |||
| 1281 | Ga0075369_10025683 | |||
| 1282 | Ga0097621_100000504 | |||
| 1283 | Ga0097621_100216422 | |||
| 1284 | Ga0068871_100000815 | |||
| 1285 | Ga0068871_100123836 | |||
| 1286 | Ga0075433_10011448 | |||
| 1287 | Ga0075434_100000244 | |||
| 1288 | Ga0075434_100056527 | |||
| 1289 | Ga0068865_100000332 | |||
| 1290 | Ga0068865_100242097 | |||
| 1291 | Ga0097620_100000894 | |||
| 1292 | Ga0097620_100076272 | |||
| 1293 | Ga0097620_100104582 | |||
| 1294 | Ga0097620_100135034 | |||
| 1295 | Ga0099794_10007686 | |||
| 1296 | Ga0099794_10009781 | |||
| 1297 | Ga0099795_10005073 | |||
| 1298 | Ga0099795_10007212 | |||
| 1299 | Ga0105251_10029811 | |||
| 1300 | Ga0105250_10014671 | |||
| 1301 | Ga0105240_10169358 | |||
| 1302 | Ga0105240_10314210 | |||
| 1303 | Ga0111539_10001076 | |||
| 1304 | Ga0111539_10004346 | |||
| 1305 | Ga0111539_10018601 | |||
| 1306 | Ga0111539_10037099 | |||
| 1307 | Ga0105245_10000451 | |||
| 1308 | Ga0105245_10010020 | |||
| 1309 | Ga0105247_10001016 | |||
| 1310 | Ga0105247_10015146 | |||
| 1311 | Ga0105247_10041969 | |||
| 1312 | Ga0105247_10115949 | |||
| 1313 | Ga0114129_10067676 | |||
| 1314 | Ga0105243_10002173 | |||
| 1315 | Ga0105243_10028538 | |||
| 1316 | Ga0105241_10001549 | |||
| 1317 | Ga0105241_10003089 | |||
| 1318 | Ga0105241_10033060 | |||
| 1319 | Ga0105241_10095469 | |||
| 1320 | Ga0105242_10000947 | |||
| 1321 | Ga0105242_10079700 | |||
| 1322 | Ga0105248_10000837 | |||
| 1323 | Ga0105248_10019175 | |||
| 1324 | Ga0105248_10102973 | |||
| 1325 | Ga0105248_10399841 | |||
| 1326 | Ga0105237_10007227 | |||
| 1327 | Ga0105237_10013803 | |||
| 1328 | Ga0105237_10068310 | |||
| 1329 | Ga0105237_10098472 | |||
| 1330 | Ga0105237_10245793 | |||
| 1331 | Ga0105238_10002126 | |||
| 1332 | Ga0105238_10008316 | |||
| 1333 | Ga0105238_10047126 | |||
| 1334 | Ga0105249_10000976 | |||
| 1335 | Ga0105249_10002863 | |||
| 1336 | Ga0105249_10032554 | |||
| 1337 | Ga0105249_10077505 | |||
| 1338 | Ga0105249_10391717 | |||
| 1339 | Ga0099796_10024353 | |||
| 1340 | Ga0099796_10057587 | |||
| 1341 | Ga0105239_10040227 | |||
| 1342 | Ga0105239_10049131 | |||
| 1343 | Ga0105239_10049768 | |||
| 1344 | Ga0105239_10050199 | |||
| 1345 | Ga0105239_10055969 | |||
| 1346 | Ga0105239_10111085 | |||
| 1347 | Ga0105239_10143485 | |||
| 1348 | Ga0105239_10386026 | |||
| 1349 | Ga0105239_10441185 | |||
| 1350 | Ga0105246_10000100 | |||
| 1351 | Ga0105246_10005103 | |||
| 1352 | Ga0157373_10138365 | |||
| 1353 | Ga0157371_10001676 | |||
| 1354 | Ga0157370_10035405 | |||
| 1355 | Ga0157374_10000956 | |||
| 1356 | Ga0157374_10084181 | |||
| 1357 | Ga0157378_10001544 | |||
| 1358 | Ga0157378_10050788 | |||
| 1359 | Ga0157378_10214547 | |||
| 1360 | Ga0157378_10297262 | |||
| 1361 | Ga0157378_10337345 | |||
| 1362 | Ga0163162_10001003 | |||
| 1363 | Ga0163162_10027342 | |||
| 1364 | Ga0163162_10133725 | |||
| 1365 | Ga0163162_10239709 | |||
| 1366 | Ga0157372_10003782 | |||
| 1367 | Ga0157375_10000464 | |||
| 1368 | Ga0163163_10003318 | |||
| 1369 | Ga0163163_10003907 | |||
| 1370 | Ga0163163_10010710 | |||
| 1371 | Ga0163163_10088226 | |||
| 1372 | Ga0157380_10000145 | |||
| 1373 | Ga0182008_10044170 | |||
| 1374 | Ga0157377_10000179 | |||
| 1375 | Ga0157379_10000067 | |||
| 1376 | Ga0157379_10012965 | |||
| 1377 | Ga0157376_10023037 | |||
| 1378 | Ga0163161_10001462 | |||
| 1379 | Ga0213876_10003374 | |||
| 1380 | Ga0209677_101310 | |||
| 1381 | Ga0209148_1003403 | |||
| 1382 | Ga0209233_1007754 | |||
| 1383 | Ga0207666_1000002 | |||
| 1384 | Ga0207666_1000947 | |||
| 1385 | Ga0209455_1005530 | |||
| 1386 | Ga0209758_1007162 | |||
| 1387 | Ga0207697_10000113 | |||
| 1388 | Ga0207697_10053399 | |||
| 1389 | Ga0207653_10001270 | |||
| 1390 | Ga0207682_10000094 | |||
| 1391 | Ga0207692_10000538 | |||
| 1392 | Ga0207692_10001089 | |||
| 1393 | Ga0207692_10041923 | |||
| 1394 | Ga0207642_10014853 | |||
| 1395 | Ga0207642_10049816 | |||
| 1396 | Ga0207642_10151026 | |||
| 1397 | Ga0207710_10000795 | |||
| 1398 | Ga0207710_10022769 | |||
| 1399 | Ga0207710_10023206 | |||
| 1400 | Ga0207688_10000074 | |||
| 1401 | Ga0207688_10019408 | |||
| 1402 | Ga0207688_10141845 | |||
| 1403 | Ga0207680_10010896 | |||
| 1404 | Ga0207647_10000218 | |||
| 1405 | Ga0207647_10015942 | |||
| 1406 | Ga0207647_10025737 | |||
| 1407 | Ga0207647_10048560 | |||
| 1408 | Ga0207685_10013726 | |||
| 1409 | Ga0207699_10000984 | |||
| 1410 | Ga0207699_10001601 | |||
| 1411 | Ga0207645_10000247 | |||
| 1412 | Ga0207643_10000004 | |||
| 1413 | Ga0207705_10148064 | |||
| 1414 | Ga0207684_10019778 | |||
| 1415 | Ga0207684_10228828 | |||
| 1416 | Ga0207654_10000152 | |||
| 1417 | Ga0207707_10000618 | |||
| 1418 | Ga0207707_10008271 | |||
| 1419 | Ga0207707_10377474 | |||
| 1420 | Ga0207695_10003119 | |||
| 1421 | Ga0207695_10019340 | |||
| 1422 | Ga0207695_10045656 | |||
| 1423 | Ga0207671_10010899 | |||
| 1424 | Ga0207671_10014218 | |||
| 1425 | Ga0207693_10000633 | |||
| 1426 | Ga0207693_10008274 | |||
| 1427 | Ga0207693_10072976 | |||
| 1428 | Ga0207663_10010136 | |||
| 1429 | Ga0207663_10021758 | |||
| 1430 | Ga0207660_10000741 | |||
| 1431 | Ga0207660_10006792 | |||
| 1432 | Ga0207662_10000119 | |||
| 1433 | Ga0207662_10002690 | |||
| 1434 | Ga0207657_10000316 | |||
| 1435 | Ga0207657_10059870 | |||
| 1436 | Ga0207657_10133039 | |||
| 1437 | Ga0207649_10000090 | |||
| 1438 | Ga0207652_10000847 | |||
| 1439 | Ga0207652_10046491 | |||
| 1440 | Ga0207652_10154122 | |||
| 1441 | Ga0207652_10338806 | |||
| 1442 | Ga0207681_10000370 | |||
| 1443 | Ga0207681_10037300 | |||
| 1444 | Ga0207681_10077875 | |||
| 1445 | Ga0207694_10000106 | |||
| 1446 | Ga0207694_10110720 | |||
| 1447 | Ga0207694_10124010 | |||
| 1448 | Ga0207650_10017812 | |||
| 1449 | Ga0207659_10000038 | |||
| 1450 | Ga0207687_10000784 | |||
| 1451 | Ga0207687_10022557 | |||
| 1452 | Ga0207700_10048583 | |||
| 1453 | Ga0207664_10014626 | |||
| 1454 | Ga0207644_10001053 | |||
| 1455 | Ga0207644_10055397 | |||
| 1456 | Ga0207690_10000239 | |||
| 1457 | Ga0207706_10000424 | |||
| 1458 | Ga0207706_10045250 | |||
| 1459 | Ga0207706_10078566 | |||
| 1460 | Ga0207706_10123181 | |||
| 1461 | Ga0207686_10001203 | |||
| 1462 | Ga0207709_10000379 | |||
| 1463 | Ga0207709_10004757 | |||
| 1464 | Ga0207709_10010467 | |||
| 1465 | Ga0207670_10000176 | |||
| 1466 | Ga0207669_10000165 | |||
| 1467 | Ga0207669_10018298 | |||
| 1468 | Ga0207704_10001709 | |||
| 1469 | Ga0207665_10003827 | |||
| 1470 | Ga0207665_10004109 | |||
| 1471 | Ga0207665_10022548 | |||
| 1472 | Ga0207691_10000358 | |||
| 1473 | Ga0207691_10044524 | |||
| 1474 | Ga0207691_10045591 | |||
| 1475 | Ga0207691_10117883 | |||
| 1476 | Ga0207711_10000780 | |||
| 1477 | Ga0207711_10043524 | |||
| 1478 | Ga0207711_10148884 | |||
| 1479 | Ga0207689_10000479 | |||
| 1480 | Ga0207689_10022242 | |||
| 1481 | Ga0207689_10057913 | |||
| 1482 | Ga0207689_10192610 | |||
| 1483 | Ga0207689_10341529 | |||
| 1484 | Ga0207661_10000604 | |||
| 1485 | Ga0207661_10088670 | |||
| 1486 | Ga0207661_10092221 | |||
| 1487 | Ga0207679_10000139 | |||
| 1488 | Ga0207679_10135058 | |||
| 1489 | Ga0207679_10159170 | |||
| 1490 | Ga0207667_10003492 | |||
| 1491 | Ga0207667_10011749 | |||
| 1492 | Ga0207667_10034706 | |||
| 1493 | Ga0207667_10095670 | |||
| 1494 | Ga0207667_10121867 | |||
| 1495 | Ga0207667_10223546 | |||
| 1496 | Ga0207667_10233633 | |||
| 1497 | Ga0207651_10000072 | |||
| 1498 | Ga0207712_10000588 | |||
| 1499 | Ga0207712_10038903 | |||
| 1500 | Ga0207668_10000168 | |||
| 1501 | Ga0207668_10019110 | |||
| 1502 | Ga0207668_10066608 | |||
| 1503 | Ga0207668_10068636 | |||
| 1504 | Ga0207668_10235129 | |||
| 1505 | Ga0207640_10000242 | |||
| 1506 | Ga0207658_10000667 | |||
| 1507 | Ga0207677_10004440 | |||
| 1508 | Ga0207677_10076780 | |||
| 1509 | Ga0207703_10000463 | |||
| 1510 | Ga0207703_10219227 | |||
| 1511 | Ga0207703_10222606 | |||
| 1512 | Ga0207639_10000745 | |||
| 1513 | Ga0207639_10047187 | |||
| 1514 | Ga0207639_10088492 | |||
| 1515 | Ga0207639_10109237 | |||
| 1516 | Ga0207639_10308800 | |||
| 1517 | Ga0207678_10000447 | |||
| 1518 | Ga0207678_10033426 | |||
| 1519 | Ga0207708_10000293 | |||
| 1520 | Ga0207708_10001642 | |||
| 1521 | Ga0207708_10053637 | |||
| 1522 | Ga0207702_10000004 | |||
| 1523 | Ga0207702_10007213 | |||
| 1524 | Ga0207702_10358044 | |||
| 1525 | Ga0207641_10000724 | |||
| 1526 | Ga0207648_10000223 | |||
| 1527 | Ga0207648_10248151 | |||
| 1528 | Ga0207676_10000392 | |||
| 1529 | Ga0207674_10000955 | |||
| 1530 | Ga0207674_10015429 | |||
| 1531 | Ga0207674_10038075 | |||
| 1532 | Ga0207674_10043252 | |||
| 1533 | Ga0207675_100000364 | |||
| 1534 | Ga0207675_100015329 | |||
| 1535 | Ga0207675_100019492 | |||
| 1536 | Ga0207675_100024249 | |||
| 1537 | Ga0207675_100038369 | |||
| 1538 | Ga0207675_100094123 | |||
| 1539 | Ga0207675_100236859 | |||
| 1540 | Ga0207683_10000397 | |||
| 1541 | Ga0207698_10003705 | |||
| 1542 | Ga0207698_10007410 | |||
| 1543 | Ga0207698_10132253 | |||
| 1544 | Ga0207698_10157066 | |||
| 1545 | Ga0209984_1002742 | |||
| 1546 | Ga0209179_1001356 | |||
| 1547 | Ga0209588_1010276 | |||
| 1548 | Ga0209998_10000535 | |||
| 1549 | Ga0209998_10012119 | |||
| 1550 | Ga0209998_10012410 | |||
| 1551 | Ga0209974_10001185 | |||
| 1552 | Ga0209974_10039574 | |||
| 1553 | Ga0207428_10000164 | |||
| 1554 | Ga0207428_10000439 | |||
| 1555 | Ga0268266_10001331 | |||
| 1556 | Ga0268266_10001870 | |||
| 1557 | Ga0268266_10008599 | |||
| 1558 | Ga0268266_10094578 | |||
| 1559 | Ga0268265_10001307 | |||
| 1560 | Ga0268265_10016028 | |||
| 1561 | Ga0268265_10016324 | |||
| 1562 | Ga0268265_10052521 | |||
| 1563 | Ga0268265_10300383 | |||
| 1564 | Ga0268264_10000084 | |||
| 1565 | Ga0268264_10000890 | |||
| 1566 | Ga0268264_10055833 | |||
| 1567 | Ga0268264_10120126 | |||
| 1568 | Ga0265334_10036455 | |||
| 1569 | Ga0265336_10005233 | |||
| 1570 | Ga0307515_10260329 | |||
| 1571 | Ga0265338_10000328 | |||
| 1572 | Ga0307511_10091324 | |||
| 1573 | Ga0265330_10007778 | |||
| 1574 | Ga0265340_10005751 | |||
| 1575 | Ga0265339_10008893 | |||
| 1576 | Ga0265339_10039873 | |||
| 1577 | Ga0307513_10208314 | |||
| 1578 | Ga0307509_10022959 | |||
| 1579 | Ga0307509_10033098 | |||
| 1580 | Ga0307508_10000105 | |||
| 1581 | Ga0265342_10050824 | |||
| 1582 | Ga0307516_10006693 | |||
| 1583 | Ga0307516_10029708 | |||
| 1584 | Ga0307516_10117785 | |||
| 1585 | Ga0307416_100169867 | |||
| 1586 | Ga0307507_10041585 | |||
| 1587 | Ga0307510_10021386 | |||
| 1588 | Ga0373930_0000249 | |||
| 1589 | Ga0373950_0000554 | |||
| 1590 | Ga0373958_0000184 | |||
| 1591 | Ga0373958_0000847 | |||
| 1592 | Ga0373938_0007981 | |||
| 1593 | Ga0373928_0000961 | |||
| 1594 | Ga0373928_0014002 | |||
| 1595 | Ga0373934_0013639 | |||
| 1596 | Ga0373940_0000149 | |||
| 1597 | Ga0373940_0009491 | |||
| 1598 | Ga0373944_0002242 | |||
| 1599 | Ga0373949_0000476 | |||
| 1600 | Ga0373949_0006745 | |||
| 1601 | Ga0373951_0000556 | |||
| 1602 | Ga0373952_0000375 | |||
| 1603 | Ga0373952_0000491 | |||
| 1604 | Ga0373923_0001200 | |||
| 1605 | Ga0373923_0004465 | |||
| 1606 | Ga0373932_0000419 | |||
| 1607 | Ga0373936_0002403 | |||
| 1608 | Ga0373936_0010433 | |||
| 1609 | Ga0373939_0000671 | |||
| 1610 | Ga0373939_0001011 | |||
| 1611 | Ga0373941_0000283 | |||
| 1612 | Ga0373941_0002421 | |||
| 1613 | Ga0373945_0013151 | |||
| 1614 | Ga0373953_0000986 | |||
| 1615 | Ga0373953_0013697 | |||
| 1616 | Ga0373953_0017919 | |||
| 1617 | Ga0373953_0097070 | |||
| 1618 | Ga0373953_0108640 | |||
| 1619 | Ga0373954_0000377 | |||
| 1620 | Ga0373954_0034619 | |||
| 1621 | Ga0373956_0002477 | |||
| 1622 | Ga0373956_0007446 | |||
| 1623 | Ga0373956_0044890 | |||
| 1624 | Ga0373956_0046690 | |||
| 1625 | Ga0373957_0000292 | |||
| 1626 | Ga0373960_0000720 | |||
| 1627 | Ga0373960_0001077 | |||
| 1628 | Ga0373943_0001653 | |||
| 1629 | Ga0373943_0004339 | |||
| 1630 | Ga0373943_0005625 | |||
| 1631 | Ga0373943_0019645 | |||
| 1632 | Ga0373946_0014033 | |||
| 1633 | Ga0373946_0017711 | |||
| 1634 | Ga0373955_0000348 | |||
| 1635 | Ga0373955_0066110 | |||
| 1636 | Ga0373955_0096554 | |||
| 1637 | Ga0373955_0099978 | |||
| 1638 | Ga0373942_0002656 | |||
| 1639 | Ga0373961_0001332 | |||
| 1640 | Ga0373962_0005337 | |||
| 1641 | Ga0373962_0014338 | |||
| 1642 | Ga0373924_0014135 | |||
| 1643 | Ga0373924_0034063 | |||
| 1644 | Ga0373931_0000089 | |||
| 1645 | Ga0373931_0003734 | |||
| 1646 | Ga0373931_0046094 | |||
| 1647 | Ga0373935_0007646 | |||
| 1648 | Ga0373935_0008907 | |||
| 1649 | Ga0373935_0032361 | |||
| 1650 | Ga0373935_0064740 | |||
| 1651 | Ga0373935_0086918 | |||
| 1652 | Ga0373927_0000990 | |||
| 1653 | Ga0373927_0008010 | |||
| 1654 | Ga0373927_0066789 | |||
| 1655 | Ga0373927_0152087 | |||
| 1656 | Ga0373933_0004936 | |||
| 1657 | Ga0373933_0034036 | |||
| 1658 | Ga0373933_0048919 | |||
| 1659 | Ga0373933_0096607 | |||
| 1660 | Ga0373933_0220365 | |||
| 1661 | Ga0373947_0001990 | |||
| 1662 | Ga0373947_0038205 | |||
| 1663 | Ga0373947_0106761 | |||
| 1664 | Ga0373947_0109252 | |||
| 1665 | Ga0373947_0272258 | |||
| 1666 | Ga0373937_0006630 | |||
| 1667 | Ga0373937_0061646 | |||
| 1668 | Ga0373937_0089832 | |||
| 1669 | Ga0373937_0134577 | |||
| 1670 | Ga0373937_0156945 | |||
| 1671 | Ga0373925_0000863 | |||
| 1672 | Ga0373925_0004100 | |||
| 1673 | Ga0373925_0046571 | |||
| 1674 | Ga0373925_0074250 | |||
| 1675 | Ga0373925_0078861 | |||
| 1676 | Ga0395898_0441057 | |||
| 1677 | Ga0395905_0170975 | |||
| 1678 | Ga0395905_0332748 | |||
| 1679 | Ga0436365_0245719 | |||
| 1680 | Ga0436361_0192460 | |||
| 1681 | Ga0436363_0021603 | |||
| 1682 | Ga0436362_0125439 | |||
| 1683 | Ga0451789_0437480 | |||
| 1684 | Ga0451802_0821672 | |||
| 1685 | Ga0451802_1192777 | |||
| 1686 | Ga0439448_0033854 | |||
| 1687 | Ga0439455_0005262 | |||
| 1688 | Ga0466969_0129318 | |||
| 1689 | Ga0453683_0012196 | |||
| 1690 | Ga0466957_0062115 | |||
| 1691 | Ga0451576_0153537 | |||
| 1692 | Ga0495617_009150 | |||
| 1693 | Ga0495627_068260 | |||
| 1694 | Ga0495592_0001421 | |||
| 1695 | Ga0495592_0049016 | |||
| 1696 | Ga0495592_0051951 | |||
| 1697 | Ga0495592_0058218 | |||
| 1698 | Ga0495592_0061171 | |||
| 1699 | Ga0495603_0000091 | |||
| 1700 | Ga0495603_0007129 | |||
| 1701 | Ga0495603_0042395 | |||
| 1702 | Ga0495603_0156822 | |||
| 1703 | Ga0495629_0000011 | |||
| 1704 | Ga0495629_0000583 | |||
| 1705 | Ga0495629_0002565 | |||
| 1706 | Ga0495629_0029527 | |||
| 1707 | Ga0495629_0062559 | |||
| 1708 | Ga0495638_0019825 | |||
| 1709 | Ga0495641_0003388 | |||
| 1710 | Ga0495641_0016919 | |||
| 1711 | Ga0495651_0012272 | |||
| 1712 | Ga0495651_0017917 | |||
| 1713 | Ga0495651_0057255 | |||
| 1714 | Ga0495651_0232807 | |||
| 1715 | Ga0495653_0021441 | |||
| 1716 | Ga0495653_0021760 | |||
| 1717 | Ga0495653_0051973 | |||
| 1718 | Ga0495653_0120600 | |||
| 1719 | Ga0495580_0009686 | |||
| 1720 | Ga0495580_0019072 | |||
| 1721 | Ga0495582_0000049 | |||
| 1722 | Ga0495582_0010994 | |||
| 1723 | Ga0495582_0054597 | |||
| 1724 | Ga0495582_0253854 | |||
| 1725 | Ga0495605_0044201 | |||
| 1726 | Ga0495605_0089094 | |||
| 1727 | Ga0495605_0095109 | |||
| 1728 | Ga0495639_0000303 | |||
| 1729 | Ga0495639_0000815 | |||
| 1730 | Ga0495639_0026553 | |||
| 1731 | Ga0495639_0052876 | |||
| 1732 | Ga0495662_0000387 | |||
| 1733 | Ga0495662_0015027 | |||
| 1734 | Ga0495662_0134505 | |||
| 1735 | Ga0495664_0002459 | |||
| 1736 | Ga0495664_0009480 | |||
| 1737 | Ga0495584_0021432 | |||
| 1738 | Ga0495584_0027251 | |||
| 1739 | Ga0495584_0152203 | |||
| 1740 | Ga0495585_0004147 | |||
| 1741 | Ga0495585_0057680 | |||
| 1742 | Ga0495585_0159766 | |||
| 1743 | Ga0495594_0000641 | |||
| 1744 | Ga0495594_0020339 | |||
| 1745 | Ga0495594_0026882 | |||
| 1746 | Ga0495607_0022202 | |||
| 1747 | Ga0495583_0038379 | |||
| 1748 | Ga0495583_0107340 | |||
| 1749 | Ga0495608_0011931 | |||
| 1750 | Ga0495608_0012258 | |||
| 1751 | Ga0495608_0061334 | |||
| 1752 | Ga0495610_0047845 | |||
| 1753 | Ga0495616_0016601 | |||
| 1754 | Ga0495616_0061922 | |||
| 1755 | Ga0495618_0017431 | |||
| 1756 | Ga0495618_0269276 | |||
| 1757 | Ga0495628_0012236 | |||
| 1758 | Ga0495628_0053918 | |||
| 1759 | Ga0495628_0155743 | |||
| 1760 | Ga0495630_0045453 | |||
| 1761 | Ga0495631_0033478 | |||
| 1762 | Ga0495632_0051846 | |||
| 1763 | Ga0495643_0081441 | |||
| 1764 | Ga0495644_0002015 | |||
| 1765 | Ga0495648_0000436 | |||
| 1766 | Ga0495648_0053962 | |||
| 1767 | Ga0495648_0091052 | |||
| 1768 | Ga0495663_0013129 | |||
| 1769 | Ga0495666_0001631 | |||
| 1770 | Ga0495666_0017973 | |||
| 1771 | Ga0495652_0055002 | |||
| 1772 | Ga0495652_0067614 | |||
| 1773 | Ga0495652_0078831 | |||
| 1774 | Ga0495652_0096797 | |||
| 1775 | Ga0495665_0000101 | |||
| 1776 | Ga0495640_0003445 | |||
| 1777 | Ga0495640_0016301 | |||
| 1778 | Ga0495640_0048081 | |||
| 1779 | Ga0495640_0050502 | |||
| 1780 | Ga0495640_0098440 | |||
| 1781 | Ga0495640_0254266 | |||
| 1782 | Ga0495586_0000755 | |||
| 1783 | Ga0495587_0013085 | |||
| 1784 | Ga0495587_0016782 | |||
| 1785 | Ga0495587_0075499 | |||
| 1786 | Ga0495598_0006129 | |||
| 1787 | Ga0495598_0019419 | |||
| 1788 | Ga0495609_0094471 | |||
| 1789 | Ga0495645_0002559 | |||
| 1790 | Ga0495645_0004167 | |||
| 1791 | Ga0495622_0004249 | |||
| 1792 | Ga0495622_0007367 | |||
| 1793 | Ga0495622_0059416 | |||
| 1794 | Ga0495633_0080437 | |||
| 1795 | Ga0495667_0013983 | |||
| 1796 | Ga0495667_0020621 | |||
| 1797 | Ga0495667_0035233 | |||
| 1798 | Ga0495667_0066122 | |||
| 1799 | Ga0495656_0000562 | |||
| 1800 | Ga0495656_0168225 | |||
| 1801 | Ga0495668_0023571 | |||
| 1802 | Ga0495668_0085540 | |||
| 1803 | Ga0495668_0229152 | |||
| 1804 | Ga0495634_0000267 | |||
| 1805 | Ga0495634_0150493 | |||
| 1806 | Ga0495611_0004220 | |||
| 1807 | Ga0495611_0070779 | |||
| 1808 | Ga0495611_0077025 | |||
| 1809 | Ga0495625_0042249 | |||
| 1810 | Ga0495625_0114974 | |||
| 1811 | Ga0495625_0172313 | |||
| 1812 | Ga0495635_0000084 | |||
| 1813 | Ga0495635_0006470 | |||
| 1814 | Ga0495635_0009263 | |||
| 1815 | Ga0495635_0015264 | |||
| 1816 | Ga0495635_0015655 | |||
| 1817 | Ga0495635_0092474 | |||
| 1818 | Ga0495659_0029506 | |||
| 1819 | Ga0495661_0054221 | |||
| 1820 | Ga0495588_0004581 | |||
| 1821 | Ga0495657_0017064 | |||
| 1822 | Ga0495657_0084392 | |||
| 1823 | Ga0495657_0136886 | |||
| 1824 | Ga0495599_0035912 | |||
| 1825 | Ga0495599_0043703 | |||
| 1826 | Ga0495599_0092688 | |||
| 1827 | Ga0495623_0014573 | |||
| 1828 | Ga0495623_0200844 | |||
| 1829 | Ga0495646_0006452 | |||
| 1830 | Ga0495646_0009027 | |||
| 1831 | Ga0495646_0023402 | |||
| 1832 | Ga0495646_0024146 | |||
| 1833 | Ga0495647_0003483 | |||
| 1834 | Ga0495647_0007118 | |||
| 1835 | Ga0495647_0076376 | |||
| 1836 | Ga0495658_0000173 | |||
| 1837 | Ga0495658_0057813 | |||
| 1838 | Ga0495669_0024503 | |||
| 1839 | Ga0495613_0005231 | |||
| 1840 | Ga0495613_0011762 | |||
| 1841 | Ga0495613_0025072 | |||
| 1842 | Ga0495613_0128414 | |||
| 1843 | Ga0495624_0001263 | |||
| 1844 | Ga0495624_0078806 | |||
| 1845 | Ga0495670_0006473 | |||
| 1846 | Ga0495670_0032727 | |||
| 1847 | Ga0495670_0100940 | |||
| 1848 | Ga0495671_0036879 | |||
| 1849 | Ga0495671_0108984 | |||
| 1850 | Ga0495649_0108048 | |||
| 1851 | Ga0495589_0071633 | |||
| 1852 | Ga0495589_0075273 | |||
| 1853 | Ga0495600_0007694 | |||
| 1854 | Ga0495600_0040507 | |||
| 1855 | Ga0495600_0074224 | |||
| 1856 | Ga0495600_0197010 | |||
| 1857 | Ga0495660_0084157 | |||
| 1858 | Ga0495660_0145671 | |||
| 1859 | Ga0495581_0000864 | |||
| 1860 | Ga0495581_0008649 | |||
| 1861 | Ga0495581_0188756 | |||
| 1862 | Ga0495604_0010756 | |||
| 1863 | Ga0495604_0015977 | |||
| 1864 | Ga0495604_0045948 | |||
| 1865 | Ga0495674_0049391 | |||
| 1866 | Ga0495674_0118586 | |||
| 1867 | Ga0495672_0063988 | |||
| 1868 | Ga0495676_0004982 | |||
| 1869 | Ga0495676_0016365 | |||
| 1870 | Ga0495676_0029827 | |||
| 1871 | Ga0495676_0062408 | |||
| 1872 | Ga0495676_0126239 | |||
| 1873 | Ga0495680_0001934 | |||
| 1874 | Ga0495680_0018136 | |||
| 1875 | Ga0495680_0020444 | |||
| 1876 | Ga0495680_0029773 | |||
| 1877 | Ga0495680_0054136 | |||
| 1878 | Ga0495680_0186033 | |||
| 1879 | Ga0495680_0227149 | |||
| 1880 | Ga0495683_0144769 | |||
| 1881 | Ga0495675_0000862 | |||
| 1882 | Ga0495675_0044349 | |||
| 1883 | Ga0495675_0142250 | |||
| 1884 | Ga0495675_0249785 | |||
| 1885 | Ga0495679_011605 | |||
| 1886 | Ga0495681_0075638 | |||
| 1887 | Ga0495684_0000701 | |||
| 1888 | Ga0495684_0041413 | |||
| 1889 | Ga0495684_0145506 | |||
| 1890 | Ga0495593_0000016 | |||
| 1891 | Ga0495593_0026325 | |||
| 1892 | Ga0495593_0060225 | |||
| 1893 | Ga0495602_0011145 | |||
| 1894 | Ga0495602_0022469 | |||
| 1895 | Ga0495602_0152802 | |||
| 1896 | Ga0495614_0071916 | |||
| 1897 | Ga0496100_0000200 | |||
| 1898 | Ga0496100_0060876 | |||
| 1899 | Ga0496100_0337258 | |||
| 1900 | Ga0496101_0000339 | |||
| 1901 | Ga0496102_0000729 | |||
| 1902 | Ga0496102_0016911 | |||
| 1903 | Ga0496102_0032117 | |||
| 1904 | Ga0496102_0054713 | |||
| 1905 | Ga0496102_0290402 | |||
| 1906 | Ga0496102_0336808 | |||
| 1907 | Ga0496103_0001639 | |||
| 1908 | Ga0496104_0002526 | |||
| 1909 | Ga0496104_0330946 | |||
| 1910 | Ga0496104_0482350 | |||
| 1911 | Ga0496105_0044036 | |||
| 1912 | Ga0496105_0233258 | |||
| 1913 | Ga0496106_0000202 | |||
| 1914 | Ga0496106_0005687 | |||
| 1915 | Ga0496106_0064478 | |||
| 1916 | Ga0496106_0072449 | |||
| 1917 | Ga0496106_0188979 | |||
| 1918 | Ga0496106_0394675 | |||
| 1919 | Ga0496107_0000066 | |||
| 1920 | Ga0496107_0010112 | |||
| 1921 | Ga0496108_0009303 | |||
| 1922 | Ga0496108_0011418 | |||
| 1923 | Ga0496108_0015918 | |||
| 1924 | Ga0496108_0043555 | |||
| 1925 | Ga0496109_0000595 | |||
| 1926 | Ga0496109_0020680 | |||
| 1927 | Ga0496109_0038245 | |||
| 1928 | Ga0496109_0099281 | |||
| 1929 | Ga0496109_0143391 | |||
| 1930 | Ga0496110_0064886 | |||
| 1931 | Ga0496110_0253987 | |||
| 1932 | Ga0496111_0016577 | |||
| 1933 | Ga0496112_0005122 | |||
| 1934 | Ga0496112_0007966 | |||
| 1935 | Ga0496112_0013236 | |||
| 1936 | Ga0496112_0043635 | |||
| 1937 | Ga0496112_0205776 | |||
| 1938 | Ga0496113_0008065 | |||
| 1939 | Ga0496113_0041677 | |||
| 1940 | Ga0496113_0420805 | |||
| 1941 | Ga0496114_0023336 | |||
| 1942 | Ga0496114_0248749 | |||
| 1943 | Ga0496115_0001197 | |||
| 1944 | Ga0496115_0022519 | |||
| 1945 | Ga0496115_0058265 | |||
| 1946 | Ga0496115_0102550 | |||
| 1947 | Ga0496116_0151268 | |||
| 1948 | Ga0496117_0035051 | |||
| 1949 | Ga0496118_0002112 | |||
| 1950 | Ga0496118_0052143 | |||
| 1951 | Ga0496118_0071969 | |||
| 1952 | Ga0496118_0180623 | |||
| 1953 | Ga0496121_0000077 | |||
| 1954 | Ga0496121_0030446 | |||
| 1955 | Ga0496121_0048141 | |||
| 1956 | Ga0496121_0081538 | |||
| 1957 | Ga0496121_0089776 | |||
| 1958 | Ga0496121_0098951 | |||
| 1959 | Ga0496121_0173892 | |||
| 1960 | Ga0496122_0035498 | |||
| 1961 | Ga0496124_0002375 | |||
| 1962 | Ga0496124_0121758 | |||
| 1963 | Ga0496125_0048124 | |||
| 1964 | Ga0496125_0062411 | |||
| 1965 | Ga0496125_0154636 | |||
| 1966 | Ga0496126_0006024 | |||
| 1967 | Ga0496126_0018133 | |||
| 1968 | Ga0496126_0026244 | |||
| 1969 | Ga0496126_0034951 | |||
| 1970 | Ga0496126_0051994 | |||
| 1971 | Ga0496126_0155440 | |||
| 1972 | Ga0496126_0180962 | |||
| 1973 | Ga0496126_0203176 | |||
| 1974 | Ga0496126_0408124 | |||
| 1975 | Ga0501031_0038357 | |||
| 1976 | Ga0501031_0139413 | |||
| 1977 | Ga0501031_0192239 | |||
| 1978 | Ga0501032_0093040 | |||
| 1979 | Ga0501033_0030031 | |||
| 1980 | Ga0501034_0032996 | |||
| 1981 | Ga0501037_0014466 | |||
| 1982 | Ga0501037_0049800 | |||
| 1983 | Ga0501038_0012458 | |||
| 1984 | Ga0501039_0008471 | |||
| 1985 | Ga0501039_0078299 | |||
| 1986 | Ga0501040_0006582 | |||
| 1987 | Ga0501040_0077037 | |||
| 1988 | Ga0501042_0014951 | |||
| 1989 | Ga0501043_0067091 | |||
| 1990 | Ga0501047_0092278 | |||
| 1991 | Ga0501048_0010834 | |||
| 1992 | Ga0501067_0003500 | |||
| 1993 | Ga0501067_0014400 | |||
| 1994 | Ga0501067_0048239 | |||
| 1995 | Ga0501068_0005171 | |||
| 1996 | Ga0501068_0127201 | |||
| 1997 | Ga0501069_0032536 | |||
| 1998 | Ga0501069_0044001 | |||
| 1999 | Ga0501070_0021264 | |||
| 2000 | Ga0501070_0021894 | |||
| 2001 | Ga0501071_0268885 | |||
| 2002 | Ga0501072_0030261 | |||
| 2003 | Ga0501073_0000701 | |||
| 2004 | Ga0501073_0014223 | |||
| 2005 | Ga0501074_0088728 | |||
| 2006 | Ga0501075_0075879 | |||
| 2007 | Ga0501077_0075666 | |||
| 2008 | Ga0501079_0022790 | |||
| 2009 | Ga0501079_0070801 | |||
| 2010 | Ga0501079_0374500 | |||
| 2011 | Ga0501080_0149095 | |||
| 2012 | Ga0501083_0031342 | |||
| 2013 | Ga0501083_0061060 | |||
| 2014 | Ga0501044_0103701 | |||
| 2015 | Ga0501045_0002697 | |||
| 2016 | nmdc:mga03n38_6006_c1 | |||
| 2017 | nmdc:mga06z11_121961_c1 | |||
| 2018 | nmdc:mga06z11_13965_c1 | |||
| 2019 | nmdc:mga06z11_15652_c1 | |||
| 2020 | nmdc:mga07m45_62937_c1 | |||
| 2021 | nmdc:mga05p37_124219_c1 | |||
| 2022 | nmdc:mga05p37_272266_c1 | |||
| 2023 | nmdc:mga08y16_214543_c1 | |||
| 2024 | nmdc:mga08y16_2489_c1 | |||
| 2025 | nmdc:mga08y16_3164_c1 | |||
| 2026 | nmdc:mga08y16_56024_c1 | |||
| 2027 | nmdc:mga08y16_8401_c1 | |||
| 2028 | nmdc:mga0n895_275928_c1 | |||
| 2029 | nmdc:mga0n895_381_c1 | |||
| 2030 | nmdc:mga0a205_2432_c1 | |||
| 2031 | nmdc:mga0a205_472178_c1 | |||
| 2032 | nmdc:mga0a205_49895_c1 | |||
| 2033 | nmdc:mga0sz30_20613_c2 | |||
| 2034 | Ga0495601_0005443 | |||
| 2035 | Ga0495601_0007975 | |||
| 2036 | Ga0495601_0340549 | |||
| 2037 | Ga0495612_0013688 | |||
| 2038 | Ga0495612_0013901 | |||
| 2039 | Ga0500635_0004635 | |||
| 2040 | Ga0500635_0010920 | |||
| 2041 | Ga0500635_0022158 | |||
| 2042 | Ga0495595_0001767 | |||
| 2043 | Ga0495595_0003811 | |||
| 2044 | Ga0495595_0006384 | |||
| 2045 | Ga0495619_0000308 | |||
| 2046 | Ga0495619_0016450 | |||
| 2047 | Ga0495619_0043597 | |||
| 2048 | Ga0495619_0175450 | |||
| 2049 | Ga0500646_0010209 | |||
| 2050 | Ga0500566_0069485 | |||
| 2051 | Ga0500641_0002055 | |||
| 2052 | Ga0500650_0079712 | |||
| 2053 | Ga0500554_000935 | |||
| 2054 | Ga0500556_0026238 | |||
| 2055 | Ga0500572_000056 | |||
| 2056 | Ga0500595_043425 | |||
| 2057 | Ga0500655_006959 | |||
| 2058 | Ga0500658_0044292 | |||
| 2059 | Ga0500559_0000423 | |||
| 2060 | Ga0500588_0029484 | |||
| 2061 | Ga0500603_032165 | |||
| 2062 | Ga0500634_0066796 | |||
| 2063 | Ga0500639_009475 | |||
| 2064 | Ga0500637_0054269 | |||
| 2065 | Ga0500637_0096258 | |||
| 2066 | Ga0500637_0136517 | |||
| 2067 | Ga0500645_009336 | |||
| 2068 | Ga0500596_000256 | |||
| 2069 | Ga0500596_000710 | |||
| 2070 | Ga0501084_0034204 | |||
| 2071 | Ga0501082_0054566 | |||
| 2072 | Ga0501082_0176206 | |||
| 2073 | Ga0501082_0299150 | |||
| 2074 | Ga0466962_0160947 | |||
| 2075 | Ga0530510_0032958 | |||
| 2076 | 2513673985 | |||
| 2077 | 2513696000 | |||
| 2078 | 2524470026 | |||
| 2079 | 2723846234 | |||
| 2080 | 2793080550 | |||
| 2081 | 2874610805 | |||
| 2082 | 2879118885 | |||
| 2083 | 2885386359 | |||
| 2084 | 2889039323 | |||
| 2085 | 2903771403 | |||
| 2086 | 2922362035 | |||
| 2087 | 2922389810 | |||
| 2088 | 8006964608 | |||
| 2089 | 8006991236 | |||
| 2090 | 8006999975 | |||
| 2091 | 8056680387 | |||
| 2092 | 8056683137 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wj7-assembly1.cif.gz_C | crystal structure of gox2253 | 0.8501 | 1 | 325 |
| 3wj7-assembly1.cif.gz_C | crystal structure of gox2253 | 0.8427 | 1 | 325 |
| 2x4g-assembly1.cif.gz_A-2 | crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa | 0.8361 | 2 | 325 |
| 4lk3-assembly1.cif.gz_E | crystal structure of human udp-xylose synthase r236a substitution | 0.8317 | 1 | 323 |
| 4m55-assembly1.cif.gz_D | crystal structure of human udp-xylose synthase r236h substitution | 0.8289 | 1 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94HG6_1_340_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9164 | 2 | 324 | 3.40.50.720 |
| af_Q94HG6_1_340_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.903 | 2 | 324 | 3.40.50.720 |
| af_P96816_2_332_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8671 | 1 | 323 | 3.40.50.720 |
| af_Q23086_2_345_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8589 | 3 | 320 | 3.40.50.720 |
| af_Q54TU9_1_334_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8582 | 2 | 325 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537R5V1-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9682 | 1 | 325 |
GO:0004029
GO:0005737 |
| AF-A0A3M1GBQ3-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9639 | 2 | 325 |
GO:0004029
GO:0005737 |
| AF-A0A537R5V1-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9623 | 1 | 325 |
GO:0004029
GO:0005737 |
| AF-A0A318CJT1-F1-model_v4 | NAD-dependent dehydratase | 0.9532 | 4 | 323 |
GO:0004029
GO:0005737 |
| AF-A0A4V0HYJ9-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9526 | 2 | 323 |
GO:0004029
GO:0005737 |