F488982

General Info

Members Datasets Scaffolds Average Seq Length
1047 851 2094 351

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0030883|Ga0495643_0030883_940_2127
Length 395
Sequence LIPGRFGRTICRRPTNRLNKDRKTIGDGFRVSSARGCGGGTMTGAQEFERVLDESDKSVASFEHESVSLIKRAQHFLHSTPAAVPLIVLILSIVIFGLAIGGRFFSSYTLTLILQQIAIVGILGAGQTLVILTAGIDLSIGVIMVISAVIMGNVAITYGIPTPIAVIAGLIVGGLCGLLNGFLVAFMKLPPFIVTLGTWNIVMATNFIYSANETIRDTDVDEQAPLLHLFATSFKLGSAVLTLGVIAMVLLVVLLWYVLNHTAWGRHVYAVGDDPEAAKLSGIQTKKVLLTVYTISGVIAAFAAWVSIGRNGSISPSSAVTDYNLQAITATVIGGISLFGGRGSILGTLFGTMIVGVVSMGLNMLGADPQWKVLLTGVLIIAAVAIDQWIRKVSV

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
73 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
187 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
188 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
189 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
190 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
269 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
305 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
306 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
307 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
308 2509276019 Ensifer aridi TW10 Isolate Nodule
309 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
310 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
311 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
312 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
313 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
314 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
315 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
316 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
317 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
318 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
319 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
320 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
321 2512875024
322 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
323 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
324 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
325 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
326 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
327 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
328 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
329 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
330 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
331 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
332 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
333 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
334 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
335 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
336 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
337 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
338 2516143018 Ensifer sp. BR816 Isolate Nodule
339 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
340 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
341 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
342 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
343 2519899620 Rhizobium sp. Pop5 Isolate Nodule
344 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
345 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
346 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
347 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
348 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
349 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
350 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
351 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
352 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
353 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
354 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
355 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
356 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
357 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
358 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
359 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
360 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
361 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
362 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
363 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
364 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
365 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
366 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
367 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
368 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
369 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
370 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
371 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
372 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
373 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
374 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
375 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
376 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
377 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
378 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
379 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
380 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
381 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
382 2643221557 Ensifer sp. Root558 Isolate Unclassified
383 2643221568 Rhizobium sp. Root564 Isolate Unclassified
384 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
385 2643221599 Rhizobium sp. Root708 Isolate Unclassified
386 2643221607 Rhizobium sp. Root73 Isolate Unclassified
387 2643221610 Ensifer sp. Root74 Isolate Unclassified
388 2643221618 Ensifer sp. Root231 Isolate Unclassified
389 2643221626 Ensifer sp. Root31 Isolate Unclassified
390 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
391 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
392 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
393 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
394 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
395 2643221655 Ensifer sp. Root1252 Isolate Unclassified
396 2643221659 Ensifer sp. Root127 Isolate Unclassified
397 2643221668 Ensifer sp. Root423 Isolate Unclassified
398 2643221675 Ensifer sp. Root1298 Isolate Unclassified
399 2643221680 Ensifer sp. Root1312 Isolate Unclassified
400 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
401 2643221688 Rhizobium sp. Root482 Isolate Unclassified
402 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
403 2643221698 Ensifer sp. Root142 Isolate Unclassified
404 2643221712 Ensifer sp. Root258 Isolate Unclassified
405 2643221719 Rhizobium sp. Root274 Isolate Unclassified
406 2643221723 Ensifer sp. Root278 Isolate Unclassified
407 2643221726 Ensifer sp. Root954 Isolate Unclassified
408 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
409 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
410 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
411 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
412 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
413 2718217882 Rhizobium sp. N741 Isolate Nodule
414 2718217927 Rhizobium sp. N324 Isolate Nodule
415 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
416 2718218009 Rhizobium sp. N561 Isolate Nodule
417 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
418 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
419 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
420 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
421 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
422 2718218363 Rhizobium sp. N113 Isolate Nodule
423 2718218365 Rhizobium sp. N731 Isolate Nodule
424 2718218366 Rhizobium sp. N621 Isolate Nodule
425 2718218423 Rhizobium sp. N941 Isolate Nodule
426 2721755514 Rhizobium sp. N6212 Isolate Nodule
427 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
428 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
429 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
430 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
431 2721755809 Rhizobium sp. N541 Isolate Nodule
432 2721755810 Rhizobium sp. N871 Isolate Nodule
433 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
434 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
435 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
436 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
437 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
438 2728369365 Rhizobium sp. N1341 Isolate Nodule
439 2728369397 Rhizobium sp. N1314 Isolate Nodule
440 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
441 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
442 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
443 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
444 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
445 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
446 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
447 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
448 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
449 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
450 2791355256 Rhizobium sp. M10 Isolate Nodule
451 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
452 2791355260 Rhizobium sp. L9 Isolate Nodule
453 2791355261 Rhizobium sp. J15 Isolate Nodule
454 2791355262 Rhizobium sp. M1 Isolate Nodule
455 2791355263 Rhizobium chutanense C5 Isolate Nodule
456 2791355264 Rhizobium sp. S9 Isolate Nodule
457 2791355265 Rhizobium sp. H4 Isolate Nodule
458 2791355266 Rhizobium sp. L43 Isolate Nodule
459 2791355267 Rhizobium sp. L18 Isolate Nodule
460 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
461 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
462 2802429633 Rhizobium anhuiense J3 Isolate Nodule
463 2802429634 Rhizobium anhuiense S10 Isolate Nodule
464 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
465 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
466 2802429637 Rhizobium anhuiense C15 Isolate Nodule
467 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
468 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
469 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
470 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
471 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
472 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
473 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
474 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
475 2838048938 Rhizobium pisi 27/80 Isolate Nodule
476 2838061910 Rhizobium phaseoli L15 Isolate Nodule
477 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
478 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
479 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
480 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
481 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
482 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
483 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
484 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
485 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
486 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
487 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
488 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
489 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
490 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
491 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
492 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
493 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
494 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
495 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
496 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
497 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
498 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
499 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
500 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
501 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
502 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
503 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
504 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
505 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
506 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
507 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
508 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
509 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
510 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
511 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
512 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
513 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
514 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
515 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
516 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
517 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
518 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
519 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
520 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
521 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
522 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
523 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
524 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
525 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
526 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
527 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
528 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
529 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
530 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
531 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
532 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
533 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
534 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
535 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
536 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
537 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
538 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
539 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
540 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
541 2844163670 Ensifer sp. 1H6 Isolate Unclassified
542 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
543 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
544 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
545 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
546 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
547 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
548 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
549 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
550 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
551 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
552 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
553 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
554 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
555 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
556 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
557 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
558 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
559 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
560 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
561 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
562 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
563 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
564 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
565 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
566 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
567 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
568 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
569 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
570 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
571 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
572 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
573 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
574 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
575 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
576 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
577 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
578 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
579 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
580 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
581 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
582 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
583 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
584 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
585 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
586 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
587 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
588 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
589 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
590 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
591 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
592 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
593 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
594 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
595 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
596 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
597 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
598 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
599 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
600 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
601 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
602 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
603 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
604 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
605 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
606 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
607 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
608 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
609 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
610 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
611 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
612 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
613 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
614 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
615 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
616 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
617 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
618 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
619 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
620 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
621 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
622 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
623 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
624 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
625 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
626 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
627 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
628 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
629 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
630 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
631 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
632 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
633 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
634 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
635 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
636 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
637 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
638 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
639 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
640 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
641 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
642 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
643 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
644 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
645 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
646 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
647 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
648 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
649 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
650 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
651 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
652 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
653 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
654 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
655 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
656 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
657 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
658 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
659 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
660 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
661 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
662 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
663 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
664 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
665 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
666 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
667 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
668 2933599457 Rhizobium phaseoli M3 Isolate Nodule
669 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
670 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
671 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
672 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
673 2936381700 Rhizobium chutanense C16 Isolate Unclassified
674 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
675 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
676 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
677 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
678 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
679 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
680 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
681 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
682 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
683 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
684 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
685 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
686 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
687 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
688 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
689 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
690 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
691 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
692 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
693 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
694 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
695 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
696 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
697 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
698 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
699 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
700 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
701 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
702 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
703 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
704 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
705 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
706 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
707 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
708 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
709 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
710 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
711 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
712 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
713 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
714 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
715 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
716 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
717 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
718 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
719 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
720 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
721 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
722 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
723 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
724 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
725 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
726 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
727 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
728 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
729 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
730 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
731 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
732 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
733 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
734 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
735 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
736 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
737 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
738 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
739 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
740 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
741 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
742 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
743 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
744 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
745 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
746 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
747 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
748 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
749 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
750 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
751 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
752 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
753 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
754 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
755 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
756 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
757 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
758 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
759 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
760 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
761 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
762 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
763 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
764 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
765 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
766 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
767 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
768 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
769 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
770 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
771 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
772 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
773 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
774 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
775 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
776 2996887358 Rhizobium sp. R711 Isolate Nodule
777 2996893221 Rhizobium sp. R635 Isolate Nodule
778 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
779 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
780 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
781 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
782 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
783 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
784 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
785 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
786 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
787 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
788 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
789 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
790 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
791 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
792 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
793 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
794 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
795 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
796 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
797 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
798 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
799 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
800 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
801 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
802 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
803 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
804 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
805 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
806 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
807 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
808 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
809 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
810 8005258706 Rhizobium sp. R693 Isolate Nodule
811 8005275841 Rhizobium sp. N4311 Isolate Nodule
812 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
813 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
814 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
815 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
816 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
817 8005321885 Rhizobium sp. R72 Isolate Nodule
818 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
819 8005382845 Rhizobium sp. R634 Isolate Nodule
820 8005395548 Rhizobium sp. R339 Isolate Nodule
821 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
822 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
823 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
824 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
825 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
826 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
827 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
828 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
829 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
830 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
831 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
832 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
833 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
834 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
835 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
836 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
837 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
838 8018176218 Rhizobium sp. N122 Isolate Nodule
839 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
840 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
841 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
842 8024501048 Rhizobium sp. H4 Isolate Nodule
843 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
844 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
845 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
846 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
847 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
848 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
849 8056382006 Rhizobium croatiense 13T Isolate Nodule
850 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
851 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.94
Metatranscriptomes 3.53
Isolates 52.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 14.61
Nodule 40.4
Rhizoplane 0.57
Rhizosphere 30.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0030883 3300046522 Bacteria 2987
2 JGI24740J21852_10003158 3300001979 Bacteria 7270
3 JGI24740J21852_10034379 3300001979 Bacteria 1597
4 JGI24739J22299_10021505 3300001989 Bacteria 2295
5 JGI25155J39150_1000013 3300002704 Bacteria 198215
6 JGI25156J39149_1000011 3300002705 Bacteria 198215
7 JGI25162J39368_1000689 3300002737 Bacteria 23547
8 JGI25162J39368_1000691 3300002737 Bacteria 23463
9 JGI25154J39366_1000030 3300002738 Bacteria 191444
10 JGI25158J39367_1000035 3300002739 Bacteria 30451
11 JGI25158J39367_1000131 3300002739 Bacteria 17548
12 JGI25157J39369_1000013 3300002741 Bacteria 198211
13 JGI25152J39213_1001483 3300002773 Bacteria 10028
14 JGI25152J39213_1001575 3300002773 Bacteria 9574
15 JGI25150J39212_1005319 3300002774 Bacteria 2762
16 JGI25150J39212_1007582 3300002774 Bacteria 2171
17 JGI25159J45721_1000003 3300002987 Bacteria 274069
18 JGI25159J45721_1000744 3300002987 Bacteria 14188
19 JGI25159J45721_1005254 3300002987 Bacteria 4092
20 JGI25151J46595_10003116 3300003187 Bacteria 9331
21 JGI25165J46597_1000570 3300003214 Bacteria 33114
22 JGI25165J46597_1000585 3300003214 Bacteria 31924
23 JGI25165J46597_1005287 3300003214 Bacteria 2528
24 JGI25153J46596_10000019 3300003215 Bacteria 260291
25 JGI25153J46596_10012357 3300003215 Bacteria 3692
26 JGI25153J46596_10019798 3300003215 Bacteria 2564
27 JGI25153J46596_10031042 3300003215 Bacteria 1806
28 JGI25153J46596_10035557 3300003215 Bacteria 1611
29 rootH2_10073882 3300003320 Bacteria 1671
30 rootL2_10169956 3300003322 Bacteria 1601
31 rootH1_10045214 3300003323 Bacteria 1312
32 rootH1_10045215 3300003323 Bacteria 1971
33 JGI25160J50197_1000003 3300003354 Bacteria 482719
34 JGI25160J50197_1000012 3300003354 Bacteria 267582
35 JGI25160J50197_1001972 3300003354 Bacteria 9783
36 JGI25160J50197_1003267 3300003354 Bacteria 7299
37 JGI25161J50226_1000002 3300003374 Bacteria 420324
38 JGI25161J50226_1000117 3300003374 Bacteria 59670
39 JGI25161J50226_1000239 3300003374 Bacteria 32969
40 JGI25161J50226_1003492 3300003374 Bacteria 3579
41 Ga0055542_1001310 3300003762 Bacteria 13179
42 Ga0055526_1003533 3300003771 Bacteria 9871
43 Ga0055526_1004786 3300003771 Bacteria 8014
44 Ga0055526_1005685 3300003771 Bacteria 7079
45 Ga0055526_1008119 3300003771 Bacteria 5292
46 Ga0055526_1010480 3300003771 Bacteria 4304
47 Ga0055524_1000434 3300003775 Bacteria 34967
48 Ga0055524_1002834 3300003775 Bacteria 8692
49 Ga0055524_1004206 3300003775 Bacteria 6704
50 Ga0055524_1012460 3300003775 Bacteria 3262
51 Ga0055536_1001453 3300003781 Bacteria 14249
52 Ga0055536_1009528 3300003781 Bacteria 4003
53 Ga0055528_1000980 3300003790 Bacteria 18963
54 Ga0055528_1006042 3300003790 Bacteria 5539
55 Ga0055528_1024873 3300003790 Bacteria 1779
56 Ga0055530_10015740 3300003791 Bacteria 2452
57 Ga0055540_1000272 3300003792 Bacteria 46628
58 Ga0055540_1001914 3300003792 Bacteria 11641
59 Ga0055540_1006279 3300003792 Bacteria 4756
60 Ga0055531_10004167 3300003794 Bacteria 8915
61 Ga0055531_10009339 3300003794 Bacteria 5024
62 Ga0055543_1000037 3300004625 Bacteria 125386
63 Ga0055543_1000043 3300004625 Bacteria 116599
64 Ga0055543_1000050 3300004625 Bacteria 107366
65 Ga0055543_1000774 3300004625 Bacteria 15885
66 Ga0065165_1000025 3300005262 Bacteria 246909
67 Ga0065165_1000031 3300005262 Bacteria 216330
68 Ga0065165_1011568 3300005262 Bacteria 3661
69 Ga0070658_10002384 3300005327 Bacteria 15783
70 Ga0070658_10043031 3300005327 Bacteria 3649
71 Ga0070676_10035100 3300005328 Bacteria 2882
72 Ga0070683_100050306 3300005329 Bacteria 3857
73 Ga0070670_100000804 3300005331 Bacteria 24410
74 Ga0068868_100151352 3300005338 Bacteria 1911
75 Ga0070660_100073407 3300005339 Bacteria 2675
76 Ga0070661_100002956 3300005344 Bacteria 11725
77 Ga0070668_100292478 3300005347 Bacteria 1364
78 Ga0070674_100003923 3300005356 Bacteria 8424
79 Ga0070659_100009384 3300005366 Bacteria 7186
80 Ga0070659_100025829 3300005366 Bacteria 4517
81 Ga0070667_100030775 3300005367 Bacteria 4476
82 Ga0070714_100052896 3300005435 Bacteria 3464
83 Ga0070711_100010859 3300005439 Bacteria 5646
84 Ga0068867_100062890 3300005459 Bacteria 2759
85 Ga0070706_100165663 3300005467 Bacteria 2064
86 Ga0068853_100002324 3300005539 Bacteria 14237
87 Ga0068853_100027668 3300005539 Bacteria 4765
88 Ga0070696_100013007 3300005546 Bacteria 5584
89 Ga0070665_100056660 3300005548 Bacteria 3929
90 Ga0070665_100094359 3300005548 Bacteria 2997
91 Ga0070665_100242741 3300005548 Bacteria 1802
92 Ga0068857_100037943 3300005577 Bacteria 4268
93 Ga0068857_100115940 3300005577 Bacteria 2410
94 Ga0068854_100015003 3300005578 Bacteria 5121
95 Ga0068854_100056539 3300005578 Bacteria 2828
96 Ga0068854_100116883 3300005578 Bacteria 2019
97 Ga0068856_100029490 3300005614 Bacteria 5359
98 Ga0068856_100034847 3300005614 Bacteria 4932
99 Ga0068856_100042470 3300005614 Bacteria 4473
100 Ga0068856_100055414 3300005614 Bacteria 3913
101 Ga0068856_100111178 3300005614 Bacteria 2737
102 Ga0068852_100005219 3300005616 Bacteria 9263
103 Ga0068852_100013122 3300005616 Bacteria 6330
104 Ga0068852_100081107 3300005616 Bacteria 2879
105 Ga0068852_100103702 3300005616 Bacteria 2573
106 Ga0068852_100180931 3300005616 Bacteria 1982
107 Ga0081538_10031659 3300005981 Bacteria 3562
108 Ga0075365_10001931 3300006038 Bacteria 9786
109 Ga0075365_10002056 3300006038 Bacteria 9591
110 Ga0075365_10006944 3300006038 Bacteria 6289
111 Ga0075365_10125946 3300006038 Bacteria 1770
112 Ga0075365_10186989 3300006038 Bacteria 1449
113 Ga0075368_10039284 3300006042 Bacteria 1854
114 Ga0075363_100061610 3300006048 Bacteria 2022
115 Ga0075364_10038606 3300006051 Bacteria 3094
116 Ga0070716_100031359 3300006173 Bacteria 2890
117 Ga0070712_100010344 3300006175 Bacteria 5883
118 Ga0070712_100100551 3300006175 Bacteria 2137
119 Ga0070712_100216157 3300006175 Bacteria 1514
120 Ga0075362_10000690 3300006177 Bacteria 9988
121 Ga0075362_10059267 3300006177 Bacteria 1728
122 Ga0075367_10007331 3300006178 Bacteria 5640
123 Ga0075367_10009334 3300006178 Bacteria 5123
124 Ga0075367_10030465 3300006178 Bacteria 3094
125 Ga0075370_10018681 3300006353 Bacteria 3762
126 Ga0075370_10109436 3300006353 Bacteria 1604
127 Ga0075370_10149612 3300006353 Bacteria 1368
128 Ga0075370_10162050 3300006353 Bacteria 1313
129 Ga0068871_100125217 3300006358 Bacteria 2174
130 Ga0105251_10029488 3300009011 Bacteria 2764
131 Ga0105240_10000024 3300009093 Bacteria 375919
132 Ga0105240_10141342 3300009093 Bacteria 2878
133 Ga0105247_10209062 3300009101 Bacteria 1315
134 Ga0105243_10187896 3300009148 Bacteria 1802
135 Ga0105241_10071891 3300009174 Bacteria 2687
136 Ga0105237_10000836 3300009545 Bacteria 42087
137 Ga0105237_10187633 3300009545 Bacteria 2067
138 Ga0105238_10034431 3300009551 Bacteria 5153
139 Ga0105238_10084504 3300009551 Bacteria 3163
140 Ga0105249_10082657 3300009553 Bacteria 2988
141 Ga0123341_1000038 3300009765 Bacteria 60679
142 Ga0123342_1018935 3300009766 Bacteria 5364
143 Ga0123342_1020164 3300009766 Bacteria 4925
144 Ga0105239_10002164 3300010375 Bacteria 25271
145 Ga0105239_10027356 3300010375 Bacteria 6278
146 Ga0105239_10225211 3300010375 Bacteria 2103
147 Ga0105239_10301481 3300010375 Bacteria 1804
148 Ga0105239_10392335 3300010375 Bacteria 1570
149 Ga0105246_10165297 3300011119 Bacteria 1689
150 Ga0157371_10005722 3300013102 Bacteria 10420
151 Ga0157371_10013041 3300013102 Bacteria 6328
152 Ga0157370_10009366 3300013104 Bacteria 10474
153 Ga0157370_10013336 3300013104 Bacteria 8465
154 Ga0157369_10019547 3300013105 Bacteria 7579
155 Ga0157369_10203492 3300013105 Bacteria 2077
156 Ga0171463_1001 3300013249 Bacteria 1406070
157 Ga0157374_10405397 3300013296 Bacteria 1361
158 Ga0157378_10305188 3300013297 Bacteria 1542
159 Ga0163162_10221066 3300013306 Bacteria 2024
160 Ga0157380_10013281 3300014326 Bacteria 6000
161 Ga0183363_1081 3300015690 Bacteria 29051
162 Ga0163161_10075353 3300017792 Bacteria 2476
163 Ga0214543_1000027 3300021327 Bacteria 215065
164 Ga0213874_10011048 3300021377 Bacteria 2277
165 Ga0213876_10045224 3300021384 Bacteria 2329
166 Ga0209435_100026 3300025206 Bacteria 198295
167 Ga0209436_100054 3300025208 Bacteria 62857
168 Ga0209672_103076 3300025228 Bacteria 3630
169 Ga0209563_101317 3300025230 Bacteria 6775
170 Ga0209437_100050 3300025233 Bacteria 394010
171 Ga0209437_100056 3300025233 Bacteria 363071
172 Ga0207425_1000673 3300025245 Bacteria 18670
173 Ga0209646_1000084 3300025246 Bacteria 198295
174 Ga0209646_1013046 3300025246 Bacteria 1268
175 Ga0209026_1000080 3300025250 Bacteria 198295
176 Ga0209148_1000056 3300025254 Bacteria 363380
177 Ga0209759_1000061 3300025256 Bacteria 198295
178 Ga0209129_1002601 3300025258 Bacteria 8623
179 Ga0209129_1002974 3300025258 Bacteria 7724
180 Ga0209233_1000037 3300025261 Bacteria 554620
181 Ga0209233_1000071 3300025261 Bacteria 363290
182 Ga0209233_1000327 3300025261 Bacteria 49691
183 Ga0209455_1000285 3300025272 Bacteria 54489
184 Ga0209673_1000063 3300025273 Bacteria 256709
185 Ga0209673_1002213 3300025273 Bacteria 14182
186 Ga0209673_1004086 3300025273 Bacteria 8039
187 Ga0209673_1018230 3300025273 Bacteria 2561
188 Ga0209130_1000002 3300025284 Bacteria 722648
189 Ga0209130_1000005 3300025284 Bacteria 599620
190 Ga0209130_1000028 3300025284 Bacteria 325668
191 Ga0209130_1013611 3300025284 Bacteria 2076
192 Ga0209675_1011465 3300025291 Bacteria 2938
193 Ga0209676_1001325 3300025292 Bacteria 25063
194 Ga0209676_1011651 3300025292 Bacteria 3524
195 Ga0209025_1000377 3300025294 Bacteria 92728
196 Ga0209025_1000640 3300025294 Bacteria 61714
197 Ga0209025_1001341 3300025294 Bacteria 33186
198 Ga0209025_1022700 3300025294 Bacteria 3315
199 Ga0209025_1047344 3300025294 Bacteria 1757
200 Ga0209564_1000093 3300025295 Bacteria 245793
201 Ga0209564_1000316 3300025295 Bacteria 94849
202 Ga0209564_1000850 3300025295 Bacteria 40751
203 Ga0209564_1001378 3300025295 Bacteria 25367
204 Ga0209758_1000028 3300025297 Bacteria 530102
205 Ga0209758_1000260 3300025297 Bacteria 104985
206 Ga0209758_1002404 3300025297 Bacteria 19205
207 Ga0209758_1003956 3300025297 Bacteria 12860
208 Ga0209758_1004858 3300025297 Bacteria 10841
209 Ga0209050_1006323 3300025298 Bacteria 7052
210 Ga0209050_1011244 3300025298 Bacteria 4278
211 Ga0209256_1000027 3300025299 Bacteria 423283
212 Ga0209256_1001021 3300025299 Bacteria 32969
213 Ga0209256_1004071 3300025299 Bacteria 9499
214 Ga0209256_1004369 3300025299 Bacteria 8944
215 Ga0209256_1004751 3300025299 Bacteria 8294
216 Ga0209256_1010844 3300025299 Bacteria 3746
217 Ga0207426_1000012 3300025302 Bacteria 730942
218 Ga0207426_1000013 3300025302 Bacteria 721897
219 Ga0207426_1000015 3300025302 Bacteria 599316
220 Ga0207426_1000070 3300025302 Bacteria 331559
221 Ga0207426_1006180 3300025302 Bacteria 5268
222 Ga0209051_1011032 3300025303 Bacteria 4503
223 Ga0209051_1015226 3300025303 Bacteria 3549
224 Ga0209257_1001105 3300025304 Bacteria 35073
225 Ga0209257_1001210 3300025304 Bacteria 32401
226 Ga0209257_1005410 3300025304 Bacteria 8981
227 Ga0207656_10039610 3300025321 Bacteria 1994
228 Ga0207713_1055387 3300025735 Bacteria 1548
229 Ga0207692_10034512 3300025898 Bacteria 2450
230 Ga0207642_10010103 3300025899 Bacteria 3311
231 Ga0207647_10025575 3300025904 Bacteria 3876
232 Ga0207645_10111544 3300025907 Bacteria 1771
233 Ga0207705_10031430 3300025909 Bacteria 3790
234 Ga0207684_10129516 3300025910 Bacteria 2166
235 Ga0207654_10076085 3300025911 Bacteria 2008
236 Ga0207654_10130529 3300025911 Bacteria 1590
237 Ga0207695_10000036 3300025913 Bacteria 477897
238 Ga0207695_10043453 3300025913 Bacteria 4789
239 Ga0207671_10000153 3300025914 Bacteria 107114
240 Ga0207671_10169984 3300025914 Bacteria 1692
241 Ga0207671_10171981 3300025914 Bacteria 1683
242 Ga0207693_10039217 3300025915 Bacteria 3730
243 Ga0207693_10075686 3300025915 Bacteria 2636
244 Ga0207663_10046377 3300025916 Bacteria 2677
245 Ga0207657_10006840 3300025919 Bacteria 11765
246 Ga0207649_10013572 3300025920 Bacteria 4550
247 Ga0207649_10212709 3300025920 Bacteria 1373
248 Ga0207694_10121149 3300025924 Bacteria 2089
249 Ga0207694_10141417 3300025924 Bacteria 1935
250 Ga0207650_10000782 3300025925 Bacteria 24485
251 Ga0207659_10141946 3300025926 Bacteria 1865
252 Ga0207664_10088642 3300025929 Bacteria 2532
253 Ga0207664_10369939 3300025929 Bacteria 1271
254 Ga0207644_10169720 3300025931 Bacteria 1702
255 Ga0207690_10206419 3300025932 Bacteria 1495
256 Ga0207706_10088214 3300025933 Bacteria 2727
257 Ga0207669_10002893 3300025937 Bacteria 7365
258 Ga0207704_10014825 3300025938 Bacteria 3950
259 Ga0207665_10039024 3300025939 Bacteria 3164
260 Ga0207667_10008878 3300025949 Bacteria 11896
261 Ga0207667_10026867 3300025949 Bacteria 6281
262 Ga0207640_10152532 3300025981 Bacteria 1699
263 Ga0207639_10001998 3300026041 Bacteria 13745
264 Ga0207639_10201711 3300026041 Bacteria 1706
265 Ga0207702_10008133 3300026078 Bacteria 8875
266 Ga0207702_10055122 3300026078 Bacteria 3371
267 Ga0207702_10097326 3300026078 Bacteria 2590
268 Ga0207702_10174175 3300026078 Bacteria 1976
269 Ga0207674_10120759 3300026116 Bacteria 2588
270 Ga0207698_10006747 3300026142 Bacteria 7172
271 Ga0207698_10009753 3300026142 Bacteria 6133
272 Ga0207698_10071795 3300026142 Bacteria 2749
273 Ga0209371_1002557 3300027312 Bacteria 10046
274 Ga0268266_10047955 3300028379 Bacteria 3661
275 Ga0268266_10066214 3300028379 Bacteria 3124
276 Ga0268265_10051264 3300028380 Bacteria 3115
277 Ga0307515_10000029 3300028794 Bacteria 365410
278 Ga0307515_10001776 3300028794 Bacteria 48034
279 Ga0307515_10003164 3300028794 Bacteria 34834
280 Ga0307515_10026670 3300028794 Bacteria 9929
281 Ga0265338_10069386 3300028800 Bacteria 3028
282 Ga0268256_1002463 3300030500 Bacteria 9407
283 Ga0265325_10035986 3300031241 Bacteria 2626
284 Ga0265339_10023194 3300031249 Bacteria 3589
285 Ga0307513_10001982 3300031456 Bacteria 28985
286 Ga0307513_10073472 3300031456 Bacteria 3560
287 Ga0307513_10375722 3300031456 Bacteria 1162
288 Ga0307408_100060821 3300031548 Bacteria 2755
289 Ga0265313_10046954 3300031595 Bacteria 2093
290 Ga0307508_10000020 3300031616 Bacteria 188730
291 Ga0307412_10054903 3300031911 Bacteria 2647
292 Ga0307412_10289925 3300031911 Bacteria 1289
293 Ga0307414_10191183 3300032004 Bacteria 1656
294 Ga0307510_10084998 3300033180 Bacteria 3044
295 Ga0373926_0011056 3300035083 Bacteria 3033
296 Ga0373944_0015436 3300035089 Bacteria 2143
297 Ga0373945_0016063 3300035116 Bacteria 2521
298 Ga0373953_0057400 3300035117 Bacteria 1585
299 Ga0373954_0025143 3300035118 Bacteria 2720
300 Ga0373956_0040919 3300035119 Bacteria 2057
301 Ga0373957_0023047 3300035120 Bacteria 2223
302 Ga0373955_0056713 3300035172 Bacteria 2149
303 Ga0373924_0024890 3300035410 Bacteria 2362
304 Ga0373935_0050703 3300035692 Bacteria 2634
305 Ga0373927_0006032 3300035695 Bacteria 8301
306 Ga0373927_0012029 3300035695 Bacteria 5756
307 Ga0373933_0014450 3300035724 Bacteria 4393
308 Ga0373925_0019083 3300037068 Bacteria 4985
309 Ga0373925_0028001 3300037068 Bacteria 4126
310 Ga0395900_0045661 3300037418 Bacteria 4512
311 Ga0395900_0056317 3300037418 Bacteria 4047
312 Ga0395898_0105359 3300037466 Bacteria 2704
313 Ga0395898_0127035 3300037466 Bacteria 2443
314 Ga0395905_0001768 3300037471 Bacteria 25105
315 Ga0395905_0037373 3300037471 Bacteria 4559
316 Ga0395905_0073182 3300037471 Bacteria 3212
317 Ga0395905_0111462 3300037471 Bacteria 2569
318 Ga0395905_0180188 3300037471 Bacteria 1983
319 Ga0395901_0065263 3300038443 Bacteria 3790
320 Ga0395901_0134057 3300038443 Bacteria 2603
321 Ga0400483_103419 3300039062 Bacteria 1666
322 Ga0400489_17362 3300039093 Bacteria 11149
323 Ga0436365_0573039 3300039437 Bacteria 3443
324 Ga0436365_0621918 3300039437 Bacteria 5397
325 Ga0436360_0132579 3300039438 Bacteria 4138
326 Ga0436360_0289876 3300039438 Bacteria 1176
327 Ga0436360_1083723 3300039438 Bacteria 2336
328 Ga0436361_0164403 3300039447 Bacteria 1321
329 Ga0436363_0564222 3300039450 Bacteria 1337
330 Ga0436362_1026947 3300039453 Bacteria 1580
331 Ga0451833_0106057 3300041491 Bacteria 4438
332 Ga0451841_0249018 3300041498 Bacteria 2987
333 Ga0451846_46969 3300041502 Bacteria 3335
334 Ga0451849_0240187 3300041505 Bacteria 3766
335 Ga0451850_19693 3300041506 Bacteria 1511
336 Ga0451851_0622038 3300041507 Bacteria 4766
337 Ga0451843_1077451 3300041509 Bacteria 4580
338 Ga0451853_3983291 3300041512 Bacteria 3410
339 Ga0439449_0059483 3300042007 Bacteria 1410
340 Ga0466959_0031023 3300045049 Bacteria 3956
341 Ga0466958_0070504 3300045836 Bacteria 2139
342 Ga0495592_0097731 3300046454 Bacteria 2096
343 Ga0495603_0036543 3300046455 Bacteria 2949
344 Ga0495629_0096324 3300046459 Bacteria 2064
345 Ga0495638_0003118 3300046460 Bacteria 13128
346 Ga0495638_0023360 3300046460 Bacteria 4044
347 Ga0495641_0019765 3300046461 Bacteria 3435
348 Ga0495582_0041095 3300046473 Bacteria 2547
349 Ga0495605_0002225 3300046474 Bacteria 12113
350 Ga0495605_0070882 3300046474 Bacteria 1647
351 Ga0495639_0034108 3300046475 Bacteria 2275
352 Ga0495662_0008741 3300046476 Bacteria 4981
353 Ga0495664_0081840 3300046477 Bacteria 1936
354 Ga0495585_0020361 3300046492 Bacteria 3815
355 Ga0495585_0064288 3300046492 Bacteria 2012
356 Ga0495585_0067069 3300046492 Bacteria 1964
357 Ga0495594_0013312 3300046499 Bacteria 4292
358 Ga0495583_0053229 3300046506 Bacteria 1838
359 Ga0495606_0083978 3300046507 Bacteria 1973
360 Ga0495608_0085807 3300046511 Bacteria 2040
361 Ga0495610_0050712 3300046512 Bacteria 2024
362 Ga0495616_0076071 3300046513 Bacteria 1614
363 Ga0495618_0049027 3300046514 Bacteria 2667
364 Ga0495620_0014278 3300046515 Bacteria 4040
365 Ga0495620_0040589 3300046515 Bacteria 2047
366 Ga0495628_0032817 3300046516 Bacteria 4188
367 Ga0495628_0300649 3300046516 Bacteria 1188
368 Ga0495630_0040671 3300046517 Bacteria 3474
369 Ga0495631_0009759 3300046518 Bacteria 4781
370 Ga0495632_0038861 3300046519 Bacteria 2407
371 Ga0495643_0034019 3300046522 Bacteria 2814
372 Ga0495643_0061381 3300046522 Bacteria 1994
373 Ga0495643_0080626 3300046522 Bacteria 1694
374 Ga0495648_0046690 3300046524 Bacteria 2682
375 Ga0495666_0021162 3300046526 Bacteria 3219
376 Ga0495652_0065477 3300046529 Bacteria 3053
377 Ga0495654_0115971 3300046530 Bacteria 1217
378 Ga0495665_0016261 3300046531 Bacteria 4008
379 Ga0495667_0074476 3300046559 Bacteria 2210
380 Ga0495668_0012485 3300046616 Bacteria 5036
381 Ga0495668_0088676 3300046616 Bacteria 1696
382 Ga0495634_0039279 3300046642 Bacteria 3223
383 Ga0495625_0015581 3300046660 Bacteria 6014
384 Ga0495635_0022301 3300046663 Bacteria 4408
385 Ga0495588_0027302 3300046674 Bacteria 2853
386 Ga0495588_0058951 3300046674 Bacteria 1985
387 Ga0495599_0077880 3300046678 Bacteria 2070
388 Ga0495647_0030554 3300046681 Bacteria 1999
389 Ga0495658_0036633 3300046683 Bacteria 2707
390 Ga0495613_0041019 3300046689 Bacteria 3428
391 Ga0495624_0066685 3300046690 Bacteria 2246
392 Ga0495660_0060652 3300046810 Bacteria 2031
393 Ga0495660_0078927 3300046810 Bacteria 1729
394 Ga0495581_0035060 3300047315 Bacteria 2903
395 Ga0495604_0075601 3300047317 Bacteria 2536
396 Ga0495672_0058306 3300047320 Bacteria 2239
397 Ga0495676_0066952 3300047321 Bacteria 2780
398 Ga0495684_0004438 3300047471 Bacteria 10966
399 Ga0495593_0027567 3300047673 Bacteria 3126
400 Ga0495614_0016974 3300048089 Bacteria 3165
401 Ga0495626_0172561 3300048091 Bacteria 901
402 Ga0496100_0223798 3300048903 Bacteria 1382
403 Ga0496110_0271537 3300048913 Bacteria 1544
404 Ga0496112_0483260 3300048915 Bacteria 1175
405 Ga0496115_0204697 3300048918 Bacteria 1630
406 Ga0496116_0000817 3300048919 Bacteria 39421
407 Ga0496116_0078573 3300048919 Bacteria 2057
408 Ga0496117_0001790 3300048920 Bacteria 29267
409 Ga0496118_0047854 3300048921 Bacteria 3310
410 Ga0496120_0070693 3300048923 Bacteria 1919
411 Ga0496121_0027658 3300048924 Bacteria 5301
412 Ga0496121_0155236 3300048924 Bacteria 1680
413 Ga0496121_0178770 3300048924 Bacteria 1534
414 Ga0496121_0215283 3300048924 Bacteria 1358
415 Ga0496122_0000321 3300048925 Bacteria 105353
416 Ga0496122_0004983 3300048925 Bacteria 16067
417 Ga0496123_0002294 3300048926 Bacteria 24023
418 Ga0496123_0064404 3300048926 Bacteria 2336
419 Ga0496124_0000558 3300048927 Bacteria 63070
420 Ga0496125_0000628 3300048928 Bacteria 59302
421 Ga0496126_0000378 3300048929 Bacteria 92187
422 Ga0496126_0001398 3300048929 Bacteria 38223
423 Ga0501033_0002685 3300049570 Bacteria 14934
424 Ga0501034_0035062 3300049571 Bacteria 5088
425 Ga0501034_0114416 3300049571 Bacteria 2686
426 Ga0501034_0177714 3300049571 Bacteria 2094
427 Ga0501034_0188553 3300049571 Bacteria 2025
428 Ga0501034_0218209 3300049571 Bacteria 1860
429 Ga0501034_0223547 3300049571 Bacteria 1834
430 Ga0501067_0056163 3300049583 Bacteria 2182
431 Ga0501070_0123642 3300049586 Bacteria 2138
432 Ga0501080_0012824 3300049742 Bacteria 7688
433 Ga0501080_0031148 3300049742 Bacteria 4970
434 Ga0501080_0236591 3300049742 Bacteria 1668
435 Ga0501083_0061025 3300049744 Bacteria 2518
436 Ga0501035_0001858 3300049822 Bacteria 21271
437 Ga0501044_0178664 3300049823 Bacteria 2090
438 nmdc:mga00v17_69096_c1 3300050491 Bacteria 2185
439 nmdc:mga0yw44_4194_c1 3300050492 Bacteria 6558
440 nmdc:mga0yw44_47282_c1 3300050492 Bacteria 2589
441 nmdc:mga07m45_68349_c1 3300050496 Bacteria 2020
442 Ga0500610_0038971 3300053079 Bacteria 2450
443 Ga0500610_0073653 3300053079 Bacteria 1781
444 Ga0500646_0012505 3300053090 Bacteria 2191
445 Ga0500594_0003597 3300053118 Bacteria 3415
446 Ga0500595_007283 3300053119 Bacteria 4594
447 Ga0500559_0015974 3300053136 Bacteria 3169
448 Ga0500568_0000125 3300053139 Bacteria 68806
449 Ga0500568_0002801 3300053139 Bacteria 10089
450 Ga0500568_0041898 3300053139 Bacteria 1837
451 Ga0500604_0001711 3300053151 Bacteria 6150
452 Ga0500616_0000294 3300053153 Bacteria 72551
453 Ga0500616_0002294 3300053153 Bacteria 16178
454 Ga0500616_0030325 3300053153 Bacteria 2970
455 Ga0500620_010779 3300053155 Bacteria 2423
456 Ga0500622_0000117 3300053156 Bacteria 82720
457 Ga0500622_0002895 3300053156 Bacteria 11971
458 Ga0500624_003493 3300053157 Bacteria 2062
459 Ga0500636_0000918 3300053177 Bacteria 15861
460 Ga0500636_0070836 3300053177 Bacteria 2022
461 Ga0500609_001646 3300053731 Bacteria 3258
462 Ga0590075_004304 3300059424 Bacteria 3372
463 Ga0587084_002332 3300059477 Bacteria 1952
464 Ga0587084_004088 3300059477 Bacteria 1647
465 Ga0587093_005551 3300059478 Bacteria 1337
466 Ga0587073_0007280 3300059492 Bacteria 1742
467 Ga0587080_005275 3300059503 Bacteria 1727
468 Ga0587082_001056 3300059504 Bacteria 2683
469 Ga0587083_0001176 3300059505 Bacteria 2832
470 Ga0587083_0003721 3300059505 Bacteria 2057
471 Ga0587088_000476 3300059508 Bacteria 3310
472 Ga0587088_000888 3300059508 Bacteria 2832
473 Ga0587090_003733 3300059510 Bacteria 1793
474 Ga0587090_004435 3300059510 Bacteria 1704
475 Ga0587091_009026 3300059511 Bacteria 1490
476 Ga0587094_003594 3300059513 Bacteria 1703
477 Ga0587098_002840 3300059604 Bacteria 1504
478 Ga0587106_000776 3300059605 Bacteria 2498
479 Ga0587115_006031 3300059626 Bacteria 1384
480 Ga0587128_000287 3300059630 Bacteria 3356
481 Ga0587128_001328 3300059630 Bacteria 2297
482 Ga0587128_001652 3300059630 Bacteria 2161
483 Ga0587072_012696 3300059643 Bacteria 1396
484 Ga0587075_000216 3300059644 Bacteria 3841
485 Ga0587075_001341 3300059644 Bacteria 2346
486 Ga0587076_000314 3300059645 Bacteria 3689
487 Ga0587076_005422 3300059645 Bacteria 1649
488 Ga0587078_000357 3300059646 Bacteria 3289
489 Ga0587079_004623 3300059647 Bacteria 1888
490 Ga0587079_007276 3300059647 Bacteria 1650
491 Ga0587119_000952 3300059658 Bacteria 2195
492 Ga0587071_001084 3300060344 Bacteria 3235
493 Ga0587071_010558 3300060344 Bacteria 1543
494 Ga0587111_0001234 3300060346 Bacteria 2981
495 Ga0587111_0002147 3300060346 Bacteria 2570
496 Ga0587111_0006406 3300060346 Bacteria 1865
497 Ga0587111_0022169 3300060346 Bacteria 1231
498 2509109048 2508501122 Bacteria 6292184
499 2509118984 2508501123 Bacteria 6283661
500 2509141173 2508501127 Bacteria 7037543
501 2509370950 2509276018 Bacteria 6910194
502 2509375218 2509276019 Bacteria 6802256
503 2509388701 2509276021 Bacteria 7634384
504 2509397932 2509276022 Bacteria 6200534
505 2509444289 2509276033 Bacteria 7180565
506 2510131148 2510065019 Bacteria 6903379
507 2510316511 2510065059 Bacteria 6847884
508 2510897456 2510461076 Bacteria 8618824
509 2511134686 2510917022 Bacteria 6504556
510 2511172672 2510917026 Bacteria 7046020
511 2511186899 2510917028 Bacteria 6185411
512 2511197800 2510917030 Bacteria 7460662
513 2511391213 2511231027 Bacteria 5013807
514 2512929595 2512875016 Bacteria 6529530
515 2512964378 2512875024 Bacteria 7195110
516 2513570355 2513237084 Bacteria 7231967
517 2513574650 2513237085 Bacteria 7695351
518 2513597359 2513237088 Bacteria 6927906
519 2513633906 2513237093 Bacteria 7545552
520 2513707285 2513237103 Bacteria 7647401
521 2513869078 2513237138 Bacteria 7368160
522 2513911249 2513237144 Bacteria 7530820
523 2513924552 2513237146 Bacteria 7166346
524 2514024689 2513237162 Bacteria 7468464
525 2514036911 2513237164 Bacteria 7563725
526 2514422852 2513237305 Bacteria 7293571
527 2515110080 2515075009 Bacteria 7288508
528 2515638813 2515154113 Bacteria 7807172
529 2515646894 2515154114 Bacteria 7848616
530 2515661151 2515154116 Bacteria 7552979
531 2515740846 2515154134 Bacteria 7220242
532 2516204541 2516143018 Bacteria 6951533
533 2517038769 2516653077 Bacteria 7555578
534 2517079017 2516653085 Bacteria 7346596
535 2517097810 2517093000 Bacteria 7412387
536 2517409230 2517287029 Bacteria 6905599
537 2520375725 2519899620 Bacteria 6499161
538 2524458183 2524023209 Bacteria 6679728
539 2530648076 2529292951 Bacteria 6916614
540 2535514839 2534681796 Bacteria 7146037
541 2558866320 2558860100 Bacteria 8458965
542 2585164682 2582581283 Bacteria 6030556
543 2585205571 2582581294 Bacteria 6626667
544 2585223526 2582581298 Bacteria 7315509
545 2585229585 2582581299 Bacteria 6518058
546 2585265030 2582581306 Bacteria 6450535
547 2585273767 2582581307 Bacteria 6597605
548 2585280059 2582581308 Bacteria 7413247
549 2585326164 2582581315 Bacteria 7318924
550 2585330330 2582581316 Bacteria 7774528
551 2585385911 2582581865 Bacteria 6644329
552 2585398818 2582581867 Bacteria 7184437
553 2585523645 2585427526 Bacteria 7258840
554 2585533689 2585427527 Bacteria 7273426
555 2585541945 2585427528 Bacteria 6842387
556 2585545878 2585427529 Bacteria 7395659
557 2585553282 2585427530 Bacteria 7383882
558 2585559941 2585427531 Bacteria 6992870
559 2585819062 2585427590 Bacteria 6824633
560 2585840407 2585427593 Bacteria 7141551
561 2585900617 2585427608 Bacteria 6544331
562 2585905880 2585427609 Bacteria 6667127
563 2585996399 2585427633 Bacteria 6413184
564 2586001007 2585427634 Bacteria 6455027
565 2587979005 2585428125 Bacteria 6662905
566 2588515167 2588253730 Bacteria 6881675
567 2597815897 2597489875 Bacteria 7010078
568 2599419484 2599185170 Bacteria 7295545
569 2600191176 2599185352 Bacteria 7228948
570 2616293684 2615840624 Bacteria 6557588
571 2616309305 2615840626 Bacteria 7921970
572 2616553222 2615840698 Bacteria 7319877
573 2617380439 2617270742 Bacteria 6808054
574 2643774762 2643221551 Bacteria 3750538
575 2643793206 2643221555 Bacteria 3749717
576 2643806062 2643221557 Bacteria 7184309
577 2643857450 2643221568 Bacteria 5187270
578 2643989064 2643221595 Bacteria 6565519
579 2644004668 2643221599 Bacteria 6292121
580 2644047449 2643221607 Bacteria 6314006
581 2644066239 2643221610 Bacteria 7480339
582 2644103519 2643221618 Bacteria 7717186
583 2644144398 2643221626 Bacteria 8069654
584 2644152249 2643221627 Bacteria 6761570
585 2644194540 2643221634 Bacteria 6705461
586 2644199867 2643221636 Bacteria 6583769
587 2644237418 2643221643 Bacteria 5749658
588 2644297858 2643221653 Bacteria 4569637
589 2644306449 2643221655 Bacteria 7722067
590 2644330639 2643221659 Bacteria 7890716
591 2644377323 2643221668 Bacteria 7306521
592 2644417570 2643221675 Bacteria 7473456
593 2644450966 2643221680 Bacteria 7473610
594 2644480238 2643221686 Bacteria 6310811
595 2644495624 2643221688 Bacteria 5260751
596 2644497060 2643221689 Bacteria 6042950
597 2644542557 2643221698 Bacteria 7756764
598 2644612060 2643221712 Bacteria 7729434
599 2644656111 2643221719 Bacteria 4568197
600 2644671746 2643221723 Bacteria 7095460
601 2644692611 2643221726 Bacteria 7455827
602 2671113845 2667528174 Bacteria 6435400
603 2688600345 2687453392 Bacteria 6880454
604 2692317500 2690316117 Bacteria 6800650
605 2694632519 2693429783 Bacteria 7019804
606 2694639750 2693429784 Bacteria 7241525
607 2719179296 2718217882 Bacteria 6556348
608 2719383866 2718217927 Bacteria 6972593
609 2719663656 2718217997 Bacteria 6740740
610 2719729966 2718218009 Bacteria 6478651
611 2720490075 2718218199 Bacteria 6740745
612 2720611455 2718218232 Bacteria 6720332
613 2720618305 2718218233 Bacteria 6662049
614 2720629708 2718218235 Bacteria 6630699
615 2720773404 2718218269 Bacteria 6906114
616 2721145389 2718218363 Bacteria 6524337
617 2721156905 2718218365 Bacteria 6274507
618 2721162284 2718218366 Bacteria 6425255
619 2721397636 2718218423 Bacteria 6438183
620 2722838454 2721755514 Bacteria 6424414
621 2723025078 2721755556 Bacteria 6745503
622 2723558660 2721755684 Bacteria 6859907
623 2723565230 2721755685 Bacteria 6704835
624 2723577637 2721755686 Bacteria 7343952
625 2724036446 2721755809 Bacteria 6438790
626 2724042722 2721755810 Bacteria 6479005
627 2724088011 2721755819 Bacteria 6906405
628 2724102495 2721755822 Bacteria 6726041
629 2724108395 2721755823 Bacteria 6752556
630 2725952317 2724679232 Bacteria 7646494
631 2730106014 2728369352 Bacteria 6745171
632 2730162533 2728369365 Bacteria 6555560
633 2730296537 2728369397 Bacteria 6274511
634 2738947233 2738541317 Bacteria 5340176
635 2739036830 2738541333 Bacteria 7106503
636 2753462660 2751185821 Bacteria 6189929
637 2756673091 2756170246 Bacteria 7451806
638 2766063463 2765235942 Bacteria 7445910
639 2776911798 2775507049 Bacteria 6284736
640 2778177132 2775507266 Bacteria 7392367
641 2792621206 2791355091 Bacteria 6135441
642 2792625421 2791355092 Bacteria 6248105
643 2792637853 2791355094 Bacteria 7011481
644 2793296895 2791355256 Bacteria 6798008
645 2793313932 2791355259 Bacteria 7254731
646 2793322226 2791355260 Bacteria 6598818
647 2793329953 2791355261 Bacteria 6661293
648 2793336187 2791355262 Bacteria 6774204
649 2793344850 2791355263 Bacteria 6872478
650 2793348402 2791355264 Bacteria 6429314
651 2793352751 2791355265 Bacteria 6539969
652 2793358220 2791355266 Bacteria 7116587
653 2793365623 2791355267 Bacteria 7222458
654 2805928080 2802429605 Bacteria 6875453
655 2805935441 2802429606 Bacteria 6346811
656 2806046762 2802429633 Bacteria 7341974
657 2806051523 2802429634 Bacteria 7083200
658 2806059512 2802429635 Bacteria 7650140
659 2806066523 2802429636 Bacteria 7597525
660 2806073581 2802429637 Bacteria 7067217
661 2819245102 2818991272 Bacteria 4622173
662 2819608590 2818991448 Bacteria 6772224
663 2819640699 2818991453 Bacteria 7181617
664 2838022533 2838016132 Bacteria 6577831
665 2838028482 2838022645 Bacteria 6494267
666 2838029473 2838029111 Bacteria 6603031
667 2838039984 2838035591 Bacteria 7166484
668 2838048801 2838042994 Bacteria 6046894
669 2838053855 2838048938 Bacteria 6044578
670 2838065939 2838061910 Bacteria 6794874
671 2838070811 2838068647 Bacteria 6208656
672 2838666130 2838661181 Bacteria 7385261
673 2838673286 2838668709 Bacteria 6671819
674 2838680322 2838680041 Bacteria 6545511
675 2838689535 2838686498 Bacteria 7807632
676 2838695646 2838694306 Bacteria 6853137
677 2838707306 2838701080 Bacteria 6669771
678 2838709022 2838707686 Bacteria 6619912
679 2838731756 2838729681 Bacteria 7400765
680 2838744697 2838742623 Bacteria 7396178
681 2841734963 2841734538 Bacteria 6784580
682 2841853238 2841851746 Bacteria 7532261
683 2841868813 2841864319 Bacteria 6742987
684 2842079743 2842077413 Bacteria 6508645
685 2842117744 2842110456 Bacteria 7656360
686 2842120361 2842118031 Bacteria 7033875
687 2842150624 2842146304 Bacteria 5957337
688 2842160563 2842156927 Bacteria 6894975
689 2842165449 2842163707 Bacteria 6916235
690 2842183771 2842180545 Bacteria 6888678
691 2842198082 2842192696 Bacteria 6147454
692 2842204510 2842198810 Bacteria 6608673
693 2842211105 2842205361 Bacteria 6340321
694 2842219122 2842217011 Bacteria 7497767
695 2842231351 2842229732 Bacteria 7475766
696 2842238433 2842237096 Bacteria 6620661
697 2842246178 2842243621 Bacteria 7421798
698 2842255497 2842250916 Bacteria 6579627
699 2842260556 2842257432 Bacteria 7401195
700 2842270382 2842264693 Bacteria 6472963
701 2842273981 2842271015 Bacteria 7807131
702 2842284557 2842278818 Bacteria 6340002
703 2842286570 2842285085 Bacteria 6011953
704 2842293404 2842291075 Bacteria 7076806
705 2842299632 2842298080 Bacteria 6123127
706 2842310649 2842304105 Bacteria 7023636
707 2842317204 2842311132 Bacteria 6616990
708 2842323738 2842317721 Bacteria 6793725
709 2842344345 2842341865 Bacteria 7003929
710 2842361061 2842357229 Bacteria 6485165
711 2842367390 2842363717 Bacteria 6844742
712 2842370785 2842370503 Bacteria 7038661
713 2842379801 2842377471 Bacteria 7140707
714 2842386872 2842384541 Bacteria 7057858
715 2842401776 2842395702 Bacteria 6780583
716 2842403877 2842402390 Bacteria 6681310
717 2842410420 2842409023 Bacteria 6687331
718 2842417068 2842415677 Bacteria 6596907
719 2842424426 2842422224 Bacteria 6239196
720 2842434204 2842428310 Bacteria 6767288
721 2842440537 2842434925 Bacteria 6502746
722 2842447189 2842441272 Bacteria 6769273
723 2842452923 2842447887 Bacteria 6754142
724 2842468626 2842462802 Bacteria 6588055
725 2842475142 2842469257 Bacteria 6752936
726 2842476097 2842475841 Bacteria 6603183
727 2842486183 2842482326 Bacteria 7212537
728 2842495403 2842489311 Bacteria 6620893
729 2842499993 2842495871 Bacteria 6820686
730 2842503001 2842502639 Bacteria 6604161
731 2842512855 2842509118 Bacteria 6850950
732 2842875794 2842871566 Bacteria 4827117
733 2844005540 2844002411 Bacteria 7168230
734 2844015657 2844009547 Bacteria 6728125
735 2844170212 2844163670 Bacteria 7266046
736 2844456296 2844454524 Bacteria 7952546
737 2847417430 2847417321 Bacteria 6913799
738 2847672029 2847670302 Bacteria 6165597
739 2847688339 2847686936 Bacteria 6278406
740 2848992214 2848992105 Bacteria 6810864
741 2850079720 2850079185 Bacteria 6848280
742 2852388265 2852387548 Bacteria 8025568
743 2854899805 2854896431 Bacteria 5869725
744 2854920975 2854916844 Bacteria 5725939
745 2855876438 2855872281 Bacteria 6964271
746 2856324199 2856320880 Bacteria 7263508
747 2856328639 2856328259 Bacteria 6528202
748 2856341661 2856334872 Bacteria 7037011
749 2856345370 2856342000 Bacteria 7176905
750 2856351209 2856349417 Bacteria 6230045
751 2856364872 2856364286 Bacteria 6939991
752 2857354872 2857349434 Bacteria 7926032
753 2857370965 2857367948 Bacteria 6965560
754 2857524488 2857516855 Bacteria 7787325
755 2869243155 2869242130 Bacteria 6609239
756 2869253611 2869249662 Bacteria 6868783
757 2869259414 2869256925 Bacteria 6981691
758 2869271187 2869264136 Bacteria 6880765
759 2869278539 2869271264 Bacteria 6908218
760 2869281803 2869278585 Bacteria 7077053
761 2869289679 2869285874 Bacteria 6901219
762 2871431745 2871429161 Bacteria 6547891
763 2871453863 2871451962 Bacteria 7336357
764 2871466052 2871459585 Bacteria 6866887
765 2871473173 2871466892 Bacteria 6923287
766 2871475426 2871474448 Bacteria 6806570
767 2871494139 2871488783 Bacteria 6929816
768 2871499001 2871495908 Bacteria 6935695
769 2874103963 2874102143 Bacteria 6342645
770 2874111427 2874109183 Bacteria 6517025
771 2874116942 2874116593 Bacteria 6674494
772 2874127770 2874123672 Bacteria 7238285
773 2874133489 2874131515 Bacteria 6820270
774 2874140519 2874139085 Bacteria 7021506
775 2874155423 2874146452 Bacteria 7533118
776 2874162280 2874155637 Bacteria 6724144
777 2874166606 2874162495 Bacteria 6174670
778 2876366843 2876363079 Bacteria 6544991
779 2876375289 2876369609 Bacteria 6807521
780 2876387425 2876386047 Bacteria 6698674
781 2876398818 2876392853 Bacteria 6660880
782 2876404653 2876399893 Bacteria 6927900
783 2876412212 2876406927 Bacteria 6191900
784 2876420768 2876413966 Bacteria 6831344
785 2876427008 2876420981 Bacteria 6687741
786 2878037543 2878035449 Bacteria 6555736
787 2878732973 2878730984 Bacteria 6380721
788 2878739465 2878738818 Bacteria 7136951
789 2878748351 2878745973 Bacteria 6867388
790 2878756714 2878753008 Bacteria 6922523
791 2878763211 2878760144 Bacteria 6823465
792 2878770189 2878767105 Bacteria 6898628
793 2878776239 2878774303 Bacteria 6108671
794 2878786140 2878781027 Bacteria 6834456
795 2878790570 2878788777 Bacteria 6567085
796 2881153958 2881147464 Bacteria 7779814
797 2881157664 2881155292 Bacteria 6461656
798 2881163031 2881161766 Bacteria 7127907
799 2881851058 2881845957 Bacteria 6611900
800 2881859874 2881853255 Bacteria 6698367
801 2881862441 2881861095 Bacteria 7128710
802 2882636932 2882632389 Bacteria 8154593
803 2882915404 2882912400 Bacteria 6801539
804 2885311966 2885305155 Bacteria 7348390
805 2885315938 2885312484 Bacteria 6415165
806 2885325348 2885318864 Bacteria 6729568
807 2885331750 2885326080 Bacteria 7134805
808 2885342083 2885334103 Bacteria 7216818
809 2885349699 2885342637 Bacteria 7011821
810 2885353319 2885350715 Bacteria 6787678
811 2888341722 2888337043 Bacteria 6629336
812 2888349012 2888343758 Bacteria 6611049
813 2888350864 2888350351 Bacteria 7372807
814 2889013210 2889010040 Bacteria 6749192
815 2889021937 2889016732 Bacteria 6700763
816 2903453689 2903448605 Bacteria 7357801
817 2903502357 2903492973 Bacteria 13473544
818 2903506028 2903492973 Bacteria 13473544
819 2903521120 2903513507 Bacteria 6344008
820 2903524710 2903521522 Bacteria 6525694
821 2903531047 2903528002 Bacteria 6586099
822 2903543802 2903540706 Bacteria 7062119
823 2904665350 2904659560 Bacteria 6685615
824 2906311968 2906308376 Bacteria 6841989
825 2906323706 2906321335 Bacteria 6579571
826 2906331503 2906328253 Bacteria 6585166
827 2906365048 2906363423 Bacteria 6856682
828 2906371138 2906370794 Bacteria 6881062
829 2906379541 2906378014 Bacteria 6911440
830 2906389234 2906386501 Bacteria 5977019
831 2906394068 2906393657 Bacteria 6790866
832 2906405897 2906401398 Bacteria 6693206
833 2906408440 2906408224 Bacteria 6162342
834 2906418268 2906414383 Bacteria 6580790
835 2906432040 2906427513 Bacteria 6375796
836 2913312670 2913308742 Bacteria 5350706
837 2919101592 2919100787 Bacteria 7710546
838 2919166571 2919166419 Bacteria 4952238
839 2919174520 2919171160 Bacteria 6499771
840 2919408615 2919408235 Bacteria 6149349
841 2920823096 2920822456 Bacteria 6897201
842 2922136670 2922130491 Bacteria 7173936
843 2922153488 2922151315 Bacteria 6902399
844 2922159399 2922158528 Bacteria 6573167
845 2922178137 2922172374 Bacteria 6167644
846 2922181987 2922178524 Bacteria 6025201
847 2922190565 2922185730 Bacteria 7113964
848 2923556456 2923556063 Bacteria 6793593
849 2924710788 2924710171 Bacteria 6752351
850 2924722383 2924718760 Bacteria 6331356
851 2924733138 2924726620 Bacteria 6271473
852 2924736042 2924733363 Bacteria 7574837
853 2924746345 2924741084 Bacteria 6661321
854 2924751416 2924748358 Bacteria 6154725
855 2924758084 2924754689 Bacteria 6774424
856 2924764400 2924762789 Bacteria 6561353
857 2924776990 2924776078 Bacteria 7492003
858 2924788303 2924784321 Bacteria 7416538
859 2928525207 2928521798 Bacteria 4960112
860 2933020260 2933016740 Bacteria 6355406
861 2933577140 2933570622 Bacteria 7023390
862 2933593788 2933586486 Bacteria 7667493
863 2933601614 2933599457 Bacteria 5858799
864 2935896168 2935894831 Bacteria 6620579
865 2935902631 2935901341 Bacteria 7341747
866 2936369218 2936367885 Bacteria 7324495
867 2936377435 2936375103 Bacteria 6652732
868 2936387160 2936381700 Bacteria 7006523
869 2937818209 2937813078 Bacteria 7783518
870 2937838570 2937836603 Bacteria 6811263
871 2937846124 2937843397 Bacteria 5256375
872 2937850644 2937848649 Bacteria 6983481
873 2937863164 2937861824 Bacteria 6660327
874 2937873656 2937868953 Bacteria 6639878
875 2937880295 2937877337 Bacteria 7246526
876 2937896418 2937891427 Bacteria 6357007
877 2937976160 2937972304 Bacteria 7532020
878 2937986501 2937980651 Bacteria 6517427
879 2937997652 2937994558 Bacteria 7036190
880 2941500942 2941499720 Bacteria 7599444
881 2954011252 2954011201 Bacteria 4762601
882 2958037764 2958034702 Bacteria 6989922
883 2958047476 2958041894 Bacteria 13082850
884 2958056270 2958041894 Bacteria 13082850
885 2958074602 2958071322 Bacteria 6815895
886 2958087431 2958084443 Bacteria 7312792
887 2958100066 2958092219 Bacteria 6861151
888 2958104018 2958100919 Bacteria 6800575
889 2958112667 2958108152 Bacteria 6681128
890 2958116701 2958115193 Bacteria 6923548
891 2958128842 2958122699 Bacteria 7280457
892 2958134052 2958130278 Bacteria 6897202
893 2958142977 2958137437 Bacteria 6050276
894 2958149073 2958144490 Bacteria 6677056
895 2958164528 2958158011 Bacteria 6058449
896 2958168126 2958165035 Bacteria 6906348
897 2958175973 2958172287 Bacteria 6716688
898 2958183698 2958179912 Bacteria 6874908
899 2961081664 2961077736 Bacteria 7079850
900 2961120350 2961114664 Bacteria 6680456
901 2961134137 2961127735 Bacteria 7196641
902 2961139440 2961136820 Bacteria 6775228
903 2961166591 2961163497 Bacteria 6901077
904 2961173004 2961170736 Bacteria 7072258
905 2961187026 2961183825 Bacteria 6688536
906 2963649637 2963644680 Bacteria 6530403
907 2965021414 2965018300 Bacteria 6883036
908 2965026260 2965025482 Bacteria 6532201
909 2965037532 2965032056 Bacteria 6887443
910 2965046565 2965040258 Bacteria 6855979
911 2965051308 2965047637 Bacteria 6623551
912 2965070154 2965062239 Bacteria 7412989
913 2965094969 2965089291 Bacteria 6866420
914 2965106519 2965102966 Bacteria 6800987
915 2965112496 2965110997 Bacteria 6693150
916 2965121158 2965119406 Bacteria 6956431
917 2967998215 2967996073 Bacteria 6787468
918 2968008867 2968003550 Bacteria 6929263
919 2968019388 2968016561 Bacteria 7022047
920 2968087053 2968083720 Bacteria 7351627
921 2968095697 2968091066 Bacteria 6052692
922 2968099617 2968097103 Bacteria 6107094
923 2968116817 2968110612 Bacteria 6814636
924 2968118543 2968117919 Bacteria 6536078
925 2968131875 2968128360 Bacteria 6270294
926 2968145752 2968138860 Bacteria 6605449
927 2968174996 2968171901 Bacteria 6894245
928 2970472709 2970469710 Bacteria 6969209
929 2970494716 2970489779 Bacteria 6517260
930 2970505598 2970503327 Bacteria 7099517
931 2970515900 2970510686 Bacteria 7006402
932 2970529206 2970524798 Bacteria 6840927
933 2970544233 2970540015 Bacteria 6977556
934 2970550668 2970547951 Bacteria 6931819
935 2970558055 2970554993 Bacteria 6814252
936 2970596407 2970593180 Bacteria 7073582
937 2970624138 2970619444 Bacteria 6986144
938 2970627446 2970627176 Bacteria 6680862
939 2977825894 2977821940 Bacteria 6906439
940 2977836549 2977828996 Bacteria 7007971
941 2977851305 2977843712 Bacteria 6753583
942 2977854967 2977851361 Bacteria 6694324
943 2977861811 2977858184 Bacteria 6215359
944 2977874973 2977872689 Bacteria 7270173
945 2977898933 2977898635 Bacteria 6675551
946 2977912719 2977907340 Bacteria 6577984
947 2977915812 2977915119 Bacteria 6829656
948 2977927667 2977922695 Bacteria 6956781
949 2977938608 2977935797 Bacteria 6252826
950 2977946655 2977942078 Bacteria 7570577
951 2977955370 2977950692 Bacteria 6893264
952 2977960412 2977957713 Bacteria 6877875
953 2978972962 2978969890 Bacteria 5400756
954 2979711935 2979710463 Bacteria 6785254
955 2979748531 2979742915 Bacteria 7301278
956 2979771053 2979764755 Bacteria 6610066
957 2979776254 2979772303 Bacteria 6618277
958 2979781248 2979779861 Bacteria 6219781
959 2979810319 2979808191 Bacteria 7179355
960 2984591210 2984587000 Bacteria 5263363
961 2987643474 2987636660 Bacteria 8088555
962 2987649310 2987645492 Bacteria 6117018
963 2987654955 2987652177 Bacteria 6969023
964 2987662602 2987659509 Bacteria 6966464
965 2987672754 2987666974 Bacteria 6509233
966 2987679201 2987673487 Bacteria 6884027
967 2989777195 2989776772 Bacteria 4843317
968 2996313108 2996310559 Bacteria 6357320
969 2996340108 2996336353 Bacteria 5511628
970 2996347097 2996341866 Bacteria 6643098
971 2996352158 2996348954 Bacteria 7239054
972 2996888258 2996887358 Bacteria 5795980
973 2996897867 2996893221 Bacteria 5823108
974 3000142072 3000135777 Bacteria 6891109
975 3004191653 3004188549 Bacteria 6952365
976 3004198772 3004195979 Bacteria 6776956
977 3004207019 3004203850 Bacteria 7307914
978 3004213939 3004211236 Bacteria 7417683
979 3004223530 3004218560 Bacteria 7421728
980 3004234154 3004232784 Bacteria 6662140
981 3004252905 3004248173 Bacteria 6563236
982 3004273271 3004268573 Bacteria 7043476
983 3004278856 3004275668 Bacteria 7114440
984 3004296333 3004289098 Bacteria 6135450
985 3004339176 3004334049 Bacteria 8449246
986 3005422994 3005416602 Bacteria 7064308
987 3005445948 3005445848 Bacteria 6906074
988 3005456625 3005452660 Bacteria 5889319
989 637079341 637000159 Bacteria 7596297
990 639646363 639633055 Bacteria 7751309
991 643824320 643692032 Bacteria 6891900
992 649874807 649633066 Bacteria 6690028
993 8004306074 8004300914 Bacteria 6132239
994 8004362607 8004361976 Bacteria 6858373
995 8004378302 8004374579 Bacteria 6898112
996 8004391557 8004387939 Bacteria 7049250
997 8004396067 8004395343 Bacteria 6620908
998 8004448890 8004445564 Bacteria 6322258
999 8004635885 8004633249 Bacteria 6723080
1000 8004646146 8004640170 Bacteria 6723001
1001 8004698064 8004695233 Bacteria 6731676
1002 8004705040 8004703790 Bacteria 8006957
1003 8004716926 8004714634 Bacteria 6776161
1004 8004730796 8004727605 Bacteria 6643904
1005 8005247657 8005246636 Bacteria 4933972
1006 8005261190 8005258706 Bacteria 6184835
1007 8005278572 8005275841 Bacteria 6929066
1008 8005282888 8005282627 Bacteria 6675747
1009 8005291360 8005289223 Bacteria 6634003
1010 8005305739 8005301065 Bacteria 6614431
1011 8005310556 8005307578 Bacteria 7395396
1012 8005315321 8005314921 Bacteria 7072929
1013 8005322785 8005321885 Bacteria 5795980
1014 8005377721 8005376324 Bacteria 6590079
1015 8005385050 8005382845 Bacteria 6732062
1016 8005399873 8005395548 Bacteria 6806915
1017 8005432671 8005430974 Bacteria 6689030
1018 8005460716 8005460587 Bacteria 7157962
1019 8005484763 8005484373 Bacteria 6297373
1020 8005498400 8005497431 Bacteria 6477605
1021 8005543511 8005542996 Bacteria 7077758
1022 8005560324 8005556819 Bacteria 6908598
1023 8005564215 8005563573 Bacteria 7153261
1024 8005573779 8005570704 Bacteria 6957481
1025 8005619591 8005619151 Bacteria 7030230
1026 8005628157 8005626139 Bacteria 6534237
1027 8005649456 8005645114 Bacteria 6950293
1028 8005669809 8005668836 Bacteria 6953162
1029 8005685300 8005682033 Bacteria 6726518
1030 8005692506 8005688590 Bacteria 6610080
1031 8005699550 8005695170 Bacteria 6912330
1032 8018132833 8018127388 Bacteria 7351159
1033 8018167294 8018163183 Bacteria 7277977
1034 8018181779 8018176218 Bacteria 6896178
1035 8023684532 8023680758 Bacteria 7729763
1036 8024480007 8024479707 Bacteria 6954785
1037 8024491588 8024486573 Bacteria 6540512
1038 8024502276 8024501048 Bacteria 6427847
1039 8045868836 8045864390 Bacteria 5043873
1040 8046770887 8046767195 Bacteria 7547379
1041 8054463969 8054460903 Bacteria 4872905
1042 8054562429 8054558443 Bacteria 5204801
1043 8055623281 8055617313 Bacteria 7548464
1044 8056376216 8056375014 Bacteria 7006639
1045 8056384049 8056382006 Bacteria 6408074
1046 8057580504 8057575449 Bacteria 7367519
1047 8057877445 8057874678 Bacteria 7494653
1048 Ga0495643_0030883
1049 JGI24740J21852_10003158
1050 JGI24740J21852_10034379
1051 JGI24739J22299_10021505
1052 JGI25155J39150_1000013
1053 JGI25156J39149_1000011
1054 JGI25162J39368_1000689
1055 JGI25162J39368_1000691
1056 JGI25154J39366_1000030
1057 JGI25158J39367_1000035
1058 JGI25158J39367_1000131
1059 JGI25157J39369_1000013
1060 JGI25152J39213_1001483
1061 JGI25152J39213_1001575
1062 JGI25150J39212_1005319
1063 JGI25150J39212_1007582
1064 JGI25159J45721_1000003
1065 JGI25159J45721_1000744
1066 JGI25159J45721_1005254
1067 JGI25151J46595_10003116
1068 JGI25165J46597_1000570
1069 JGI25165J46597_1000585
1070 JGI25165J46597_1005287
1071 JGI25153J46596_10000019
1072 JGI25153J46596_10012357
1073 JGI25153J46596_10019798
1074 JGI25153J46596_10031042
1075 JGI25153J46596_10035557
1076 rootH2_10073882
1077 rootL2_10169956
1078 rootH1_10045214
1079 rootH1_10045215
1080 JGI25160J50197_1000003
1081 JGI25160J50197_1000012
1082 JGI25160J50197_1001972
1083 JGI25160J50197_1003267
1084 JGI25161J50226_1000002
1085 JGI25161J50226_1000117
1086 JGI25161J50226_1000239
1087 JGI25161J50226_1003492
1088 Ga0055542_1001310
1089 Ga0055526_1003533
1090 Ga0055526_1004786
1091 Ga0055526_1005685
1092 Ga0055526_1008119
1093 Ga0055526_1010480
1094 Ga0055524_1000434
1095 Ga0055524_1002834
1096 Ga0055524_1004206
1097 Ga0055524_1012460
1098 Ga0055536_1001453
1099 Ga0055536_1009528
1100 Ga0055528_1000980
1101 Ga0055528_1006042
1102 Ga0055528_1024873
1103 Ga0055530_10015740
1104 Ga0055540_1000272
1105 Ga0055540_1001914
1106 Ga0055540_1006279
1107 Ga0055531_10004167
1108 Ga0055531_10009339
1109 Ga0055543_1000037
1110 Ga0055543_1000043
1111 Ga0055543_1000050
1112 Ga0055543_1000774
1113 Ga0065165_1000025
1114 Ga0065165_1000031
1115 Ga0065165_1011568
1116 Ga0070658_10002384
1117 Ga0070658_10043031
1118 Ga0070676_10035100
1119 Ga0070683_100050306
1120 Ga0070670_100000804
1121 Ga0068868_100151352
1122 Ga0070660_100073407
1123 Ga0070661_100002956
1124 Ga0070668_100292478
1125 Ga0070674_100003923
1126 Ga0070659_100009384
1127 Ga0070659_100025829
1128 Ga0070667_100030775
1129 Ga0070714_100052896
1130 Ga0070711_100010859
1131 Ga0068867_100062890
1132 Ga0070706_100165663
1133 Ga0068853_100002324
1134 Ga0068853_100027668
1135 Ga0070696_100013007
1136 Ga0070665_100056660
1137 Ga0070665_100094359
1138 Ga0070665_100242741
1139 Ga0068857_100037943
1140 Ga0068857_100115940
1141 Ga0068854_100015003
1142 Ga0068854_100056539
1143 Ga0068854_100116883
1144 Ga0068856_100029490
1145 Ga0068856_100034847
1146 Ga0068856_100042470
1147 Ga0068856_100055414
1148 Ga0068856_100111178
1149 Ga0068852_100005219
1150 Ga0068852_100013122
1151 Ga0068852_100081107
1152 Ga0068852_100103702
1153 Ga0068852_100180931
1154 Ga0081538_10031659
1155 Ga0075365_10001931
1156 Ga0075365_10002056
1157 Ga0075365_10006944
1158 Ga0075365_10125946
1159 Ga0075365_10186989
1160 Ga0075368_10039284
1161 Ga0075363_100061610
1162 Ga0075364_10038606
1163 Ga0070716_100031359
1164 Ga0070712_100010344
1165 Ga0070712_100100551
1166 Ga0070712_100216157
1167 Ga0075362_10000690
1168 Ga0075362_10059267
1169 Ga0075367_10007331
1170 Ga0075367_10009334
1171 Ga0075367_10030465
1172 Ga0075370_10018681
1173 Ga0075370_10109436
1174 Ga0075370_10149612
1175 Ga0075370_10162050
1176 Ga0068871_100125217
1177 Ga0105251_10029488
1178 Ga0105240_10000024
1179 Ga0105240_10141342
1180 Ga0105247_10209062
1181 Ga0105243_10187896
1182 Ga0105241_10071891
1183 Ga0105237_10000836
1184 Ga0105237_10187633
1185 Ga0105238_10034431
1186 Ga0105238_10084504
1187 Ga0105249_10082657
1188 Ga0123341_1000038
1189 Ga0123342_1018935
1190 Ga0123342_1020164
1191 Ga0105239_10002164
1192 Ga0105239_10027356
1193 Ga0105239_10225211
1194 Ga0105239_10301481
1195 Ga0105239_10392335
1196 Ga0105246_10165297
1197 Ga0157371_10005722
1198 Ga0157371_10013041
1199 Ga0157370_10009366
1200 Ga0157370_10013336
1201 Ga0157369_10019547
1202 Ga0157369_10203492
1203 Ga0171463_1001
1204 Ga0157374_10405397
1205 Ga0157378_10305188
1206 Ga0163162_10221066
1207 Ga0157380_10013281
1208 Ga0183363_1081
1209 Ga0163161_10075353
1210 Ga0214543_1000027
1211 Ga0213874_10011048
1212 Ga0213876_10045224
1213 Ga0209435_100026
1214 Ga0209436_100054
1215 Ga0209672_103076
1216 Ga0209563_101317
1217 Ga0209437_100050
1218 Ga0209437_100056
1219 Ga0207425_1000673
1220 Ga0209646_1000084
1221 Ga0209646_1013046
1222 Ga0209026_1000080
1223 Ga0209148_1000056
1224 Ga0209759_1000061
1225 Ga0209129_1002601
1226 Ga0209129_1002974
1227 Ga0209233_1000037
1228 Ga0209233_1000071
1229 Ga0209233_1000327
1230 Ga0209455_1000285
1231 Ga0209673_1000063
1232 Ga0209673_1002213
1233 Ga0209673_1004086
1234 Ga0209673_1018230
1235 Ga0209130_1000002
1236 Ga0209130_1000005
1237 Ga0209130_1000028
1238 Ga0209130_1013611
1239 Ga0209675_1011465
1240 Ga0209676_1001325
1241 Ga0209676_1011651
1242 Ga0209025_1000377
1243 Ga0209025_1000640
1244 Ga0209025_1001341
1245 Ga0209025_1022700
1246 Ga0209025_1047344
1247 Ga0209564_1000093
1248 Ga0209564_1000316
1249 Ga0209564_1000850
1250 Ga0209564_1001378
1251 Ga0209758_1000028
1252 Ga0209758_1000260
1253 Ga0209758_1002404
1254 Ga0209758_1003956
1255 Ga0209758_1004858
1256 Ga0209050_1006323
1257 Ga0209050_1011244
1258 Ga0209256_1000027
1259 Ga0209256_1001021
1260 Ga0209256_1004071
1261 Ga0209256_1004369
1262 Ga0209256_1004751
1263 Ga0209256_1010844
1264 Ga0207426_1000012
1265 Ga0207426_1000013
1266 Ga0207426_1000015
1267 Ga0207426_1000070
1268 Ga0207426_1006180
1269 Ga0209051_1011032
1270 Ga0209051_1015226
1271 Ga0209257_1001105
1272 Ga0209257_1001210
1273 Ga0209257_1005410
1274 Ga0207656_10039610
1275 Ga0207713_1055387
1276 Ga0207692_10034512
1277 Ga0207642_10010103
1278 Ga0207647_10025575
1279 Ga0207645_10111544
1280 Ga0207705_10031430
1281 Ga0207684_10129516
1282 Ga0207654_10076085
1283 Ga0207654_10130529
1284 Ga0207695_10000036
1285 Ga0207695_10043453
1286 Ga0207671_10000153
1287 Ga0207671_10169984
1288 Ga0207671_10171981
1289 Ga0207693_10039217
1290 Ga0207693_10075686
1291 Ga0207663_10046377
1292 Ga0207657_10006840
1293 Ga0207649_10013572
1294 Ga0207649_10212709
1295 Ga0207694_10121149
1296 Ga0207694_10141417
1297 Ga0207650_10000782
1298 Ga0207659_10141946
1299 Ga0207664_10088642
1300 Ga0207664_10369939
1301 Ga0207644_10169720
1302 Ga0207690_10206419
1303 Ga0207706_10088214
1304 Ga0207669_10002893
1305 Ga0207704_10014825
1306 Ga0207665_10039024
1307 Ga0207667_10008878
1308 Ga0207667_10026867
1309 Ga0207640_10152532
1310 Ga0207639_10001998
1311 Ga0207639_10201711
1312 Ga0207702_10008133
1313 Ga0207702_10055122
1314 Ga0207702_10097326
1315 Ga0207702_10174175
1316 Ga0207674_10120759
1317 Ga0207698_10006747
1318 Ga0207698_10009753
1319 Ga0207698_10071795
1320 Ga0209371_1002557
1321 Ga0268266_10047955
1322 Ga0268266_10066214
1323 Ga0268265_10051264
1324 Ga0307515_10000029
1325 Ga0307515_10001776
1326 Ga0307515_10003164
1327 Ga0307515_10026670
1328 Ga0265338_10069386
1329 Ga0268256_1002463
1330 Ga0265325_10035986
1331 Ga0265339_10023194
1332 Ga0307513_10001982
1333 Ga0307513_10073472
1334 Ga0307513_10375722
1335 Ga0307408_100060821
1336 Ga0265313_10046954
1337 Ga0307508_10000020
1338 Ga0307412_10054903
1339 Ga0307412_10289925
1340 Ga0307414_10191183
1341 Ga0307510_10084998
1342 Ga0373926_0011056
1343 Ga0373944_0015436
1344 Ga0373945_0016063
1345 Ga0373953_0057400
1346 Ga0373954_0025143
1347 Ga0373956_0040919
1348 Ga0373957_0023047
1349 Ga0373955_0056713
1350 Ga0373924_0024890
1351 Ga0373935_0050703
1352 Ga0373927_0006032
1353 Ga0373927_0012029
1354 Ga0373933_0014450
1355 Ga0373925_0019083
1356 Ga0373925_0028001
1357 Ga0395900_0045661
1358 Ga0395900_0056317
1359 Ga0395898_0105359
1360 Ga0395898_0127035
1361 Ga0395905_0001768
1362 Ga0395905_0037373
1363 Ga0395905_0073182
1364 Ga0395905_0111462
1365 Ga0395905_0180188
1366 Ga0395901_0065263
1367 Ga0395901_0134057
1368 Ga0400483_103419
1369 Ga0400489_17362
1370 Ga0436365_0573039
1371 Ga0436365_0621918
1372 Ga0436360_0132579
1373 Ga0436360_0289876
1374 Ga0436360_1083723
1375 Ga0436361_0164403
1376 Ga0436363_0564222
1377 Ga0436362_1026947
1378 Ga0451833_0106057
1379 Ga0451841_0249018
1380 Ga0451846_46969
1381 Ga0451849_0240187
1382 Ga0451850_19693
1383 Ga0451851_0622038
1384 Ga0451843_1077451
1385 Ga0451853_3983291
1386 Ga0439449_0059483
1387 Ga0466959_0031023
1388 Ga0466958_0070504
1389 Ga0495592_0097731
1390 Ga0495603_0036543
1391 Ga0495629_0096324
1392 Ga0495638_0003118
1393 Ga0495638_0023360
1394 Ga0495641_0019765
1395 Ga0495582_0041095
1396 Ga0495605_0002225
1397 Ga0495605_0070882
1398 Ga0495639_0034108
1399 Ga0495662_0008741
1400 Ga0495664_0081840
1401 Ga0495585_0020361
1402 Ga0495585_0064288
1403 Ga0495585_0067069
1404 Ga0495594_0013312
1405 Ga0495583_0053229
1406 Ga0495606_0083978
1407 Ga0495608_0085807
1408 Ga0495610_0050712
1409 Ga0495616_0076071
1410 Ga0495618_0049027
1411 Ga0495620_0014278
1412 Ga0495620_0040589
1413 Ga0495628_0032817
1414 Ga0495628_0300649
1415 Ga0495630_0040671
1416 Ga0495631_0009759
1417 Ga0495632_0038861
1418 Ga0495643_0034019
1419 Ga0495643_0061381
1420 Ga0495643_0080626
1421 Ga0495648_0046690
1422 Ga0495666_0021162
1423 Ga0495652_0065477
1424 Ga0495654_0115971
1425 Ga0495665_0016261
1426 Ga0495667_0074476
1427 Ga0495668_0012485
1428 Ga0495668_0088676
1429 Ga0495634_0039279
1430 Ga0495625_0015581
1431 Ga0495635_0022301
1432 Ga0495588_0027302
1433 Ga0495588_0058951
1434 Ga0495599_0077880
1435 Ga0495647_0030554
1436 Ga0495658_0036633
1437 Ga0495613_0041019
1438 Ga0495624_0066685
1439 Ga0495660_0060652
1440 Ga0495660_0078927
1441 Ga0495581_0035060
1442 Ga0495604_0075601
1443 Ga0495672_0058306
1444 Ga0495676_0066952
1445 Ga0495684_0004438
1446 Ga0495593_0027567
1447 Ga0495614_0016974
1448 Ga0495626_0172561
1449 Ga0496100_0223798
1450 Ga0496110_0271537
1451 Ga0496112_0483260
1452 Ga0496115_0204697
1453 Ga0496116_0000817
1454 Ga0496116_0078573
1455 Ga0496117_0001790
1456 Ga0496118_0047854
1457 Ga0496120_0070693
1458 Ga0496121_0027658
1459 Ga0496121_0155236
1460 Ga0496121_0178770
1461 Ga0496121_0215283
1462 Ga0496122_0000321
1463 Ga0496122_0004983
1464 Ga0496123_0002294
1465 Ga0496123_0064404
1466 Ga0496124_0000558
1467 Ga0496125_0000628
1468 Ga0496126_0000378
1469 Ga0496126_0001398
1470 Ga0501033_0002685
1471 Ga0501034_0035062
1472 Ga0501034_0114416
1473 Ga0501034_0177714
1474 Ga0501034_0188553
1475 Ga0501034_0218209
1476 Ga0501034_0223547
1477 Ga0501067_0056163
1478 Ga0501070_0123642
1479 Ga0501080_0012824
1480 Ga0501080_0031148
1481 Ga0501080_0236591
1482 Ga0501083_0061025
1483 Ga0501035_0001858
1484 Ga0501044_0178664
1485 nmdc:mga00v17_69096_c1
1486 nmdc:mga0yw44_4194_c1
1487 nmdc:mga0yw44_47282_c1
1488 nmdc:mga07m45_68349_c1
1489 Ga0500610_0038971
1490 Ga0500610_0073653
1491 Ga0500646_0012505
1492 Ga0500594_0003597
1493 Ga0500595_007283
1494 Ga0500559_0015974
1495 Ga0500568_0000125
1496 Ga0500568_0002801
1497 Ga0500568_0041898
1498 Ga0500604_0001711
1499 Ga0500616_0000294
1500 Ga0500616_0002294
1501 Ga0500616_0030325
1502 Ga0500620_010779
1503 Ga0500622_0000117
1504 Ga0500622_0002895
1505 Ga0500624_003493
1506 Ga0500636_0000918
1507 Ga0500636_0070836
1508 Ga0500609_001646
1509 Ga0590075_004304
1510 Ga0587084_002332
1511 Ga0587084_004088
1512 Ga0587093_005551
1513 Ga0587073_0007280
1514 Ga0587080_005275
1515 Ga0587082_001056
1516 Ga0587083_0001176
1517 Ga0587083_0003721
1518 Ga0587088_000476
1519 Ga0587088_000888
1520 Ga0587090_003733
1521 Ga0587090_004435
1522 Ga0587091_009026
1523 Ga0587094_003594
1524 Ga0587098_002840
1525 Ga0587106_000776
1526 Ga0587115_006031
1527 Ga0587128_000287
1528 Ga0587128_001328
1529 Ga0587128_001652
1530 Ga0587072_012696
1531 Ga0587075_000216
1532 Ga0587075_001341
1533 Ga0587076_000314
1534 Ga0587076_005422
1535 Ga0587078_000357
1536 Ga0587079_004623
1537 Ga0587079_007276
1538 Ga0587119_000952
1539 Ga0587071_001084
1540 Ga0587071_010558
1541 Ga0587111_0001234
1542 Ga0587111_0002147
1543 Ga0587111_0006406
1544 Ga0587111_0022169
1545 2509109048
1546 2509118984
1547 2509141173
1548 2509370950
1549 2509375218
1550 2509388701
1551 2509397932
1552 2509444289
1553 2510131148
1554 2510316511
1555 2510897456
1556 2511134686
1557 2511172672
1558 2511186899
1559 2511197800
1560 2511391213
1561 2512929595
1562 2512964378
1563 2513570355
1564 2513574650
1565 2513597359
1566 2513633906
1567 2513707285
1568 2513869078
1569 2513911249
1570 2513924552
1571 2514024689
1572 2514036911
1573 2514422852
1574 2515110080
1575 2515638813
1576 2515646894
1577 2515661151
1578 2515740846
1579 2516204541
1580 2517038769
1581 2517079017
1582 2517097810
1583 2517409230
1584 2520375725
1585 2524458183
1586 2530648076
1587 2535514839
1588 2558866320
1589 2585164682
1590 2585205571
1591 2585223526
1592 2585229585
1593 2585265030
1594 2585273767
1595 2585280059
1596 2585326164
1597 2585330330
1598 2585385911
1599 2585398818
1600 2585523645
1601 2585533689
1602 2585541945
1603 2585545878
1604 2585553282
1605 2585559941
1606 2585819062
1607 2585840407
1608 2585900617
1609 2585905880
1610 2585996399
1611 2586001007
1612 2587979005
1613 2588515167
1614 2597815897
1615 2599419484
1616 2600191176
1617 2616293684
1618 2616309305
1619 2616553222
1620 2617380439
1621 2643774762
1622 2643793206
1623 2643806062
1624 2643857450
1625 2643989064
1626 2644004668
1627 2644047449
1628 2644066239
1629 2644103519
1630 2644144398
1631 2644152249
1632 2644194540
1633 2644199867
1634 2644237418
1635 2644297858
1636 2644306449
1637 2644330639
1638 2644377323
1639 2644417570
1640 2644450966
1641 2644480238
1642 2644495624
1643 2644497060
1644 2644542557
1645 2644612060
1646 2644656111
1647 2644671746
1648 2644692611
1649 2671113845
1650 2688600345
1651 2692317500
1652 2694632519
1653 2694639750
1654 2719179296
1655 2719383866
1656 2719663656
1657 2719729966
1658 2720490075
1659 2720611455
1660 2720618305
1661 2720629708
1662 2720773404
1663 2721145389
1664 2721156905
1665 2721162284
1666 2721397636
1667 2722838454
1668 2723025078
1669 2723558660
1670 2723565230
1671 2723577637
1672 2724036446
1673 2724042722
1674 2724088011
1675 2724102495
1676 2724108395
1677 2725952317
1678 2730106014
1679 2730162533
1680 2730296537
1681 2738947233
1682 2739036830
1683 2753462660
1684 2756673091
1685 2766063463
1686 2776911798
1687 2778177132
1688 2792621206
1689 2792625421
1690 2792637853
1691 2793296895
1692 2793313932
1693 2793322226
1694 2793329953
1695 2793336187
1696 2793344850
1697 2793348402
1698 2793352751
1699 2793358220
1700 2793365623
1701 2805928080
1702 2805935441
1703 2806046762
1704 2806051523
1705 2806059512
1706 2806066523
1707 2806073581
1708 2819245102
1709 2819608590
1710 2819640699
1711 2838022533
1712 2838028482
1713 2838029473
1714 2838039984
1715 2838048801
1716 2838053855
1717 2838065939
1718 2838070811
1719 2838666130
1720 2838673286
1721 2838680322
1722 2838689535
1723 2838695646
1724 2838707306
1725 2838709022
1726 2838731756
1727 2838744697
1728 2841734963
1729 2841853238
1730 2841868813
1731 2842079743
1732 2842117744
1733 2842120361
1734 2842150624
1735 2842160563
1736 2842165449
1737 2842183771
1738 2842198082
1739 2842204510
1740 2842211105
1741 2842219122
1742 2842231351
1743 2842238433
1744 2842246178
1745 2842255497
1746 2842260556
1747 2842270382
1748 2842273981
1749 2842284557
1750 2842286570
1751 2842293404
1752 2842299632
1753 2842310649
1754 2842317204
1755 2842323738
1756 2842344345
1757 2842361061
1758 2842367390
1759 2842370785
1760 2842379801
1761 2842386872
1762 2842401776
1763 2842403877
1764 2842410420
1765 2842417068
1766 2842424426
1767 2842434204
1768 2842440537
1769 2842447189
1770 2842452923
1771 2842468626
1772 2842475142
1773 2842476097
1774 2842486183
1775 2842495403
1776 2842499993
1777 2842503001
1778 2842512855
1779 2842875794
1780 2844005540
1781 2844015657
1782 2844170212
1783 2844456296
1784 2847417430
1785 2847672029
1786 2847688339
1787 2848992214
1788 2850079720
1789 2852388265
1790 2854899805
1791 2854920975
1792 2855876438
1793 2856324199
1794 2856328639
1795 2856341661
1796 2856345370
1797 2856351209
1798 2856364872
1799 2857354872
1800 2857370965
1801 2857524488
1802 2869243155
1803 2869253611
1804 2869259414
1805 2869271187
1806 2869278539
1807 2869281803
1808 2869289679
1809 2871431745
1810 2871453863
1811 2871466052
1812 2871473173
1813 2871475426
1814 2871494139
1815 2871499001
1816 2874103963
1817 2874111427
1818 2874116942
1819 2874127770
1820 2874133489
1821 2874140519
1822 2874155423
1823 2874162280
1824 2874166606
1825 2876366843
1826 2876375289
1827 2876387425
1828 2876398818
1829 2876404653
1830 2876412212
1831 2876420768
1832 2876427008
1833 2878037543
1834 2878732973
1835 2878739465
1836 2878748351
1837 2878756714
1838 2878763211
1839 2878770189
1840 2878776239
1841 2878786140
1842 2878790570
1843 2881153958
1844 2881157664
1845 2881163031
1846 2881851058
1847 2881859874
1848 2881862441
1849 2882636932
1850 2882915404
1851 2885311966
1852 2885315938
1853 2885325348
1854 2885331750
1855 2885342083
1856 2885349699
1857 2885353319
1858 2888341722
1859 2888349012
1860 2888350864
1861 2889013210
1862 2889021937
1863 2903453689
1864 2903502357
1865 2903506028
1866 2903521120
1867 2903524710
1868 2903531047
1869 2903543802
1870 2904665350
1871 2906311968
1872 2906323706
1873 2906331503
1874 2906365048
1875 2906371138
1876 2906379541
1877 2906389234
1878 2906394068
1879 2906405897
1880 2906408440
1881 2906418268
1882 2906432040
1883 2913312670
1884 2919101592
1885 2919166571
1886 2919174520
1887 2919408615
1888 2920823096
1889 2922136670
1890 2922153488
1891 2922159399
1892 2922178137
1893 2922181987
1894 2922190565
1895 2923556456
1896 2924710788
1897 2924722383
1898 2924733138
1899 2924736042
1900 2924746345
1901 2924751416
1902 2924758084
1903 2924764400
1904 2924776990
1905 2924788303
1906 2928525207
1907 2933020260
1908 2933577140
1909 2933593788
1910 2933601614
1911 2935896168
1912 2935902631
1913 2936369218
1914 2936377435
1915 2936387160
1916 2937818209
1917 2937838570
1918 2937846124
1919 2937850644
1920 2937863164
1921 2937873656
1922 2937880295
1923 2937896418
1924 2937976160
1925 2937986501
1926 2937997652
1927 2941500942
1928 2954011252
1929 2958037764
1930 2958047476
1931 2958056270
1932 2958074602
1933 2958087431
1934 2958100066
1935 2958104018
1936 2958112667
1937 2958116701
1938 2958128842
1939 2958134052
1940 2958142977
1941 2958149073
1942 2958164528
1943 2958168126
1944 2958175973
1945 2958183698
1946 2961081664
1947 2961120350
1948 2961134137
1949 2961139440
1950 2961166591
1951 2961173004
1952 2961187026
1953 2963649637
1954 2965021414
1955 2965026260
1956 2965037532
1957 2965046565
1958 2965051308
1959 2965070154
1960 2965094969
1961 2965106519
1962 2965112496
1963 2965121158
1964 2967998215
1965 2968008867
1966 2968019388
1967 2968087053
1968 2968095697
1969 2968099617
1970 2968116817
1971 2968118543
1972 2968131875
1973 2968145752
1974 2968174996
1975 2970472709
1976 2970494716
1977 2970505598
1978 2970515900
1979 2970529206
1980 2970544233
1981 2970550668
1982 2970558055
1983 2970596407
1984 2970624138
1985 2970627446
1986 2977825894
1987 2977836549
1988 2977851305
1989 2977854967
1990 2977861811
1991 2977874973
1992 2977898933
1993 2977912719
1994 2977915812
1995 2977927667
1996 2977938608
1997 2977946655
1998 2977955370
1999 2977960412
2000 2978972962
2001 2979711935
2002 2979748531
2003 2979771053
2004 2979776254
2005 2979781248
2006 2979810319
2007 2984591210
2008 2987643474
2009 2987649310
2010 2987654955
2011 2987662602
2012 2987672754
2013 2987679201
2014 2989777195
2015 2996313108
2016 2996340108
2017 2996347097
2018 2996352158
2019 2996888258
2020 2996897867
2021 3000142072
2022 3004191653
2023 3004198772
2024 3004207019
2025 3004213939
2026 3004223530
2027 3004234154
2028 3004252905
2029 3004273271
2030 3004278856
2031 3004296333
2032 3004339176
2033 3005422994
2034 3005445948
2035 3005456625
2036 637079341
2037 639646363
2038 643824320
2039 649874807
2040 8004306074
2041 8004362607
2042 8004378302
2043 8004391557
2044 8004396067
2045 8004448890
2046 8004635885
2047 8004646146
2048 8004698064
2049 8004705040
2050 8004716926
2051 8004730796
2052 8005247657
2053 8005261190
2054 8005278572
2055 8005282888
2056 8005291360
2057 8005305739
2058 8005310556
2059 8005315321
2060 8005322785
2061 8005377721
2062 8005385050
2063 8005399873
2064 8005432671
2065 8005460716
2066 8005484763
2067 8005498400
2068 8005543511
2069 8005560324
2070 8005564215
2071 8005573779
2072 8005619591
2073 8005628157
2074 8005649456
2075 8005669809
2076 8005685300
2077 8005692506
2078 8005699550
2079 8018132833
2080 8018167294
2081 8018181779
2082 8023684532
2083 8024480007
2084 8024491588
2085 8024502276
2086 8045868836
2087 8046770887
2088 8054463969
2089 8054562429
2090 8055623281
2091 8056376216
2092 8056384049
2093 8057580504
2094 8057877445

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

109

384

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.533 63 335
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.518 66 338
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.5098 66 343
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5065 41 337
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5015 66 338
ID Description Score Start End Superfamily
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.887 66 335 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8831 63 335 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8815 62 335 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8805 63 335 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8787 63 335 1.10.3470.10
ID Description Score Start End GO Terms
AF-D2C7R8-F1-model_v4 Autoinducer 2 import ATP-binding protein LsrA (EC 7.6.2.13) 0.9091 40 319 GO:0005524
GO:0005886
GO:0015611
GO:0016887
AF-A0A4Q3J594-F1-model_v4 Autoinducer 2 import system permease protein LsrD 0.9076 40 343 GO:0005886
GO:0022857
AF-A0A537LNY8-F1-model_v4 Autoinducer 2 import system permease protein LsrD 0.9064 76 335 GO:0005886
GO:0022857
AF-A0A645E5B6-F1-model_v4 Ribose import permease protein RbsC 0.9012 76 342 GO:0005886
GO:0022857
AF-A0A2U9PIC9-F1-model_v4 Autoinducer 2 import system permease protein LsrC 0.8978 72 279 GO:0005886
GO:0022857

Map