F488986

General Info

Members Datasets Scaffolds Average Seq Length
1047 586 2094 254

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0121404|Ga0501035_0121404_1111_2031
Length 306
Sequence MRYFASWGSGFSDSAKSVASQTRSAGSDYALDRAGKWDDGRQSDCHDAGSDMADWSATQYLKFEDERTRPARDLLAQVPVAEPKRVVDIGCGPGNSTELLVARWPEAQVSGFDTSPDMIDKARKRLPAVHFELADAEGWMPAQPVDVIFANAVFQWLPRHQAVFRRLMGLLAPGGALAVQMPDNLAEPSHRLMRETAADMPFTEKLKGAARAPLPPVSSYYDLLRPLSARVDIWHTHYYHPLADAVAIVEWVKSTGLKPFLDPLEEEERREFLDRYTARIADTYPPAADGKVLLKFPRLFIVATKG

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
295 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
301 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
306 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
307 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
313 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
317 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
318 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
319 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
320 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
321 2512875024
322 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
323 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
324 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
325 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
326 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
327 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
328 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
329 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
330 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
331 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
332 2643221618 Ensifer sp. Root231 Isolate Unclassified
333 2643221626 Ensifer sp. Root31 Isolate Unclassified
334 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
335 2643221655 Ensifer sp. Root1252 Isolate Unclassified
336 2643221659 Ensifer sp. Root127 Isolate Unclassified
337 2643221698 Ensifer sp. Root142 Isolate Unclassified
338 2643221712 Ensifer sp. Root258 Isolate Unclassified
339 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
340 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
341 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
342 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
343 2738543024 Aminobacter sp. AP02 Isolate Unclassified
344 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
345 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
346 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
347 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
348 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
349 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
350 2844163670 Ensifer sp. 1H6 Isolate Unclassified
351 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
352 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
353 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
354 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
355 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
356 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
357 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
358 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
359 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
360 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
361 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
362 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
363 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
364 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
365 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
366 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
367 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
368 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
369 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
370 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
371 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
372 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
373 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
374 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
375 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
376 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
377 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
378 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
379 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
380 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
381 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
382 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
383 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
384 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
385 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
386 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
387 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
388 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
389 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
390 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
391 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
392 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
393 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
394 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
395 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
396 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
397 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
398 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
399 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
400 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
401 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
402 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
403 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
404 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
405 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
406 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
407 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
408 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
409 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
410 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
411 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
412 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
413 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
414 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
415 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
416 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
417 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
418 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
419 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
420 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
421 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
422 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
423 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
424 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
425 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
426 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
427 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
428 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
429 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
430 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
431 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
432 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
433 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
434 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
435 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
436 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
437 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
438 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
439 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
440 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
441 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
442 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
443 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
444 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
445 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
446 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
447 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
448 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
449 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
450 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
451 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
452 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
453 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
454 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
455 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
456 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
457 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
458 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
459 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
460 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
461 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
462 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
463 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
464 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
465 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
466 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
467 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
468 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
469 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
470 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
471 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
472 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
473 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
474 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
475 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
476 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
477 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
478 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
479 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
480 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
481 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
482 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
483 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
484 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
485 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
486 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
487 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
488 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
489 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
490 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
491 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
492 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
493 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
494 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
495 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
496 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
497 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
498 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
499 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
500 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
501 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
502 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
503 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
504 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
505 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
506 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
507 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
508 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
509 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
510 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
511 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
512 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
513 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
514 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
515 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
516 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
517 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
518 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
519 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
520 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
521 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
522 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
523 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
524 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
525 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
526 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
527 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
528 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
529 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
530 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
531 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
532 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
533 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
534 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
535 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
536 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
537 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
538 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
539 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
540 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
541 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
542 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
543 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
544 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
545 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
546 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
547 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
548 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
549 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
550 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
551 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
552 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
553 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
554 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
555 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
556 3004167301 Mesorhizobium loti 582 Isolate Unclassified
557 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
558 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
559 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
560 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
561 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
562 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
563 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
564 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
565 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
566 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
567 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
568 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
569 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
570 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
571 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
572 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
573 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
574 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
575 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
576 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
577 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
578 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
579 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
580 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
581 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
582 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
583 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
584 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
585 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
586 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.83
Metatranscriptomes 0.1
Isolates 26.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 21.68
Rhizoplane 2.77
Rhizosphere 61.6
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0121404 3300049822 Bacteria 2284
2 JGI24737J22298_10002261 3300001990 Bacteria 6862
3 JGI24735J21928_10007364 3300002067 Bacteria 3592
4 JGI25406J46586_10001817 3300003203 Bacteria 10016
5 Ga0055542_1000986 3300003762 Bacteria 18435
6 Ga0055528_1007052 3300003790 Eukaryota 5022
7 Ga0070683_100326147 3300005329 Bacteria 1462
8 Ga0070670_100008351 3300005331 Bacteria 8827
9 Ga0070680_100063778 3300005336 Bacteria 3019
10 Ga0070680_100106225 3300005336 Bacteria 2334
11 Ga0070680_100285748 3300005336 Bacteria 1398
12 Ga0070682_100046685 3300005337 Bacteria 2689
13 Ga0070661_100227053 3300005344 Bacteria 1434
14 Ga0070661_100570677 3300005344 Bacteria 912
15 Ga0070659_100089890 3300005366 Bacteria 2460
16 Ga0070659_100123154 3300005366 Bacteria 2102
17 Ga0070659_100298918 3300005366 Bacteria 1342
18 Ga0070667_100348700 3300005367 Bacteria 1340
19 Ga0070709_10008945 3300005434 Bacteria 5513
20 Ga0070709_10025287 3300005434 Bacteria 3507
21 Ga0070709_10104679 3300005434 Bacteria 1891
22 Ga0070709_10224734 3300005434 Bacteria 1340
23 Ga0070709_10286081 3300005434 Bacteria 1200
24 Ga0070714_100021907 3300005435 Bacteria 5232
25 Ga0070713_100045619 3300005436 Bacteria 3593
26 Ga0070710_10000417 3300005437 Bacteria 19992
27 Ga0070710_10118230 3300005437 Bacteria 1601
28 Ga0070711_100003647 3300005439 Bacteria 8999
29 Ga0070711_100122213 3300005439 Bacteria 1928
30 Ga0070663_100013308 3300005455 Bacteria 5241
31 Ga0070663_100014776 3300005455 Bacteria 5019
32 Ga0070662_100008152 3300005457 Bacteria 6825
33 Ga0070681_10022697 3300005458 Bacteria 6305
34 Ga0070681_10134356 3300005458 Bacteria 2405
35 Ga0070681_10244274 3300005458 Bacteria 1708
36 Ga0070681_10278429 3300005458 Bacteria 1584
37 Ga0070679_100019564 3300005530 Bacteria 6587
38 Ga0070679_100070219 3300005530 Bacteria 3495
39 Ga0070679_100137818 3300005530 Bacteria 2421
40 Ga0070684_100007976 3300005535 Bacteria 8266
41 Ga0070684_100086636 3300005535 Bacteria 2780
42 Ga0068853_100022093 3300005539 Bacteria 5309
43 Ga0068853_100024626 3300005539 Bacteria 5048
44 Ga0068853_100031106 3300005539 Bacteria 4513
45 Ga0068853_100095964 3300005539 Bacteria 2615
46 Ga0068853_100158998 3300005539 Bacteria 2037
47 Ga0070693_100172819 3300005547 Bacteria 1385
48 Ga0070693_100301259 3300005547 Bacteria 1081
49 Ga0070665_100082332 3300005548 Bacteria 3223
50 Ga0070665_100146315 3300005548 Bacteria 2366
51 Ga0068855_100018872 3300005563 Bacteria 8290
52 Ga0068855_100078782 3300005563 Bacteria 3822
53 Ga0068855_100285170 3300005563 Bacteria 1832
54 Ga0068855_100482265 3300005563 Bacteria 1349
55 Ga0068857_100003393 3300005577 Bacteria 13264
56 Ga0068857_100016795 3300005577 Bacteria 6412
57 Ga0068854_100026994 3300005578 Bacteria 3952
58 Ga0068854_100179605 3300005578 Bacteria 1653
59 Ga0068854_100185865 3300005578 Bacteria 1626
60 Ga0068856_100002827 3300005614 Bacteria 17773
61 Ga0068856_100016560 3300005614 Bacteria 7135
62 Ga0068856_100175169 3300005614 Bacteria 2157
63 Ga0068852_100137192 3300005616 Bacteria 2259
64 Ga0068852_100293120 3300005616 Bacteria 1572
65 Ga0068864_100500101 3300005618 Unclassified 1169
66 Ga0068851_10001384 3300005834 Bacteria 10587
67 Ga0068862_100451139 3300005844 Bacteria 1212
68 Ga0081539_10003450 3300005985 Bacteria 19403
69 Ga0070717_10275568 3300006028 Bacteria 1491
70 Ga0075365_10007012 3300006038 Bacteria 6270
71 Ga0075365_10121498 3300006038 Bacteria 1802
72 Ga0075365_10192221 3300006038 Bacteria 1428
73 Ga0075363_100124524 3300006048 Bacteria 1442
74 Ga0070715_10015227 3300006163 Bacteria 2863
75 Ga0070716_100004688 3300006173 Bacteria 6556
76 Ga0070716_100137540 3300006173 Bacteria 1553
77 Ga0075367_10152218 3300006178 Bacteria 1436
78 Ga0075369_10021673 3300006186 Bacteria 2643
79 Ga0075369_10049536 3300006186 Bacteria 1815
80 Ga0068871_100496554 3300006358 Bacteria 1099
81 Ga0075428_100008942 3300006844 Bacteria 11115
82 Ga0075431_100342205 3300006847 Bacteria 1505
83 Ga0075429_100231393 3300006880 Bacteria 1619
84 Ga0068865_100415313 3300006881 Bacteria 1105
85 Ga0099794_10005752 3300007265 Bacteria 4997
86 Ga0099794_10186145 3300007265 Bacteria 1061
87 Ga0099795_10004056 3300007788 Bacteria 3728
88 Ga0105240_10012741 3300009093 Bacteria 11589
89 Ga0105240_10039036 3300009093 Bacteria 6083
90 Ga0105240_10064831 3300009093 Bacteria 4538
91 Ga0105240_10195546 3300009093 Bacteria 2375
92 Ga0111539_10070035 3300009094 Bacteria 4140
93 Ga0114129_10004474 3300009147 Bacteria 19707
94 Ga0105243_10340825 3300009148 Bacteria 1373
95 Ga0105241_10002223 3300009174 Bacteria 14590
96 Ga0105237_10024483 3300009545 Bacteria 6175
97 Ga0105237_10046007 3300009545 Bacteria 4391
98 Ga0105237_10402357 3300009545 Bacteria 1374
99 Ga0105238_10005872 3300009551 Bacteria 12161
100 Ga0105238_10009265 3300009551 Bacteria 9853
101 Ga0105238_10026487 3300009551 Bacteria 5912
102 Ga0105238_10105708 3300009551 Bacteria 2797
103 Ga0105238_10447731 3300009551 Bacteria 1288
104 Ga0105238_10455735 3300009551 Bacteria 1276
105 Ga0099796_10012686 3300010159 Bacteria 2387
106 Ga0099796_10080751 3300010159 Bacteria 1192
107 Ga0105239_10006765 3300010375 Bacteria 13236
108 Ga0105239_10014460 3300010375 Bacteria 8758
109 Ga0105239_10022601 3300010375 Bacteria 6933
110 Ga0105239_10344869 3300010375 Bacteria 1681
111 Ga0105246_10039432 3300011119 Bacteria 3182
112 Ga0157371_10025461 3300013102 Bacteria 4312
113 Ga0157370_10138591 3300013104 Bacteria 2267
114 Ga0157370_10278531 3300013104 Bacteria 1545
115 Ga0157369_10017756 3300013105 Bacteria 7989
116 Ga0157374_10070061 3300013296 Bacteria 3303
117 Ga0163162_10637225 3300013306 Bacteria 1190
118 Ga0157372_10095195 3300013307 Bacteria 3392
119 Ga0157372_10419084 3300013307 Bacteria 1560
120 Ga0163163_10008704 3300014325 Bacteria 9027
121 Ga0182008_10019310 3300014497 Bacteria 3519
122 Ga0163161_10318736 3300017792 Bacteria 1228
123 Ga0206356_11139929 3300020070 Bacteria 1840
124 Ga0213873_10002325 3300021358 Bacteria 3280
125 Ga0213876_10067483 3300021384 Bacteria 1889
126 Ga0213875_10000036 3300021388 Bacteria 166707
127 Ga0209026_1000025 3300025250 Bacteria 352548
128 Ga0209677_114036 3300025253 Bacteria 1111
129 Ga0209148_1000181 3300025254 Bacteria 124691
130 Ga0209759_1000121 3300025256 Bacteria 138469
131 Ga0209455_1000127 3300025272 Bacteria 162518
132 Ga0209673_1000457 3300025273 Eukaryota 69083
133 Ga0209025_1000165 3300025294 Bacteria 164692
134 Ga0209564_1001849 3300025295 Bacteria 19271
135 Ga0209758_1000005 3300025297 Bacteria 1368918
136 Ga0209758_1010358 3300025297 Bacteria 5593
137 Ga0209050_1001615 3300025298 Bacteria 23174
138 Ga0209051_1025118 3300025303 Bacteria 2433
139 Ga0209257_1000303 3300025304 Bacteria 107862
140 Ga0209257_1025954 3300025304 Bacteria 1988
141 Ga0207692_10058908 3300025898 Bacteria 1981
142 Ga0207692_10104911 3300025898 Bacteria 1558
143 Ga0207647_10001898 3300025904 Bacteria 16019
144 Ga0207647_10210891 3300025904 Bacteria 1122
145 Ga0207685_10037457 3300025905 Bacteria 1786
146 Ga0207699_10000473 3300025906 Bacteria 20435
147 Ga0207699_10005645 3300025906 Bacteria 6006
148 Ga0207699_10069035 3300025906 Bacteria 2153
149 Ga0207699_10080453 3300025906 Bacteria 2019
150 Ga0207699_10301521 3300025906 Bacteria 1119
151 Ga0207654_10000317 3300025911 Bacteria 28925
152 Ga0207654_10274339 3300025911 Bacteria 1139
153 Ga0207707_10000505 3300025912 Bacteria 40031
154 Ga0207707_10005928 3300025912 Bacteria 10692
155 Ga0207707_10154019 3300025912 Bacteria 2010
156 Ga0207707_10514845 3300025912 Bacteria 1019
157 Ga0207695_10000713 3300025913 Bacteria 64808
158 Ga0207695_10394346 3300025913 Bacteria 1269
159 Ga0207695_10439169 3300025913 Bacteria 1189
160 Ga0207695_10618729 3300025913 Bacteria 964
161 Ga0207671_10010503 3300025914 Bacteria 7634
162 Ga0207671_10122066 3300025914 Bacteria 1992
163 Ga0207671_10241384 3300025914 Bacteria 1419
164 Ga0207693_10275029 3300025915 Bacteria 1319
165 Ga0207663_10017841 3300025916 Bacteria 3964
166 Ga0207663_10029578 3300025916 Bacteria 3220
167 Ga0207660_10372899 3300025917 Bacteria 1146
168 Ga0207657_10121530 3300025919 Bacteria 2149
169 Ga0207652_10026858 3300025921 Bacteria 4797
170 Ga0207652_10036599 3300025921 Bacteria 4149
171 Ga0207652_10053469 3300025921 Bacteria 3469
172 Ga0207652_10216309 3300025921 Bacteria 1726
173 Ga0207652_10231332 3300025921 Bacteria 1666
174 Ga0207694_10000155 3300025924 Bacteria 70678
175 Ga0207694_10003031 3300025924 Bacteria 13465
176 Ga0207694_10028952 3300025924 Bacteria 4224
177 Ga0207694_10035867 3300025924 Bacteria 3804
178 Ga0207694_10099055 3300025924 Bacteria 2309
179 Ga0207650_10012045 3300025925 Bacteria 5961
180 Ga0207700_10038473 3300025928 Bacteria 3472
181 Ga0207700_10062898 3300025928 Bacteria 2820
182 Ga0207700_10128764 3300025928 Bacteria 2063
183 Ga0207664_10009878 3300025929 Bacteria 6719
184 Ga0207664_10028623 3300025929 Bacteria 4236
185 Ga0207664_10336209 3300025929 Bacteria 1335
186 Ga0207690_10252679 3300025932 Bacteria 1362
187 Ga0207706_10049641 3300025933 Bacteria 3708
188 Ga0207706_10170757 3300025933 Bacteria 1911
189 Ga0207704_10354894 3300025938 Bacteria 1143
190 Ga0207665_10013789 3300025939 Bacteria 5316
191 Ga0207667_10016768 3300025949 Bacteria 8265
192 Ga0207667_10026865 3300025949 Bacteria 6281
193 Ga0207667_10133139 3300025949 Bacteria 2561
194 Ga0207712_10061145 3300025961 Bacteria 2672
195 Ga0207640_10002792 3300025981 Bacteria 9367
196 Ga0207640_10074759 3300025981 Bacteria 2294
197 Ga0207658_10298843 3300025986 Bacteria 1386
198 Ga0207658_10316007 3300025986 Bacteria 1351
199 Ga0207639_10003685 3300026041 Bacteria 10298
200 Ga0207639_10019633 3300026041 Bacteria 4823
201 Ga0207639_10255061 3300026041 Bacteria 1531
202 Ga0207678_10032286 3300026067 Bacteria 4562
203 Ga0207678_10037450 3300026067 Bacteria 4218
204 Ga0207678_10039836 3300026067 Bacteria 4076
205 Ga0207702_10000022 3300026078 Bacteria 192961
206 Ga0207702_10003504 3300026078 Bacteria 14307
207 Ga0207702_10633332 3300026078 Bacteria 1051
208 Ga0207648_10160854 3300026089 Bacteria 1983
209 Ga0207676_10588552 3300026095 Unclassified 1067
210 Ga0207698_10370677 3300026142 Bacteria 1359
211 Ga0209588_1000792 3300027671 Bacteria 8037
212 Ga0209588_1002811 3300027671 Bacteria 4768
213 Ga0209588_1071906 3300027671 Bacteria 1117
214 Ga0209813_10025213 3300027866 Bacteria 1708
215 Ga0268266_10013179 3300028379 Bacteria 7130
216 Ga0268266_10031714 3300028379 Bacteria 4489
217 Ga0268265_10008367 3300028380 Bacteria 6985
218 Ga0265319_1022836 3300028563 Bacteria 2273
219 Ga0265318_10000680 3300028577 Bacteria 23043
220 Ga0265318_10062432 3300028577 Bacteria 1387
221 Ga0307515_10000420 3300028794 Bacteria 102216
222 Ga0265330_10053739 3300031235 Bacteria 1762
223 Ga0265325_10000869 3300031241 Bacteria 21778
224 Ga0265325_10030653 3300031241 Bacteria 2882
225 Ga0265325_10106323 3300031241 Bacteria 1368
226 Ga0265340_10001284 3300031247 Bacteria 14403
227 Ga0265340_10007346 3300031247 Bacteria 5987
228 Ga0265340_10047670 3300031247 Bacteria 2085
229 Ga0265339_10002241 3300031249 Bacteria 13980
230 Ga0265339_10036911 3300031249 Bacteria 2732
231 Ga0265339_10171239 3300031249 Bacteria 1086
232 Ga0265331_10030152 3300031250 Bacteria 2702
233 Ga0265316_10004479 3300031344 Bacteria 13884
234 Ga0265316_10068620 3300031344 Bacteria 2738
235 Ga0265316_10376169 3300031344 Bacteria 1025
236 Ga0307513_10004196 3300031456 Bacteria 19276
237 Ga0265313_10000872 3300031595 Bacteria 30443
238 Ga0265313_10006312 3300031595 Bacteria 8440
239 Ga0265313_10077882 3300031595 Bacteria 1512
240 Ga0307508_10302973 3300031616 Bacteria 1191
241 Ga0265314_10005202 3300031711 Bacteria 11816
242 Ga0265314_10018990 3300031711 Bacteria 5334
243 Ga0265314_10279103 3300031711 Bacteria 946
244 Ga0265342_10058055 3300031712 Bacteria 2288
245 Ga0265342_10086906 3300031712 Bacteria 1797
246 Ga0265342_10212684 3300031712 Bacteria 1045
247 Ga0307416_100526101 3300032002 Bacteria 1252
248 Ga0307510_10039607 3300033180 Bacteria 5188
249 Ga0373923_0015582 3300035111 Bacteria 2872
250 Ga0373936_0040621 3300035113 Bacteria 1864
251 Ga0373936_0089581 3300035113 Bacteria 1289
252 Ga0373945_0010763 3300035116 Bacteria 3014
253 Ga0373953_0156086 3300035117 Bacteria 980
254 Ga0373954_0021500 3300035118 Bacteria 2922
255 Ga0373954_0098805 3300035118 Bacteria 1407
256 Ga0373957_0062499 3300035120 Bacteria 1445
257 Ga0373943_0002114 3300035170 Bacteria 9027
258 Ga0373946_0052621 3300035171 Bacteria 1708
259 Ga0373955_0136656 3300035172 Bacteria 1434
260 Ga0373924_0009305 3300035410 Bacteria 3598
261 Ga0373924_0073268 3300035410 Bacteria 1447
262 Ga0373935_0000660 3300035692 Bacteria 18207
263 Ga0373935_0075583 3300035692 Bacteria 2179
264 Ga0373927_0006115 3300035695 Bacteria 8242
265 Ga0373927_0119546 3300035695 Bacteria 1719
266 Ga0373927_0138205 3300035695 Bacteria 1593
267 Ga0373933_0152369 3300035724 Bacteria 1464
268 Ga0373933_0277406 3300035724 Bacteria 1083
269 Ga0373947_0001631 3300035725 Bacteria 13762
270 Ga0373947_0023727 3300035725 Bacteria 3570
271 Ga0373947_0151341 3300035725 Bacteria 1495
272 Ga0373925_0001524 3300037068 Bacteria 19779
273 Ga0373925_0163160 3300037068 Bacteria 1756
274 Ga0395899_0000117 3300037312 Bacteria 130159
275 Ga0395900_0000020 3300037418 Bacteria 353500
276 Ga0395900_0028714 3300037418 Bacteria 5702
277 Ga0395900_0065797 3300037418 Bacteria 3724
278 Ga0395900_0150361 3300037418 Bacteria 2379
279 Ga0395900_0342480 3300037418 Bacteria 1470
280 Ga0395900_0631503 3300037418 Bacteria 1009
281 Ga0395898_0000259 3300037466 Bacteria 130131
282 Ga0395898_0041398 3300037466 Bacteria 4551
283 Ga0395898_0097159 3300037466 Bacteria 2829
284 Ga0395898_0166073 3300037466 Bacteria 2111
285 Ga0395898_0383176 3300037466 Bacteria 1341
286 Ga0395898_0613319 3300037466 Bacteria 1031
287 Ga0395905_0000019 3300037471 Bacteria 353500
288 Ga0395905_0112114 3300037471 Bacteria 2561
289 Ga0395905_0160038 3300037471 Bacteria 2116
290 Ga0436364_0245439 3300037853 Bacteria 33775
291 Ga0436364_1071235 3300037853 Bacteria 1166
292 Ga0395901_0000016 3300038443 Bacteria 354008
293 Ga0395901_0027609 3300038443 Bacteria 5833
294 Ga0395901_0207606 3300038443 Bacteria 2051
295 Ga0395901_0279626 3300038443 Bacteria 1734
296 Ga0395901_0361372 3300038443 Bacteria 1497
297 Ga0395901_0460124 3300038443 Bacteria 1300
298 Ga0436365_0040457 3300039437 Bacteria 1404
299 Ga0436365_0179006 3300039437 Bacteria 2423
300 Ga0436365_0928236 3300039437 Bacteria 1560
301 Ga0436365_0959977 3300039437 Bacteria 23998
302 Ga0436365_1259906 3300039437 Bacteria 1920
303 Ga0436365_1681226 3300039437 Bacteria 1246
304 Ga0436360_0655288 3300039438 Bacteria 1674
305 Ga0436363_0945892 3300039450 Bacteria 889
306 Ga0436362_0631993 3300039453 Bacteria 4184
307 Ga0466969_0007887 3300044656 Bacteria 5652
308 Ga0466972_0033120 3300044658 Bacteria 2535
309 Ga0466966_0073582 3300044684 Bacteria 2136
310 Ga0466966_0186975 3300044684 Bacteria 1256
311 Ga0466961_0079695 3300044693 Bacteria 2073
312 Ga0466971_0034150 3300044719 Bacteria 2280
313 Ga0466970_0086840 3300044765 Bacteria 1696
314 Ga0466960_0026413 3300044901 Unclassified 2638
315 Ga0466959_0027484 3300045049 Bacteria 4220
316 Ga0466958_0169788 3300045836 Bacteria 1381
317 Ga0466967_0039398 3300045976 Bacteria 4062
318 Ga0495592_0011842 3300046454 Bacteria 6607
319 Ga0495592_0036626 3300046454 Eukaryota 3694
320 Ga0495603_0000155 3300046455 Bacteria 34390
321 Ga0495629_0001568 3300046459 Bacteria 17966
322 Ga0495629_0055389 3300046459 Eukaryota 2773
323 Ga0495641_0011193 3300046461 Bacteria 5133
324 Ga0495641_0012521 3300046461 Eukaryota 4736
325 Ga0495641_0014774 3300046461 Eukaryota 4210
326 Ga0495651_0018841 3300046462 Eukaryota 5346
327 Ga0495651_0266716 3300046462 Bacteria 1163
328 Ga0495653_0024094 3300046463 Eukaryota 4910
329 Ga0495580_0013322 3300046472 Bacteria 6283
330 Ga0495582_0000401 3300046473 Bacteria 23632
331 Ga0495639_0000146 3300046475 Bacteria 36496
332 Ga0495639_0043582 3300046475 Bacteria 2027
333 Ga0495639_0149143 3300046475 Bacteria 1127
334 Ga0495662_0000242 3300046476 Bacteria 23091
335 Ga0495662_0018902 3300046476 Bacteria 3335
336 Ga0495662_0165446 3300046476 Bacteria 1090
337 Ga0495664_0011226 3300046477 Bacteria 5046
338 Ga0495664_0024087 3300046477 Bacteria 3535
339 Ga0495664_0029291 3300046477 Bacteria 3218
340 Ga0495584_0012407 3300046491 Bacteria 4349
341 Ga0495594_0001113 3300046499 Bacteria 14042
342 Ga0495607_0046014 3300046501 Bacteria 2565
343 Ga0495608_0009795 3300046511 Eukaryota 6688
344 Ga0495608_0162938 3300046511 Bacteria 1417
345 Ga0495608_0485275 3300046511 Bacteria 749
346 Ga0495610_0137322 3300046512 Bacteria 1056
347 Ga0495618_0000589 3300046514 Eukaryota 25905
348 Ga0495618_0046370 3300046514 Eukaryota 2743
349 Ga0495618_0163683 3300046514 Bacteria 1417
350 Ga0495620_0021102 3300046515 Eukaryota 3168
351 Ga0495628_0077931 3300046516 Bacteria 2578
352 Ga0495628_0232250 3300046516 Bacteria 1382
353 Ga0495628_0240957 3300046516 Bacteria 1353
354 Ga0495630_0000634 3300046517 Bacteria 25446
355 Ga0495630_0009739 3300046517 Bacteria 6913
356 Ga0495630_0165218 3300046517 Eukaryota 1685
357 Ga0495630_0171772 3300046517 Bacteria 1652
358 Ga0495637_0045137 3300046520 Bacteria 1872
359 Ga0495644_0037671 3300046523 Bacteria 1825
360 Ga0495652_0001002 3300046529 Eukaryota 32338
361 Ga0495652_0016908 3300046529 Eukaryota 6518
362 Ga0495652_0026936 3300046529 Eukaryota 5070
363 Ga0495652_0037188 3300046529 Eukaryota 4225
364 Ga0495652_0054963 3300046529 Bacteria 3388
365 Ga0495652_0059829 3300046529 Bacteria 3222
366 Ga0495665_0000150 3300046531 Bacteria 34308
367 Ga0495665_0025824 3300046531 Bacteria 3154
368 Ga0495640_0004664 3300046533 Bacteria 10930
369 Ga0495640_0050622 3300046533 Bacteria 2861
370 Ga0495640_0225732 3300046533 Bacteria 1179
371 Ga0495586_0260769 3300046535 Bacteria 990
372 Ga0495621_0107948 3300046539 Bacteria 1065
373 Ga0495645_0003965 3300046543 Eukaryota 10092
374 Ga0495645_0089904 3300046543 Bacteria 2195
375 Ga0495645_0154783 3300046543 Eukaryota 1589
376 Ga0495645_0333635 3300046543 Bacteria 981
377 Ga0495622_0005717 3300046557 Bacteria 5767
378 Ga0495656_0006603 3300046615 Bacteria 4073
379 Ga0495634_0003138 3300046642 Bacteria 13406
380 Ga0495634_0003515 3300046642 Eukaryota 12551
381 Ga0495634_0124485 3300046642 Bacteria 1648
382 Ga0495625_0183588 3300046660 Bacteria 1389
383 Ga0495635_0000823 3300046663 Bacteria 20335
384 Ga0495635_0017735 3300046663 Bacteria 4972
385 Ga0495635_0038903 3300046663 Eukaryota 3293
386 Ga0495588_0029919 3300046674 Bacteria 2734
387 Ga0495657_0010790 3300046675 Eukaryota 6861
388 Ga0495599_0009593 3300046678 Eukaryota 5922
389 Ga0495623_0008876 3300046679 Eukaryota 6525
390 Ga0495646_0002238 3300046680 Eukaryota 11812
391 Ga0495647_0001777 3300046681 Bacteria 6690
392 Ga0495658_0044213 3300046683 Bacteria 2495
393 Ga0495613_0004476 3300046689 Bacteria 10468
394 Ga0495613_0074243 3300046689 Bacteria 2477
395 Ga0495624_0001759 3300046690 Eukaryota 16579
396 Ga0495624_0002699 3300046690 Bacteria 13343
397 Ga0495624_0003993 3300046690 Eukaryota 10856
398 Ga0495670_0080569 3300046691 Bacteria 1658
399 Ga0495671_0111227 3300046692 Bacteria 1338
400 Ga0495600_0181483 3300046809 Bacteria 1356
401 Ga0495600_0203706 3300046809 Eukaryota 1270
402 Ga0495600_0349818 3300046809 Bacteria 926
403 Ga0495581_0005294 3300047315 Bacteria 7464
404 Ga0495581_0040579 3300047315 Bacteria 2693
405 Ga0495581_0048716 3300047315 Bacteria 2446
406 Ga0495581_0135283 3300047315 Bacteria 1437
407 Ga0495604_0290819 3300047317 Eukaryota 1100
408 Ga0495674_0000447 3300047319 Eukaryota 37194
409 Ga0495674_0001343 3300047319 Bacteria 23998
410 Ga0495674_0458280 3300047319 Eukaryota 1024
411 Ga0495672_0019570 3300047320 Bacteria 4462
412 Ga0495672_0091653 3300047320 Bacteria 1668
413 Ga0495676_0001115 3300047321 Eukaryota 22776
414 Ga0495676_0005737 3300047321 Eukaryota 11382
415 Ga0495676_0052329 3300047321 Bacteria 3260
416 Ga0495676_0109929 3300047321 Bacteria 2024
417 Ga0495676_0234980 3300047321 Eukaryota 1257
418 Ga0495680_0214347 3300047322 Bacteria 1377
419 Ga0495675_0096316 3300047444 Eukaryota 1855
420 Ga0495673_0020830 3300047469 Bacteria 3255
421 Ga0495684_0008505 3300047471 Bacteria 7950
422 Ga0495684_0089421 3300047471 Bacteria 2333
423 Ga0495684_0381849 3300047471 Eukaryota 993
424 Ga0495686_0074618 3300047472 Bacteria 2081
425 Ga0495593_0000406 3300047673 Bacteria 23955
426 Ga0495593_0054266 3300047673 Bacteria 2113
427 Ga0495602_0005170 3300048088 Eukaryota 13673
428 Ga0495602_0012148 3300048088 Eukaryota 8867
429 Ga0495602_0017788 3300048088 Eukaryota 7116
430 Ga0495602_0025881 3300048088 Eukaryota 5670
431 Ga0495602_0153309 3300048088 Bacteria 1808
432 Ga0495614_0013877 3300048089 Bacteria 3531
433 Ga0495614_0103739 3300048089 Bacteria 1245
434 Ga0496100_0014292 3300048903 Bacteria 4606
435 Ga0496101_0408759 3300048904 Bacteria 1069
436 Ga0496102_0028833 3300048905 Bacteria 4962
437 Ga0496102_0096793 3300048905 Bacteria 2737
438 Ga0496102_0487748 3300048905 Bacteria 1154
439 Ga0496102_0622599 3300048905 Bacteria 1002
440 Ga0496103_0242699 3300048906 Bacteria 1159
441 Ga0496104_0000740 3300048907 Bacteria 28026
442 Ga0496104_0386621 3300048907 Bacteria 1312
443 Ga0496105_0018506 3300048908 Bacteria 5602
444 Ga0496106_0002088 3300048909 Bacteria 14981
445 Ga0496106_0110106 3300048909 Bacteria 2143
446 Ga0496107_0066849 3300048910 Bacteria 2607
447 Ga0496107_0081789 3300048910 Bacteria 2355
448 Ga0496108_0000449 3300048911 Bacteria 32814
449 Ga0496108_0001075 3300048911 Bacteria 21328
450 Ga0496109_0002544 3300048912 Bacteria 15291
451 Ga0496109_0004948 3300048912 Bacteria 11126
452 Ga0496109_0625840 3300048912 Bacteria 1013
453 Ga0496110_0008032 3300048913 Bacteria 8461
454 Ga0496110_0275443 3300048913 Bacteria 1532
455 Ga0496111_0033862 3300048914 Bacteria 3644
456 Ga0496111_0122137 3300048914 Bacteria 1924
457 Ga0496112_0006031 3300048915 Bacteria 10580
458 Ga0496112_0083677 3300048915 Bacteria 3156
459 Ga0496112_0231068 3300048915 Bacteria 1804
460 Ga0496113_0001942 3300048916 Bacteria 11836
461 Ga0496114_0458645 3300048917 Unclassified 1128
462 Ga0496116_0011742 3300048919 Bacteria 7216
463 Ga0496117_0002204 3300048920 Bacteria 25295
464 Ga0496117_0057126 3300048920 Bacteria 2713
465 Ga0496119_0019343 3300048922 Bacteria 5021
466 Ga0496119_0088747 3300048922 Bacteria 1762
467 Ga0496119_0132032 3300048922 Bacteria 1360
468 Ga0496119_0137958 3300048922 Bacteria 1320
469 Ga0496120_0003090 3300048923 Bacteria 15675
470 Ga0496120_0166544 3300048923 Bacteria 1094
471 Ga0496120_0177487 3300048923 Bacteria 1048
472 Ga0496121_0000500 3300048924 Bacteria 74914
473 Ga0496121_0001203 3300048924 Bacteria 45295
474 Ga0496121_0097616 3300048924 Bacteria 2276
475 Ga0496121_0107722 3300048924 Bacteria 2133
476 Ga0496121_0129673 3300048924 Bacteria 1890
477 Ga0496121_0315036 3300048924 Bacteria 1056
478 Ga0496122_0004346 3300048925 Bacteria 17714
479 Ga0496122_0042654 3300048925 Bacteria 3566
480 Ga0496122_0074967 3300048925 Bacteria 2390
481 Ga0496123_0000103 3300048926 Bacteria 168232
482 Ga0496123_0032651 3300048926 Bacteria 3763
483 Ga0496123_0097351 3300048926 Bacteria 1724
484 Ga0496124_0005072 3300048927 Bacteria 15019
485 Ga0496124_0057457 3300048927 Bacteria 3278
486 Ga0496125_0000154 3300048928 Bacteria 152240
487 Ga0496125_0000879 3300048928 Bacteria 47630
488 Ga0496125_0217618 3300048928 Bacteria 1234
489 Ga0496126_0001336 3300048929 Bacteria 39105
490 Ga0496126_0006815 3300048929 Bacteria 12673
491 Ga0496126_0012132 3300048929 Bacteria 8846
492 Ga0496126_0012891 3300048929 Bacteria 8539
493 Ga0496126_0050759 3300048929 Bacteria 3779
494 Ga0496126_0058933 3300048929 Bacteria 3460
495 Ga0496126_0100519 3300048929 Bacteria 2531
496 Ga0496126_0172975 3300048929 Bacteria 1839
497 Ga0496126_0197255 3300048929 Bacteria 1702
498 Ga0501031_0000036 3300049568 Bacteria 73760
499 Ga0501031_0001531 3300049568 Bacteria 14370
500 Ga0501031_0001871 3300049568 Bacteria 13238
501 Ga0501031_0035703 3300049568 Bacteria 3243
502 Ga0501031_0083684 3300049568 Bacteria 2079
503 Ga0501031_0137476 3300049568 Bacteria 1596
504 Ga0501031_0154846 3300049568 Bacteria 1498
505 Ga0501031_0217685 3300049568 Bacteria 1244
506 Ga0501032_0000100 3300049569 Bacteria 73505
507 Ga0501032_0000144 3300049569 Bacteria 58016
508 Ga0501032_0000421 3300049569 Bacteria 35100
509 Ga0501032_0015412 3300049569 Bacteria 5395
510 Ga0501032_0027119 3300049569 Bacteria 3938
511 Ga0501032_0035557 3300049569 Bacteria 3405
512 Ga0501032_0103174 3300049569 Bacteria 1890
513 Ga0501032_0106489 3300049569 Bacteria 1857
514 Ga0501032_0208710 3300049569 Bacteria 1274
515 Ga0501032_0284314 3300049569 Bacteria 1071
516 Ga0501033_0000088 3300049570 Bacteria 87638
517 Ga0501033_0000124 3300049570 Bacteria 74731
518 Ga0501033_0000206 3300049570 Bacteria 56405
519 Ga0501033_0001695 3300049570 Bacteria 19276
520 Ga0501033_0002152 3300049570 Bacteria 17031
521 Ga0501033_0012955 3300049570 Bacteria 6360
522 Ga0501033_0025755 3300049570 Bacteria 4430
523 Ga0501033_0052909 3300049570 Bacteria 3008
524 Ga0501033_0060131 3300049570 Bacteria 2804
525 Ga0501033_0102387 3300049570 Bacteria 2089
526 Ga0501033_0149548 3300049570 Bacteria 1685
527 Ga0501034_0000159 3300049571 Bacteria 127397
528 Ga0501034_0000397 3300049571 Bacteria 73511
529 Ga0501034_0061784 3300049571 Bacteria 3762
530 Ga0501034_0089811 3300049571 Bacteria 3070
531 Ga0501034_0127329 3300049571 Bacteria 2531
532 Ga0501034_0207525 3300049571 Bacteria 1915
533 Ga0501034_0248233 3300049571 Bacteria 1724
534 Ga0501034_0289450 3300049571 Bacteria 1576
535 Ga0501034_0304802 3300049571 Bacteria 1529
536 Ga0501034_0338685 3300049571 Bacteria 1434
537 Ga0501034_0658412 3300049571 Bacteria 948
538 Ga0501034_0733023 3300049571 Bacteria 885
539 Ga0501036_0000039 3300049572 Bacteria 83065
540 Ga0501036_0000056 3300049572 Bacteria 73511
541 Ga0501036_0005635 3300049572 Bacteria 10155
542 Ga0501036_0042683 3300049572 Bacteria 3839
543 Ga0501036_0084382 3300049572 Bacteria 2685
544 Ga0501036_0093225 3300049572 Bacteria 2544
545 Ga0501036_0221352 3300049572 Bacteria 1589
546 Ga0501036_0424919 3300049572 Bacteria 1108
547 Ga0501037_0000119 3300049573 Bacteria 73510
548 Ga0501037_0000181 3300049573 Bacteria 58438
549 Ga0501037_0000247 3300049573 Bacteria 46080
550 Ga0501037_0000396 3300049573 Bacteria 36209
551 Ga0501037_0001963 3300049573 Bacteria 14861
552 Ga0501037_0041465 3300049573 Bacteria 3385
553 Ga0501037_0062969 3300049573 Bacteria 2704
554 Ga0501037_0071116 3300049573 Bacteria 2531
555 Ga0501037_0117480 3300049573 Bacteria 1914
556 Ga0501037_0145479 3300049573 Bacteria 1695
557 Ga0501037_0147533 3300049573 Bacteria 1682
558 Ga0501037_0155128 3300049573 Bacteria 1635
559 Ga0501037_0278606 3300049573 Bacteria 1165
560 Ga0501037_0356785 3300049573 Bacteria 1008
561 Ga0501038_0000041 3300049574 Bacteria 120557
562 Ga0501038_0000098 3300049574 Bacteria 73471
563 Ga0501038_0000371 3300049574 Bacteria 38754
564 Ga0501038_0013061 3300049574 Bacteria 7574
565 Ga0501038_0022184 3300049574 Bacteria 5689
566 Ga0501038_0093320 3300049574 Bacteria 2518
567 Ga0501038_0123608 3300049574 Bacteria 2131
568 Ga0501038_0134942 3300049574 Bacteria 2023
569 Ga0501038_0228125 3300049574 Bacteria 1483
570 Ga0501038_0269727 3300049574 Bacteria 1342
571 Ga0501038_0360356 3300049574 Bacteria 1131
572 Ga0501039_0000013 3300049575 Bacteria 234418
573 Ga0501039_0000853 3300049575 Bacteria 22029
574 Ga0501039_0000926 3300049575 Bacteria 21446
575 Ga0501039_0016084 3300049575 Bacteria 5729
576 Ga0501039_0035142 3300049575 Bacteria 3867
577 Ga0501039_0045031 3300049575 Bacteria 3407
578 Ga0501039_0064691 3300049575 Bacteria 2835
579 Ga0501039_0121317 3300049575 Bacteria 2048
580 Ga0501039_0243546 3300049575 Bacteria 1414
581 Ga0501040_0051279 3300049576 Bacteria 2822
582 Ga0501040_0245630 3300049576 Bacteria 1276
583 Ga0501041_0170403 3300049577 Bacteria 1362
584 Ga0501042_0023910 3300049578 Bacteria 4280
585 Ga0501042_0067668 3300049578 Bacteria 2553
586 Ga0501042_0111391 3300049578 Bacteria 1971
587 Ga0501042_0180403 3300049578 Bacteria 1523
588 Ga0501043_0000008 3300049579 Bacteria 223654
589 Ga0501043_0000202 3300049579 Bacteria 54441
590 Ga0501043_0000498 3300049579 Bacteria 35297
591 Ga0501043_0001500 3300049579 Bacteria 20376
592 Ga0501043_0003541 3300049579 Bacteria 12833
593 Ga0501043_0024793 3300049579 Bacteria 4705
594 Ga0501043_0033474 3300049579 Bacteria 4043
595 Ga0501043_0048171 3300049579 Bacteria 3351
596 Ga0501043_0049416 3300049579 Bacteria 3306
597 Ga0501043_0058488 3300049579 Bacteria 3026
598 Ga0501043_0070501 3300049579 Bacteria 2745
599 Ga0501043_0182142 3300049579 Bacteria 1636
600 Ga0501043_0283127 3300049579 Bacteria 1270
601 Ga0501046_0000397 3300049580 Bacteria 43539
602 Ga0501046_0046453 3300049580 Bacteria 3446
603 Ga0501046_0063507 3300049580 Bacteria 2883
604 Ga0501046_0068316 3300049580 Bacteria 2766
605 Ga0501046_0070822 3300049580 Bacteria 2710
606 Ga0501046_0089401 3300049580 Bacteria 2370
607 Ga0501046_0142522 3300049580 Bacteria 1813
608 Ga0501046_0147866 3300049580 Bacteria 1773
609 Ga0501046_0165024 3300049580 Bacteria 1664
610 Ga0501046_0236184 3300049580 Bacteria 1349
611 Ga0501046_0237702 3300049580 Bacteria 1344
612 Ga0501046_0389374 3300049580 Bacteria 1008
613 Ga0501047_0000288 3300049581 Bacteria 57965
614 Ga0501047_0000392 3300049581 Bacteria 49114
615 Ga0501047_0006231 3300049581 Bacteria 11214
616 Ga0501047_0021920 3300049581 Bacteria 6134
617 Ga0501047_0024115 3300049581 Bacteria 5843
618 Ga0501047_0091355 3300049581 Bacteria 2922
619 Ga0501047_0095674 3300049581 Bacteria 2848
620 Ga0501047_0128910 3300049581 Bacteria 2410
621 Ga0501047_0191388 3300049581 Bacteria 1909
622 Ga0501047_0361827 3300049581 Bacteria 1286
623 Ga0501047_0380699 3300049581 Bacteria 1245
624 Ga0501048_0000834 3300049582 Bacteria 22734
625 Ga0501048_0129345 3300049582 Bacteria 1785
626 Ga0501048_0134387 3300049582 Bacteria 1748
627 Ga0501048_0171714 3300049582 Bacteria 1536
628 Ga0501048_0264014 3300049582 Bacteria 1223
629 Ga0501067_0000333 3300049583 Bacteria 25656
630 Ga0501067_0010498 3300049583 Bacteria 5128
631 Ga0501067_0013258 3300049583 Bacteria 4564
632 Ga0501067_0019085 3300049583 Bacteria 3795
633 Ga0501067_0055840 3300049583 Bacteria 2188
634 Ga0501068_0003723 3300049584 Bacteria 8248
635 Ga0501068_0028630 3300049584 Bacteria 3296
636 Ga0501069_0001610 3300049585 Bacteria 11171
637 Ga0501069_0010029 3300049585 Bacteria 5008
638 Ga0501069_0019384 3300049585 Bacteria 3678
639 Ga0501069_0053827 3300049585 Bacteria 2241
640 Ga0501069_0118107 3300049585 Bacteria 1513
641 Ga0501069_0138129 3300049585 Bacteria 1397
642 Ga0501070_0000175 3300049586 Bacteria 59483
643 Ga0501070_0000264 3300049586 Bacteria 49510
644 Ga0501070_0000476 3300049586 Bacteria 36484
645 Ga0501070_0007787 3300049586 Bacteria 9081
646 Ga0501070_0017987 3300049586 Bacteria 5931
647 Ga0501070_0020560 3300049586 Bacteria 5536
648 Ga0501070_0020934 3300049586 Bacteria 5487
649 Ga0501070_0043206 3300049586 Bacteria 3751
650 Ga0501070_0071314 3300049586 Bacteria 2876
651 Ga0501070_0090664 3300049586 Bacteria 2530
652 Ga0501070_0116227 3300049586 Bacteria 2209
653 Ga0501071_0016378 3300049587 Bacteria 5096
654 Ga0501072_0004129 3300049588 Bacteria 10991
655 Ga0501072_0276654 3300049588 Bacteria 1335
656 Ga0501073_0000034 3300049589 Bacteria 95224
657 Ga0501073_0011018 3300049589 Bacteria 6613
658 Ga0501073_0034023 3300049589 Bacteria 3628
659 Ga0501073_0046674 3300049589 Bacteria 3045
660 Ga0501073_0105423 3300049589 Bacteria 1956
661 Ga0501073_0156779 3300049589 Bacteria 1577
662 Ga0501073_0281453 3300049589 Bacteria 1147
663 Ga0501074_0000016 3300049590 Bacteria 78666
664 Ga0501074_0000395 3300049590 Bacteria 25957
665 Ga0501074_0005501 3300049590 Bacteria 9113
666 Ga0501074_0020725 3300049590 Bacteria 4776
667 Ga0501074_0035325 3300049590 Bacteria 3621
668 Ga0501074_0312954 3300049590 Bacteria 1115
669 Ga0501076_0152018 3300049592 Bacteria 1883
670 Ga0501079_0003579 3300049741 Bacteria 11425
671 Ga0501079_0028231 3300049741 Bacteria 4305
672 Ga0501079_0217056 3300049741 Bacteria 1494
673 Ga0501080_0000846 3300049742 Bacteria 25014
674 Ga0501080_0012000 3300049742 Bacteria 7935
675 Ga0501080_0015856 3300049742 Bacteria 6951
676 Ga0501080_0029605 3300049742 Bacteria 5098
677 Ga0501080_0032773 3300049742 Bacteria 4847
678 Ga0501080_0052040 3300049742 Bacteria 3811
679 Ga0501080_0061934 3300049742 Bacteria 3482
680 Ga0501080_0095411 3300049742 Bacteria 2762
681 Ga0501080_0129525 3300049742 Bacteria 2335
682 Ga0501080_0175361 3300049742 Bacteria 1975
683 Ga0501080_0242350 3300049742 Bacteria 1645
684 Ga0501083_0000035 3300049744 Bacteria 96241
685 Ga0501083_0001286 3300049744 Bacteria 16988
686 Ga0501083_0037718 3300049744 Bacteria 3289
687 Ga0501083_0054077 3300049744 Bacteria 2695
688 Ga0501035_0000011 3300049822 Bacteria 305794
689 Ga0501035_0000053 3300049822 Bacteria 142860
690 Ga0501035_0000137 3300049822 Bacteria 89273
691 Ga0501035_0000155 3300049822 Bacteria 84012
692 Ga0501035_0002015 3300049822 Bacteria 20268
693 Ga0501035_0005448 3300049822 Bacteria 12037
694 Ga0501035_0017260 3300049822 Bacteria 6654
695 Ga0501035_0039642 3300049822 Bacteria 4261
696 Ga0501035_0068402 3300049822 Bacteria 3149
697 Ga0501035_0108767 3300049822 Bacteria 2430
698 Ga0501035_0123606 3300049822 Bacteria 2260
699 Ga0501035_0124084 3300049822 Bacteria 2255
700 Ga0501035_0208643 3300049822 Bacteria 1672
701 Ga0501035_0218339 3300049822 Bacteria 1629
702 Ga0501035_0244195 3300049822 Bacteria 1526
703 Ga0501035_0415234 3300049822 Bacteria 1118
704 Ga0501035_0437522 3300049822 Bacteria 1083
705 Ga0501035_0684418 3300049822 Bacteria 828
706 Ga0501044_0000011 3300049823 Bacteria 257385
707 Ga0501044_0000214 3300049823 Bacteria 73483
708 Ga0501044_0000393 3300049823 Bacteria 54257
709 Ga0501044_0000431 3300049823 Bacteria 51668
710 Ga0501044_0003054 3300049823 Bacteria 18937
711 Ga0501044_0003281 3300049823 Bacteria 18216
712 Ga0501044_0019399 3300049823 Bacteria 7276
713 Ga0501044_0020202 3300049823 Bacteria 7109
714 Ga0501044_0024315 3300049823 Bacteria 6434
715 Ga0501044_0032428 3300049823 Bacteria 5492
716 Ga0501044_0043264 3300049823 Bacteria 4680
717 Ga0501044_0043882 3300049823 Bacteria 4643
718 Ga0501044_0044832 3300049823 Bacteria 4586
719 Ga0501044_0072449 3300049823 Bacteria 3502
720 Ga0501044_0177814 3300049823 Bacteria 2096
721 Ga0501044_0222222 3300049823 Bacteria 1839
722 Ga0501044_0245096 3300049823 Bacteria 1735
723 Ga0501044_0255665 3300049823 Bacteria 1691
724 Ga0501044_0336315 3300049823 Bacteria 1431
725 Ga0501045_0007978 3300049824 Bacteria 7375
726 Ga0501045_0191335 3300049824 Bacteria 1525
727 nmdc:mga03683_7659_c1 3300050489 Bacteria 3760
728 nmdc:mga03n38_9312_c1 3300050490 Bacteria 3567
729 nmdc:mga0yw44_219775_c1 3300050492 Bacteria 1259
730 nmdc:mga0yw44_32262_c1 3300050492 Bacteria 3051
731 nmdc:mga0yw44_95771_c1 3300050492 Bacteria 1883
732 nmdc:mga0yw44_9790_c1 3300050492 Bacteria 4868
733 nmdc:mga06z11_124599_c1 3300050494 Bacteria 1441
734 nmdc:mga06z11_137634_c1 3300050494 Bacteria 1377
735 nmdc:mga04h51_35256_c1 3300050495 Bacteria 1603
736 nmdc:mga05p37_16081_c1 3300050507 Bacteria 9006
737 nmdc:mga09592_314902_c1 3300050508 Bacteria 1356
738 nmdc:mga06r32_553745_c1 3300050510 Bacteria 1124
739 nmdc:mga08y16_144371_c1 3300050511 Bacteria 2474
740 nmdc:mga0n895_152422_c1 3300050512 Bacteria 2342
741 Ga0495612_0028966 3300053078 Bacteria 2229
742 Ga0495612_0072861 3300053078 Bacteria 1434
743 Ga0500610_0030879 3300053079 Bacteria 2718
744 Ga0500635_0003040 3300053080 Bacteria 4188
745 Ga0495655_0034272 3300053083 Bacteria 1255
746 Ga0495619_0046133 3300053085 Bacteria 2864
747 Ga0500583_0093219 3300053092 Bacteria 1468
748 Ga0500641_0000965 3300053096 Bacteria 10243
749 Ga0500650_0121401 3300053098 Bacteria 1218
750 Ga0500554_003388 3300053102 Bacteria 3258
751 Ga0500595_003756 3300053119 Bacteria 6994
752 Ga0500595_016614 3300053119 Bacteria 2736
753 Ga0500595_031129 3300053119 Bacteria 1792
754 Ga0500595_066540 3300053119 Bacteria 1077
755 Ga0500559_0173651 3300053136 Bacteria 1014
756 Ga0500568_0014496 3300053139 Bacteria 3558
757 Ga0500573_0003712 3300053140 Bacteria 7943
758 Ga0500573_0007019 3300053140 Bacteria 6122
759 Ga0500577_0000509 3300053142 Bacteria 10008
760 Ga0500603_000410 3300053150 Bacteria 11214
761 Ga0500604_0011263 3300053151 Bacteria 2399
762 Ga0500616_0001510 3300053153 Bacteria 21977
763 Ga0500627_0029275 3300053158 Bacteria 2296
764 Ga0500627_0076537 3300053158 Bacteria 1488
765 Ga0500627_0077622 3300053158 Bacteria 1477
766 Ga0500636_0014172 3300053177 Bacteria 4687
767 Ga0500636_0162871 3300053177 Bacteria 1214
768 Ga0500637_0003231 3300053178 Bacteria 7476
769 Ga0500567_126883 3300053723 Bacteria 1006
770 Ga0501084_0008623 3300054114 Bacteria 8428
771 Ga0501084_0101726 3300054114 Bacteria 2413
772 Ga0501082_0018579 3300060353 Bacteria 5992
773 Ga0501082_0018837 3300060353 Bacteria 5947
774 Ga0501082_0027092 3300060353 Bacteria 4938
775 2503201530 2503198000 Bacteria 6884444
776 2509113134 2508501123 Bacteria 6283661
777 2509143302 2508501127 Bacteria 7037543
778 2509396311 2509276022 Bacteria 6200534
779 2512931500 2512875016 Bacteria 6529530
780 2512959331 2512875024 Bacteria 7195110
781 2513612723 2513237090 Bacteria 7096802
782 2514420883 2513237305 Bacteria 7293571
783 2588517337 2588253730 Bacteria 6881675
784 2597813225 2597489875 Bacteria 7010078
785 2599936752 2599185301 Bacteria 6161860
786 2643771110 2643221550 Bacteria 4619371
787 2643776113 2643221551 Bacteria 3750538
788 2643794560 2643221555 Bacteria 3749717
789 2643840019 2643221564 Bacteria 4193379
790 2643984399 2643221595 Bacteria 6565519
791 2644109177 2643221618 Bacteria 7717186
792 2644151699 2643221626 Bacteria 8069654
793 2644153256 2643221627 Bacteria 6761570
794 2644311833 2643221655 Bacteria 7722067
795 2644330105 2643221659 Bacteria 7890716
796 2644543141 2643221698 Bacteria 7756764
797 2644617631 2643221712 Bacteria 7729434
798 2688598447 2687453392 Bacteria 6880454
799 2694631074 2693429783 Bacteria 7019804
800 2694636428 2693429784 Bacteria 7241525
801 2723575380 2721755686 Bacteria 7343952
802 2739307168 2738543024 Bacteria 5603683
803 2756675469 2756170246 Bacteria 7451806
804 2792749237 2791355123 Bacteria 8049106
805 2793283387 2791355253 Bacteria 5171699
806 2819242803 2818991272 Bacteria 4622173
807 2841739198 2841734538 Bacteria 6784580
808 2844007426 2844002411 Bacteria 7168230
809 2844163812 2844163670 Bacteria 7266046
810 2847675614 2847670302 Bacteria 6165597
811 2847692258 2847686936 Bacteria 6278406
812 2856319501 2856314179 Bacteria 6477897
813 2856327481 2856320880 Bacteria 7263508
814 2856334567 2856328259 Bacteria 6528202
815 2856340888 2856334872 Bacteria 7037011
816 2856344937 2856342000 Bacteria 7176905
817 2856352442 2856349417 Bacteria 6230045
818 2856358597 2856356410 Bacteria 6297484
819 2856369460 2856364286 Bacteria 6939991
820 2857351152 2857349434 Bacteria 7926032
821 2857371324 2857367948 Bacteria 6965560
822 2869169292 2869162929 Bacteria 6399702
823 2869172867 2869169390 Bacteria 6659796
824 2869237208 2869234852 Bacteria 6654993
825 2869244702 2869242130 Bacteria 6609239
826 2869253111 2869249662 Bacteria 6868783
827 2869260294 2869256925 Bacteria 6981691
828 2869272228 2869271264 Bacteria 6908218
829 2869284931 2869278585 Bacteria 7077053
830 2869286466 2869285874 Bacteria 6901219
831 2871434619 2871429161 Bacteria 6547891
832 2871442679 2871435913 Bacteria 6880295
833 2871444179 2871444079 Bacteria 6423508
834 2871457891 2871451962 Bacteria 7336357
835 2871462731 2871459585 Bacteria 6866887
836 2871469824 2871466892 Bacteria 6923287
837 2871475707 2871474448 Bacteria 6806570
838 2871494542 2871488783 Bacteria 6929816
839 2871501396 2871495908 Bacteria 6935695
840 2874103728 2874102143 Bacteria 6342645
841 2874112353 2874109183 Bacteria 6517025
842 2874122671 2874116593 Bacteria 6674494
843 2874132088 2874131515 Bacteria 6820270
844 2874145874 2874139085 Bacteria 7021506
845 2874149825 2874146452 Bacteria 7533118
846 2874158083 2874155637 Bacteria 6724144
847 2874168250 2874162495 Bacteria 6174670
848 2874169856 2874168670 Bacteria 8062617
849 2876368481 2876363079 Bacteria 6544991
850 2876380336 2876377896 Bacteria 6565995
851 2876386707 2876386047 Bacteria 6698674
852 2876398442 2876392853 Bacteria 6660880
853 2876400211 2876399893 Bacteria 6927900
854 2876409301 2876406927 Bacteria 6191900
855 2876416287 2876413966 Bacteria 6831344
856 2876422997 2876420981 Bacteria 6687741
857 2878040736 2878035449 Bacteria 6555736
858 2878731753 2878730984 Bacteria 6380721
859 2878745213 2878738818 Bacteria 7136951
860 2878751752 2878745973 Bacteria 6867388
861 2878758876 2878753008 Bacteria 6922523
862 2878765376 2878760144 Bacteria 6823465
863 2878773084 2878767105 Bacteria 6898628
864 2878777093 2878774303 Bacteria 6108671
865 2878784539 2878781027 Bacteria 6834456
866 2878793925 2878788777 Bacteria 6567085
867 2881151331 2881147464 Bacteria 7779814
868 2881155307 2881155292 Bacteria 6461656
869 2881167532 2881161766 Bacteria 7127907
870 2881853101 2881845957 Bacteria 6611900
871 2881853708 2881853255 Bacteria 6698367
872 2881867312 2881861095 Bacteria 7128710
873 2882636276 2882632389 Bacteria 8154593
874 2882912561 2882912400 Bacteria 6801539
875 2885309434 2885305155 Bacteria 7348390
876 2885317988 2885312484 Bacteria 6415165
877 2885323699 2885318864 Bacteria 6729568
878 2885330373 2885326080 Bacteria 7134805
879 2885337499 2885334103 Bacteria 7216818
880 2885356697 2885350715 Bacteria 6787678
881 2888339424 2888337043 Bacteria 6629336
882 2888346815 2888343758 Bacteria 6611049
883 2888355760 2888350351 Bacteria 7372807
884 2889017606 2889016732 Bacteria 6700763
885 2891376482 2891373044 Bacteria 5202277
886 2903451313 2903448605 Bacteria 7357801
887 2903503885 2903492973 Bacteria 13473544
888 2903504698 2903492973 Bacteria 13473544
889 2903527480 2903521522 Bacteria 6525694
890 2903533934 2903528002 Bacteria 6586099
891 2903546207 2903540706 Bacteria 7062119
892 2904664997 2904659560 Bacteria 6685615
893 2906314150 2906308376 Bacteria 6841989
894 2906327316 2906321335 Bacteria 6579571
895 2906330005 2906328253 Bacteria 6585166
896 2906360846 2906354277 Bacteria 6991324
897 2906366766 2906363423 Bacteria 6856682
898 2906372607 2906370794 Bacteria 6881062
899 2906387985 2906386501 Bacteria 5977019
900 2906405393 2906401398 Bacteria 6693206
901 2906408906 2906408224 Bacteria 6162342
902 2906420221 2906414383 Bacteria 6580790
903 2906432767 2906427513 Bacteria 6375796
904 2922134343 2922130491 Bacteria 7173936
905 2922152073 2922151315 Bacteria 6902399
906 2922162838 2922158528 Bacteria 6573167
907 2922178286 2922172374 Bacteria 6167644
908 2922188795 2922185730 Bacteria 7113964
909 2924715699 2924710171 Bacteria 6752351
910 2924728241 2924726620 Bacteria 6271473
911 2924743494 2924741084 Bacteria 6661321
912 2924764249 2924762789 Bacteria 6561353
913 2924783350 2924776078 Bacteria 7492003
914 2924789080 2924784321 Bacteria 7416538
915 2937815739 2937813078 Bacteria 7783518
916 2937824460 2937822353 Bacteria 7290551
917 2937839387 2937836603 Bacteria 6811263
918 2937862769 2937861824 Bacteria 6660327
919 2937870538 2937868953 Bacteria 6639878
920 2937882123 2937877337 Bacteria 7246526
921 2937896290 2937891427 Bacteria 6357007
922 2937978583 2937972304 Bacteria 7532020
923 2937988152 2937980651 Bacteria 6517427
924 2938000065 2937994558 Bacteria 7036190
925 2938022088 2938014810 Bacteria 6700592
926 2941500403 2941499720 Bacteria 7599444
927 2958040633 2958034702 Bacteria 6989922
928 2958056715 2958041894 Bacteria 13082850
929 2958057848 2958041894 Bacteria 13082850
930 2958064376 2958064165 Bacteria 7158582
931 2958089245 2958084443 Bacteria 7312792
932 2958096506 2958092219 Bacteria 6861151
933 2958105745 2958100919 Bacteria 6800575
934 2958111520 2958108152 Bacteria 6681128
935 2958118462 2958115193 Bacteria 6923548
936 2958125424 2958122699 Bacteria 7280457
937 2958130869 2958130278 Bacteria 6897202
938 2958138000 2958137437 Bacteria 6050276
939 2958146136 2958144490 Bacteria 6677056
940 2958170529 2958165035 Bacteria 6906348
941 2958173532 2958172287 Bacteria 6716688
942 2958184790 2958179912 Bacteria 6874908
943 2961082957 2961077736 Bacteria 7079850
944 2961119996 2961114664 Bacteria 6680456
945 2961131611 2961127735 Bacteria 7196641
946 2961138713 2961136820 Bacteria 6775228
947 2961168984 2961163497 Bacteria 6901077
948 2961176045 2961170736 Bacteria 7072258
949 2961185945 2961183825 Bacteria 6688536
950 2963647712 2963644680 Bacteria 6530403
951 2965024271 2965018300 Bacteria 6883036
952 2965031751 2965025482 Bacteria 6532201
953 2965038127 2965032056 Bacteria 6887443
954 2965045713 2965040258 Bacteria 6855979
955 2965051618 2965047637 Bacteria 6623551
956 2965066005 2965062239 Bacteria 7412989
957 2965094258 2965089291 Bacteria 6866420
958 2965108624 2965102966 Bacteria 6800987
959 2965117254 2965110997 Bacteria 6693150
960 2965122060 2965119406 Bacteria 6956431
961 2968001933 2967996073 Bacteria 6787468
962 2968009043 2968003550 Bacteria 6929263
963 2968018450 2968016561 Bacteria 7022047
964 2968090343 2968083720 Bacteria 7351627
965 2968096367 2968091066 Bacteria 6052692
966 2968098868 2968097103 Bacteria 6107094
967 2968116353 2968110612 Bacteria 6814636
968 2968120634 2968117919 Bacteria 6536078
969 2968129186 2968128360 Bacteria 6270294
970 2968138942 2968138860 Bacteria 6605449
971 2968177378 2968171901 Bacteria 6894245
972 2970471377 2970469710 Bacteria 6969209
973 2970491115 2970489779 Bacteria 6517260
974 2970508711 2970503327 Bacteria 7099517
975 2970514623 2970510686 Bacteria 7006402
976 2970528594 2970524798 Bacteria 6840927
977 2970539979 2970532167 Bacteria 6553173
978 2970544790 2970540015 Bacteria 6977556
979 2970552022 2970547951 Bacteria 6931819
980 2970560224 2970554993 Bacteria 6814252
981 2970599546 2970593180 Bacteria 7073582
982 2970620844 2970619444 Bacteria 6986144
983 2970628904 2970627176 Bacteria 6680862
984 2977827416 2977821940 Bacteria 6906439
985 2977830951 2977828996 Bacteria 7007971
986 2977845975 2977843712 Bacteria 6753583
987 2977854377 2977851361 Bacteria 6694324
988 2977859278 2977858184 Bacteria 6215359
989 2977867086 2977864932 Bacteria 7534097
990 2977875258 2977872689 Bacteria 7270173
991 2977904373 2977898635 Bacteria 6675551
992 2977911338 2977907340 Bacteria 6577984
993 2977924221 2977922695 Bacteria 6956781
994 2977941199 2977935797 Bacteria 6252826
995 2977942749 2977942078 Bacteria 7570577
996 2977957853 2977957713 Bacteria 6877875
997 2977974520 2977971508 Bacteria 7472917
998 2979717543 2979710463 Bacteria 6785254
999 2979766235 2979764755 Bacteria 6610066
1000 2979774491 2979772303 Bacteria 6618277
1001 2979781283 2979779861 Bacteria 6219781
1002 2979796344 2979793036 Bacteria 6808957
1003 2979811641 2979808191 Bacteria 7179355
1004 2987638336 2987636660 Bacteria 8088555
1005 2987645776 2987645492 Bacteria 6117018
1006 2987654659 2987652177 Bacteria 6969023
1007 2987665015 2987659509 Bacteria 6966464
1008 2987669244 2987666974 Bacteria 6509233
1009 2987676017 2987673487 Bacteria 6884027
1010 2989355156 2989349275 Bacteria 6349068
1011 2989775377 2989771324 Bacteria 5605128
1012 2996314074 2996310559 Bacteria 6357320
1013 2996345072 2996341866 Bacteria 6643098
1014 2996350169 2996348954 Bacteria 7239054
1015 2996391443 2996386984 Bacteria 6978667
1016 3000140661 3000135777 Bacteria 6891109
1017 3004168902 3004167301 Bacteria 8330599
1018 3004194072 3004188549 Bacteria 6952365
1019 3004196256 3004195979 Bacteria 6776956
1020 3004205420 3004203850 Bacteria 7307914
1021 3004215956 3004211236 Bacteria 7417683
1022 3004223706 3004218560 Bacteria 7421728
1023 3004235837 3004232784 Bacteria 6662140
1024 3004246437 3004239961 Bacteria 6892290
1025 3004254705 3004248173 Bacteria 6563236
1026 3004274946 3004268573 Bacteria 7043476
1027 3004276868 3004275668 Bacteria 7114440
1028 3004290898 3004289098 Bacteria 6135450
1029 3004334356 3004334049 Bacteria 8449246
1030 637074599 637000159 Bacteria 7596297
1031 649872973 649633066 Bacteria 6690028
1032 8002289041 8002285264 Bacteria 6717907
1033 8004301043 8004300914 Bacteria 6132239
1034 8004314009 8004312739 Bacteria 7444653
1035 8004365134 8004361976 Bacteria 6858373
1036 8004380397 8004374579 Bacteria 6898112
1037 8004393640 8004387939 Bacteria 7049250
1038 8004402716 8004395343 Bacteria 6620908
1039 8004450199 8004445564 Bacteria 6322258
1040 8004634825 8004633249 Bacteria 6723080
1041 8004640821 8004640170 Bacteria 6723001
1042 8004703603 8004695233 Bacteria 6731676
1043 8004709364 8004703790 Bacteria 8006957
1044 8004720408 8004714634 Bacteria 6776161
1045 8005246851 8005246636 Bacteria 4933972
1046 8054560085 8054558443 Bacteria 5204801
1047 8055620777 8055617313 Bacteria 7548464
1048 Ga0501035_0121404
1049 JGI24737J22298_10002261
1050 JGI24735J21928_10007364
1051 JGI25406J46586_10001817
1052 Ga0055542_1000986
1053 Ga0055528_1007052
1054 Ga0070683_100326147
1055 Ga0070670_100008351
1056 Ga0070680_100063778
1057 Ga0070680_100106225
1058 Ga0070680_100285748
1059 Ga0070682_100046685
1060 Ga0070661_100227053
1061 Ga0070661_100570677
1062 Ga0070659_100089890
1063 Ga0070659_100123154
1064 Ga0070659_100298918
1065 Ga0070667_100348700
1066 Ga0070709_10008945
1067 Ga0070709_10025287
1068 Ga0070709_10104679
1069 Ga0070709_10224734
1070 Ga0070709_10286081
1071 Ga0070714_100021907
1072 Ga0070713_100045619
1073 Ga0070710_10000417
1074 Ga0070710_10118230
1075 Ga0070711_100003647
1076 Ga0070711_100122213
1077 Ga0070663_100013308
1078 Ga0070663_100014776
1079 Ga0070662_100008152
1080 Ga0070681_10022697
1081 Ga0070681_10134356
1082 Ga0070681_10244274
1083 Ga0070681_10278429
1084 Ga0070679_100019564
1085 Ga0070679_100070219
1086 Ga0070679_100137818
1087 Ga0070684_100007976
1088 Ga0070684_100086636
1089 Ga0068853_100022093
1090 Ga0068853_100024626
1091 Ga0068853_100031106
1092 Ga0068853_100095964
1093 Ga0068853_100158998
1094 Ga0070693_100172819
1095 Ga0070693_100301259
1096 Ga0070665_100082332
1097 Ga0070665_100146315
1098 Ga0068855_100018872
1099 Ga0068855_100078782
1100 Ga0068855_100285170
1101 Ga0068855_100482265
1102 Ga0068857_100003393
1103 Ga0068857_100016795
1104 Ga0068854_100026994
1105 Ga0068854_100179605
1106 Ga0068854_100185865
1107 Ga0068856_100002827
1108 Ga0068856_100016560
1109 Ga0068856_100175169
1110 Ga0068852_100137192
1111 Ga0068852_100293120
1112 Ga0068864_100500101
1113 Ga0068851_10001384
1114 Ga0068862_100451139
1115 Ga0081539_10003450
1116 Ga0070717_10275568
1117 Ga0075365_10007012
1118 Ga0075365_10121498
1119 Ga0075365_10192221
1120 Ga0075363_100124524
1121 Ga0070715_10015227
1122 Ga0070716_100004688
1123 Ga0070716_100137540
1124 Ga0075367_10152218
1125 Ga0075369_10021673
1126 Ga0075369_10049536
1127 Ga0068871_100496554
1128 Ga0075428_100008942
1129 Ga0075431_100342205
1130 Ga0075429_100231393
1131 Ga0068865_100415313
1132 Ga0099794_10005752
1133 Ga0099794_10186145
1134 Ga0099795_10004056
1135 Ga0105240_10012741
1136 Ga0105240_10039036
1137 Ga0105240_10064831
1138 Ga0105240_10195546
1139 Ga0111539_10070035
1140 Ga0114129_10004474
1141 Ga0105243_10340825
1142 Ga0105241_10002223
1143 Ga0105237_10024483
1144 Ga0105237_10046007
1145 Ga0105237_10402357
1146 Ga0105238_10005872
1147 Ga0105238_10009265
1148 Ga0105238_10026487
1149 Ga0105238_10105708
1150 Ga0105238_10447731
1151 Ga0105238_10455735
1152 Ga0099796_10012686
1153 Ga0099796_10080751
1154 Ga0105239_10006765
1155 Ga0105239_10014460
1156 Ga0105239_10022601
1157 Ga0105239_10344869
1158 Ga0105246_10039432
1159 Ga0157371_10025461
1160 Ga0157370_10138591
1161 Ga0157370_10278531
1162 Ga0157369_10017756
1163 Ga0157374_10070061
1164 Ga0163162_10637225
1165 Ga0157372_10095195
1166 Ga0157372_10419084
1167 Ga0163163_10008704
1168 Ga0182008_10019310
1169 Ga0163161_10318736
1170 Ga0206356_11139929
1171 Ga0213873_10002325
1172 Ga0213876_10067483
1173 Ga0213875_10000036
1174 Ga0209026_1000025
1175 Ga0209677_114036
1176 Ga0209148_1000181
1177 Ga0209759_1000121
1178 Ga0209455_1000127
1179 Ga0209673_1000457
1180 Ga0209025_1000165
1181 Ga0209564_1001849
1182 Ga0209758_1000005
1183 Ga0209758_1010358
1184 Ga0209050_1001615
1185 Ga0209051_1025118
1186 Ga0209257_1000303
1187 Ga0209257_1025954
1188 Ga0207692_10058908
1189 Ga0207692_10104911
1190 Ga0207647_10001898
1191 Ga0207647_10210891
1192 Ga0207685_10037457
1193 Ga0207699_10000473
1194 Ga0207699_10005645
1195 Ga0207699_10069035
1196 Ga0207699_10080453
1197 Ga0207699_10301521
1198 Ga0207654_10000317
1199 Ga0207654_10274339
1200 Ga0207707_10000505
1201 Ga0207707_10005928
1202 Ga0207707_10154019
1203 Ga0207707_10514845
1204 Ga0207695_10000713
1205 Ga0207695_10394346
1206 Ga0207695_10439169
1207 Ga0207695_10618729
1208 Ga0207671_10010503
1209 Ga0207671_10122066
1210 Ga0207671_10241384
1211 Ga0207693_10275029
1212 Ga0207663_10017841
1213 Ga0207663_10029578
1214 Ga0207660_10372899
1215 Ga0207657_10121530
1216 Ga0207652_10026858
1217 Ga0207652_10036599
1218 Ga0207652_10053469
1219 Ga0207652_10216309
1220 Ga0207652_10231332
1221 Ga0207694_10000155
1222 Ga0207694_10003031
1223 Ga0207694_10028952
1224 Ga0207694_10035867
1225 Ga0207694_10099055
1226 Ga0207650_10012045
1227 Ga0207700_10038473
1228 Ga0207700_10062898
1229 Ga0207700_10128764
1230 Ga0207664_10009878
1231 Ga0207664_10028623
1232 Ga0207664_10336209
1233 Ga0207690_10252679
1234 Ga0207706_10049641
1235 Ga0207706_10170757
1236 Ga0207704_10354894
1237 Ga0207665_10013789
1238 Ga0207667_10016768
1239 Ga0207667_10026865
1240 Ga0207667_10133139
1241 Ga0207712_10061145
1242 Ga0207640_10002792
1243 Ga0207640_10074759
1244 Ga0207658_10298843
1245 Ga0207658_10316007
1246 Ga0207639_10003685
1247 Ga0207639_10019633
1248 Ga0207639_10255061
1249 Ga0207678_10032286
1250 Ga0207678_10037450
1251 Ga0207678_10039836
1252 Ga0207702_10000022
1253 Ga0207702_10003504
1254 Ga0207702_10633332
1255 Ga0207648_10160854
1256 Ga0207676_10588552
1257 Ga0207698_10370677
1258 Ga0209588_1000792
1259 Ga0209588_1002811
1260 Ga0209588_1071906
1261 Ga0209813_10025213
1262 Ga0268266_10013179
1263 Ga0268266_10031714
1264 Ga0268265_10008367
1265 Ga0265319_1022836
1266 Ga0265318_10000680
1267 Ga0265318_10062432
1268 Ga0307515_10000420
1269 Ga0265330_10053739
1270 Ga0265325_10000869
1271 Ga0265325_10030653
1272 Ga0265325_10106323
1273 Ga0265340_10001284
1274 Ga0265340_10007346
1275 Ga0265340_10047670
1276 Ga0265339_10002241
1277 Ga0265339_10036911
1278 Ga0265339_10171239
1279 Ga0265331_10030152
1280 Ga0265316_10004479
1281 Ga0265316_10068620
1282 Ga0265316_10376169
1283 Ga0307513_10004196
1284 Ga0265313_10000872
1285 Ga0265313_10006312
1286 Ga0265313_10077882
1287 Ga0307508_10302973
1288 Ga0265314_10005202
1289 Ga0265314_10018990
1290 Ga0265314_10279103
1291 Ga0265342_10058055
1292 Ga0265342_10086906
1293 Ga0265342_10212684
1294 Ga0307416_100526101
1295 Ga0307510_10039607
1296 Ga0373923_0015582
1297 Ga0373936_0040621
1298 Ga0373936_0089581
1299 Ga0373945_0010763
1300 Ga0373953_0156086
1301 Ga0373954_0021500
1302 Ga0373954_0098805
1303 Ga0373957_0062499
1304 Ga0373943_0002114
1305 Ga0373946_0052621
1306 Ga0373955_0136656
1307 Ga0373924_0009305
1308 Ga0373924_0073268
1309 Ga0373935_0000660
1310 Ga0373935_0075583
1311 Ga0373927_0006115
1312 Ga0373927_0119546
1313 Ga0373927_0138205
1314 Ga0373933_0152369
1315 Ga0373933_0277406
1316 Ga0373947_0001631
1317 Ga0373947_0023727
1318 Ga0373947_0151341
1319 Ga0373925_0001524
1320 Ga0373925_0163160
1321 Ga0395899_0000117
1322 Ga0395900_0000020
1323 Ga0395900_0028714
1324 Ga0395900_0065797
1325 Ga0395900_0150361
1326 Ga0395900_0342480
1327 Ga0395900_0631503
1328 Ga0395898_0000259
1329 Ga0395898_0041398
1330 Ga0395898_0097159
1331 Ga0395898_0166073
1332 Ga0395898_0383176
1333 Ga0395898_0613319
1334 Ga0395905_0000019
1335 Ga0395905_0112114
1336 Ga0395905_0160038
1337 Ga0436364_0245439
1338 Ga0436364_1071235
1339 Ga0395901_0000016
1340 Ga0395901_0027609
1341 Ga0395901_0207606
1342 Ga0395901_0279626
1343 Ga0395901_0361372
1344 Ga0395901_0460124
1345 Ga0436365_0040457
1346 Ga0436365_0179006
1347 Ga0436365_0928236
1348 Ga0436365_0959977
1349 Ga0436365_1259906
1350 Ga0436365_1681226
1351 Ga0436360_0655288
1352 Ga0436363_0945892
1353 Ga0436362_0631993
1354 Ga0466969_0007887
1355 Ga0466972_0033120
1356 Ga0466966_0073582
1357 Ga0466966_0186975
1358 Ga0466961_0079695
1359 Ga0466971_0034150
1360 Ga0466970_0086840
1361 Ga0466960_0026413
1362 Ga0466959_0027484
1363 Ga0466958_0169788
1364 Ga0466967_0039398
1365 Ga0495592_0011842
1366 Ga0495592_0036626
1367 Ga0495603_0000155
1368 Ga0495629_0001568
1369 Ga0495629_0055389
1370 Ga0495641_0011193
1371 Ga0495641_0012521
1372 Ga0495641_0014774
1373 Ga0495651_0018841
1374 Ga0495651_0266716
1375 Ga0495653_0024094
1376 Ga0495580_0013322
1377 Ga0495582_0000401
1378 Ga0495639_0000146
1379 Ga0495639_0043582
1380 Ga0495639_0149143
1381 Ga0495662_0000242
1382 Ga0495662_0018902
1383 Ga0495662_0165446
1384 Ga0495664_0011226
1385 Ga0495664_0024087
1386 Ga0495664_0029291
1387 Ga0495584_0012407
1388 Ga0495594_0001113
1389 Ga0495607_0046014
1390 Ga0495608_0009795
1391 Ga0495608_0162938
1392 Ga0495608_0485275
1393 Ga0495610_0137322
1394 Ga0495618_0000589
1395 Ga0495618_0046370
1396 Ga0495618_0163683
1397 Ga0495620_0021102
1398 Ga0495628_0077931
1399 Ga0495628_0232250
1400 Ga0495628_0240957
1401 Ga0495630_0000634
1402 Ga0495630_0009739
1403 Ga0495630_0165218
1404 Ga0495630_0171772
1405 Ga0495637_0045137
1406 Ga0495644_0037671
1407 Ga0495652_0001002
1408 Ga0495652_0016908
1409 Ga0495652_0026936
1410 Ga0495652_0037188
1411 Ga0495652_0054963
1412 Ga0495652_0059829
1413 Ga0495665_0000150
1414 Ga0495665_0025824
1415 Ga0495640_0004664
1416 Ga0495640_0050622
1417 Ga0495640_0225732
1418 Ga0495586_0260769
1419 Ga0495621_0107948
1420 Ga0495645_0003965
1421 Ga0495645_0089904
1422 Ga0495645_0154783
1423 Ga0495645_0333635
1424 Ga0495622_0005717
1425 Ga0495656_0006603
1426 Ga0495634_0003138
1427 Ga0495634_0003515
1428 Ga0495634_0124485
1429 Ga0495625_0183588
1430 Ga0495635_0000823
1431 Ga0495635_0017735
1432 Ga0495635_0038903
1433 Ga0495588_0029919
1434 Ga0495657_0010790
1435 Ga0495599_0009593
1436 Ga0495623_0008876
1437 Ga0495646_0002238
1438 Ga0495647_0001777
1439 Ga0495658_0044213
1440 Ga0495613_0004476
1441 Ga0495613_0074243
1442 Ga0495624_0001759
1443 Ga0495624_0002699
1444 Ga0495624_0003993
1445 Ga0495670_0080569
1446 Ga0495671_0111227
1447 Ga0495600_0181483
1448 Ga0495600_0203706
1449 Ga0495600_0349818
1450 Ga0495581_0005294
1451 Ga0495581_0040579
1452 Ga0495581_0048716
1453 Ga0495581_0135283
1454 Ga0495604_0290819
1455 Ga0495674_0000447
1456 Ga0495674_0001343
1457 Ga0495674_0458280
1458 Ga0495672_0019570
1459 Ga0495672_0091653
1460 Ga0495676_0001115
1461 Ga0495676_0005737
1462 Ga0495676_0052329
1463 Ga0495676_0109929
1464 Ga0495676_0234980
1465 Ga0495680_0214347
1466 Ga0495675_0096316
1467 Ga0495673_0020830
1468 Ga0495684_0008505
1469 Ga0495684_0089421
1470 Ga0495684_0381849
1471 Ga0495686_0074618
1472 Ga0495593_0000406
1473 Ga0495593_0054266
1474 Ga0495602_0005170
1475 Ga0495602_0012148
1476 Ga0495602_0017788
1477 Ga0495602_0025881
1478 Ga0495602_0153309
1479 Ga0495614_0013877
1480 Ga0495614_0103739
1481 Ga0496100_0014292
1482 Ga0496101_0408759
1483 Ga0496102_0028833
1484 Ga0496102_0096793
1485 Ga0496102_0487748
1486 Ga0496102_0622599
1487 Ga0496103_0242699
1488 Ga0496104_0000740
1489 Ga0496104_0386621
1490 Ga0496105_0018506
1491 Ga0496106_0002088
1492 Ga0496106_0110106
1493 Ga0496107_0066849
1494 Ga0496107_0081789
1495 Ga0496108_0000449
1496 Ga0496108_0001075
1497 Ga0496109_0002544
1498 Ga0496109_0004948
1499 Ga0496109_0625840
1500 Ga0496110_0008032
1501 Ga0496110_0275443
1502 Ga0496111_0033862
1503 Ga0496111_0122137
1504 Ga0496112_0006031
1505 Ga0496112_0083677
1506 Ga0496112_0231068
1507 Ga0496113_0001942
1508 Ga0496114_0458645
1509 Ga0496116_0011742
1510 Ga0496117_0002204
1511 Ga0496117_0057126
1512 Ga0496119_0019343
1513 Ga0496119_0088747
1514 Ga0496119_0132032
1515 Ga0496119_0137958
1516 Ga0496120_0003090
1517 Ga0496120_0166544
1518 Ga0496120_0177487
1519 Ga0496121_0000500
1520 Ga0496121_0001203
1521 Ga0496121_0097616
1522 Ga0496121_0107722
1523 Ga0496121_0129673
1524 Ga0496121_0315036
1525 Ga0496122_0004346
1526 Ga0496122_0042654
1527 Ga0496122_0074967
1528 Ga0496123_0000103
1529 Ga0496123_0032651
1530 Ga0496123_0097351
1531 Ga0496124_0005072
1532 Ga0496124_0057457
1533 Ga0496125_0000154
1534 Ga0496125_0000879
1535 Ga0496125_0217618
1536 Ga0496126_0001336
1537 Ga0496126_0006815
1538 Ga0496126_0012132
1539 Ga0496126_0012891
1540 Ga0496126_0050759
1541 Ga0496126_0058933
1542 Ga0496126_0100519
1543 Ga0496126_0172975
1544 Ga0496126_0197255
1545 Ga0501031_0000036
1546 Ga0501031_0001531
1547 Ga0501031_0001871
1548 Ga0501031_0035703
1549 Ga0501031_0083684
1550 Ga0501031_0137476
1551 Ga0501031_0154846
1552 Ga0501031_0217685
1553 Ga0501032_0000100
1554 Ga0501032_0000144
1555 Ga0501032_0000421
1556 Ga0501032_0015412
1557 Ga0501032_0027119
1558 Ga0501032_0035557
1559 Ga0501032_0103174
1560 Ga0501032_0106489
1561 Ga0501032_0208710
1562 Ga0501032_0284314
1563 Ga0501033_0000088
1564 Ga0501033_0000124
1565 Ga0501033_0000206
1566 Ga0501033_0001695
1567 Ga0501033_0002152
1568 Ga0501033_0012955
1569 Ga0501033_0025755
1570 Ga0501033_0052909
1571 Ga0501033_0060131
1572 Ga0501033_0102387
1573 Ga0501033_0149548
1574 Ga0501034_0000159
1575 Ga0501034_0000397
1576 Ga0501034_0061784
1577 Ga0501034_0089811
1578 Ga0501034_0127329
1579 Ga0501034_0207525
1580 Ga0501034_0248233
1581 Ga0501034_0289450
1582 Ga0501034_0304802
1583 Ga0501034_0338685
1584 Ga0501034_0658412
1585 Ga0501034_0733023
1586 Ga0501036_0000039
1587 Ga0501036_0000056
1588 Ga0501036_0005635
1589 Ga0501036_0042683
1590 Ga0501036_0084382
1591 Ga0501036_0093225
1592 Ga0501036_0221352
1593 Ga0501036_0424919
1594 Ga0501037_0000119
1595 Ga0501037_0000181
1596 Ga0501037_0000247
1597 Ga0501037_0000396
1598 Ga0501037_0001963
1599 Ga0501037_0041465
1600 Ga0501037_0062969
1601 Ga0501037_0071116
1602 Ga0501037_0117480
1603 Ga0501037_0145479
1604 Ga0501037_0147533
1605 Ga0501037_0155128
1606 Ga0501037_0278606
1607 Ga0501037_0356785
1608 Ga0501038_0000041
1609 Ga0501038_0000098
1610 Ga0501038_0000371
1611 Ga0501038_0013061
1612 Ga0501038_0022184
1613 Ga0501038_0093320
1614 Ga0501038_0123608
1615 Ga0501038_0134942
1616 Ga0501038_0228125
1617 Ga0501038_0269727
1618 Ga0501038_0360356
1619 Ga0501039_0000013
1620 Ga0501039_0000853
1621 Ga0501039_0000926
1622 Ga0501039_0016084
1623 Ga0501039_0035142
1624 Ga0501039_0045031
1625 Ga0501039_0064691
1626 Ga0501039_0121317
1627 Ga0501039_0243546
1628 Ga0501040_0051279
1629 Ga0501040_0245630
1630 Ga0501041_0170403
1631 Ga0501042_0023910
1632 Ga0501042_0067668
1633 Ga0501042_0111391
1634 Ga0501042_0180403
1635 Ga0501043_0000008
1636 Ga0501043_0000202
1637 Ga0501043_0000498
1638 Ga0501043_0001500
1639 Ga0501043_0003541
1640 Ga0501043_0024793
1641 Ga0501043_0033474
1642 Ga0501043_0048171
1643 Ga0501043_0049416
1644 Ga0501043_0058488
1645 Ga0501043_0070501
1646 Ga0501043_0182142
1647 Ga0501043_0283127
1648 Ga0501046_0000397
1649 Ga0501046_0046453
1650 Ga0501046_0063507
1651 Ga0501046_0068316
1652 Ga0501046_0070822
1653 Ga0501046_0089401
1654 Ga0501046_0142522
1655 Ga0501046_0147866
1656 Ga0501046_0165024
1657 Ga0501046_0236184
1658 Ga0501046_0237702
1659 Ga0501046_0389374
1660 Ga0501047_0000288
1661 Ga0501047_0000392
1662 Ga0501047_0006231
1663 Ga0501047_0021920
1664 Ga0501047_0024115
1665 Ga0501047_0091355
1666 Ga0501047_0095674
1667 Ga0501047_0128910
1668 Ga0501047_0191388
1669 Ga0501047_0361827
1670 Ga0501047_0380699
1671 Ga0501048_0000834
1672 Ga0501048_0129345
1673 Ga0501048_0134387
1674 Ga0501048_0171714
1675 Ga0501048_0264014
1676 Ga0501067_0000333
1677 Ga0501067_0010498
1678 Ga0501067_0013258
1679 Ga0501067_0019085
1680 Ga0501067_0055840
1681 Ga0501068_0003723
1682 Ga0501068_0028630
1683 Ga0501069_0001610
1684 Ga0501069_0010029
1685 Ga0501069_0019384
1686 Ga0501069_0053827
1687 Ga0501069_0118107
1688 Ga0501069_0138129
1689 Ga0501070_0000175
1690 Ga0501070_0000264
1691 Ga0501070_0000476
1692 Ga0501070_0007787
1693 Ga0501070_0017987
1694 Ga0501070_0020560
1695 Ga0501070_0020934
1696 Ga0501070_0043206
1697 Ga0501070_0071314
1698 Ga0501070_0090664
1699 Ga0501070_0116227
1700 Ga0501071_0016378
1701 Ga0501072_0004129
1702 Ga0501072_0276654
1703 Ga0501073_0000034
1704 Ga0501073_0011018
1705 Ga0501073_0034023
1706 Ga0501073_0046674
1707 Ga0501073_0105423
1708 Ga0501073_0156779
1709 Ga0501073_0281453
1710 Ga0501074_0000016
1711 Ga0501074_0000395
1712 Ga0501074_0005501
1713 Ga0501074_0020725
1714 Ga0501074_0035325
1715 Ga0501074_0312954
1716 Ga0501076_0152018
1717 Ga0501079_0003579
1718 Ga0501079_0028231
1719 Ga0501079_0217056
1720 Ga0501080_0000846
1721 Ga0501080_0012000
1722 Ga0501080_0015856
1723 Ga0501080_0029605
1724 Ga0501080_0032773
1725 Ga0501080_0052040
1726 Ga0501080_0061934
1727 Ga0501080_0095411
1728 Ga0501080_0129525
1729 Ga0501080_0175361
1730 Ga0501080_0242350
1731 Ga0501083_0000035
1732 Ga0501083_0001286
1733 Ga0501083_0037718
1734 Ga0501083_0054077
1735 Ga0501035_0000011
1736 Ga0501035_0000053
1737 Ga0501035_0000137
1738 Ga0501035_0000155
1739 Ga0501035_0002015
1740 Ga0501035_0005448
1741 Ga0501035_0017260
1742 Ga0501035_0039642
1743 Ga0501035_0068402
1744 Ga0501035_0108767
1745 Ga0501035_0123606
1746 Ga0501035_0124084
1747 Ga0501035_0208643
1748 Ga0501035_0218339
1749 Ga0501035_0244195
1750 Ga0501035_0415234
1751 Ga0501035_0437522
1752 Ga0501035_0684418
1753 Ga0501044_0000011
1754 Ga0501044_0000214
1755 Ga0501044_0000393
1756 Ga0501044_0000431
1757 Ga0501044_0003054
1758 Ga0501044_0003281
1759 Ga0501044_0019399
1760 Ga0501044_0020202
1761 Ga0501044_0024315
1762 Ga0501044_0032428
1763 Ga0501044_0043264
1764 Ga0501044_0043882
1765 Ga0501044_0044832
1766 Ga0501044_0072449
1767 Ga0501044_0177814
1768 Ga0501044_0222222
1769 Ga0501044_0245096
1770 Ga0501044_0255665
1771 Ga0501044_0336315
1772 Ga0501045_0007978
1773 Ga0501045_0191335
1774 nmdc:mga03683_7659_c1
1775 nmdc:mga03n38_9312_c1
1776 nmdc:mga0yw44_219775_c1
1777 nmdc:mga0yw44_32262_c1
1778 nmdc:mga0yw44_95771_c1
1779 nmdc:mga0yw44_9790_c1
1780 nmdc:mga06z11_124599_c1
1781 nmdc:mga06z11_137634_c1
1782 nmdc:mga04h51_35256_c1
1783 nmdc:mga05p37_16081_c1
1784 nmdc:mga09592_314902_c1
1785 nmdc:mga06r32_553745_c1
1786 nmdc:mga08y16_144371_c1
1787 nmdc:mga0n895_152422_c1
1788 Ga0495612_0028966
1789 Ga0495612_0072861
1790 Ga0500610_0030879
1791 Ga0500635_0003040
1792 Ga0495655_0034272
1793 Ga0495619_0046133
1794 Ga0500583_0093219
1795 Ga0500641_0000965
1796 Ga0500650_0121401
1797 Ga0500554_003388
1798 Ga0500595_003756
1799 Ga0500595_016614
1800 Ga0500595_031129
1801 Ga0500595_066540
1802 Ga0500559_0173651
1803 Ga0500568_0014496
1804 Ga0500573_0003712
1805 Ga0500573_0007019
1806 Ga0500577_0000509
1807 Ga0500603_000410
1808 Ga0500604_0011263
1809 Ga0500616_0001510
1810 Ga0500627_0029275
1811 Ga0500627_0076537
1812 Ga0500627_0077622
1813 Ga0500636_0014172
1814 Ga0500636_0162871
1815 Ga0500637_0003231
1816 Ga0500567_126883
1817 Ga0501084_0008623
1818 Ga0501084_0101726
1819 Ga0501082_0018579
1820 Ga0501082_0018837
1821 Ga0501082_0027092
1822 2503201530
1823 2509113134
1824 2509143302
1825 2509396311
1826 2512931500
1827 2512959331
1828 2513612723
1829 2514420883
1830 2588517337
1831 2597813225
1832 2599936752
1833 2643771110
1834 2643776113
1835 2643794560
1836 2643840019
1837 2643984399
1838 2644109177
1839 2644151699
1840 2644153256
1841 2644311833
1842 2644330105
1843 2644543141
1844 2644617631
1845 2688598447
1846 2694631074
1847 2694636428
1848 2723575380
1849 2739307168
1850 2756675469
1851 2792749237
1852 2793283387
1853 2819242803
1854 2841739198
1855 2844007426
1856 2844163812
1857 2847675614
1858 2847692258
1859 2856319501
1860 2856327481
1861 2856334567
1862 2856340888
1863 2856344937
1864 2856352442
1865 2856358597
1866 2856369460
1867 2857351152
1868 2857371324
1869 2869169292
1870 2869172867
1871 2869237208
1872 2869244702
1873 2869253111
1874 2869260294
1875 2869272228
1876 2869284931
1877 2869286466
1878 2871434619
1879 2871442679
1880 2871444179
1881 2871457891
1882 2871462731
1883 2871469824
1884 2871475707
1885 2871494542
1886 2871501396
1887 2874103728
1888 2874112353
1889 2874122671
1890 2874132088
1891 2874145874
1892 2874149825
1893 2874158083
1894 2874168250
1895 2874169856
1896 2876368481
1897 2876380336
1898 2876386707
1899 2876398442
1900 2876400211
1901 2876409301
1902 2876416287
1903 2876422997
1904 2878040736
1905 2878731753
1906 2878745213
1907 2878751752
1908 2878758876
1909 2878765376
1910 2878773084
1911 2878777093
1912 2878784539
1913 2878793925
1914 2881151331
1915 2881155307
1916 2881167532
1917 2881853101
1918 2881853708
1919 2881867312
1920 2882636276
1921 2882912561
1922 2885309434
1923 2885317988
1924 2885323699
1925 2885330373
1926 2885337499
1927 2885356697
1928 2888339424
1929 2888346815
1930 2888355760
1931 2889017606
1932 2891376482
1933 2903451313
1934 2903503885
1935 2903504698
1936 2903527480
1937 2903533934
1938 2903546207
1939 2904664997
1940 2906314150
1941 2906327316
1942 2906330005
1943 2906360846
1944 2906366766
1945 2906372607
1946 2906387985
1947 2906405393
1948 2906408906
1949 2906420221
1950 2906432767
1951 2922134343
1952 2922152073
1953 2922162838
1954 2922178286
1955 2922188795
1956 2924715699
1957 2924728241
1958 2924743494
1959 2924764249
1960 2924783350
1961 2924789080
1962 2937815739
1963 2937824460
1964 2937839387
1965 2937862769
1966 2937870538
1967 2937882123
1968 2937896290
1969 2937978583
1970 2937988152
1971 2938000065
1972 2938022088
1973 2941500403
1974 2958040633
1975 2958056715
1976 2958057848
1977 2958064376
1978 2958089245
1979 2958096506
1980 2958105745
1981 2958111520
1982 2958118462
1983 2958125424
1984 2958130869
1985 2958138000
1986 2958146136
1987 2958170529
1988 2958173532
1989 2958184790
1990 2961082957
1991 2961119996
1992 2961131611
1993 2961138713
1994 2961168984
1995 2961176045
1996 2961185945
1997 2963647712
1998 2965024271
1999 2965031751
2000 2965038127
2001 2965045713
2002 2965051618
2003 2965066005
2004 2965094258
2005 2965108624
2006 2965117254
2007 2965122060
2008 2968001933
2009 2968009043
2010 2968018450
2011 2968090343
2012 2968096367
2013 2968098868
2014 2968116353
2015 2968120634
2016 2968129186
2017 2968138942
2018 2968177378
2019 2970471377
2020 2970491115
2021 2970508711
2022 2970514623
2023 2970528594
2024 2970539979
2025 2970544790
2026 2970552022
2027 2970560224
2028 2970599546
2029 2970620844
2030 2970628904
2031 2977827416
2032 2977830951
2033 2977845975
2034 2977854377
2035 2977859278
2036 2977867086
2037 2977875258
2038 2977904373
2039 2977911338
2040 2977924221
2041 2977941199
2042 2977942749
2043 2977957853
2044 2977974520
2045 2979717543
2046 2979766235
2047 2979774491
2048 2979781283
2049 2979796344
2050 2979811641
2051 2987638336
2052 2987645776
2053 2987654659
2054 2987665015
2055 2987669244
2056 2987676017
2057 2989355156
2058 2989775377
2059 2996314074
2060 2996345072
2061 2996350169
2062 2996391443
2063 3000140661
2064 3004168902
2065 3004194072
2066 3004196256
2067 3004205420
2068 3004215956
2069 3004223706
2070 3004235837
2071 3004246437
2072 3004254705
2073 3004274946
2074 3004276868
2075 3004290898
2076 3004334356
2077 637074599
2078 649872973
2079 8002289041
2080 8004301043
2081 8004314009
2082 8004365134
2083 8004380397
2084 8004393640
2085 8004402716
2086 8004450199
2087 8004634825
2088 8004640821
2089 8004703603
2090 8004709364
2091 8004720408
2092 8005246851
2093 8054560085
2094 8055620777

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

87

177

0.95

PF08241

Methyltransf_11

Methyltransferase domain

87

179

0.93

PF13649

Methyltransf_25

Methyltransferase domain

86

175

0.93

PF13847

Methyltransf_31

Methyltransferase domain

81

244

0.88

PF13489

Methyltransf_23

Methyltransferase domain

60

258

0.84

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

71

206

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9774 14 256
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9655 14 256
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9436 7 256
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9323 7 256
7phf-assembly2.cif.gz_D chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8502 33 129
ID Description Score Start End Superfamily
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9736 14 256 3.40.50.150
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9563 14 256 3.40.50.150
af_A0A0R0HV62_55_242_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8835 20 131 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8668 20 130 3.40.50.150
af_P9WK03_7_174_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.863 16 128 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A428QU34-F1-model_v4 Methyltransferase domain-containing protein 0.9775 2 256 GO:0030798
GO:0032259
AF-A0A0A1SRF0-F1-model_v4 Methyltransferase domain-containing protein 0.9764 1 256 GO:0030798
GO:0032259
AF-A0A526YVL1-F1-model_v4 Methyltransferase domain-containing protein 0.9737 62 256 GO:0030798
GO:0032259
AF-A0A0Q8BKD9-F1-model_v4 deleted 0.9733 1 256
AF-A0A0A1SRF0-F1-model_v4 Methyltransferase domain-containing protein 0.9726 1 256 GO:0030798
GO:0032259

Map