F488986
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1047 | 586 | 2094 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0121404|Ga0501035_0121404_1111_2031 |
| Length | 306 |
| Sequence | MRYFASWGSGFSDSAKSVASQTRSAGSDYALDRAGKWDDGRQSDCHDAGSDMADWSATQYLKFEDERTRPARDLLAQVPVAEPKRVVDIGCGPGNSTELLVARWPEAQVSGFDTSPDMIDKARKRLPAVHFELADAEGWMPAQPVDVIFANAVFQWLPRHQAVFRRLMGLLAPGGALAVQMPDNLAEPSHRLMRETAADMPFTEKLKGAARAPLPPVSSYYDLLRPLSARVDIWHTHYYHPLADAVAIVEWVKSTGLKPFLDPLEEEERREFLDRYTARIADTYPPAADGKVLLKFPRLFIVATKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 73 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 125 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 126 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 142 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 161 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 167 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 247 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 296 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 299 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 300 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 301 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 302 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 303 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 305 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 306 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 313 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 317 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 318 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 319 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 320 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 321 | 2512875024 | |||
| 322 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 323 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 324 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 325 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 326 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 327 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 328 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 329 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 330 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 331 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 332 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 333 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 334 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 335 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 336 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 337 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 338 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 339 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 340 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 341 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 342 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 343 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 344 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 345 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 346 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 347 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 348 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 349 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 350 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 351 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 352 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 353 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 354 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 355 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 356 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 357 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 358 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 359 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 360 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 361 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 362 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 363 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 364 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 365 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 366 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 367 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 368 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 369 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 370 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 371 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 372 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 373 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 374 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 375 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 376 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 377 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 378 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 379 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 380 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 381 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 382 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 383 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 384 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 385 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 386 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 387 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 388 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 389 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 390 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 391 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 392 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 393 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 394 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 395 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 396 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 397 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 398 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 399 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 400 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 401 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 402 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 403 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 404 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 405 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 406 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 407 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 408 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 409 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 410 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 411 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 412 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 413 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 414 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 415 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 416 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 417 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 418 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 419 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 420 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 421 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 422 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 423 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 424 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 425 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 426 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 427 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 428 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 429 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 430 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 431 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 432 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 433 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 434 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 435 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 436 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 437 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 438 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 439 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 440 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 441 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 442 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 443 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 444 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 445 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 446 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 447 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 448 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 449 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 450 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 451 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 452 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 453 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 454 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 455 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 456 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 457 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 458 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 459 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 460 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 461 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 462 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 463 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 464 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 465 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 466 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 467 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 468 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 469 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 470 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 471 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 472 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 473 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 474 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 475 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 476 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 477 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 478 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 479 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 480 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 481 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 482 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 483 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 484 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 485 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 486 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 487 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 488 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 489 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 490 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 491 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 492 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 493 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 494 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 495 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 496 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 497 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 498 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 499 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 500 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 501 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 502 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 503 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 504 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 505 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 506 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 507 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 508 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 509 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 510 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 511 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 512 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 513 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 514 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 515 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 516 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 517 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 518 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 519 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 520 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 521 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 522 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 523 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 524 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 525 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 526 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 527 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 528 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 529 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 530 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 531 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 532 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 533 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 534 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 535 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 536 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 537 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 538 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 539 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 540 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 541 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 542 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 543 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 544 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 545 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 546 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 547 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 548 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 549 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 550 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 551 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 552 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 553 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 554 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 555 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 556 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 557 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 558 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 559 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 560 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 561 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 562 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 563 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 564 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 565 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 566 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 567 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 568 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 569 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 570 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 571 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 572 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 573 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 574 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 575 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 576 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 577 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 578 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 579 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 580 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 581 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 582 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 583 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 584 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 585 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 586 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.83 |
| Metatranscriptomes | 0.1 |
| Isolates | 26.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.35 |
| Nodule | 21.68 |
| Rhizoplane | 2.77 |
| Rhizosphere | 61.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501035_0121404 | 3300049822 | Bacteria | 2284 |
| 2 | JGI24737J22298_10002261 | 3300001990 | Bacteria | 6862 |
| 3 | JGI24735J21928_10007364 | 3300002067 | Bacteria | 3592 |
| 4 | JGI25406J46586_10001817 | 3300003203 | Bacteria | 10016 |
| 5 | Ga0055542_1000986 | 3300003762 | Bacteria | 18435 |
| 6 | Ga0055528_1007052 | 3300003790 | Eukaryota | 5022 |
| 7 | Ga0070683_100326147 | 3300005329 | Bacteria | 1462 |
| 8 | Ga0070670_100008351 | 3300005331 | Bacteria | 8827 |
| 9 | Ga0070680_100063778 | 3300005336 | Bacteria | 3019 |
| 10 | Ga0070680_100106225 | 3300005336 | Bacteria | 2334 |
| 11 | Ga0070680_100285748 | 3300005336 | Bacteria | 1398 |
| 12 | Ga0070682_100046685 | 3300005337 | Bacteria | 2689 |
| 13 | Ga0070661_100227053 | 3300005344 | Bacteria | 1434 |
| 14 | Ga0070661_100570677 | 3300005344 | Bacteria | 912 |
| 15 | Ga0070659_100089890 | 3300005366 | Bacteria | 2460 |
| 16 | Ga0070659_100123154 | 3300005366 | Bacteria | 2102 |
| 17 | Ga0070659_100298918 | 3300005366 | Bacteria | 1342 |
| 18 | Ga0070667_100348700 | 3300005367 | Bacteria | 1340 |
| 19 | Ga0070709_10008945 | 3300005434 | Bacteria | 5513 |
| 20 | Ga0070709_10025287 | 3300005434 | Bacteria | 3507 |
| 21 | Ga0070709_10104679 | 3300005434 | Bacteria | 1891 |
| 22 | Ga0070709_10224734 | 3300005434 | Bacteria | 1340 |
| 23 | Ga0070709_10286081 | 3300005434 | Bacteria | 1200 |
| 24 | Ga0070714_100021907 | 3300005435 | Bacteria | 5232 |
| 25 | Ga0070713_100045619 | 3300005436 | Bacteria | 3593 |
| 26 | Ga0070710_10000417 | 3300005437 | Bacteria | 19992 |
| 27 | Ga0070710_10118230 | 3300005437 | Bacteria | 1601 |
| 28 | Ga0070711_100003647 | 3300005439 | Bacteria | 8999 |
| 29 | Ga0070711_100122213 | 3300005439 | Bacteria | 1928 |
| 30 | Ga0070663_100013308 | 3300005455 | Bacteria | 5241 |
| 31 | Ga0070663_100014776 | 3300005455 | Bacteria | 5019 |
| 32 | Ga0070662_100008152 | 3300005457 | Bacteria | 6825 |
| 33 | Ga0070681_10022697 | 3300005458 | Bacteria | 6305 |
| 34 | Ga0070681_10134356 | 3300005458 | Bacteria | 2405 |
| 35 | Ga0070681_10244274 | 3300005458 | Bacteria | 1708 |
| 36 | Ga0070681_10278429 | 3300005458 | Bacteria | 1584 |
| 37 | Ga0070679_100019564 | 3300005530 | Bacteria | 6587 |
| 38 | Ga0070679_100070219 | 3300005530 | Bacteria | 3495 |
| 39 | Ga0070679_100137818 | 3300005530 | Bacteria | 2421 |
| 40 | Ga0070684_100007976 | 3300005535 | Bacteria | 8266 |
| 41 | Ga0070684_100086636 | 3300005535 | Bacteria | 2780 |
| 42 | Ga0068853_100022093 | 3300005539 | Bacteria | 5309 |
| 43 | Ga0068853_100024626 | 3300005539 | Bacteria | 5048 |
| 44 | Ga0068853_100031106 | 3300005539 | Bacteria | 4513 |
| 45 | Ga0068853_100095964 | 3300005539 | Bacteria | 2615 |
| 46 | Ga0068853_100158998 | 3300005539 | Bacteria | 2037 |
| 47 | Ga0070693_100172819 | 3300005547 | Bacteria | 1385 |
| 48 | Ga0070693_100301259 | 3300005547 | Bacteria | 1081 |
| 49 | Ga0070665_100082332 | 3300005548 | Bacteria | 3223 |
| 50 | Ga0070665_100146315 | 3300005548 | Bacteria | 2366 |
| 51 | Ga0068855_100018872 | 3300005563 | Bacteria | 8290 |
| 52 | Ga0068855_100078782 | 3300005563 | Bacteria | 3822 |
| 53 | Ga0068855_100285170 | 3300005563 | Bacteria | 1832 |
| 54 | Ga0068855_100482265 | 3300005563 | Bacteria | 1349 |
| 55 | Ga0068857_100003393 | 3300005577 | Bacteria | 13264 |
| 56 | Ga0068857_100016795 | 3300005577 | Bacteria | 6412 |
| 57 | Ga0068854_100026994 | 3300005578 | Bacteria | 3952 |
| 58 | Ga0068854_100179605 | 3300005578 | Bacteria | 1653 |
| 59 | Ga0068854_100185865 | 3300005578 | Bacteria | 1626 |
| 60 | Ga0068856_100002827 | 3300005614 | Bacteria | 17773 |
| 61 | Ga0068856_100016560 | 3300005614 | Bacteria | 7135 |
| 62 | Ga0068856_100175169 | 3300005614 | Bacteria | 2157 |
| 63 | Ga0068852_100137192 | 3300005616 | Bacteria | 2259 |
| 64 | Ga0068852_100293120 | 3300005616 | Bacteria | 1572 |
| 65 | Ga0068864_100500101 | 3300005618 | Unclassified | 1169 |
| 66 | Ga0068851_10001384 | 3300005834 | Bacteria | 10587 |
| 67 | Ga0068862_100451139 | 3300005844 | Bacteria | 1212 |
| 68 | Ga0081539_10003450 | 3300005985 | Bacteria | 19403 |
| 69 | Ga0070717_10275568 | 3300006028 | Bacteria | 1491 |
| 70 | Ga0075365_10007012 | 3300006038 | Bacteria | 6270 |
| 71 | Ga0075365_10121498 | 3300006038 | Bacteria | 1802 |
| 72 | Ga0075365_10192221 | 3300006038 | Bacteria | 1428 |
| 73 | Ga0075363_100124524 | 3300006048 | Bacteria | 1442 |
| 74 | Ga0070715_10015227 | 3300006163 | Bacteria | 2863 |
| 75 | Ga0070716_100004688 | 3300006173 | Bacteria | 6556 |
| 76 | Ga0070716_100137540 | 3300006173 | Bacteria | 1553 |
| 77 | Ga0075367_10152218 | 3300006178 | Bacteria | 1436 |
| 78 | Ga0075369_10021673 | 3300006186 | Bacteria | 2643 |
| 79 | Ga0075369_10049536 | 3300006186 | Bacteria | 1815 |
| 80 | Ga0068871_100496554 | 3300006358 | Bacteria | 1099 |
| 81 | Ga0075428_100008942 | 3300006844 | Bacteria | 11115 |
| 82 | Ga0075431_100342205 | 3300006847 | Bacteria | 1505 |
| 83 | Ga0075429_100231393 | 3300006880 | Bacteria | 1619 |
| 84 | Ga0068865_100415313 | 3300006881 | Bacteria | 1105 |
| 85 | Ga0099794_10005752 | 3300007265 | Bacteria | 4997 |
| 86 | Ga0099794_10186145 | 3300007265 | Bacteria | 1061 |
| 87 | Ga0099795_10004056 | 3300007788 | Bacteria | 3728 |
| 88 | Ga0105240_10012741 | 3300009093 | Bacteria | 11589 |
| 89 | Ga0105240_10039036 | 3300009093 | Bacteria | 6083 |
| 90 | Ga0105240_10064831 | 3300009093 | Bacteria | 4538 |
| 91 | Ga0105240_10195546 | 3300009093 | Bacteria | 2375 |
| 92 | Ga0111539_10070035 | 3300009094 | Bacteria | 4140 |
| 93 | Ga0114129_10004474 | 3300009147 | Bacteria | 19707 |
| 94 | Ga0105243_10340825 | 3300009148 | Bacteria | 1373 |
| 95 | Ga0105241_10002223 | 3300009174 | Bacteria | 14590 |
| 96 | Ga0105237_10024483 | 3300009545 | Bacteria | 6175 |
| 97 | Ga0105237_10046007 | 3300009545 | Bacteria | 4391 |
| 98 | Ga0105237_10402357 | 3300009545 | Bacteria | 1374 |
| 99 | Ga0105238_10005872 | 3300009551 | Bacteria | 12161 |
| 100 | Ga0105238_10009265 | 3300009551 | Bacteria | 9853 |
| 101 | Ga0105238_10026487 | 3300009551 | Bacteria | 5912 |
| 102 | Ga0105238_10105708 | 3300009551 | Bacteria | 2797 |
| 103 | Ga0105238_10447731 | 3300009551 | Bacteria | 1288 |
| 104 | Ga0105238_10455735 | 3300009551 | Bacteria | 1276 |
| 105 | Ga0099796_10012686 | 3300010159 | Bacteria | 2387 |
| 106 | Ga0099796_10080751 | 3300010159 | Bacteria | 1192 |
| 107 | Ga0105239_10006765 | 3300010375 | Bacteria | 13236 |
| 108 | Ga0105239_10014460 | 3300010375 | Bacteria | 8758 |
| 109 | Ga0105239_10022601 | 3300010375 | Bacteria | 6933 |
| 110 | Ga0105239_10344869 | 3300010375 | Bacteria | 1681 |
| 111 | Ga0105246_10039432 | 3300011119 | Bacteria | 3182 |
| 112 | Ga0157371_10025461 | 3300013102 | Bacteria | 4312 |
| 113 | Ga0157370_10138591 | 3300013104 | Bacteria | 2267 |
| 114 | Ga0157370_10278531 | 3300013104 | Bacteria | 1545 |
| 115 | Ga0157369_10017756 | 3300013105 | Bacteria | 7989 |
| 116 | Ga0157374_10070061 | 3300013296 | Bacteria | 3303 |
| 117 | Ga0163162_10637225 | 3300013306 | Bacteria | 1190 |
| 118 | Ga0157372_10095195 | 3300013307 | Bacteria | 3392 |
| 119 | Ga0157372_10419084 | 3300013307 | Bacteria | 1560 |
| 120 | Ga0163163_10008704 | 3300014325 | Bacteria | 9027 |
| 121 | Ga0182008_10019310 | 3300014497 | Bacteria | 3519 |
| 122 | Ga0163161_10318736 | 3300017792 | Bacteria | 1228 |
| 123 | Ga0206356_11139929 | 3300020070 | Bacteria | 1840 |
| 124 | Ga0213873_10002325 | 3300021358 | Bacteria | 3280 |
| 125 | Ga0213876_10067483 | 3300021384 | Bacteria | 1889 |
| 126 | Ga0213875_10000036 | 3300021388 | Bacteria | 166707 |
| 127 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 128 | Ga0209677_114036 | 3300025253 | Bacteria | 1111 |
| 129 | Ga0209148_1000181 | 3300025254 | Bacteria | 124691 |
| 130 | Ga0209759_1000121 | 3300025256 | Bacteria | 138469 |
| 131 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 132 | Ga0209673_1000457 | 3300025273 | Eukaryota | 69083 |
| 133 | Ga0209025_1000165 | 3300025294 | Bacteria | 164692 |
| 134 | Ga0209564_1001849 | 3300025295 | Bacteria | 19271 |
| 135 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 136 | Ga0209758_1010358 | 3300025297 | Bacteria | 5593 |
| 137 | Ga0209050_1001615 | 3300025298 | Bacteria | 23174 |
| 138 | Ga0209051_1025118 | 3300025303 | Bacteria | 2433 |
| 139 | Ga0209257_1000303 | 3300025304 | Bacteria | 107862 |
| 140 | Ga0209257_1025954 | 3300025304 | Bacteria | 1988 |
| 141 | Ga0207692_10058908 | 3300025898 | Bacteria | 1981 |
| 142 | Ga0207692_10104911 | 3300025898 | Bacteria | 1558 |
| 143 | Ga0207647_10001898 | 3300025904 | Bacteria | 16019 |
| 144 | Ga0207647_10210891 | 3300025904 | Bacteria | 1122 |
| 145 | Ga0207685_10037457 | 3300025905 | Bacteria | 1786 |
| 146 | Ga0207699_10000473 | 3300025906 | Bacteria | 20435 |
| 147 | Ga0207699_10005645 | 3300025906 | Bacteria | 6006 |
| 148 | Ga0207699_10069035 | 3300025906 | Bacteria | 2153 |
| 149 | Ga0207699_10080453 | 3300025906 | Bacteria | 2019 |
| 150 | Ga0207699_10301521 | 3300025906 | Bacteria | 1119 |
| 151 | Ga0207654_10000317 | 3300025911 | Bacteria | 28925 |
| 152 | Ga0207654_10274339 | 3300025911 | Bacteria | 1139 |
| 153 | Ga0207707_10000505 | 3300025912 | Bacteria | 40031 |
| 154 | Ga0207707_10005928 | 3300025912 | Bacteria | 10692 |
| 155 | Ga0207707_10154019 | 3300025912 | Bacteria | 2010 |
| 156 | Ga0207707_10514845 | 3300025912 | Bacteria | 1019 |
| 157 | Ga0207695_10000713 | 3300025913 | Bacteria | 64808 |
| 158 | Ga0207695_10394346 | 3300025913 | Bacteria | 1269 |
| 159 | Ga0207695_10439169 | 3300025913 | Bacteria | 1189 |
| 160 | Ga0207695_10618729 | 3300025913 | Bacteria | 964 |
| 161 | Ga0207671_10010503 | 3300025914 | Bacteria | 7634 |
| 162 | Ga0207671_10122066 | 3300025914 | Bacteria | 1992 |
| 163 | Ga0207671_10241384 | 3300025914 | Bacteria | 1419 |
| 164 | Ga0207693_10275029 | 3300025915 | Bacteria | 1319 |
| 165 | Ga0207663_10017841 | 3300025916 | Bacteria | 3964 |
| 166 | Ga0207663_10029578 | 3300025916 | Bacteria | 3220 |
| 167 | Ga0207660_10372899 | 3300025917 | Bacteria | 1146 |
| 168 | Ga0207657_10121530 | 3300025919 | Bacteria | 2149 |
| 169 | Ga0207652_10026858 | 3300025921 | Bacteria | 4797 |
| 170 | Ga0207652_10036599 | 3300025921 | Bacteria | 4149 |
| 171 | Ga0207652_10053469 | 3300025921 | Bacteria | 3469 |
| 172 | Ga0207652_10216309 | 3300025921 | Bacteria | 1726 |
| 173 | Ga0207652_10231332 | 3300025921 | Bacteria | 1666 |
| 174 | Ga0207694_10000155 | 3300025924 | Bacteria | 70678 |
| 175 | Ga0207694_10003031 | 3300025924 | Bacteria | 13465 |
| 176 | Ga0207694_10028952 | 3300025924 | Bacteria | 4224 |
| 177 | Ga0207694_10035867 | 3300025924 | Bacteria | 3804 |
| 178 | Ga0207694_10099055 | 3300025924 | Bacteria | 2309 |
| 179 | Ga0207650_10012045 | 3300025925 | Bacteria | 5961 |
| 180 | Ga0207700_10038473 | 3300025928 | Bacteria | 3472 |
| 181 | Ga0207700_10062898 | 3300025928 | Bacteria | 2820 |
| 182 | Ga0207700_10128764 | 3300025928 | Bacteria | 2063 |
| 183 | Ga0207664_10009878 | 3300025929 | Bacteria | 6719 |
| 184 | Ga0207664_10028623 | 3300025929 | Bacteria | 4236 |
| 185 | Ga0207664_10336209 | 3300025929 | Bacteria | 1335 |
| 186 | Ga0207690_10252679 | 3300025932 | Bacteria | 1362 |
| 187 | Ga0207706_10049641 | 3300025933 | Bacteria | 3708 |
| 188 | Ga0207706_10170757 | 3300025933 | Bacteria | 1911 |
| 189 | Ga0207704_10354894 | 3300025938 | Bacteria | 1143 |
| 190 | Ga0207665_10013789 | 3300025939 | Bacteria | 5316 |
| 191 | Ga0207667_10016768 | 3300025949 | Bacteria | 8265 |
| 192 | Ga0207667_10026865 | 3300025949 | Bacteria | 6281 |
| 193 | Ga0207667_10133139 | 3300025949 | Bacteria | 2561 |
| 194 | Ga0207712_10061145 | 3300025961 | Bacteria | 2672 |
| 195 | Ga0207640_10002792 | 3300025981 | Bacteria | 9367 |
| 196 | Ga0207640_10074759 | 3300025981 | Bacteria | 2294 |
| 197 | Ga0207658_10298843 | 3300025986 | Bacteria | 1386 |
| 198 | Ga0207658_10316007 | 3300025986 | Bacteria | 1351 |
| 199 | Ga0207639_10003685 | 3300026041 | Bacteria | 10298 |
| 200 | Ga0207639_10019633 | 3300026041 | Bacteria | 4823 |
| 201 | Ga0207639_10255061 | 3300026041 | Bacteria | 1531 |
| 202 | Ga0207678_10032286 | 3300026067 | Bacteria | 4562 |
| 203 | Ga0207678_10037450 | 3300026067 | Bacteria | 4218 |
| 204 | Ga0207678_10039836 | 3300026067 | Bacteria | 4076 |
| 205 | Ga0207702_10000022 | 3300026078 | Bacteria | 192961 |
| 206 | Ga0207702_10003504 | 3300026078 | Bacteria | 14307 |
| 207 | Ga0207702_10633332 | 3300026078 | Bacteria | 1051 |
| 208 | Ga0207648_10160854 | 3300026089 | Bacteria | 1983 |
| 209 | Ga0207676_10588552 | 3300026095 | Unclassified | 1067 |
| 210 | Ga0207698_10370677 | 3300026142 | Bacteria | 1359 |
| 211 | Ga0209588_1000792 | 3300027671 | Bacteria | 8037 |
| 212 | Ga0209588_1002811 | 3300027671 | Bacteria | 4768 |
| 213 | Ga0209588_1071906 | 3300027671 | Bacteria | 1117 |
| 214 | Ga0209813_10025213 | 3300027866 | Bacteria | 1708 |
| 215 | Ga0268266_10013179 | 3300028379 | Bacteria | 7130 |
| 216 | Ga0268266_10031714 | 3300028379 | Bacteria | 4489 |
| 217 | Ga0268265_10008367 | 3300028380 | Bacteria | 6985 |
| 218 | Ga0265319_1022836 | 3300028563 | Bacteria | 2273 |
| 219 | Ga0265318_10000680 | 3300028577 | Bacteria | 23043 |
| 220 | Ga0265318_10062432 | 3300028577 | Bacteria | 1387 |
| 221 | Ga0307515_10000420 | 3300028794 | Bacteria | 102216 |
| 222 | Ga0265330_10053739 | 3300031235 | Bacteria | 1762 |
| 223 | Ga0265325_10000869 | 3300031241 | Bacteria | 21778 |
| 224 | Ga0265325_10030653 | 3300031241 | Bacteria | 2882 |
| 225 | Ga0265325_10106323 | 3300031241 | Bacteria | 1368 |
| 226 | Ga0265340_10001284 | 3300031247 | Bacteria | 14403 |
| 227 | Ga0265340_10007346 | 3300031247 | Bacteria | 5987 |
| 228 | Ga0265340_10047670 | 3300031247 | Bacteria | 2085 |
| 229 | Ga0265339_10002241 | 3300031249 | Bacteria | 13980 |
| 230 | Ga0265339_10036911 | 3300031249 | Bacteria | 2732 |
| 231 | Ga0265339_10171239 | 3300031249 | Bacteria | 1086 |
| 232 | Ga0265331_10030152 | 3300031250 | Bacteria | 2702 |
| 233 | Ga0265316_10004479 | 3300031344 | Bacteria | 13884 |
| 234 | Ga0265316_10068620 | 3300031344 | Bacteria | 2738 |
| 235 | Ga0265316_10376169 | 3300031344 | Bacteria | 1025 |
| 236 | Ga0307513_10004196 | 3300031456 | Bacteria | 19276 |
| 237 | Ga0265313_10000872 | 3300031595 | Bacteria | 30443 |
| 238 | Ga0265313_10006312 | 3300031595 | Bacteria | 8440 |
| 239 | Ga0265313_10077882 | 3300031595 | Bacteria | 1512 |
| 240 | Ga0307508_10302973 | 3300031616 | Bacteria | 1191 |
| 241 | Ga0265314_10005202 | 3300031711 | Bacteria | 11816 |
| 242 | Ga0265314_10018990 | 3300031711 | Bacteria | 5334 |
| 243 | Ga0265314_10279103 | 3300031711 | Bacteria | 946 |
| 244 | Ga0265342_10058055 | 3300031712 | Bacteria | 2288 |
| 245 | Ga0265342_10086906 | 3300031712 | Bacteria | 1797 |
| 246 | Ga0265342_10212684 | 3300031712 | Bacteria | 1045 |
| 247 | Ga0307416_100526101 | 3300032002 | Bacteria | 1252 |
| 248 | Ga0307510_10039607 | 3300033180 | Bacteria | 5188 |
| 249 | Ga0373923_0015582 | 3300035111 | Bacteria | 2872 |
| 250 | Ga0373936_0040621 | 3300035113 | Bacteria | 1864 |
| 251 | Ga0373936_0089581 | 3300035113 | Bacteria | 1289 |
| 252 | Ga0373945_0010763 | 3300035116 | Bacteria | 3014 |
| 253 | Ga0373953_0156086 | 3300035117 | Bacteria | 980 |
| 254 | Ga0373954_0021500 | 3300035118 | Bacteria | 2922 |
| 255 | Ga0373954_0098805 | 3300035118 | Bacteria | 1407 |
| 256 | Ga0373957_0062499 | 3300035120 | Bacteria | 1445 |
| 257 | Ga0373943_0002114 | 3300035170 | Bacteria | 9027 |
| 258 | Ga0373946_0052621 | 3300035171 | Bacteria | 1708 |
| 259 | Ga0373955_0136656 | 3300035172 | Bacteria | 1434 |
| 260 | Ga0373924_0009305 | 3300035410 | Bacteria | 3598 |
| 261 | Ga0373924_0073268 | 3300035410 | Bacteria | 1447 |
| 262 | Ga0373935_0000660 | 3300035692 | Bacteria | 18207 |
| 263 | Ga0373935_0075583 | 3300035692 | Bacteria | 2179 |
| 264 | Ga0373927_0006115 | 3300035695 | Bacteria | 8242 |
| 265 | Ga0373927_0119546 | 3300035695 | Bacteria | 1719 |
| 266 | Ga0373927_0138205 | 3300035695 | Bacteria | 1593 |
| 267 | Ga0373933_0152369 | 3300035724 | Bacteria | 1464 |
| 268 | Ga0373933_0277406 | 3300035724 | Bacteria | 1083 |
| 269 | Ga0373947_0001631 | 3300035725 | Bacteria | 13762 |
| 270 | Ga0373947_0023727 | 3300035725 | Bacteria | 3570 |
| 271 | Ga0373947_0151341 | 3300035725 | Bacteria | 1495 |
| 272 | Ga0373925_0001524 | 3300037068 | Bacteria | 19779 |
| 273 | Ga0373925_0163160 | 3300037068 | Bacteria | 1756 |
| 274 | Ga0395899_0000117 | 3300037312 | Bacteria | 130159 |
| 275 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 276 | Ga0395900_0028714 | 3300037418 | Bacteria | 5702 |
| 277 | Ga0395900_0065797 | 3300037418 | Bacteria | 3724 |
| 278 | Ga0395900_0150361 | 3300037418 | Bacteria | 2379 |
| 279 | Ga0395900_0342480 | 3300037418 | Bacteria | 1470 |
| 280 | Ga0395900_0631503 | 3300037418 | Bacteria | 1009 |
| 281 | Ga0395898_0000259 | 3300037466 | Bacteria | 130131 |
| 282 | Ga0395898_0041398 | 3300037466 | Bacteria | 4551 |
| 283 | Ga0395898_0097159 | 3300037466 | Bacteria | 2829 |
| 284 | Ga0395898_0166073 | 3300037466 | Bacteria | 2111 |
| 285 | Ga0395898_0383176 | 3300037466 | Bacteria | 1341 |
| 286 | Ga0395898_0613319 | 3300037466 | Bacteria | 1031 |
| 287 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 288 | Ga0395905_0112114 | 3300037471 | Bacteria | 2561 |
| 289 | Ga0395905_0160038 | 3300037471 | Bacteria | 2116 |
| 290 | Ga0436364_0245439 | 3300037853 | Bacteria | 33775 |
| 291 | Ga0436364_1071235 | 3300037853 | Bacteria | 1166 |
| 292 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 293 | Ga0395901_0027609 | 3300038443 | Bacteria | 5833 |
| 294 | Ga0395901_0207606 | 3300038443 | Bacteria | 2051 |
| 295 | Ga0395901_0279626 | 3300038443 | Bacteria | 1734 |
| 296 | Ga0395901_0361372 | 3300038443 | Bacteria | 1497 |
| 297 | Ga0395901_0460124 | 3300038443 | Bacteria | 1300 |
| 298 | Ga0436365_0040457 | 3300039437 | Bacteria | 1404 |
| 299 | Ga0436365_0179006 | 3300039437 | Bacteria | 2423 |
| 300 | Ga0436365_0928236 | 3300039437 | Bacteria | 1560 |
| 301 | Ga0436365_0959977 | 3300039437 | Bacteria | 23998 |
| 302 | Ga0436365_1259906 | 3300039437 | Bacteria | 1920 |
| 303 | Ga0436365_1681226 | 3300039437 | Bacteria | 1246 |
| 304 | Ga0436360_0655288 | 3300039438 | Bacteria | 1674 |
| 305 | Ga0436363_0945892 | 3300039450 | Bacteria | 889 |
| 306 | Ga0436362_0631993 | 3300039453 | Bacteria | 4184 |
| 307 | Ga0466969_0007887 | 3300044656 | Bacteria | 5652 |
| 308 | Ga0466972_0033120 | 3300044658 | Bacteria | 2535 |
| 309 | Ga0466966_0073582 | 3300044684 | Bacteria | 2136 |
| 310 | Ga0466966_0186975 | 3300044684 | Bacteria | 1256 |
| 311 | Ga0466961_0079695 | 3300044693 | Bacteria | 2073 |
| 312 | Ga0466971_0034150 | 3300044719 | Bacteria | 2280 |
| 313 | Ga0466970_0086840 | 3300044765 | Bacteria | 1696 |
| 314 | Ga0466960_0026413 | 3300044901 | Unclassified | 2638 |
| 315 | Ga0466959_0027484 | 3300045049 | Bacteria | 4220 |
| 316 | Ga0466958_0169788 | 3300045836 | Bacteria | 1381 |
| 317 | Ga0466967_0039398 | 3300045976 | Bacteria | 4062 |
| 318 | Ga0495592_0011842 | 3300046454 | Bacteria | 6607 |
| 319 | Ga0495592_0036626 | 3300046454 | Eukaryota | 3694 |
| 320 | Ga0495603_0000155 | 3300046455 | Bacteria | 34390 |
| 321 | Ga0495629_0001568 | 3300046459 | Bacteria | 17966 |
| 322 | Ga0495629_0055389 | 3300046459 | Eukaryota | 2773 |
| 323 | Ga0495641_0011193 | 3300046461 | Bacteria | 5133 |
| 324 | Ga0495641_0012521 | 3300046461 | Eukaryota | 4736 |
| 325 | Ga0495641_0014774 | 3300046461 | Eukaryota | 4210 |
| 326 | Ga0495651_0018841 | 3300046462 | Eukaryota | 5346 |
| 327 | Ga0495651_0266716 | 3300046462 | Bacteria | 1163 |
| 328 | Ga0495653_0024094 | 3300046463 | Eukaryota | 4910 |
| 329 | Ga0495580_0013322 | 3300046472 | Bacteria | 6283 |
| 330 | Ga0495582_0000401 | 3300046473 | Bacteria | 23632 |
| 331 | Ga0495639_0000146 | 3300046475 | Bacteria | 36496 |
| 332 | Ga0495639_0043582 | 3300046475 | Bacteria | 2027 |
| 333 | Ga0495639_0149143 | 3300046475 | Bacteria | 1127 |
| 334 | Ga0495662_0000242 | 3300046476 | Bacteria | 23091 |
| 335 | Ga0495662_0018902 | 3300046476 | Bacteria | 3335 |
| 336 | Ga0495662_0165446 | 3300046476 | Bacteria | 1090 |
| 337 | Ga0495664_0011226 | 3300046477 | Bacteria | 5046 |
| 338 | Ga0495664_0024087 | 3300046477 | Bacteria | 3535 |
| 339 | Ga0495664_0029291 | 3300046477 | Bacteria | 3218 |
| 340 | Ga0495584_0012407 | 3300046491 | Bacteria | 4349 |
| 341 | Ga0495594_0001113 | 3300046499 | Bacteria | 14042 |
| 342 | Ga0495607_0046014 | 3300046501 | Bacteria | 2565 |
| 343 | Ga0495608_0009795 | 3300046511 | Eukaryota | 6688 |
| 344 | Ga0495608_0162938 | 3300046511 | Bacteria | 1417 |
| 345 | Ga0495608_0485275 | 3300046511 | Bacteria | 749 |
| 346 | Ga0495610_0137322 | 3300046512 | Bacteria | 1056 |
| 347 | Ga0495618_0000589 | 3300046514 | Eukaryota | 25905 |
| 348 | Ga0495618_0046370 | 3300046514 | Eukaryota | 2743 |
| 349 | Ga0495618_0163683 | 3300046514 | Bacteria | 1417 |
| 350 | Ga0495620_0021102 | 3300046515 | Eukaryota | 3168 |
| 351 | Ga0495628_0077931 | 3300046516 | Bacteria | 2578 |
| 352 | Ga0495628_0232250 | 3300046516 | Bacteria | 1382 |
| 353 | Ga0495628_0240957 | 3300046516 | Bacteria | 1353 |
| 354 | Ga0495630_0000634 | 3300046517 | Bacteria | 25446 |
| 355 | Ga0495630_0009739 | 3300046517 | Bacteria | 6913 |
| 356 | Ga0495630_0165218 | 3300046517 | Eukaryota | 1685 |
| 357 | Ga0495630_0171772 | 3300046517 | Bacteria | 1652 |
| 358 | Ga0495637_0045137 | 3300046520 | Bacteria | 1872 |
| 359 | Ga0495644_0037671 | 3300046523 | Bacteria | 1825 |
| 360 | Ga0495652_0001002 | 3300046529 | Eukaryota | 32338 |
| 361 | Ga0495652_0016908 | 3300046529 | Eukaryota | 6518 |
| 362 | Ga0495652_0026936 | 3300046529 | Eukaryota | 5070 |
| 363 | Ga0495652_0037188 | 3300046529 | Eukaryota | 4225 |
| 364 | Ga0495652_0054963 | 3300046529 | Bacteria | 3388 |
| 365 | Ga0495652_0059829 | 3300046529 | Bacteria | 3222 |
| 366 | Ga0495665_0000150 | 3300046531 | Bacteria | 34308 |
| 367 | Ga0495665_0025824 | 3300046531 | Bacteria | 3154 |
| 368 | Ga0495640_0004664 | 3300046533 | Bacteria | 10930 |
| 369 | Ga0495640_0050622 | 3300046533 | Bacteria | 2861 |
| 370 | Ga0495640_0225732 | 3300046533 | Bacteria | 1179 |
| 371 | Ga0495586_0260769 | 3300046535 | Bacteria | 990 |
| 372 | Ga0495621_0107948 | 3300046539 | Bacteria | 1065 |
| 373 | Ga0495645_0003965 | 3300046543 | Eukaryota | 10092 |
| 374 | Ga0495645_0089904 | 3300046543 | Bacteria | 2195 |
| 375 | Ga0495645_0154783 | 3300046543 | Eukaryota | 1589 |
| 376 | Ga0495645_0333635 | 3300046543 | Bacteria | 981 |
| 377 | Ga0495622_0005717 | 3300046557 | Bacteria | 5767 |
| 378 | Ga0495656_0006603 | 3300046615 | Bacteria | 4073 |
| 379 | Ga0495634_0003138 | 3300046642 | Bacteria | 13406 |
| 380 | Ga0495634_0003515 | 3300046642 | Eukaryota | 12551 |
| 381 | Ga0495634_0124485 | 3300046642 | Bacteria | 1648 |
| 382 | Ga0495625_0183588 | 3300046660 | Bacteria | 1389 |
| 383 | Ga0495635_0000823 | 3300046663 | Bacteria | 20335 |
| 384 | Ga0495635_0017735 | 3300046663 | Bacteria | 4972 |
| 385 | Ga0495635_0038903 | 3300046663 | Eukaryota | 3293 |
| 386 | Ga0495588_0029919 | 3300046674 | Bacteria | 2734 |
| 387 | Ga0495657_0010790 | 3300046675 | Eukaryota | 6861 |
| 388 | Ga0495599_0009593 | 3300046678 | Eukaryota | 5922 |
| 389 | Ga0495623_0008876 | 3300046679 | Eukaryota | 6525 |
| 390 | Ga0495646_0002238 | 3300046680 | Eukaryota | 11812 |
| 391 | Ga0495647_0001777 | 3300046681 | Bacteria | 6690 |
| 392 | Ga0495658_0044213 | 3300046683 | Bacteria | 2495 |
| 393 | Ga0495613_0004476 | 3300046689 | Bacteria | 10468 |
| 394 | Ga0495613_0074243 | 3300046689 | Bacteria | 2477 |
| 395 | Ga0495624_0001759 | 3300046690 | Eukaryota | 16579 |
| 396 | Ga0495624_0002699 | 3300046690 | Bacteria | 13343 |
| 397 | Ga0495624_0003993 | 3300046690 | Eukaryota | 10856 |
| 398 | Ga0495670_0080569 | 3300046691 | Bacteria | 1658 |
| 399 | Ga0495671_0111227 | 3300046692 | Bacteria | 1338 |
| 400 | Ga0495600_0181483 | 3300046809 | Bacteria | 1356 |
| 401 | Ga0495600_0203706 | 3300046809 | Eukaryota | 1270 |
| 402 | Ga0495600_0349818 | 3300046809 | Bacteria | 926 |
| 403 | Ga0495581_0005294 | 3300047315 | Bacteria | 7464 |
| 404 | Ga0495581_0040579 | 3300047315 | Bacteria | 2693 |
| 405 | Ga0495581_0048716 | 3300047315 | Bacteria | 2446 |
| 406 | Ga0495581_0135283 | 3300047315 | Bacteria | 1437 |
| 407 | Ga0495604_0290819 | 3300047317 | Eukaryota | 1100 |
| 408 | Ga0495674_0000447 | 3300047319 | Eukaryota | 37194 |
| 409 | Ga0495674_0001343 | 3300047319 | Bacteria | 23998 |
| 410 | Ga0495674_0458280 | 3300047319 | Eukaryota | 1024 |
| 411 | Ga0495672_0019570 | 3300047320 | Bacteria | 4462 |
| 412 | Ga0495672_0091653 | 3300047320 | Bacteria | 1668 |
| 413 | Ga0495676_0001115 | 3300047321 | Eukaryota | 22776 |
| 414 | Ga0495676_0005737 | 3300047321 | Eukaryota | 11382 |
| 415 | Ga0495676_0052329 | 3300047321 | Bacteria | 3260 |
| 416 | Ga0495676_0109929 | 3300047321 | Bacteria | 2024 |
| 417 | Ga0495676_0234980 | 3300047321 | Eukaryota | 1257 |
| 418 | Ga0495680_0214347 | 3300047322 | Bacteria | 1377 |
| 419 | Ga0495675_0096316 | 3300047444 | Eukaryota | 1855 |
| 420 | Ga0495673_0020830 | 3300047469 | Bacteria | 3255 |
| 421 | Ga0495684_0008505 | 3300047471 | Bacteria | 7950 |
| 422 | Ga0495684_0089421 | 3300047471 | Bacteria | 2333 |
| 423 | Ga0495684_0381849 | 3300047471 | Eukaryota | 993 |
| 424 | Ga0495686_0074618 | 3300047472 | Bacteria | 2081 |
| 425 | Ga0495593_0000406 | 3300047673 | Bacteria | 23955 |
| 426 | Ga0495593_0054266 | 3300047673 | Bacteria | 2113 |
| 427 | Ga0495602_0005170 | 3300048088 | Eukaryota | 13673 |
| 428 | Ga0495602_0012148 | 3300048088 | Eukaryota | 8867 |
| 429 | Ga0495602_0017788 | 3300048088 | Eukaryota | 7116 |
| 430 | Ga0495602_0025881 | 3300048088 | Eukaryota | 5670 |
| 431 | Ga0495602_0153309 | 3300048088 | Bacteria | 1808 |
| 432 | Ga0495614_0013877 | 3300048089 | Bacteria | 3531 |
| 433 | Ga0495614_0103739 | 3300048089 | Bacteria | 1245 |
| 434 | Ga0496100_0014292 | 3300048903 | Bacteria | 4606 |
| 435 | Ga0496101_0408759 | 3300048904 | Bacteria | 1069 |
| 436 | Ga0496102_0028833 | 3300048905 | Bacteria | 4962 |
| 437 | Ga0496102_0096793 | 3300048905 | Bacteria | 2737 |
| 438 | Ga0496102_0487748 | 3300048905 | Bacteria | 1154 |
| 439 | Ga0496102_0622599 | 3300048905 | Bacteria | 1002 |
| 440 | Ga0496103_0242699 | 3300048906 | Bacteria | 1159 |
| 441 | Ga0496104_0000740 | 3300048907 | Bacteria | 28026 |
| 442 | Ga0496104_0386621 | 3300048907 | Bacteria | 1312 |
| 443 | Ga0496105_0018506 | 3300048908 | Bacteria | 5602 |
| 444 | Ga0496106_0002088 | 3300048909 | Bacteria | 14981 |
| 445 | Ga0496106_0110106 | 3300048909 | Bacteria | 2143 |
| 446 | Ga0496107_0066849 | 3300048910 | Bacteria | 2607 |
| 447 | Ga0496107_0081789 | 3300048910 | Bacteria | 2355 |
| 448 | Ga0496108_0000449 | 3300048911 | Bacteria | 32814 |
| 449 | Ga0496108_0001075 | 3300048911 | Bacteria | 21328 |
| 450 | Ga0496109_0002544 | 3300048912 | Bacteria | 15291 |
| 451 | Ga0496109_0004948 | 3300048912 | Bacteria | 11126 |
| 452 | Ga0496109_0625840 | 3300048912 | Bacteria | 1013 |
| 453 | Ga0496110_0008032 | 3300048913 | Bacteria | 8461 |
| 454 | Ga0496110_0275443 | 3300048913 | Bacteria | 1532 |
| 455 | Ga0496111_0033862 | 3300048914 | Bacteria | 3644 |
| 456 | Ga0496111_0122137 | 3300048914 | Bacteria | 1924 |
| 457 | Ga0496112_0006031 | 3300048915 | Bacteria | 10580 |
| 458 | Ga0496112_0083677 | 3300048915 | Bacteria | 3156 |
| 459 | Ga0496112_0231068 | 3300048915 | Bacteria | 1804 |
| 460 | Ga0496113_0001942 | 3300048916 | Bacteria | 11836 |
| 461 | Ga0496114_0458645 | 3300048917 | Unclassified | 1128 |
| 462 | Ga0496116_0011742 | 3300048919 | Bacteria | 7216 |
| 463 | Ga0496117_0002204 | 3300048920 | Bacteria | 25295 |
| 464 | Ga0496117_0057126 | 3300048920 | Bacteria | 2713 |
| 465 | Ga0496119_0019343 | 3300048922 | Bacteria | 5021 |
| 466 | Ga0496119_0088747 | 3300048922 | Bacteria | 1762 |
| 467 | Ga0496119_0132032 | 3300048922 | Bacteria | 1360 |
| 468 | Ga0496119_0137958 | 3300048922 | Bacteria | 1320 |
| 469 | Ga0496120_0003090 | 3300048923 | Bacteria | 15675 |
| 470 | Ga0496120_0166544 | 3300048923 | Bacteria | 1094 |
| 471 | Ga0496120_0177487 | 3300048923 | Bacteria | 1048 |
| 472 | Ga0496121_0000500 | 3300048924 | Bacteria | 74914 |
| 473 | Ga0496121_0001203 | 3300048924 | Bacteria | 45295 |
| 474 | Ga0496121_0097616 | 3300048924 | Bacteria | 2276 |
| 475 | Ga0496121_0107722 | 3300048924 | Bacteria | 2133 |
| 476 | Ga0496121_0129673 | 3300048924 | Bacteria | 1890 |
| 477 | Ga0496121_0315036 | 3300048924 | Bacteria | 1056 |
| 478 | Ga0496122_0004346 | 3300048925 | Bacteria | 17714 |
| 479 | Ga0496122_0042654 | 3300048925 | Bacteria | 3566 |
| 480 | Ga0496122_0074967 | 3300048925 | Bacteria | 2390 |
| 481 | Ga0496123_0000103 | 3300048926 | Bacteria | 168232 |
| 482 | Ga0496123_0032651 | 3300048926 | Bacteria | 3763 |
| 483 | Ga0496123_0097351 | 3300048926 | Bacteria | 1724 |
| 484 | Ga0496124_0005072 | 3300048927 | Bacteria | 15019 |
| 485 | Ga0496124_0057457 | 3300048927 | Bacteria | 3278 |
| 486 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 487 | Ga0496125_0000879 | 3300048928 | Bacteria | 47630 |
| 488 | Ga0496125_0217618 | 3300048928 | Bacteria | 1234 |
| 489 | Ga0496126_0001336 | 3300048929 | Bacteria | 39105 |
| 490 | Ga0496126_0006815 | 3300048929 | Bacteria | 12673 |
| 491 | Ga0496126_0012132 | 3300048929 | Bacteria | 8846 |
| 492 | Ga0496126_0012891 | 3300048929 | Bacteria | 8539 |
| 493 | Ga0496126_0050759 | 3300048929 | Bacteria | 3779 |
| 494 | Ga0496126_0058933 | 3300048929 | Bacteria | 3460 |
| 495 | Ga0496126_0100519 | 3300048929 | Bacteria | 2531 |
| 496 | Ga0496126_0172975 | 3300048929 | Bacteria | 1839 |
| 497 | Ga0496126_0197255 | 3300048929 | Bacteria | 1702 |
| 498 | Ga0501031_0000036 | 3300049568 | Bacteria | 73760 |
| 499 | Ga0501031_0001531 | 3300049568 | Bacteria | 14370 |
| 500 | Ga0501031_0001871 | 3300049568 | Bacteria | 13238 |
| 501 | Ga0501031_0035703 | 3300049568 | Bacteria | 3243 |
| 502 | Ga0501031_0083684 | 3300049568 | Bacteria | 2079 |
| 503 | Ga0501031_0137476 | 3300049568 | Bacteria | 1596 |
| 504 | Ga0501031_0154846 | 3300049568 | Bacteria | 1498 |
| 505 | Ga0501031_0217685 | 3300049568 | Bacteria | 1244 |
| 506 | Ga0501032_0000100 | 3300049569 | Bacteria | 73505 |
| 507 | Ga0501032_0000144 | 3300049569 | Bacteria | 58016 |
| 508 | Ga0501032_0000421 | 3300049569 | Bacteria | 35100 |
| 509 | Ga0501032_0015412 | 3300049569 | Bacteria | 5395 |
| 510 | Ga0501032_0027119 | 3300049569 | Bacteria | 3938 |
| 511 | Ga0501032_0035557 | 3300049569 | Bacteria | 3405 |
| 512 | Ga0501032_0103174 | 3300049569 | Bacteria | 1890 |
| 513 | Ga0501032_0106489 | 3300049569 | Bacteria | 1857 |
| 514 | Ga0501032_0208710 | 3300049569 | Bacteria | 1274 |
| 515 | Ga0501032_0284314 | 3300049569 | Bacteria | 1071 |
| 516 | Ga0501033_0000088 | 3300049570 | Bacteria | 87638 |
| 517 | Ga0501033_0000124 | 3300049570 | Bacteria | 74731 |
| 518 | Ga0501033_0000206 | 3300049570 | Bacteria | 56405 |
| 519 | Ga0501033_0001695 | 3300049570 | Bacteria | 19276 |
| 520 | Ga0501033_0002152 | 3300049570 | Bacteria | 17031 |
| 521 | Ga0501033_0012955 | 3300049570 | Bacteria | 6360 |
| 522 | Ga0501033_0025755 | 3300049570 | Bacteria | 4430 |
| 523 | Ga0501033_0052909 | 3300049570 | Bacteria | 3008 |
| 524 | Ga0501033_0060131 | 3300049570 | Bacteria | 2804 |
| 525 | Ga0501033_0102387 | 3300049570 | Bacteria | 2089 |
| 526 | Ga0501033_0149548 | 3300049570 | Bacteria | 1685 |
| 527 | Ga0501034_0000159 | 3300049571 | Bacteria | 127397 |
| 528 | Ga0501034_0000397 | 3300049571 | Bacteria | 73511 |
| 529 | Ga0501034_0061784 | 3300049571 | Bacteria | 3762 |
| 530 | Ga0501034_0089811 | 3300049571 | Bacteria | 3070 |
| 531 | Ga0501034_0127329 | 3300049571 | Bacteria | 2531 |
| 532 | Ga0501034_0207525 | 3300049571 | Bacteria | 1915 |
| 533 | Ga0501034_0248233 | 3300049571 | Bacteria | 1724 |
| 534 | Ga0501034_0289450 | 3300049571 | Bacteria | 1576 |
| 535 | Ga0501034_0304802 | 3300049571 | Bacteria | 1529 |
| 536 | Ga0501034_0338685 | 3300049571 | Bacteria | 1434 |
| 537 | Ga0501034_0658412 | 3300049571 | Bacteria | 948 |
| 538 | Ga0501034_0733023 | 3300049571 | Bacteria | 885 |
| 539 | Ga0501036_0000039 | 3300049572 | Bacteria | 83065 |
| 540 | Ga0501036_0000056 | 3300049572 | Bacteria | 73511 |
| 541 | Ga0501036_0005635 | 3300049572 | Bacteria | 10155 |
| 542 | Ga0501036_0042683 | 3300049572 | Bacteria | 3839 |
| 543 | Ga0501036_0084382 | 3300049572 | Bacteria | 2685 |
| 544 | Ga0501036_0093225 | 3300049572 | Bacteria | 2544 |
| 545 | Ga0501036_0221352 | 3300049572 | Bacteria | 1589 |
| 546 | Ga0501036_0424919 | 3300049572 | Bacteria | 1108 |
| 547 | Ga0501037_0000119 | 3300049573 | Bacteria | 73510 |
| 548 | Ga0501037_0000181 | 3300049573 | Bacteria | 58438 |
| 549 | Ga0501037_0000247 | 3300049573 | Bacteria | 46080 |
| 550 | Ga0501037_0000396 | 3300049573 | Bacteria | 36209 |
| 551 | Ga0501037_0001963 | 3300049573 | Bacteria | 14861 |
| 552 | Ga0501037_0041465 | 3300049573 | Bacteria | 3385 |
| 553 | Ga0501037_0062969 | 3300049573 | Bacteria | 2704 |
| 554 | Ga0501037_0071116 | 3300049573 | Bacteria | 2531 |
| 555 | Ga0501037_0117480 | 3300049573 | Bacteria | 1914 |
| 556 | Ga0501037_0145479 | 3300049573 | Bacteria | 1695 |
| 557 | Ga0501037_0147533 | 3300049573 | Bacteria | 1682 |
| 558 | Ga0501037_0155128 | 3300049573 | Bacteria | 1635 |
| 559 | Ga0501037_0278606 | 3300049573 | Bacteria | 1165 |
| 560 | Ga0501037_0356785 | 3300049573 | Bacteria | 1008 |
| 561 | Ga0501038_0000041 | 3300049574 | Bacteria | 120557 |
| 562 | Ga0501038_0000098 | 3300049574 | Bacteria | 73471 |
| 563 | Ga0501038_0000371 | 3300049574 | Bacteria | 38754 |
| 564 | Ga0501038_0013061 | 3300049574 | Bacteria | 7574 |
| 565 | Ga0501038_0022184 | 3300049574 | Bacteria | 5689 |
| 566 | Ga0501038_0093320 | 3300049574 | Bacteria | 2518 |
| 567 | Ga0501038_0123608 | 3300049574 | Bacteria | 2131 |
| 568 | Ga0501038_0134942 | 3300049574 | Bacteria | 2023 |
| 569 | Ga0501038_0228125 | 3300049574 | Bacteria | 1483 |
| 570 | Ga0501038_0269727 | 3300049574 | Bacteria | 1342 |
| 571 | Ga0501038_0360356 | 3300049574 | Bacteria | 1131 |
| 572 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 573 | Ga0501039_0000853 | 3300049575 | Bacteria | 22029 |
| 574 | Ga0501039_0000926 | 3300049575 | Bacteria | 21446 |
| 575 | Ga0501039_0016084 | 3300049575 | Bacteria | 5729 |
| 576 | Ga0501039_0035142 | 3300049575 | Bacteria | 3867 |
| 577 | Ga0501039_0045031 | 3300049575 | Bacteria | 3407 |
| 578 | Ga0501039_0064691 | 3300049575 | Bacteria | 2835 |
| 579 | Ga0501039_0121317 | 3300049575 | Bacteria | 2048 |
| 580 | Ga0501039_0243546 | 3300049575 | Bacteria | 1414 |
| 581 | Ga0501040_0051279 | 3300049576 | Bacteria | 2822 |
| 582 | Ga0501040_0245630 | 3300049576 | Bacteria | 1276 |
| 583 | Ga0501041_0170403 | 3300049577 | Bacteria | 1362 |
| 584 | Ga0501042_0023910 | 3300049578 | Bacteria | 4280 |
| 585 | Ga0501042_0067668 | 3300049578 | Bacteria | 2553 |
| 586 | Ga0501042_0111391 | 3300049578 | Bacteria | 1971 |
| 587 | Ga0501042_0180403 | 3300049578 | Bacteria | 1523 |
| 588 | Ga0501043_0000008 | 3300049579 | Bacteria | 223654 |
| 589 | Ga0501043_0000202 | 3300049579 | Bacteria | 54441 |
| 590 | Ga0501043_0000498 | 3300049579 | Bacteria | 35297 |
| 591 | Ga0501043_0001500 | 3300049579 | Bacteria | 20376 |
| 592 | Ga0501043_0003541 | 3300049579 | Bacteria | 12833 |
| 593 | Ga0501043_0024793 | 3300049579 | Bacteria | 4705 |
| 594 | Ga0501043_0033474 | 3300049579 | Bacteria | 4043 |
| 595 | Ga0501043_0048171 | 3300049579 | Bacteria | 3351 |
| 596 | Ga0501043_0049416 | 3300049579 | Bacteria | 3306 |
| 597 | Ga0501043_0058488 | 3300049579 | Bacteria | 3026 |
| 598 | Ga0501043_0070501 | 3300049579 | Bacteria | 2745 |
| 599 | Ga0501043_0182142 | 3300049579 | Bacteria | 1636 |
| 600 | Ga0501043_0283127 | 3300049579 | Bacteria | 1270 |
| 601 | Ga0501046_0000397 | 3300049580 | Bacteria | 43539 |
| 602 | Ga0501046_0046453 | 3300049580 | Bacteria | 3446 |
| 603 | Ga0501046_0063507 | 3300049580 | Bacteria | 2883 |
| 604 | Ga0501046_0068316 | 3300049580 | Bacteria | 2766 |
| 605 | Ga0501046_0070822 | 3300049580 | Bacteria | 2710 |
| 606 | Ga0501046_0089401 | 3300049580 | Bacteria | 2370 |
| 607 | Ga0501046_0142522 | 3300049580 | Bacteria | 1813 |
| 608 | Ga0501046_0147866 | 3300049580 | Bacteria | 1773 |
| 609 | Ga0501046_0165024 | 3300049580 | Bacteria | 1664 |
| 610 | Ga0501046_0236184 | 3300049580 | Bacteria | 1349 |
| 611 | Ga0501046_0237702 | 3300049580 | Bacteria | 1344 |
| 612 | Ga0501046_0389374 | 3300049580 | Bacteria | 1008 |
| 613 | Ga0501047_0000288 | 3300049581 | Bacteria | 57965 |
| 614 | Ga0501047_0000392 | 3300049581 | Bacteria | 49114 |
| 615 | Ga0501047_0006231 | 3300049581 | Bacteria | 11214 |
| 616 | Ga0501047_0021920 | 3300049581 | Bacteria | 6134 |
| 617 | Ga0501047_0024115 | 3300049581 | Bacteria | 5843 |
| 618 | Ga0501047_0091355 | 3300049581 | Bacteria | 2922 |
| 619 | Ga0501047_0095674 | 3300049581 | Bacteria | 2848 |
| 620 | Ga0501047_0128910 | 3300049581 | Bacteria | 2410 |
| 621 | Ga0501047_0191388 | 3300049581 | Bacteria | 1909 |
| 622 | Ga0501047_0361827 | 3300049581 | Bacteria | 1286 |
| 623 | Ga0501047_0380699 | 3300049581 | Bacteria | 1245 |
| 624 | Ga0501048_0000834 | 3300049582 | Bacteria | 22734 |
| 625 | Ga0501048_0129345 | 3300049582 | Bacteria | 1785 |
| 626 | Ga0501048_0134387 | 3300049582 | Bacteria | 1748 |
| 627 | Ga0501048_0171714 | 3300049582 | Bacteria | 1536 |
| 628 | Ga0501048_0264014 | 3300049582 | Bacteria | 1223 |
| 629 | Ga0501067_0000333 | 3300049583 | Bacteria | 25656 |
| 630 | Ga0501067_0010498 | 3300049583 | Bacteria | 5128 |
| 631 | Ga0501067_0013258 | 3300049583 | Bacteria | 4564 |
| 632 | Ga0501067_0019085 | 3300049583 | Bacteria | 3795 |
| 633 | Ga0501067_0055840 | 3300049583 | Bacteria | 2188 |
| 634 | Ga0501068_0003723 | 3300049584 | Bacteria | 8248 |
| 635 | Ga0501068_0028630 | 3300049584 | Bacteria | 3296 |
| 636 | Ga0501069_0001610 | 3300049585 | Bacteria | 11171 |
| 637 | Ga0501069_0010029 | 3300049585 | Bacteria | 5008 |
| 638 | Ga0501069_0019384 | 3300049585 | Bacteria | 3678 |
| 639 | Ga0501069_0053827 | 3300049585 | Bacteria | 2241 |
| 640 | Ga0501069_0118107 | 3300049585 | Bacteria | 1513 |
| 641 | Ga0501069_0138129 | 3300049585 | Bacteria | 1397 |
| 642 | Ga0501070_0000175 | 3300049586 | Bacteria | 59483 |
| 643 | Ga0501070_0000264 | 3300049586 | Bacteria | 49510 |
| 644 | Ga0501070_0000476 | 3300049586 | Bacteria | 36484 |
| 645 | Ga0501070_0007787 | 3300049586 | Bacteria | 9081 |
| 646 | Ga0501070_0017987 | 3300049586 | Bacteria | 5931 |
| 647 | Ga0501070_0020560 | 3300049586 | Bacteria | 5536 |
| 648 | Ga0501070_0020934 | 3300049586 | Bacteria | 5487 |
| 649 | Ga0501070_0043206 | 3300049586 | Bacteria | 3751 |
| 650 | Ga0501070_0071314 | 3300049586 | Bacteria | 2876 |
| 651 | Ga0501070_0090664 | 3300049586 | Bacteria | 2530 |
| 652 | Ga0501070_0116227 | 3300049586 | Bacteria | 2209 |
| 653 | Ga0501071_0016378 | 3300049587 | Bacteria | 5096 |
| 654 | Ga0501072_0004129 | 3300049588 | Bacteria | 10991 |
| 655 | Ga0501072_0276654 | 3300049588 | Bacteria | 1335 |
| 656 | Ga0501073_0000034 | 3300049589 | Bacteria | 95224 |
| 657 | Ga0501073_0011018 | 3300049589 | Bacteria | 6613 |
| 658 | Ga0501073_0034023 | 3300049589 | Bacteria | 3628 |
| 659 | Ga0501073_0046674 | 3300049589 | Bacteria | 3045 |
| 660 | Ga0501073_0105423 | 3300049589 | Bacteria | 1956 |
| 661 | Ga0501073_0156779 | 3300049589 | Bacteria | 1577 |
| 662 | Ga0501073_0281453 | 3300049589 | Bacteria | 1147 |
| 663 | Ga0501074_0000016 | 3300049590 | Bacteria | 78666 |
| 664 | Ga0501074_0000395 | 3300049590 | Bacteria | 25957 |
| 665 | Ga0501074_0005501 | 3300049590 | Bacteria | 9113 |
| 666 | Ga0501074_0020725 | 3300049590 | Bacteria | 4776 |
| 667 | Ga0501074_0035325 | 3300049590 | Bacteria | 3621 |
| 668 | Ga0501074_0312954 | 3300049590 | Bacteria | 1115 |
| 669 | Ga0501076_0152018 | 3300049592 | Bacteria | 1883 |
| 670 | Ga0501079_0003579 | 3300049741 | Bacteria | 11425 |
| 671 | Ga0501079_0028231 | 3300049741 | Bacteria | 4305 |
| 672 | Ga0501079_0217056 | 3300049741 | Bacteria | 1494 |
| 673 | Ga0501080_0000846 | 3300049742 | Bacteria | 25014 |
| 674 | Ga0501080_0012000 | 3300049742 | Bacteria | 7935 |
| 675 | Ga0501080_0015856 | 3300049742 | Bacteria | 6951 |
| 676 | Ga0501080_0029605 | 3300049742 | Bacteria | 5098 |
| 677 | Ga0501080_0032773 | 3300049742 | Bacteria | 4847 |
| 678 | Ga0501080_0052040 | 3300049742 | Bacteria | 3811 |
| 679 | Ga0501080_0061934 | 3300049742 | Bacteria | 3482 |
| 680 | Ga0501080_0095411 | 3300049742 | Bacteria | 2762 |
| 681 | Ga0501080_0129525 | 3300049742 | Bacteria | 2335 |
| 682 | Ga0501080_0175361 | 3300049742 | Bacteria | 1975 |
| 683 | Ga0501080_0242350 | 3300049742 | Bacteria | 1645 |
| 684 | Ga0501083_0000035 | 3300049744 | Bacteria | 96241 |
| 685 | Ga0501083_0001286 | 3300049744 | Bacteria | 16988 |
| 686 | Ga0501083_0037718 | 3300049744 | Bacteria | 3289 |
| 687 | Ga0501083_0054077 | 3300049744 | Bacteria | 2695 |
| 688 | Ga0501035_0000011 | 3300049822 | Bacteria | 305794 |
| 689 | Ga0501035_0000053 | 3300049822 | Bacteria | 142860 |
| 690 | Ga0501035_0000137 | 3300049822 | Bacteria | 89273 |
| 691 | Ga0501035_0000155 | 3300049822 | Bacteria | 84012 |
| 692 | Ga0501035_0002015 | 3300049822 | Bacteria | 20268 |
| 693 | Ga0501035_0005448 | 3300049822 | Bacteria | 12037 |
| 694 | Ga0501035_0017260 | 3300049822 | Bacteria | 6654 |
| 695 | Ga0501035_0039642 | 3300049822 | Bacteria | 4261 |
| 696 | Ga0501035_0068402 | 3300049822 | Bacteria | 3149 |
| 697 | Ga0501035_0108767 | 3300049822 | Bacteria | 2430 |
| 698 | Ga0501035_0123606 | 3300049822 | Bacteria | 2260 |
| 699 | Ga0501035_0124084 | 3300049822 | Bacteria | 2255 |
| 700 | Ga0501035_0208643 | 3300049822 | Bacteria | 1672 |
| 701 | Ga0501035_0218339 | 3300049822 | Bacteria | 1629 |
| 702 | Ga0501035_0244195 | 3300049822 | Bacteria | 1526 |
| 703 | Ga0501035_0415234 | 3300049822 | Bacteria | 1118 |
| 704 | Ga0501035_0437522 | 3300049822 | Bacteria | 1083 |
| 705 | Ga0501035_0684418 | 3300049822 | Bacteria | 828 |
| 706 | Ga0501044_0000011 | 3300049823 | Bacteria | 257385 |
| 707 | Ga0501044_0000214 | 3300049823 | Bacteria | 73483 |
| 708 | Ga0501044_0000393 | 3300049823 | Bacteria | 54257 |
| 709 | Ga0501044_0000431 | 3300049823 | Bacteria | 51668 |
| 710 | Ga0501044_0003054 | 3300049823 | Bacteria | 18937 |
| 711 | Ga0501044_0003281 | 3300049823 | Bacteria | 18216 |
| 712 | Ga0501044_0019399 | 3300049823 | Bacteria | 7276 |
| 713 | Ga0501044_0020202 | 3300049823 | Bacteria | 7109 |
| 714 | Ga0501044_0024315 | 3300049823 | Bacteria | 6434 |
| 715 | Ga0501044_0032428 | 3300049823 | Bacteria | 5492 |
| 716 | Ga0501044_0043264 | 3300049823 | Bacteria | 4680 |
| 717 | Ga0501044_0043882 | 3300049823 | Bacteria | 4643 |
| 718 | Ga0501044_0044832 | 3300049823 | Bacteria | 4586 |
| 719 | Ga0501044_0072449 | 3300049823 | Bacteria | 3502 |
| 720 | Ga0501044_0177814 | 3300049823 | Bacteria | 2096 |
| 721 | Ga0501044_0222222 | 3300049823 | Bacteria | 1839 |
| 722 | Ga0501044_0245096 | 3300049823 | Bacteria | 1735 |
| 723 | Ga0501044_0255665 | 3300049823 | Bacteria | 1691 |
| 724 | Ga0501044_0336315 | 3300049823 | Bacteria | 1431 |
| 725 | Ga0501045_0007978 | 3300049824 | Bacteria | 7375 |
| 726 | Ga0501045_0191335 | 3300049824 | Bacteria | 1525 |
| 727 | nmdc:mga03683_7659_c1 | 3300050489 | Bacteria | 3760 |
| 728 | nmdc:mga03n38_9312_c1 | 3300050490 | Bacteria | 3567 |
| 729 | nmdc:mga0yw44_219775_c1 | 3300050492 | Bacteria | 1259 |
| 730 | nmdc:mga0yw44_32262_c1 | 3300050492 | Bacteria | 3051 |
| 731 | nmdc:mga0yw44_95771_c1 | 3300050492 | Bacteria | 1883 |
| 732 | nmdc:mga0yw44_9790_c1 | 3300050492 | Bacteria | 4868 |
| 733 | nmdc:mga06z11_124599_c1 | 3300050494 | Bacteria | 1441 |
| 734 | nmdc:mga06z11_137634_c1 | 3300050494 | Bacteria | 1377 |
| 735 | nmdc:mga04h51_35256_c1 | 3300050495 | Bacteria | 1603 |
| 736 | nmdc:mga05p37_16081_c1 | 3300050507 | Bacteria | 9006 |
| 737 | nmdc:mga09592_314902_c1 | 3300050508 | Bacteria | 1356 |
| 738 | nmdc:mga06r32_553745_c1 | 3300050510 | Bacteria | 1124 |
| 739 | nmdc:mga08y16_144371_c1 | 3300050511 | Bacteria | 2474 |
| 740 | nmdc:mga0n895_152422_c1 | 3300050512 | Bacteria | 2342 |
| 741 | Ga0495612_0028966 | 3300053078 | Bacteria | 2229 |
| 742 | Ga0495612_0072861 | 3300053078 | Bacteria | 1434 |
| 743 | Ga0500610_0030879 | 3300053079 | Bacteria | 2718 |
| 744 | Ga0500635_0003040 | 3300053080 | Bacteria | 4188 |
| 745 | Ga0495655_0034272 | 3300053083 | Bacteria | 1255 |
| 746 | Ga0495619_0046133 | 3300053085 | Bacteria | 2864 |
| 747 | Ga0500583_0093219 | 3300053092 | Bacteria | 1468 |
| 748 | Ga0500641_0000965 | 3300053096 | Bacteria | 10243 |
| 749 | Ga0500650_0121401 | 3300053098 | Bacteria | 1218 |
| 750 | Ga0500554_003388 | 3300053102 | Bacteria | 3258 |
| 751 | Ga0500595_003756 | 3300053119 | Bacteria | 6994 |
| 752 | Ga0500595_016614 | 3300053119 | Bacteria | 2736 |
| 753 | Ga0500595_031129 | 3300053119 | Bacteria | 1792 |
| 754 | Ga0500595_066540 | 3300053119 | Bacteria | 1077 |
| 755 | Ga0500559_0173651 | 3300053136 | Bacteria | 1014 |
| 756 | Ga0500568_0014496 | 3300053139 | Bacteria | 3558 |
| 757 | Ga0500573_0003712 | 3300053140 | Bacteria | 7943 |
| 758 | Ga0500573_0007019 | 3300053140 | Bacteria | 6122 |
| 759 | Ga0500577_0000509 | 3300053142 | Bacteria | 10008 |
| 760 | Ga0500603_000410 | 3300053150 | Bacteria | 11214 |
| 761 | Ga0500604_0011263 | 3300053151 | Bacteria | 2399 |
| 762 | Ga0500616_0001510 | 3300053153 | Bacteria | 21977 |
| 763 | Ga0500627_0029275 | 3300053158 | Bacteria | 2296 |
| 764 | Ga0500627_0076537 | 3300053158 | Bacteria | 1488 |
| 765 | Ga0500627_0077622 | 3300053158 | Bacteria | 1477 |
| 766 | Ga0500636_0014172 | 3300053177 | Bacteria | 4687 |
| 767 | Ga0500636_0162871 | 3300053177 | Bacteria | 1214 |
| 768 | Ga0500637_0003231 | 3300053178 | Bacteria | 7476 |
| 769 | Ga0500567_126883 | 3300053723 | Bacteria | 1006 |
| 770 | Ga0501084_0008623 | 3300054114 | Bacteria | 8428 |
| 771 | Ga0501084_0101726 | 3300054114 | Bacteria | 2413 |
| 772 | Ga0501082_0018579 | 3300060353 | Bacteria | 5992 |
| 773 | Ga0501082_0018837 | 3300060353 | Bacteria | 5947 |
| 774 | Ga0501082_0027092 | 3300060353 | Bacteria | 4938 |
| 775 | 2503201530 | 2503198000 | Bacteria | 6884444 |
| 776 | 2509113134 | 2508501123 | Bacteria | 6283661 |
| 777 | 2509143302 | 2508501127 | Bacteria | 7037543 |
| 778 | 2509396311 | 2509276022 | Bacteria | 6200534 |
| 779 | 2512931500 | 2512875016 | Bacteria | 6529530 |
| 780 | 2512959331 | 2512875024 | Bacteria | 7195110 |
| 781 | 2513612723 | 2513237090 | Bacteria | 7096802 |
| 782 | 2514420883 | 2513237305 | Bacteria | 7293571 |
| 783 | 2588517337 | 2588253730 | Bacteria | 6881675 |
| 784 | 2597813225 | 2597489875 | Bacteria | 7010078 |
| 785 | 2599936752 | 2599185301 | Bacteria | 6161860 |
| 786 | 2643771110 | 2643221550 | Bacteria | 4619371 |
| 787 | 2643776113 | 2643221551 | Bacteria | 3750538 |
| 788 | 2643794560 | 2643221555 | Bacteria | 3749717 |
| 789 | 2643840019 | 2643221564 | Bacteria | 4193379 |
| 790 | 2643984399 | 2643221595 | Bacteria | 6565519 |
| 791 | 2644109177 | 2643221618 | Bacteria | 7717186 |
| 792 | 2644151699 | 2643221626 | Bacteria | 8069654 |
| 793 | 2644153256 | 2643221627 | Bacteria | 6761570 |
| 794 | 2644311833 | 2643221655 | Bacteria | 7722067 |
| 795 | 2644330105 | 2643221659 | Bacteria | 7890716 |
| 796 | 2644543141 | 2643221698 | Bacteria | 7756764 |
| 797 | 2644617631 | 2643221712 | Bacteria | 7729434 |
| 798 | 2688598447 | 2687453392 | Bacteria | 6880454 |
| 799 | 2694631074 | 2693429783 | Bacteria | 7019804 |
| 800 | 2694636428 | 2693429784 | Bacteria | 7241525 |
| 801 | 2723575380 | 2721755686 | Bacteria | 7343952 |
| 802 | 2739307168 | 2738543024 | Bacteria | 5603683 |
| 803 | 2756675469 | 2756170246 | Bacteria | 7451806 |
| 804 | 2792749237 | 2791355123 | Bacteria | 8049106 |
| 805 | 2793283387 | 2791355253 | Bacteria | 5171699 |
| 806 | 2819242803 | 2818991272 | Bacteria | 4622173 |
| 807 | 2841739198 | 2841734538 | Bacteria | 6784580 |
| 808 | 2844007426 | 2844002411 | Bacteria | 7168230 |
| 809 | 2844163812 | 2844163670 | Bacteria | 7266046 |
| 810 | 2847675614 | 2847670302 | Bacteria | 6165597 |
| 811 | 2847692258 | 2847686936 | Bacteria | 6278406 |
| 812 | 2856319501 | 2856314179 | Bacteria | 6477897 |
| 813 | 2856327481 | 2856320880 | Bacteria | 7263508 |
| 814 | 2856334567 | 2856328259 | Bacteria | 6528202 |
| 815 | 2856340888 | 2856334872 | Bacteria | 7037011 |
| 816 | 2856344937 | 2856342000 | Bacteria | 7176905 |
| 817 | 2856352442 | 2856349417 | Bacteria | 6230045 |
| 818 | 2856358597 | 2856356410 | Bacteria | 6297484 |
| 819 | 2856369460 | 2856364286 | Bacteria | 6939991 |
| 820 | 2857351152 | 2857349434 | Bacteria | 7926032 |
| 821 | 2857371324 | 2857367948 | Bacteria | 6965560 |
| 822 | 2869169292 | 2869162929 | Bacteria | 6399702 |
| 823 | 2869172867 | 2869169390 | Bacteria | 6659796 |
| 824 | 2869237208 | 2869234852 | Bacteria | 6654993 |
| 825 | 2869244702 | 2869242130 | Bacteria | 6609239 |
| 826 | 2869253111 | 2869249662 | Bacteria | 6868783 |
| 827 | 2869260294 | 2869256925 | Bacteria | 6981691 |
| 828 | 2869272228 | 2869271264 | Bacteria | 6908218 |
| 829 | 2869284931 | 2869278585 | Bacteria | 7077053 |
| 830 | 2869286466 | 2869285874 | Bacteria | 6901219 |
| 831 | 2871434619 | 2871429161 | Bacteria | 6547891 |
| 832 | 2871442679 | 2871435913 | Bacteria | 6880295 |
| 833 | 2871444179 | 2871444079 | Bacteria | 6423508 |
| 834 | 2871457891 | 2871451962 | Bacteria | 7336357 |
| 835 | 2871462731 | 2871459585 | Bacteria | 6866887 |
| 836 | 2871469824 | 2871466892 | Bacteria | 6923287 |
| 837 | 2871475707 | 2871474448 | Bacteria | 6806570 |
| 838 | 2871494542 | 2871488783 | Bacteria | 6929816 |
| 839 | 2871501396 | 2871495908 | Bacteria | 6935695 |
| 840 | 2874103728 | 2874102143 | Bacteria | 6342645 |
| 841 | 2874112353 | 2874109183 | Bacteria | 6517025 |
| 842 | 2874122671 | 2874116593 | Bacteria | 6674494 |
| 843 | 2874132088 | 2874131515 | Bacteria | 6820270 |
| 844 | 2874145874 | 2874139085 | Bacteria | 7021506 |
| 845 | 2874149825 | 2874146452 | Bacteria | 7533118 |
| 846 | 2874158083 | 2874155637 | Bacteria | 6724144 |
| 847 | 2874168250 | 2874162495 | Bacteria | 6174670 |
| 848 | 2874169856 | 2874168670 | Bacteria | 8062617 |
| 849 | 2876368481 | 2876363079 | Bacteria | 6544991 |
| 850 | 2876380336 | 2876377896 | Bacteria | 6565995 |
| 851 | 2876386707 | 2876386047 | Bacteria | 6698674 |
| 852 | 2876398442 | 2876392853 | Bacteria | 6660880 |
| 853 | 2876400211 | 2876399893 | Bacteria | 6927900 |
| 854 | 2876409301 | 2876406927 | Bacteria | 6191900 |
| 855 | 2876416287 | 2876413966 | Bacteria | 6831344 |
| 856 | 2876422997 | 2876420981 | Bacteria | 6687741 |
| 857 | 2878040736 | 2878035449 | Bacteria | 6555736 |
| 858 | 2878731753 | 2878730984 | Bacteria | 6380721 |
| 859 | 2878745213 | 2878738818 | Bacteria | 7136951 |
| 860 | 2878751752 | 2878745973 | Bacteria | 6867388 |
| 861 | 2878758876 | 2878753008 | Bacteria | 6922523 |
| 862 | 2878765376 | 2878760144 | Bacteria | 6823465 |
| 863 | 2878773084 | 2878767105 | Bacteria | 6898628 |
| 864 | 2878777093 | 2878774303 | Bacteria | 6108671 |
| 865 | 2878784539 | 2878781027 | Bacteria | 6834456 |
| 866 | 2878793925 | 2878788777 | Bacteria | 6567085 |
| 867 | 2881151331 | 2881147464 | Bacteria | 7779814 |
| 868 | 2881155307 | 2881155292 | Bacteria | 6461656 |
| 869 | 2881167532 | 2881161766 | Bacteria | 7127907 |
| 870 | 2881853101 | 2881845957 | Bacteria | 6611900 |
| 871 | 2881853708 | 2881853255 | Bacteria | 6698367 |
| 872 | 2881867312 | 2881861095 | Bacteria | 7128710 |
| 873 | 2882636276 | 2882632389 | Bacteria | 8154593 |
| 874 | 2882912561 | 2882912400 | Bacteria | 6801539 |
| 875 | 2885309434 | 2885305155 | Bacteria | 7348390 |
| 876 | 2885317988 | 2885312484 | Bacteria | 6415165 |
| 877 | 2885323699 | 2885318864 | Bacteria | 6729568 |
| 878 | 2885330373 | 2885326080 | Bacteria | 7134805 |
| 879 | 2885337499 | 2885334103 | Bacteria | 7216818 |
| 880 | 2885356697 | 2885350715 | Bacteria | 6787678 |
| 881 | 2888339424 | 2888337043 | Bacteria | 6629336 |
| 882 | 2888346815 | 2888343758 | Bacteria | 6611049 |
| 883 | 2888355760 | 2888350351 | Bacteria | 7372807 |
| 884 | 2889017606 | 2889016732 | Bacteria | 6700763 |
| 885 | 2891376482 | 2891373044 | Bacteria | 5202277 |
| 886 | 2903451313 | 2903448605 | Bacteria | 7357801 |
| 887 | 2903503885 | 2903492973 | Bacteria | 13473544 |
| 888 | 2903504698 | 2903492973 | Bacteria | 13473544 |
| 889 | 2903527480 | 2903521522 | Bacteria | 6525694 |
| 890 | 2903533934 | 2903528002 | Bacteria | 6586099 |
| 891 | 2903546207 | 2903540706 | Bacteria | 7062119 |
| 892 | 2904664997 | 2904659560 | Bacteria | 6685615 |
| 893 | 2906314150 | 2906308376 | Bacteria | 6841989 |
| 894 | 2906327316 | 2906321335 | Bacteria | 6579571 |
| 895 | 2906330005 | 2906328253 | Bacteria | 6585166 |
| 896 | 2906360846 | 2906354277 | Bacteria | 6991324 |
| 897 | 2906366766 | 2906363423 | Bacteria | 6856682 |
| 898 | 2906372607 | 2906370794 | Bacteria | 6881062 |
| 899 | 2906387985 | 2906386501 | Bacteria | 5977019 |
| 900 | 2906405393 | 2906401398 | Bacteria | 6693206 |
| 901 | 2906408906 | 2906408224 | Bacteria | 6162342 |
| 902 | 2906420221 | 2906414383 | Bacteria | 6580790 |
| 903 | 2906432767 | 2906427513 | Bacteria | 6375796 |
| 904 | 2922134343 | 2922130491 | Bacteria | 7173936 |
| 905 | 2922152073 | 2922151315 | Bacteria | 6902399 |
| 906 | 2922162838 | 2922158528 | Bacteria | 6573167 |
| 907 | 2922178286 | 2922172374 | Bacteria | 6167644 |
| 908 | 2922188795 | 2922185730 | Bacteria | 7113964 |
| 909 | 2924715699 | 2924710171 | Bacteria | 6752351 |
| 910 | 2924728241 | 2924726620 | Bacteria | 6271473 |
| 911 | 2924743494 | 2924741084 | Bacteria | 6661321 |
| 912 | 2924764249 | 2924762789 | Bacteria | 6561353 |
| 913 | 2924783350 | 2924776078 | Bacteria | 7492003 |
| 914 | 2924789080 | 2924784321 | Bacteria | 7416538 |
| 915 | 2937815739 | 2937813078 | Bacteria | 7783518 |
| 916 | 2937824460 | 2937822353 | Bacteria | 7290551 |
| 917 | 2937839387 | 2937836603 | Bacteria | 6811263 |
| 918 | 2937862769 | 2937861824 | Bacteria | 6660327 |
| 919 | 2937870538 | 2937868953 | Bacteria | 6639878 |
| 920 | 2937882123 | 2937877337 | Bacteria | 7246526 |
| 921 | 2937896290 | 2937891427 | Bacteria | 6357007 |
| 922 | 2937978583 | 2937972304 | Bacteria | 7532020 |
| 923 | 2937988152 | 2937980651 | Bacteria | 6517427 |
| 924 | 2938000065 | 2937994558 | Bacteria | 7036190 |
| 925 | 2938022088 | 2938014810 | Bacteria | 6700592 |
| 926 | 2941500403 | 2941499720 | Bacteria | 7599444 |
| 927 | 2958040633 | 2958034702 | Bacteria | 6989922 |
| 928 | 2958056715 | 2958041894 | Bacteria | 13082850 |
| 929 | 2958057848 | 2958041894 | Bacteria | 13082850 |
| 930 | 2958064376 | 2958064165 | Bacteria | 7158582 |
| 931 | 2958089245 | 2958084443 | Bacteria | 7312792 |
| 932 | 2958096506 | 2958092219 | Bacteria | 6861151 |
| 933 | 2958105745 | 2958100919 | Bacteria | 6800575 |
| 934 | 2958111520 | 2958108152 | Bacteria | 6681128 |
| 935 | 2958118462 | 2958115193 | Bacteria | 6923548 |
| 936 | 2958125424 | 2958122699 | Bacteria | 7280457 |
| 937 | 2958130869 | 2958130278 | Bacteria | 6897202 |
| 938 | 2958138000 | 2958137437 | Bacteria | 6050276 |
| 939 | 2958146136 | 2958144490 | Bacteria | 6677056 |
| 940 | 2958170529 | 2958165035 | Bacteria | 6906348 |
| 941 | 2958173532 | 2958172287 | Bacteria | 6716688 |
| 942 | 2958184790 | 2958179912 | Bacteria | 6874908 |
| 943 | 2961082957 | 2961077736 | Bacteria | 7079850 |
| 944 | 2961119996 | 2961114664 | Bacteria | 6680456 |
| 945 | 2961131611 | 2961127735 | Bacteria | 7196641 |
| 946 | 2961138713 | 2961136820 | Bacteria | 6775228 |
| 947 | 2961168984 | 2961163497 | Bacteria | 6901077 |
| 948 | 2961176045 | 2961170736 | Bacteria | 7072258 |
| 949 | 2961185945 | 2961183825 | Bacteria | 6688536 |
| 950 | 2963647712 | 2963644680 | Bacteria | 6530403 |
| 951 | 2965024271 | 2965018300 | Bacteria | 6883036 |
| 952 | 2965031751 | 2965025482 | Bacteria | 6532201 |
| 953 | 2965038127 | 2965032056 | Bacteria | 6887443 |
| 954 | 2965045713 | 2965040258 | Bacteria | 6855979 |
| 955 | 2965051618 | 2965047637 | Bacteria | 6623551 |
| 956 | 2965066005 | 2965062239 | Bacteria | 7412989 |
| 957 | 2965094258 | 2965089291 | Bacteria | 6866420 |
| 958 | 2965108624 | 2965102966 | Bacteria | 6800987 |
| 959 | 2965117254 | 2965110997 | Bacteria | 6693150 |
| 960 | 2965122060 | 2965119406 | Bacteria | 6956431 |
| 961 | 2968001933 | 2967996073 | Bacteria | 6787468 |
| 962 | 2968009043 | 2968003550 | Bacteria | 6929263 |
| 963 | 2968018450 | 2968016561 | Bacteria | 7022047 |
| 964 | 2968090343 | 2968083720 | Bacteria | 7351627 |
| 965 | 2968096367 | 2968091066 | Bacteria | 6052692 |
| 966 | 2968098868 | 2968097103 | Bacteria | 6107094 |
| 967 | 2968116353 | 2968110612 | Bacteria | 6814636 |
| 968 | 2968120634 | 2968117919 | Bacteria | 6536078 |
| 969 | 2968129186 | 2968128360 | Bacteria | 6270294 |
| 970 | 2968138942 | 2968138860 | Bacteria | 6605449 |
| 971 | 2968177378 | 2968171901 | Bacteria | 6894245 |
| 972 | 2970471377 | 2970469710 | Bacteria | 6969209 |
| 973 | 2970491115 | 2970489779 | Bacteria | 6517260 |
| 974 | 2970508711 | 2970503327 | Bacteria | 7099517 |
| 975 | 2970514623 | 2970510686 | Bacteria | 7006402 |
| 976 | 2970528594 | 2970524798 | Bacteria | 6840927 |
| 977 | 2970539979 | 2970532167 | Bacteria | 6553173 |
| 978 | 2970544790 | 2970540015 | Bacteria | 6977556 |
| 979 | 2970552022 | 2970547951 | Bacteria | 6931819 |
| 980 | 2970560224 | 2970554993 | Bacteria | 6814252 |
| 981 | 2970599546 | 2970593180 | Bacteria | 7073582 |
| 982 | 2970620844 | 2970619444 | Bacteria | 6986144 |
| 983 | 2970628904 | 2970627176 | Bacteria | 6680862 |
| 984 | 2977827416 | 2977821940 | Bacteria | 6906439 |
| 985 | 2977830951 | 2977828996 | Bacteria | 7007971 |
| 986 | 2977845975 | 2977843712 | Bacteria | 6753583 |
| 987 | 2977854377 | 2977851361 | Bacteria | 6694324 |
| 988 | 2977859278 | 2977858184 | Bacteria | 6215359 |
| 989 | 2977867086 | 2977864932 | Bacteria | 7534097 |
| 990 | 2977875258 | 2977872689 | Bacteria | 7270173 |
| 991 | 2977904373 | 2977898635 | Bacteria | 6675551 |
| 992 | 2977911338 | 2977907340 | Bacteria | 6577984 |
| 993 | 2977924221 | 2977922695 | Bacteria | 6956781 |
| 994 | 2977941199 | 2977935797 | Bacteria | 6252826 |
| 995 | 2977942749 | 2977942078 | Bacteria | 7570577 |
| 996 | 2977957853 | 2977957713 | Bacteria | 6877875 |
| 997 | 2977974520 | 2977971508 | Bacteria | 7472917 |
| 998 | 2979717543 | 2979710463 | Bacteria | 6785254 |
| 999 | 2979766235 | 2979764755 | Bacteria | 6610066 |
| 1000 | 2979774491 | 2979772303 | Bacteria | 6618277 |
| 1001 | 2979781283 | 2979779861 | Bacteria | 6219781 |
| 1002 | 2979796344 | 2979793036 | Bacteria | 6808957 |
| 1003 | 2979811641 | 2979808191 | Bacteria | 7179355 |
| 1004 | 2987638336 | 2987636660 | Bacteria | 8088555 |
| 1005 | 2987645776 | 2987645492 | Bacteria | 6117018 |
| 1006 | 2987654659 | 2987652177 | Bacteria | 6969023 |
| 1007 | 2987665015 | 2987659509 | Bacteria | 6966464 |
| 1008 | 2987669244 | 2987666974 | Bacteria | 6509233 |
| 1009 | 2987676017 | 2987673487 | Bacteria | 6884027 |
| 1010 | 2989355156 | 2989349275 | Bacteria | 6349068 |
| 1011 | 2989775377 | 2989771324 | Bacteria | 5605128 |
| 1012 | 2996314074 | 2996310559 | Bacteria | 6357320 |
| 1013 | 2996345072 | 2996341866 | Bacteria | 6643098 |
| 1014 | 2996350169 | 2996348954 | Bacteria | 7239054 |
| 1015 | 2996391443 | 2996386984 | Bacteria | 6978667 |
| 1016 | 3000140661 | 3000135777 | Bacteria | 6891109 |
| 1017 | 3004168902 | 3004167301 | Bacteria | 8330599 |
| 1018 | 3004194072 | 3004188549 | Bacteria | 6952365 |
| 1019 | 3004196256 | 3004195979 | Bacteria | 6776956 |
| 1020 | 3004205420 | 3004203850 | Bacteria | 7307914 |
| 1021 | 3004215956 | 3004211236 | Bacteria | 7417683 |
| 1022 | 3004223706 | 3004218560 | Bacteria | 7421728 |
| 1023 | 3004235837 | 3004232784 | Bacteria | 6662140 |
| 1024 | 3004246437 | 3004239961 | Bacteria | 6892290 |
| 1025 | 3004254705 | 3004248173 | Bacteria | 6563236 |
| 1026 | 3004274946 | 3004268573 | Bacteria | 7043476 |
| 1027 | 3004276868 | 3004275668 | Bacteria | 7114440 |
| 1028 | 3004290898 | 3004289098 | Bacteria | 6135450 |
| 1029 | 3004334356 | 3004334049 | Bacteria | 8449246 |
| 1030 | 637074599 | 637000159 | Bacteria | 7596297 |
| 1031 | 649872973 | 649633066 | Bacteria | 6690028 |
| 1032 | 8002289041 | 8002285264 | Bacteria | 6717907 |
| 1033 | 8004301043 | 8004300914 | Bacteria | 6132239 |
| 1034 | 8004314009 | 8004312739 | Bacteria | 7444653 |
| 1035 | 8004365134 | 8004361976 | Bacteria | 6858373 |
| 1036 | 8004380397 | 8004374579 | Bacteria | 6898112 |
| 1037 | 8004393640 | 8004387939 | Bacteria | 7049250 |
| 1038 | 8004402716 | 8004395343 | Bacteria | 6620908 |
| 1039 | 8004450199 | 8004445564 | Bacteria | 6322258 |
| 1040 | 8004634825 | 8004633249 | Bacteria | 6723080 |
| 1041 | 8004640821 | 8004640170 | Bacteria | 6723001 |
| 1042 | 8004703603 | 8004695233 | Bacteria | 6731676 |
| 1043 | 8004709364 | 8004703790 | Bacteria | 8006957 |
| 1044 | 8004720408 | 8004714634 | Bacteria | 6776161 |
| 1045 | 8005246851 | 8005246636 | Bacteria | 4933972 |
| 1046 | 8054560085 | 8054558443 | Bacteria | 5204801 |
| 1047 | 8055620777 | 8055617313 | Bacteria | 7548464 |
| 1048 | Ga0501035_0121404 | |||
| 1049 | JGI24737J22298_10002261 | |||
| 1050 | JGI24735J21928_10007364 | |||
| 1051 | JGI25406J46586_10001817 | |||
| 1052 | Ga0055542_1000986 | |||
| 1053 | Ga0055528_1007052 | |||
| 1054 | Ga0070683_100326147 | |||
| 1055 | Ga0070670_100008351 | |||
| 1056 | Ga0070680_100063778 | |||
| 1057 | Ga0070680_100106225 | |||
| 1058 | Ga0070680_100285748 | |||
| 1059 | Ga0070682_100046685 | |||
| 1060 | Ga0070661_100227053 | |||
| 1061 | Ga0070661_100570677 | |||
| 1062 | Ga0070659_100089890 | |||
| 1063 | Ga0070659_100123154 | |||
| 1064 | Ga0070659_100298918 | |||
| 1065 | Ga0070667_100348700 | |||
| 1066 | Ga0070709_10008945 | |||
| 1067 | Ga0070709_10025287 | |||
| 1068 | Ga0070709_10104679 | |||
| 1069 | Ga0070709_10224734 | |||
| 1070 | Ga0070709_10286081 | |||
| 1071 | Ga0070714_100021907 | |||
| 1072 | Ga0070713_100045619 | |||
| 1073 | Ga0070710_10000417 | |||
| 1074 | Ga0070710_10118230 | |||
| 1075 | Ga0070711_100003647 | |||
| 1076 | Ga0070711_100122213 | |||
| 1077 | Ga0070663_100013308 | |||
| 1078 | Ga0070663_100014776 | |||
| 1079 | Ga0070662_100008152 | |||
| 1080 | Ga0070681_10022697 | |||
| 1081 | Ga0070681_10134356 | |||
| 1082 | Ga0070681_10244274 | |||
| 1083 | Ga0070681_10278429 | |||
| 1084 | Ga0070679_100019564 | |||
| 1085 | Ga0070679_100070219 | |||
| 1086 | Ga0070679_100137818 | |||
| 1087 | Ga0070684_100007976 | |||
| 1088 | Ga0070684_100086636 | |||
| 1089 | Ga0068853_100022093 | |||
| 1090 | Ga0068853_100024626 | |||
| 1091 | Ga0068853_100031106 | |||
| 1092 | Ga0068853_100095964 | |||
| 1093 | Ga0068853_100158998 | |||
| 1094 | Ga0070693_100172819 | |||
| 1095 | Ga0070693_100301259 | |||
| 1096 | Ga0070665_100082332 | |||
| 1097 | Ga0070665_100146315 | |||
| 1098 | Ga0068855_100018872 | |||
| 1099 | Ga0068855_100078782 | |||
| 1100 | Ga0068855_100285170 | |||
| 1101 | Ga0068855_100482265 | |||
| 1102 | Ga0068857_100003393 | |||
| 1103 | Ga0068857_100016795 | |||
| 1104 | Ga0068854_100026994 | |||
| 1105 | Ga0068854_100179605 | |||
| 1106 | Ga0068854_100185865 | |||
| 1107 | Ga0068856_100002827 | |||
| 1108 | Ga0068856_100016560 | |||
| 1109 | Ga0068856_100175169 | |||
| 1110 | Ga0068852_100137192 | |||
| 1111 | Ga0068852_100293120 | |||
| 1112 | Ga0068864_100500101 | |||
| 1113 | Ga0068851_10001384 | |||
| 1114 | Ga0068862_100451139 | |||
| 1115 | Ga0081539_10003450 | |||
| 1116 | Ga0070717_10275568 | |||
| 1117 | Ga0075365_10007012 | |||
| 1118 | Ga0075365_10121498 | |||
| 1119 | Ga0075365_10192221 | |||
| 1120 | Ga0075363_100124524 | |||
| 1121 | Ga0070715_10015227 | |||
| 1122 | Ga0070716_100004688 | |||
| 1123 | Ga0070716_100137540 | |||
| 1124 | Ga0075367_10152218 | |||
| 1125 | Ga0075369_10021673 | |||
| 1126 | Ga0075369_10049536 | |||
| 1127 | Ga0068871_100496554 | |||
| 1128 | Ga0075428_100008942 | |||
| 1129 | Ga0075431_100342205 | |||
| 1130 | Ga0075429_100231393 | |||
| 1131 | Ga0068865_100415313 | |||
| 1132 | Ga0099794_10005752 | |||
| 1133 | Ga0099794_10186145 | |||
| 1134 | Ga0099795_10004056 | |||
| 1135 | Ga0105240_10012741 | |||
| 1136 | Ga0105240_10039036 | |||
| 1137 | Ga0105240_10064831 | |||
| 1138 | Ga0105240_10195546 | |||
| 1139 | Ga0111539_10070035 | |||
| 1140 | Ga0114129_10004474 | |||
| 1141 | Ga0105243_10340825 | |||
| 1142 | Ga0105241_10002223 | |||
| 1143 | Ga0105237_10024483 | |||
| 1144 | Ga0105237_10046007 | |||
| 1145 | Ga0105237_10402357 | |||
| 1146 | Ga0105238_10005872 | |||
| 1147 | Ga0105238_10009265 | |||
| 1148 | Ga0105238_10026487 | |||
| 1149 | Ga0105238_10105708 | |||
| 1150 | Ga0105238_10447731 | |||
| 1151 | Ga0105238_10455735 | |||
| 1152 | Ga0099796_10012686 | |||
| 1153 | Ga0099796_10080751 | |||
| 1154 | Ga0105239_10006765 | |||
| 1155 | Ga0105239_10014460 | |||
| 1156 | Ga0105239_10022601 | |||
| 1157 | Ga0105239_10344869 | |||
| 1158 | Ga0105246_10039432 | |||
| 1159 | Ga0157371_10025461 | |||
| 1160 | Ga0157370_10138591 | |||
| 1161 | Ga0157370_10278531 | |||
| 1162 | Ga0157369_10017756 | |||
| 1163 | Ga0157374_10070061 | |||
| 1164 | Ga0163162_10637225 | |||
| 1165 | Ga0157372_10095195 | |||
| 1166 | Ga0157372_10419084 | |||
| 1167 | Ga0163163_10008704 | |||
| 1168 | Ga0182008_10019310 | |||
| 1169 | Ga0163161_10318736 | |||
| 1170 | Ga0206356_11139929 | |||
| 1171 | Ga0213873_10002325 | |||
| 1172 | Ga0213876_10067483 | |||
| 1173 | Ga0213875_10000036 | |||
| 1174 | Ga0209026_1000025 | |||
| 1175 | Ga0209677_114036 | |||
| 1176 | Ga0209148_1000181 | |||
| 1177 | Ga0209759_1000121 | |||
| 1178 | Ga0209455_1000127 | |||
| 1179 | Ga0209673_1000457 | |||
| 1180 | Ga0209025_1000165 | |||
| 1181 | Ga0209564_1001849 | |||
| 1182 | Ga0209758_1000005 | |||
| 1183 | Ga0209758_1010358 | |||
| 1184 | Ga0209050_1001615 | |||
| 1185 | Ga0209051_1025118 | |||
| 1186 | Ga0209257_1000303 | |||
| 1187 | Ga0209257_1025954 | |||
| 1188 | Ga0207692_10058908 | |||
| 1189 | Ga0207692_10104911 | |||
| 1190 | Ga0207647_10001898 | |||
| 1191 | Ga0207647_10210891 | |||
| 1192 | Ga0207685_10037457 | |||
| 1193 | Ga0207699_10000473 | |||
| 1194 | Ga0207699_10005645 | |||
| 1195 | Ga0207699_10069035 | |||
| 1196 | Ga0207699_10080453 | |||
| 1197 | Ga0207699_10301521 | |||
| 1198 | Ga0207654_10000317 | |||
| 1199 | Ga0207654_10274339 | |||
| 1200 | Ga0207707_10000505 | |||
| 1201 | Ga0207707_10005928 | |||
| 1202 | Ga0207707_10154019 | |||
| 1203 | Ga0207707_10514845 | |||
| 1204 | Ga0207695_10000713 | |||
| 1205 | Ga0207695_10394346 | |||
| 1206 | Ga0207695_10439169 | |||
| 1207 | Ga0207695_10618729 | |||
| 1208 | Ga0207671_10010503 | |||
| 1209 | Ga0207671_10122066 | |||
| 1210 | Ga0207671_10241384 | |||
| 1211 | Ga0207693_10275029 | |||
| 1212 | Ga0207663_10017841 | |||
| 1213 | Ga0207663_10029578 | |||
| 1214 | Ga0207660_10372899 | |||
| 1215 | Ga0207657_10121530 | |||
| 1216 | Ga0207652_10026858 | |||
| 1217 | Ga0207652_10036599 | |||
| 1218 | Ga0207652_10053469 | |||
| 1219 | Ga0207652_10216309 | |||
| 1220 | Ga0207652_10231332 | |||
| 1221 | Ga0207694_10000155 | |||
| 1222 | Ga0207694_10003031 | |||
| 1223 | Ga0207694_10028952 | |||
| 1224 | Ga0207694_10035867 | |||
| 1225 | Ga0207694_10099055 | |||
| 1226 | Ga0207650_10012045 | |||
| 1227 | Ga0207700_10038473 | |||
| 1228 | Ga0207700_10062898 | |||
| 1229 | Ga0207700_10128764 | |||
| 1230 | Ga0207664_10009878 | |||
| 1231 | Ga0207664_10028623 | |||
| 1232 | Ga0207664_10336209 | |||
| 1233 | Ga0207690_10252679 | |||
| 1234 | Ga0207706_10049641 | |||
| 1235 | Ga0207706_10170757 | |||
| 1236 | Ga0207704_10354894 | |||
| 1237 | Ga0207665_10013789 | |||
| 1238 | Ga0207667_10016768 | |||
| 1239 | Ga0207667_10026865 | |||
| 1240 | Ga0207667_10133139 | |||
| 1241 | Ga0207712_10061145 | |||
| 1242 | Ga0207640_10002792 | |||
| 1243 | Ga0207640_10074759 | |||
| 1244 | Ga0207658_10298843 | |||
| 1245 | Ga0207658_10316007 | |||
| 1246 | Ga0207639_10003685 | |||
| 1247 | Ga0207639_10019633 | |||
| 1248 | Ga0207639_10255061 | |||
| 1249 | Ga0207678_10032286 | |||
| 1250 | Ga0207678_10037450 | |||
| 1251 | Ga0207678_10039836 | |||
| 1252 | Ga0207702_10000022 | |||
| 1253 | Ga0207702_10003504 | |||
| 1254 | Ga0207702_10633332 | |||
| 1255 | Ga0207648_10160854 | |||
| 1256 | Ga0207676_10588552 | |||
| 1257 | Ga0207698_10370677 | |||
| 1258 | Ga0209588_1000792 | |||
| 1259 | Ga0209588_1002811 | |||
| 1260 | Ga0209588_1071906 | |||
| 1261 | Ga0209813_10025213 | |||
| 1262 | Ga0268266_10013179 | |||
| 1263 | Ga0268266_10031714 | |||
| 1264 | Ga0268265_10008367 | |||
| 1265 | Ga0265319_1022836 | |||
| 1266 | Ga0265318_10000680 | |||
| 1267 | Ga0265318_10062432 | |||
| 1268 | Ga0307515_10000420 | |||
| 1269 | Ga0265330_10053739 | |||
| 1270 | Ga0265325_10000869 | |||
| 1271 | Ga0265325_10030653 | |||
| 1272 | Ga0265325_10106323 | |||
| 1273 | Ga0265340_10001284 | |||
| 1274 | Ga0265340_10007346 | |||
| 1275 | Ga0265340_10047670 | |||
| 1276 | Ga0265339_10002241 | |||
| 1277 | Ga0265339_10036911 | |||
| 1278 | Ga0265339_10171239 | |||
| 1279 | Ga0265331_10030152 | |||
| 1280 | Ga0265316_10004479 | |||
| 1281 | Ga0265316_10068620 | |||
| 1282 | Ga0265316_10376169 | |||
| 1283 | Ga0307513_10004196 | |||
| 1284 | Ga0265313_10000872 | |||
| 1285 | Ga0265313_10006312 | |||
| 1286 | Ga0265313_10077882 | |||
| 1287 | Ga0307508_10302973 | |||
| 1288 | Ga0265314_10005202 | |||
| 1289 | Ga0265314_10018990 | |||
| 1290 | Ga0265314_10279103 | |||
| 1291 | Ga0265342_10058055 | |||
| 1292 | Ga0265342_10086906 | |||
| 1293 | Ga0265342_10212684 | |||
| 1294 | Ga0307416_100526101 | |||
| 1295 | Ga0307510_10039607 | |||
| 1296 | Ga0373923_0015582 | |||
| 1297 | Ga0373936_0040621 | |||
| 1298 | Ga0373936_0089581 | |||
| 1299 | Ga0373945_0010763 | |||
| 1300 | Ga0373953_0156086 | |||
| 1301 | Ga0373954_0021500 | |||
| 1302 | Ga0373954_0098805 | |||
| 1303 | Ga0373957_0062499 | |||
| 1304 | Ga0373943_0002114 | |||
| 1305 | Ga0373946_0052621 | |||
| 1306 | Ga0373955_0136656 | |||
| 1307 | Ga0373924_0009305 | |||
| 1308 | Ga0373924_0073268 | |||
| 1309 | Ga0373935_0000660 | |||
| 1310 | Ga0373935_0075583 | |||
| 1311 | Ga0373927_0006115 | |||
| 1312 | Ga0373927_0119546 | |||
| 1313 | Ga0373927_0138205 | |||
| 1314 | Ga0373933_0152369 | |||
| 1315 | Ga0373933_0277406 | |||
| 1316 | Ga0373947_0001631 | |||
| 1317 | Ga0373947_0023727 | |||
| 1318 | Ga0373947_0151341 | |||
| 1319 | Ga0373925_0001524 | |||
| 1320 | Ga0373925_0163160 | |||
| 1321 | Ga0395899_0000117 | |||
| 1322 | Ga0395900_0000020 | |||
| 1323 | Ga0395900_0028714 | |||
| 1324 | Ga0395900_0065797 | |||
| 1325 | Ga0395900_0150361 | |||
| 1326 | Ga0395900_0342480 | |||
| 1327 | Ga0395900_0631503 | |||
| 1328 | Ga0395898_0000259 | |||
| 1329 | Ga0395898_0041398 | |||
| 1330 | Ga0395898_0097159 | |||
| 1331 | Ga0395898_0166073 | |||
| 1332 | Ga0395898_0383176 | |||
| 1333 | Ga0395898_0613319 | |||
| 1334 | Ga0395905_0000019 | |||
| 1335 | Ga0395905_0112114 | |||
| 1336 | Ga0395905_0160038 | |||
| 1337 | Ga0436364_0245439 | |||
| 1338 | Ga0436364_1071235 | |||
| 1339 | Ga0395901_0000016 | |||
| 1340 | Ga0395901_0027609 | |||
| 1341 | Ga0395901_0207606 | |||
| 1342 | Ga0395901_0279626 | |||
| 1343 | Ga0395901_0361372 | |||
| 1344 | Ga0395901_0460124 | |||
| 1345 | Ga0436365_0040457 | |||
| 1346 | Ga0436365_0179006 | |||
| 1347 | Ga0436365_0928236 | |||
| 1348 | Ga0436365_0959977 | |||
| 1349 | Ga0436365_1259906 | |||
| 1350 | Ga0436365_1681226 | |||
| 1351 | Ga0436360_0655288 | |||
| 1352 | Ga0436363_0945892 | |||
| 1353 | Ga0436362_0631993 | |||
| 1354 | Ga0466969_0007887 | |||
| 1355 | Ga0466972_0033120 | |||
| 1356 | Ga0466966_0073582 | |||
| 1357 | Ga0466966_0186975 | |||
| 1358 | Ga0466961_0079695 | |||
| 1359 | Ga0466971_0034150 | |||
| 1360 | Ga0466970_0086840 | |||
| 1361 | Ga0466960_0026413 | |||
| 1362 | Ga0466959_0027484 | |||
| 1363 | Ga0466958_0169788 | |||
| 1364 | Ga0466967_0039398 | |||
| 1365 | Ga0495592_0011842 | |||
| 1366 | Ga0495592_0036626 | |||
| 1367 | Ga0495603_0000155 | |||
| 1368 | Ga0495629_0001568 | |||
| 1369 | Ga0495629_0055389 | |||
| 1370 | Ga0495641_0011193 | |||
| 1371 | Ga0495641_0012521 | |||
| 1372 | Ga0495641_0014774 | |||
| 1373 | Ga0495651_0018841 | |||
| 1374 | Ga0495651_0266716 | |||
| 1375 | Ga0495653_0024094 | |||
| 1376 | Ga0495580_0013322 | |||
| 1377 | Ga0495582_0000401 | |||
| 1378 | Ga0495639_0000146 | |||
| 1379 | Ga0495639_0043582 | |||
| 1380 | Ga0495639_0149143 | |||
| 1381 | Ga0495662_0000242 | |||
| 1382 | Ga0495662_0018902 | |||
| 1383 | Ga0495662_0165446 | |||
| 1384 | Ga0495664_0011226 | |||
| 1385 | Ga0495664_0024087 | |||
| 1386 | Ga0495664_0029291 | |||
| 1387 | Ga0495584_0012407 | |||
| 1388 | Ga0495594_0001113 | |||
| 1389 | Ga0495607_0046014 | |||
| 1390 | Ga0495608_0009795 | |||
| 1391 | Ga0495608_0162938 | |||
| 1392 | Ga0495608_0485275 | |||
| 1393 | Ga0495610_0137322 | |||
| 1394 | Ga0495618_0000589 | |||
| 1395 | Ga0495618_0046370 | |||
| 1396 | Ga0495618_0163683 | |||
| 1397 | Ga0495620_0021102 | |||
| 1398 | Ga0495628_0077931 | |||
| 1399 | Ga0495628_0232250 | |||
| 1400 | Ga0495628_0240957 | |||
| 1401 | Ga0495630_0000634 | |||
| 1402 | Ga0495630_0009739 | |||
| 1403 | Ga0495630_0165218 | |||
| 1404 | Ga0495630_0171772 | |||
| 1405 | Ga0495637_0045137 | |||
| 1406 | Ga0495644_0037671 | |||
| 1407 | Ga0495652_0001002 | |||
| 1408 | Ga0495652_0016908 | |||
| 1409 | Ga0495652_0026936 | |||
| 1410 | Ga0495652_0037188 | |||
| 1411 | Ga0495652_0054963 | |||
| 1412 | Ga0495652_0059829 | |||
| 1413 | Ga0495665_0000150 | |||
| 1414 | Ga0495665_0025824 | |||
| 1415 | Ga0495640_0004664 | |||
| 1416 | Ga0495640_0050622 | |||
| 1417 | Ga0495640_0225732 | |||
| 1418 | Ga0495586_0260769 | |||
| 1419 | Ga0495621_0107948 | |||
| 1420 | Ga0495645_0003965 | |||
| 1421 | Ga0495645_0089904 | |||
| 1422 | Ga0495645_0154783 | |||
| 1423 | Ga0495645_0333635 | |||
| 1424 | Ga0495622_0005717 | |||
| 1425 | Ga0495656_0006603 | |||
| 1426 | Ga0495634_0003138 | |||
| 1427 | Ga0495634_0003515 | |||
| 1428 | Ga0495634_0124485 | |||
| 1429 | Ga0495625_0183588 | |||
| 1430 | Ga0495635_0000823 | |||
| 1431 | Ga0495635_0017735 | |||
| 1432 | Ga0495635_0038903 | |||
| 1433 | Ga0495588_0029919 | |||
| 1434 | Ga0495657_0010790 | |||
| 1435 | Ga0495599_0009593 | |||
| 1436 | Ga0495623_0008876 | |||
| 1437 | Ga0495646_0002238 | |||
| 1438 | Ga0495647_0001777 | |||
| 1439 | Ga0495658_0044213 | |||
| 1440 | Ga0495613_0004476 | |||
| 1441 | Ga0495613_0074243 | |||
| 1442 | Ga0495624_0001759 | |||
| 1443 | Ga0495624_0002699 | |||
| 1444 | Ga0495624_0003993 | |||
| 1445 | Ga0495670_0080569 | |||
| 1446 | Ga0495671_0111227 | |||
| 1447 | Ga0495600_0181483 | |||
| 1448 | Ga0495600_0203706 | |||
| 1449 | Ga0495600_0349818 | |||
| 1450 | Ga0495581_0005294 | |||
| 1451 | Ga0495581_0040579 | |||
| 1452 | Ga0495581_0048716 | |||
| 1453 | Ga0495581_0135283 | |||
| 1454 | Ga0495604_0290819 | |||
| 1455 | Ga0495674_0000447 | |||
| 1456 | Ga0495674_0001343 | |||
| 1457 | Ga0495674_0458280 | |||
| 1458 | Ga0495672_0019570 | |||
| 1459 | Ga0495672_0091653 | |||
| 1460 | Ga0495676_0001115 | |||
| 1461 | Ga0495676_0005737 | |||
| 1462 | Ga0495676_0052329 | |||
| 1463 | Ga0495676_0109929 | |||
| 1464 | Ga0495676_0234980 | |||
| 1465 | Ga0495680_0214347 | |||
| 1466 | Ga0495675_0096316 | |||
| 1467 | Ga0495673_0020830 | |||
| 1468 | Ga0495684_0008505 | |||
| 1469 | Ga0495684_0089421 | |||
| 1470 | Ga0495684_0381849 | |||
| 1471 | Ga0495686_0074618 | |||
| 1472 | Ga0495593_0000406 | |||
| 1473 | Ga0495593_0054266 | |||
| 1474 | Ga0495602_0005170 | |||
| 1475 | Ga0495602_0012148 | |||
| 1476 | Ga0495602_0017788 | |||
| 1477 | Ga0495602_0025881 | |||
| 1478 | Ga0495602_0153309 | |||
| 1479 | Ga0495614_0013877 | |||
| 1480 | Ga0495614_0103739 | |||
| 1481 | Ga0496100_0014292 | |||
| 1482 | Ga0496101_0408759 | |||
| 1483 | Ga0496102_0028833 | |||
| 1484 | Ga0496102_0096793 | |||
| 1485 | Ga0496102_0487748 | |||
| 1486 | Ga0496102_0622599 | |||
| 1487 | Ga0496103_0242699 | |||
| 1488 | Ga0496104_0000740 | |||
| 1489 | Ga0496104_0386621 | |||
| 1490 | Ga0496105_0018506 | |||
| 1491 | Ga0496106_0002088 | |||
| 1492 | Ga0496106_0110106 | |||
| 1493 | Ga0496107_0066849 | |||
| 1494 | Ga0496107_0081789 | |||
| 1495 | Ga0496108_0000449 | |||
| 1496 | Ga0496108_0001075 | |||
| 1497 | Ga0496109_0002544 | |||
| 1498 | Ga0496109_0004948 | |||
| 1499 | Ga0496109_0625840 | |||
| 1500 | Ga0496110_0008032 | |||
| 1501 | Ga0496110_0275443 | |||
| 1502 | Ga0496111_0033862 | |||
| 1503 | Ga0496111_0122137 | |||
| 1504 | Ga0496112_0006031 | |||
| 1505 | Ga0496112_0083677 | |||
| 1506 | Ga0496112_0231068 | |||
| 1507 | Ga0496113_0001942 | |||
| 1508 | Ga0496114_0458645 | |||
| 1509 | Ga0496116_0011742 | |||
| 1510 | Ga0496117_0002204 | |||
| 1511 | Ga0496117_0057126 | |||
| 1512 | Ga0496119_0019343 | |||
| 1513 | Ga0496119_0088747 | |||
| 1514 | Ga0496119_0132032 | |||
| 1515 | Ga0496119_0137958 | |||
| 1516 | Ga0496120_0003090 | |||
| 1517 | Ga0496120_0166544 | |||
| 1518 | Ga0496120_0177487 | |||
| 1519 | Ga0496121_0000500 | |||
| 1520 | Ga0496121_0001203 | |||
| 1521 | Ga0496121_0097616 | |||
| 1522 | Ga0496121_0107722 | |||
| 1523 | Ga0496121_0129673 | |||
| 1524 | Ga0496121_0315036 | |||
| 1525 | Ga0496122_0004346 | |||
| 1526 | Ga0496122_0042654 | |||
| 1527 | Ga0496122_0074967 | |||
| 1528 | Ga0496123_0000103 | |||
| 1529 | Ga0496123_0032651 | |||
| 1530 | Ga0496123_0097351 | |||
| 1531 | Ga0496124_0005072 | |||
| 1532 | Ga0496124_0057457 | |||
| 1533 | Ga0496125_0000154 | |||
| 1534 | Ga0496125_0000879 | |||
| 1535 | Ga0496125_0217618 | |||
| 1536 | Ga0496126_0001336 | |||
| 1537 | Ga0496126_0006815 | |||
| 1538 | Ga0496126_0012132 | |||
| 1539 | Ga0496126_0012891 | |||
| 1540 | Ga0496126_0050759 | |||
| 1541 | Ga0496126_0058933 | |||
| 1542 | Ga0496126_0100519 | |||
| 1543 | Ga0496126_0172975 | |||
| 1544 | Ga0496126_0197255 | |||
| 1545 | Ga0501031_0000036 | |||
| 1546 | Ga0501031_0001531 | |||
| 1547 | Ga0501031_0001871 | |||
| 1548 | Ga0501031_0035703 | |||
| 1549 | Ga0501031_0083684 | |||
| 1550 | Ga0501031_0137476 | |||
| 1551 | Ga0501031_0154846 | |||
| 1552 | Ga0501031_0217685 | |||
| 1553 | Ga0501032_0000100 | |||
| 1554 | Ga0501032_0000144 | |||
| 1555 | Ga0501032_0000421 | |||
| 1556 | Ga0501032_0015412 | |||
| 1557 | Ga0501032_0027119 | |||
| 1558 | Ga0501032_0035557 | |||
| 1559 | Ga0501032_0103174 | |||
| 1560 | Ga0501032_0106489 | |||
| 1561 | Ga0501032_0208710 | |||
| 1562 | Ga0501032_0284314 | |||
| 1563 | Ga0501033_0000088 | |||
| 1564 | Ga0501033_0000124 | |||
| 1565 | Ga0501033_0000206 | |||
| 1566 | Ga0501033_0001695 | |||
| 1567 | Ga0501033_0002152 | |||
| 1568 | Ga0501033_0012955 | |||
| 1569 | Ga0501033_0025755 | |||
| 1570 | Ga0501033_0052909 | |||
| 1571 | Ga0501033_0060131 | |||
| 1572 | Ga0501033_0102387 | |||
| 1573 | Ga0501033_0149548 | |||
| 1574 | Ga0501034_0000159 | |||
| 1575 | Ga0501034_0000397 | |||
| 1576 | Ga0501034_0061784 | |||
| 1577 | Ga0501034_0089811 | |||
| 1578 | Ga0501034_0127329 | |||
| 1579 | Ga0501034_0207525 | |||
| 1580 | Ga0501034_0248233 | |||
| 1581 | Ga0501034_0289450 | |||
| 1582 | Ga0501034_0304802 | |||
| 1583 | Ga0501034_0338685 | |||
| 1584 | Ga0501034_0658412 | |||
| 1585 | Ga0501034_0733023 | |||
| 1586 | Ga0501036_0000039 | |||
| 1587 | Ga0501036_0000056 | |||
| 1588 | Ga0501036_0005635 | |||
| 1589 | Ga0501036_0042683 | |||
| 1590 | Ga0501036_0084382 | |||
| 1591 | Ga0501036_0093225 | |||
| 1592 | Ga0501036_0221352 | |||
| 1593 | Ga0501036_0424919 | |||
| 1594 | Ga0501037_0000119 | |||
| 1595 | Ga0501037_0000181 | |||
| 1596 | Ga0501037_0000247 | |||
| 1597 | Ga0501037_0000396 | |||
| 1598 | Ga0501037_0001963 | |||
| 1599 | Ga0501037_0041465 | |||
| 1600 | Ga0501037_0062969 | |||
| 1601 | Ga0501037_0071116 | |||
| 1602 | Ga0501037_0117480 | |||
| 1603 | Ga0501037_0145479 | |||
| 1604 | Ga0501037_0147533 | |||
| 1605 | Ga0501037_0155128 | |||
| 1606 | Ga0501037_0278606 | |||
| 1607 | Ga0501037_0356785 | |||
| 1608 | Ga0501038_0000041 | |||
| 1609 | Ga0501038_0000098 | |||
| 1610 | Ga0501038_0000371 | |||
| 1611 | Ga0501038_0013061 | |||
| 1612 | Ga0501038_0022184 | |||
| 1613 | Ga0501038_0093320 | |||
| 1614 | Ga0501038_0123608 | |||
| 1615 | Ga0501038_0134942 | |||
| 1616 | Ga0501038_0228125 | |||
| 1617 | Ga0501038_0269727 | |||
| 1618 | Ga0501038_0360356 | |||
| 1619 | Ga0501039_0000013 | |||
| 1620 | Ga0501039_0000853 | |||
| 1621 | Ga0501039_0000926 | |||
| 1622 | Ga0501039_0016084 | |||
| 1623 | Ga0501039_0035142 | |||
| 1624 | Ga0501039_0045031 | |||
| 1625 | Ga0501039_0064691 | |||
| 1626 | Ga0501039_0121317 | |||
| 1627 | Ga0501039_0243546 | |||
| 1628 | Ga0501040_0051279 | |||
| 1629 | Ga0501040_0245630 | |||
| 1630 | Ga0501041_0170403 | |||
| 1631 | Ga0501042_0023910 | |||
| 1632 | Ga0501042_0067668 | |||
| 1633 | Ga0501042_0111391 | |||
| 1634 | Ga0501042_0180403 | |||
| 1635 | Ga0501043_0000008 | |||
| 1636 | Ga0501043_0000202 | |||
| 1637 | Ga0501043_0000498 | |||
| 1638 | Ga0501043_0001500 | |||
| 1639 | Ga0501043_0003541 | |||
| 1640 | Ga0501043_0024793 | |||
| 1641 | Ga0501043_0033474 | |||
| 1642 | Ga0501043_0048171 | |||
| 1643 | Ga0501043_0049416 | |||
| 1644 | Ga0501043_0058488 | |||
| 1645 | Ga0501043_0070501 | |||
| 1646 | Ga0501043_0182142 | |||
| 1647 | Ga0501043_0283127 | |||
| 1648 | Ga0501046_0000397 | |||
| 1649 | Ga0501046_0046453 | |||
| 1650 | Ga0501046_0063507 | |||
| 1651 | Ga0501046_0068316 | |||
| 1652 | Ga0501046_0070822 | |||
| 1653 | Ga0501046_0089401 | |||
| 1654 | Ga0501046_0142522 | |||
| 1655 | Ga0501046_0147866 | |||
| 1656 | Ga0501046_0165024 | |||
| 1657 | Ga0501046_0236184 | |||
| 1658 | Ga0501046_0237702 | |||
| 1659 | Ga0501046_0389374 | |||
| 1660 | Ga0501047_0000288 | |||
| 1661 | Ga0501047_0000392 | |||
| 1662 | Ga0501047_0006231 | |||
| 1663 | Ga0501047_0021920 | |||
| 1664 | Ga0501047_0024115 | |||
| 1665 | Ga0501047_0091355 | |||
| 1666 | Ga0501047_0095674 | |||
| 1667 | Ga0501047_0128910 | |||
| 1668 | Ga0501047_0191388 | |||
| 1669 | Ga0501047_0361827 | |||
| 1670 | Ga0501047_0380699 | |||
| 1671 | Ga0501048_0000834 | |||
| 1672 | Ga0501048_0129345 | |||
| 1673 | Ga0501048_0134387 | |||
| 1674 | Ga0501048_0171714 | |||
| 1675 | Ga0501048_0264014 | |||
| 1676 | Ga0501067_0000333 | |||
| 1677 | Ga0501067_0010498 | |||
| 1678 | Ga0501067_0013258 | |||
| 1679 | Ga0501067_0019085 | |||
| 1680 | Ga0501067_0055840 | |||
| 1681 | Ga0501068_0003723 | |||
| 1682 | Ga0501068_0028630 | |||
| 1683 | Ga0501069_0001610 | |||
| 1684 | Ga0501069_0010029 | |||
| 1685 | Ga0501069_0019384 | |||
| 1686 | Ga0501069_0053827 | |||
| 1687 | Ga0501069_0118107 | |||
| 1688 | Ga0501069_0138129 | |||
| 1689 | Ga0501070_0000175 | |||
| 1690 | Ga0501070_0000264 | |||
| 1691 | Ga0501070_0000476 | |||
| 1692 | Ga0501070_0007787 | |||
| 1693 | Ga0501070_0017987 | |||
| 1694 | Ga0501070_0020560 | |||
| 1695 | Ga0501070_0020934 | |||
| 1696 | Ga0501070_0043206 | |||
| 1697 | Ga0501070_0071314 | |||
| 1698 | Ga0501070_0090664 | |||
| 1699 | Ga0501070_0116227 | |||
| 1700 | Ga0501071_0016378 | |||
| 1701 | Ga0501072_0004129 | |||
| 1702 | Ga0501072_0276654 | |||
| 1703 | Ga0501073_0000034 | |||
| 1704 | Ga0501073_0011018 | |||
| 1705 | Ga0501073_0034023 | |||
| 1706 | Ga0501073_0046674 | |||
| 1707 | Ga0501073_0105423 | |||
| 1708 | Ga0501073_0156779 | |||
| 1709 | Ga0501073_0281453 | |||
| 1710 | Ga0501074_0000016 | |||
| 1711 | Ga0501074_0000395 | |||
| 1712 | Ga0501074_0005501 | |||
| 1713 | Ga0501074_0020725 | |||
| 1714 | Ga0501074_0035325 | |||
| 1715 | Ga0501074_0312954 | |||
| 1716 | Ga0501076_0152018 | |||
| 1717 | Ga0501079_0003579 | |||
| 1718 | Ga0501079_0028231 | |||
| 1719 | Ga0501079_0217056 | |||
| 1720 | Ga0501080_0000846 | |||
| 1721 | Ga0501080_0012000 | |||
| 1722 | Ga0501080_0015856 | |||
| 1723 | Ga0501080_0029605 | |||
| 1724 | Ga0501080_0032773 | |||
| 1725 | Ga0501080_0052040 | |||
| 1726 | Ga0501080_0061934 | |||
| 1727 | Ga0501080_0095411 | |||
| 1728 | Ga0501080_0129525 | |||
| 1729 | Ga0501080_0175361 | |||
| 1730 | Ga0501080_0242350 | |||
| 1731 | Ga0501083_0000035 | |||
| 1732 | Ga0501083_0001286 | |||
| 1733 | Ga0501083_0037718 | |||
| 1734 | Ga0501083_0054077 | |||
| 1735 | Ga0501035_0000011 | |||
| 1736 | Ga0501035_0000053 | |||
| 1737 | Ga0501035_0000137 | |||
| 1738 | Ga0501035_0000155 | |||
| 1739 | Ga0501035_0002015 | |||
| 1740 | Ga0501035_0005448 | |||
| 1741 | Ga0501035_0017260 | |||
| 1742 | Ga0501035_0039642 | |||
| 1743 | Ga0501035_0068402 | |||
| 1744 | Ga0501035_0108767 | |||
| 1745 | Ga0501035_0123606 | |||
| 1746 | Ga0501035_0124084 | |||
| 1747 | Ga0501035_0208643 | |||
| 1748 | Ga0501035_0218339 | |||
| 1749 | Ga0501035_0244195 | |||
| 1750 | Ga0501035_0415234 | |||
| 1751 | Ga0501035_0437522 | |||
| 1752 | Ga0501035_0684418 | |||
| 1753 | Ga0501044_0000011 | |||
| 1754 | Ga0501044_0000214 | |||
| 1755 | Ga0501044_0000393 | |||
| 1756 | Ga0501044_0000431 | |||
| 1757 | Ga0501044_0003054 | |||
| 1758 | Ga0501044_0003281 | |||
| 1759 | Ga0501044_0019399 | |||
| 1760 | Ga0501044_0020202 | |||
| 1761 | Ga0501044_0024315 | |||
| 1762 | Ga0501044_0032428 | |||
| 1763 | Ga0501044_0043264 | |||
| 1764 | Ga0501044_0043882 | |||
| 1765 | Ga0501044_0044832 | |||
| 1766 | Ga0501044_0072449 | |||
| 1767 | Ga0501044_0177814 | |||
| 1768 | Ga0501044_0222222 | |||
| 1769 | Ga0501044_0245096 | |||
| 1770 | Ga0501044_0255665 | |||
| 1771 | Ga0501044_0336315 | |||
| 1772 | Ga0501045_0007978 | |||
| 1773 | Ga0501045_0191335 | |||
| 1774 | nmdc:mga03683_7659_c1 | |||
| 1775 | nmdc:mga03n38_9312_c1 | |||
| 1776 | nmdc:mga0yw44_219775_c1 | |||
| 1777 | nmdc:mga0yw44_32262_c1 | |||
| 1778 | nmdc:mga0yw44_95771_c1 | |||
| 1779 | nmdc:mga0yw44_9790_c1 | |||
| 1780 | nmdc:mga06z11_124599_c1 | |||
| 1781 | nmdc:mga06z11_137634_c1 | |||
| 1782 | nmdc:mga04h51_35256_c1 | |||
| 1783 | nmdc:mga05p37_16081_c1 | |||
| 1784 | nmdc:mga09592_314902_c1 | |||
| 1785 | nmdc:mga06r32_553745_c1 | |||
| 1786 | nmdc:mga08y16_144371_c1 | |||
| 1787 | nmdc:mga0n895_152422_c1 | |||
| 1788 | Ga0495612_0028966 | |||
| 1789 | Ga0495612_0072861 | |||
| 1790 | Ga0500610_0030879 | |||
| 1791 | Ga0500635_0003040 | |||
| 1792 | Ga0495655_0034272 | |||
| 1793 | Ga0495619_0046133 | |||
| 1794 | Ga0500583_0093219 | |||
| 1795 | Ga0500641_0000965 | |||
| 1796 | Ga0500650_0121401 | |||
| 1797 | Ga0500554_003388 | |||
| 1798 | Ga0500595_003756 | |||
| 1799 | Ga0500595_016614 | |||
| 1800 | Ga0500595_031129 | |||
| 1801 | Ga0500595_066540 | |||
| 1802 | Ga0500559_0173651 | |||
| 1803 | Ga0500568_0014496 | |||
| 1804 | Ga0500573_0003712 | |||
| 1805 | Ga0500573_0007019 | |||
| 1806 | Ga0500577_0000509 | |||
| 1807 | Ga0500603_000410 | |||
| 1808 | Ga0500604_0011263 | |||
| 1809 | Ga0500616_0001510 | |||
| 1810 | Ga0500627_0029275 | |||
| 1811 | Ga0500627_0076537 | |||
| 1812 | Ga0500627_0077622 | |||
| 1813 | Ga0500636_0014172 | |||
| 1814 | Ga0500636_0162871 | |||
| 1815 | Ga0500637_0003231 | |||
| 1816 | Ga0500567_126883 | |||
| 1817 | Ga0501084_0008623 | |||
| 1818 | Ga0501084_0101726 | |||
| 1819 | Ga0501082_0018579 | |||
| 1820 | Ga0501082_0018837 | |||
| 1821 | Ga0501082_0027092 | |||
| 1822 | 2503201530 | |||
| 1823 | 2509113134 | |||
| 1824 | 2509143302 | |||
| 1825 | 2509396311 | |||
| 1826 | 2512931500 | |||
| 1827 | 2512959331 | |||
| 1828 | 2513612723 | |||
| 1829 | 2514420883 | |||
| 1830 | 2588517337 | |||
| 1831 | 2597813225 | |||
| 1832 | 2599936752 | |||
| 1833 | 2643771110 | |||
| 1834 | 2643776113 | |||
| 1835 | 2643794560 | |||
| 1836 | 2643840019 | |||
| 1837 | 2643984399 | |||
| 1838 | 2644109177 | |||
| 1839 | 2644151699 | |||
| 1840 | 2644153256 | |||
| 1841 | 2644311833 | |||
| 1842 | 2644330105 | |||
| 1843 | 2644543141 | |||
| 1844 | 2644617631 | |||
| 1845 | 2688598447 | |||
| 1846 | 2694631074 | |||
| 1847 | 2694636428 | |||
| 1848 | 2723575380 | |||
| 1849 | 2739307168 | |||
| 1850 | 2756675469 | |||
| 1851 | 2792749237 | |||
| 1852 | 2793283387 | |||
| 1853 | 2819242803 | |||
| 1854 | 2841739198 | |||
| 1855 | 2844007426 | |||
| 1856 | 2844163812 | |||
| 1857 | 2847675614 | |||
| 1858 | 2847692258 | |||
| 1859 | 2856319501 | |||
| 1860 | 2856327481 | |||
| 1861 | 2856334567 | |||
| 1862 | 2856340888 | |||
| 1863 | 2856344937 | |||
| 1864 | 2856352442 | |||
| 1865 | 2856358597 | |||
| 1866 | 2856369460 | |||
| 1867 | 2857351152 | |||
| 1868 | 2857371324 | |||
| 1869 | 2869169292 | |||
| 1870 | 2869172867 | |||
| 1871 | 2869237208 | |||
| 1872 | 2869244702 | |||
| 1873 | 2869253111 | |||
| 1874 | 2869260294 | |||
| 1875 | 2869272228 | |||
| 1876 | 2869284931 | |||
| 1877 | 2869286466 | |||
| 1878 | 2871434619 | |||
| 1879 | 2871442679 | |||
| 1880 | 2871444179 | |||
| 1881 | 2871457891 | |||
| 1882 | 2871462731 | |||
| 1883 | 2871469824 | |||
| 1884 | 2871475707 | |||
| 1885 | 2871494542 | |||
| 1886 | 2871501396 | |||
| 1887 | 2874103728 | |||
| 1888 | 2874112353 | |||
| 1889 | 2874122671 | |||
| 1890 | 2874132088 | |||
| 1891 | 2874145874 | |||
| 1892 | 2874149825 | |||
| 1893 | 2874158083 | |||
| 1894 | 2874168250 | |||
| 1895 | 2874169856 | |||
| 1896 | 2876368481 | |||
| 1897 | 2876380336 | |||
| 1898 | 2876386707 | |||
| 1899 | 2876398442 | |||
| 1900 | 2876400211 | |||
| 1901 | 2876409301 | |||
| 1902 | 2876416287 | |||
| 1903 | 2876422997 | |||
| 1904 | 2878040736 | |||
| 1905 | 2878731753 | |||
| 1906 | 2878745213 | |||
| 1907 | 2878751752 | |||
| 1908 | 2878758876 | |||
| 1909 | 2878765376 | |||
| 1910 | 2878773084 | |||
| 1911 | 2878777093 | |||
| 1912 | 2878784539 | |||
| 1913 | 2878793925 | |||
| 1914 | 2881151331 | |||
| 1915 | 2881155307 | |||
| 1916 | 2881167532 | |||
| 1917 | 2881853101 | |||
| 1918 | 2881853708 | |||
| 1919 | 2881867312 | |||
| 1920 | 2882636276 | |||
| 1921 | 2882912561 | |||
| 1922 | 2885309434 | |||
| 1923 | 2885317988 | |||
| 1924 | 2885323699 | |||
| 1925 | 2885330373 | |||
| 1926 | 2885337499 | |||
| 1927 | 2885356697 | |||
| 1928 | 2888339424 | |||
| 1929 | 2888346815 | |||
| 1930 | 2888355760 | |||
| 1931 | 2889017606 | |||
| 1932 | 2891376482 | |||
| 1933 | 2903451313 | |||
| 1934 | 2903503885 | |||
| 1935 | 2903504698 | |||
| 1936 | 2903527480 | |||
| 1937 | 2903533934 | |||
| 1938 | 2903546207 | |||
| 1939 | 2904664997 | |||
| 1940 | 2906314150 | |||
| 1941 | 2906327316 | |||
| 1942 | 2906330005 | |||
| 1943 | 2906360846 | |||
| 1944 | 2906366766 | |||
| 1945 | 2906372607 | |||
| 1946 | 2906387985 | |||
| 1947 | 2906405393 | |||
| 1948 | 2906408906 | |||
| 1949 | 2906420221 | |||
| 1950 | 2906432767 | |||
| 1951 | 2922134343 | |||
| 1952 | 2922152073 | |||
| 1953 | 2922162838 | |||
| 1954 | 2922178286 | |||
| 1955 | 2922188795 | |||
| 1956 | 2924715699 | |||
| 1957 | 2924728241 | |||
| 1958 | 2924743494 | |||
| 1959 | 2924764249 | |||
| 1960 | 2924783350 | |||
| 1961 | 2924789080 | |||
| 1962 | 2937815739 | |||
| 1963 | 2937824460 | |||
| 1964 | 2937839387 | |||
| 1965 | 2937862769 | |||
| 1966 | 2937870538 | |||
| 1967 | 2937882123 | |||
| 1968 | 2937896290 | |||
| 1969 | 2937978583 | |||
| 1970 | 2937988152 | |||
| 1971 | 2938000065 | |||
| 1972 | 2938022088 | |||
| 1973 | 2941500403 | |||
| 1974 | 2958040633 | |||
| 1975 | 2958056715 | |||
| 1976 | 2958057848 | |||
| 1977 | 2958064376 | |||
| 1978 | 2958089245 | |||
| 1979 | 2958096506 | |||
| 1980 | 2958105745 | |||
| 1981 | 2958111520 | |||
| 1982 | 2958118462 | |||
| 1983 | 2958125424 | |||
| 1984 | 2958130869 | |||
| 1985 | 2958138000 | |||
| 1986 | 2958146136 | |||
| 1987 | 2958170529 | |||
| 1988 | 2958173532 | |||
| 1989 | 2958184790 | |||
| 1990 | 2961082957 | |||
| 1991 | 2961119996 | |||
| 1992 | 2961131611 | |||
| 1993 | 2961138713 | |||
| 1994 | 2961168984 | |||
| 1995 | 2961176045 | |||
| 1996 | 2961185945 | |||
| 1997 | 2963647712 | |||
| 1998 | 2965024271 | |||
| 1999 | 2965031751 | |||
| 2000 | 2965038127 | |||
| 2001 | 2965045713 | |||
| 2002 | 2965051618 | |||
| 2003 | 2965066005 | |||
| 2004 | 2965094258 | |||
| 2005 | 2965108624 | |||
| 2006 | 2965117254 | |||
| 2007 | 2965122060 | |||
| 2008 | 2968001933 | |||
| 2009 | 2968009043 | |||
| 2010 | 2968018450 | |||
| 2011 | 2968090343 | |||
| 2012 | 2968096367 | |||
| 2013 | 2968098868 | |||
| 2014 | 2968116353 | |||
| 2015 | 2968120634 | |||
| 2016 | 2968129186 | |||
| 2017 | 2968138942 | |||
| 2018 | 2968177378 | |||
| 2019 | 2970471377 | |||
| 2020 | 2970491115 | |||
| 2021 | 2970508711 | |||
| 2022 | 2970514623 | |||
| 2023 | 2970528594 | |||
| 2024 | 2970539979 | |||
| 2025 | 2970544790 | |||
| 2026 | 2970552022 | |||
| 2027 | 2970560224 | |||
| 2028 | 2970599546 | |||
| 2029 | 2970620844 | |||
| 2030 | 2970628904 | |||
| 2031 | 2977827416 | |||
| 2032 | 2977830951 | |||
| 2033 | 2977845975 | |||
| 2034 | 2977854377 | |||
| 2035 | 2977859278 | |||
| 2036 | 2977867086 | |||
| 2037 | 2977875258 | |||
| 2038 | 2977904373 | |||
| 2039 | 2977911338 | |||
| 2040 | 2977924221 | |||
| 2041 | 2977941199 | |||
| 2042 | 2977942749 | |||
| 2043 | 2977957853 | |||
| 2044 | 2977974520 | |||
| 2045 | 2979717543 | |||
| 2046 | 2979766235 | |||
| 2047 | 2979774491 | |||
| 2048 | 2979781283 | |||
| 2049 | 2979796344 | |||
| 2050 | 2979811641 | |||
| 2051 | 2987638336 | |||
| 2052 | 2987645776 | |||
| 2053 | 2987654659 | |||
| 2054 | 2987665015 | |||
| 2055 | 2987669244 | |||
| 2056 | 2987676017 | |||
| 2057 | 2989355156 | |||
| 2058 | 2989775377 | |||
| 2059 | 2996314074 | |||
| 2060 | 2996345072 | |||
| 2061 | 2996350169 | |||
| 2062 | 2996391443 | |||
| 2063 | 3000140661 | |||
| 2064 | 3004168902 | |||
| 2065 | 3004194072 | |||
| 2066 | 3004196256 | |||
| 2067 | 3004205420 | |||
| 2068 | 3004215956 | |||
| 2069 | 3004223706 | |||
| 2070 | 3004235837 | |||
| 2071 | 3004246437 | |||
| 2072 | 3004254705 | |||
| 2073 | 3004274946 | |||
| 2074 | 3004276868 | |||
| 2075 | 3004290898 | |||
| 2076 | 3004334356 | |||
| 2077 | 637074599 | |||
| 2078 | 649872973 | |||
| 2079 | 8002289041 | |||
| 2080 | 8004301043 | |||
| 2081 | 8004314009 | |||
| 2082 | 8004365134 | |||
| 2083 | 8004380397 | |||
| 2084 | 8004393640 | |||
| 2085 | 8004402716 | |||
| 2086 | 8004450199 | |||
| 2087 | 8004634825 | |||
| 2088 | 8004640821 | |||
| 2089 | 8004703603 | |||
| 2090 | 8004709364 | |||
| 2091 | 8004720408 | |||
| 2092 | 8005246851 | |||
| 2093 | 8054560085 | |||
| 2094 | 8055620777 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p35-assembly1.cif.gz_B | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.9774 | 14 | 256 |
| 2p35-assembly1.cif.gz_B | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.9655 | 14 | 256 |
| 2p35-assembly1.cif.gz_A | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.9436 | 7 | 256 |
| 2p35-assembly1.cif.gz_A | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.9323 | 7 | 256 |
| 7phf-assembly2.cif.gz_D | chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk | 0.8502 | 33 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p35B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9736 | 14 | 256 | 3.40.50.150 |
| 2p35B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9563 | 14 | 256 | 3.40.50.150 |
| af_A0A0R0HV62_55_242_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8835 | 20 | 131 | 3.40.50.150 |
| af_K7KE15_1_124_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8668 | 20 | 130 | 3.40.50.150 |
| af_P9WK03_7_174_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.863 | 16 | 128 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A428QU34-F1-model_v4 | Methyltransferase domain-containing protein | 0.9775 | 2 | 256 |
GO:0030798
GO:0032259 |
| AF-A0A0A1SRF0-F1-model_v4 | Methyltransferase domain-containing protein | 0.9764 | 1 | 256 |
GO:0030798
GO:0032259 |
| AF-A0A526YVL1-F1-model_v4 | Methyltransferase domain-containing protein | 0.9737 | 62 | 256 |
GO:0030798
GO:0032259 |
| AF-A0A0Q8BKD9-F1-model_v4 | deleted | 0.9733 | 1 | 256 |
|
| AF-A0A0A1SRF0-F1-model_v4 | Methyltransferase domain-containing protein | 0.9726 | 1 | 256 |
GO:0030798
GO:0032259 |