F488987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1047 | 339 | 2094 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300050005|Ga0501284_00052|Ga0501284_00052_22685_23389 |
| Length | 234 |
| Sequence | VLSVTRRRQATGHTRFTPLPVLIFGLNLPDSSIKSNQAINKMILPIVAYGAPILRTVAKDITPDYPGLAKLIEDMWETMYASNGVGLAAPQINRDIRLFVVDSSQIFENMDDDDDAKKYPDAPGIKQVFINAHIKSLNGEEWAYNEGCLSIPKIREDVYRSEEVVLEYVDENFESHTKTFNGISARVILHEYDHIEGKLFIDYLKPLKKRMLKGKLDDISKGKVRVDYKMTFQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 199 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 227 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 228 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 295 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 296 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 308 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 310 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 311 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 312 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 313 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 314 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 315 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 316 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 317 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 318 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 319 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 320 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 323 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 324 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 329 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 330 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 331 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 332 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 333 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 334 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 335 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 336 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 337 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 338 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 339 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0 |
| Isolates | 1.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.64 |
| Nodule | 0 |
| Rhizoplane | 0.48 |
| Rhizosphere | 90.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501284_00052 | 3300050005 | Bacteria | 43054 |
| 2 | JGI24740J21852_10025081 | 3300001979 | Bacteria | 2014 |
| 3 | JGI24033J26618_1027915 | 3300002155 | Bacteria | 749 |
| 4 | JGI24751J29686_10002768 | 3300002459 | Bacteria | 3527 |
| 5 | JGI25154J39366_1000854 | 3300002738 | Bacteria | 13221 |
| 6 | JGI25406J46586_10000164 | 3300003203 | Bacteria | 29453 |
| 7 | JGI25153J46596_10000259 | 3300003215 | Bacteria | 42646 |
| 8 | JGI25153J46596_10037826 | 3300003215 | Bacteria | 1529 |
| 9 | rootH1_10049724 | 3300003316 | Bacteria | 1887 |
| 10 | rootH2_10049481 | 3300003320 | Bacteria | 8238 |
| 11 | rootH2_10061731 | 3300003320 | Bacteria | 8243 |
| 12 | rootH2_10077478 | 3300003320 | Bacteria | 2626 |
| 13 | rootH2_10231120 | 3300003320 | Bacteria | 1364 |
| 14 | rootH2_10264992 | 3300003320 | Bacteria | 1687 |
| 15 | rootL2_10009667 | 3300003322 | Bacteria | 12380 |
| 16 | rootL2_10277905 | 3300003322 | Bacteria | 2997 |
| 17 | rootH1_10005105 | 3300003323 | Bacteria | 17579 |
| 18 | rootH1_10084867 | 3300003323 | Bacteria | 9308 |
| 19 | rootH1_10096535 | 3300003323 | Bacteria | 2838 |
| 20 | rootH1_10294837 | 3300003323 | Bacteria | 3208 |
| 21 | JGI25160J50197_1000890 | 3300003354 | Bacteria | 15723 |
| 22 | JGI25160J50197_1001617 | 3300003354 | Bacteria | 11069 |
| 23 | JGI25160J50197_1008782 | 3300003354 | Bacteria | 3817 |
| 24 | JGI25160J50197_1019271 | 3300003354 | Bacteria | 2097 |
| 25 | Ga0055526_1037364 | 3300003771 | Unclassified | 1271 |
| 26 | Ga0055528_1002738 | 3300003790 | Bacteria | 9236 |
| 27 | Ga0055530_10001045 | 3300003791 | Bacteria | 22009 |
| 28 | Ga0055543_1010568 | 3300004625 | Unclassified | 1928 |
| 29 | Ga0065165_1000102 | 3300005262 | Bacteria | 140917 |
| 30 | Ga0065165_1005334 | 3300005262 | Bacteria | 7305 |
| 31 | Ga0065165_1008566 | 3300005262 | Bacteria | 4757 |
| 32 | Ga0065714_10071790 | 3300005288 | Bacteria | 3494 |
| 33 | Ga0065714_10237391 | 3300005288 | Unclassified | 802 |
| 34 | Ga0065704_10076087 | 3300005289 | Bacteria | 5269 |
| 35 | Ga0065704_10176799 | 3300005289 | Bacteria | 1259 |
| 36 | Ga0065712_10077630 | 3300005290 | Bacteria | 3464 |
| 37 | Ga0065712_10092087 | 3300005290 | Bacteria | 2344 |
| 38 | Ga0065715_10005566 | 3300005293 | Unclassified | 3438 |
| 39 | Ga0065707_10272871 | 3300005295 | Bacteria | 1067 |
| 40 | Ga0070658_10496283 | 3300005327 | Bacteria | 1054 |
| 41 | Ga0070676_10014038 | 3300005328 | Bacteria | 4395 |
| 42 | Ga0070676_10416603 | 3300005328 | Bacteria | 938 |
| 43 | Ga0070683_100013449 | 3300005329 | Bacteria | 7137 |
| 44 | Ga0070683_100029539 | 3300005329 | Bacteria | 4964 |
| 45 | Ga0070683_100050705 | 3300005329 | Bacteria | 3843 |
| 46 | Ga0070683_100073584 | 3300005329 | Unclassified | 3190 |
| 47 | Ga0070683_100117751 | 3300005329 | Bacteria | 2508 |
| 48 | Ga0070683_100296627 | 3300005329 | Bacteria | 1537 |
| 49 | Ga0070683_100347161 | 3300005329 | Bacteria | 1413 |
| 50 | Ga0070690_100116466 | 3300005330 | Unclassified | 1789 |
| 51 | Ga0070690_100279252 | 3300005330 | Bacteria | 1191 |
| 52 | Ga0070670_100037676 | 3300005331 | Bacteria | 4160 |
| 53 | Ga0070670_100090795 | 3300005331 | Bacteria | 2625 |
| 54 | Ga0070670_100094000 | 3300005331 | Bacteria | 2579 |
| 55 | Ga0070670_100116859 | 3300005331 | Bacteria | 2300 |
| 56 | Ga0070670_100181776 | 3300005331 | Unclassified | 1826 |
| 57 | Ga0070677_10061911 | 3300005333 | Bacteria | 1546 |
| 58 | Ga0070677_10078169 | 3300005333 | Bacteria | 1409 |
| 59 | Ga0070677_10196881 | 3300005333 | Bacteria | 970 |
| 60 | Ga0070677_10202314 | 3300005333 | Unclassified | 959 |
| 61 | Ga0068869_100009985 | 3300005334 | Bacteria | 6173 |
| 62 | Ga0068869_100022928 | 3300005334 | Bacteria | 4306 |
| 63 | Ga0068869_100055657 | 3300005334 | Unclassified | 2883 |
| 64 | Ga0068869_100127384 | 3300005334 | Bacteria | 1954 |
| 65 | Ga0068869_100247953 | 3300005334 | Bacteria | 1421 |
| 66 | Ga0068869_100290617 | 3300005334 | Bacteria | 1317 |
| 67 | Ga0068869_100299384 | 3300005334 | Bacteria | 1298 |
| 68 | Ga0068869_100447076 | 3300005334 | Bacteria | 1071 |
| 69 | Ga0068869_100789960 | 3300005334 | Bacteria | 815 |
| 70 | Ga0068869_100832557 | 3300005334 | Bacteria | 795 |
| 71 | Ga0070666_10000028 | 3300005335 | Bacteria | 144796 |
| 72 | Ga0070666_10005690 | 3300005335 | Bacteria | 7645 |
| 73 | Ga0070666_10057201 | 3300005335 | Bacteria | 2635 |
| 74 | Ga0070666_10059242 | 3300005335 | Bacteria | 2590 |
| 75 | Ga0070666_10322691 | 3300005335 | Bacteria | 1102 |
| 76 | Ga0070680_100000254 | 3300005336 | Bacteria | 35204 |
| 77 | Ga0070680_100442157 | 3300005336 | Bacteria | 1110 |
| 78 | Ga0070680_101027924 | 3300005336 | Bacteria | 712 |
| 79 | Ga0070682_100000190 | 3300005337 | Bacteria | 46394 |
| 80 | Ga0070682_100000549 | 3300005337 | Bacteria | 23315 |
| 81 | Ga0070682_100007803 | 3300005337 | Bacteria | 6026 |
| 82 | Ga0070682_100377542 | 3300005337 | Unclassified | 1065 |
| 83 | Ga0070682_100547673 | 3300005337 | Bacteria | 905 |
| 84 | Ga0070682_100658926 | 3300005337 | Bacteria | 834 |
| 85 | Ga0068868_100001540 | 3300005338 | Bacteria | 15748 |
| 86 | Ga0068868_100010912 | 3300005338 | Bacteria | 6593 |
| 87 | Ga0068868_100043201 | 3300005338 | Bacteria | 3520 |
| 88 | Ga0068868_100075207 | 3300005338 | Bacteria | 2699 |
| 89 | Ga0068868_100140702 | 3300005338 | Bacteria | 1981 |
| 90 | Ga0068868_100149964 | 3300005338 | Bacteria | 1920 |
| 91 | Ga0068868_100406995 | 3300005338 | Bacteria | 1175 |
| 92 | Ga0068868_100621513 | 3300005338 | Bacteria | 959 |
| 93 | Ga0070660_100095469 | 3300005339 | Bacteria | 2350 |
| 94 | Ga0070660_100128342 | 3300005339 | Bacteria | 2028 |
| 95 | Ga0070660_100283216 | 3300005339 | Bacteria | 1356 |
| 96 | Ga0070660_100405787 | 3300005339 | Bacteria | 1127 |
| 97 | Ga0070689_100001483 | 3300005340 | Bacteria | 14964 |
| 98 | Ga0070689_100004391 | 3300005340 | Bacteria | 9521 |
| 99 | Ga0070689_100228638 | 3300005340 | Bacteria | 1528 |
| 100 | Ga0070689_100384396 | 3300005340 | Unclassified | 1184 |
| 101 | Ga0070689_100419012 | 3300005340 | Bacteria | 1134 |
| 102 | Ga0070691_10000748 | 3300005341 | Bacteria | 12807 |
| 103 | Ga0070691_10055582 | 3300005341 | Unclassified | 1896 |
| 104 | Ga0070687_100109830 | 3300005343 | Bacteria | 1559 |
| 105 | Ga0070687_100156075 | 3300005343 | Unclassified | 1344 |
| 106 | Ga0070661_100007303 | 3300005344 | Bacteria | 7621 |
| 107 | Ga0070661_100037273 | 3300005344 | Bacteria | 3536 |
| 108 | Ga0070692_10296988 | 3300005345 | Bacteria | 985 |
| 109 | Ga0070692_10328003 | 3300005345 | Bacteria | 944 |
| 110 | Ga0070669_100000458 | 3300005353 | Bacteria | 30951 |
| 111 | Ga0070669_100026149 | 3300005353 | Unclassified | 4198 |
| 112 | Ga0070669_100031608 | 3300005353 | Bacteria | 3824 |
| 113 | Ga0070669_100124832 | 3300005353 | Bacteria | 1968 |
| 114 | Ga0070669_100181644 | 3300005353 | Bacteria | 1646 |
| 115 | Ga0070669_100678601 | 3300005353 | Bacteria | 869 |
| 116 | Ga0070675_100006330 | 3300005354 | Bacteria | 9088 |
| 117 | Ga0070675_100084712 | 3300005354 | Bacteria | 2647 |
| 118 | Ga0070675_100141965 | 3300005354 | Bacteria | 2053 |
| 119 | Ga0070675_100152186 | 3300005354 | Bacteria | 1984 |
| 120 | Ga0070675_100392754 | 3300005354 | Bacteria | 1236 |
| 121 | Ga0070675_100411791 | 3300005354 | Bacteria | 1207 |
| 122 | Ga0070675_100855142 | 3300005354 | Bacteria | 833 |
| 123 | Ga0070671_100401446 | 3300005355 | Bacteria | 1173 |
| 124 | Ga0070671_100405368 | 3300005355 | Bacteria | 1167 |
| 125 | Ga0070671_100517966 | 3300005355 | Bacteria | 1027 |
| 126 | Ga0070671_101071431 | 3300005355 | Bacteria | 707 |
| 127 | Ga0070674_100311522 | 3300005356 | Unclassified | 1259 |
| 128 | Ga0070674_100638206 | 3300005356 | Bacteria | 904 |
| 129 | Ga0070674_100891995 | 3300005356 | Unclassified | 774 |
| 130 | Ga0070673_100006930 | 3300005364 | Bacteria | 7414 |
| 131 | Ga0070673_100041630 | 3300005364 | Bacteria | 3536 |
| 132 | Ga0070673_100049130 | 3300005364 | Bacteria | 3292 |
| 133 | Ga0070673_100062586 | 3300005364 | Bacteria | 2957 |
| 134 | Ga0070673_100131518 | 3300005364 | Bacteria | 2100 |
| 135 | Ga0070673_100293197 | 3300005364 | Bacteria | 1430 |
| 136 | Ga0070673_100374173 | 3300005364 | Bacteria | 1269 |
| 137 | Ga0070673_101225137 | 3300005364 | Bacteria | 703 |
| 138 | Ga0070688_100000687 | 3300005365 | Bacteria | 16799 |
| 139 | Ga0070688_100146709 | 3300005365 | Unclassified | 1608 |
| 140 | Ga0070688_100171013 | 3300005365 | Bacteria | 1500 |
| 141 | Ga0070688_100516849 | 3300005365 | Bacteria | 903 |
| 142 | Ga0070659_100008332 | 3300005366 | Bacteria | 7568 |
| 143 | Ga0070659_100063157 | 3300005366 | Bacteria | 2929 |
| 144 | Ga0070659_100290228 | 3300005366 | Bacteria | 1362 |
| 145 | Ga0070659_100307568 | 3300005366 | Bacteria | 1323 |
| 146 | Ga0070659_100920340 | 3300005366 | Unclassified | 765 |
| 147 | Ga0070667_100011625 | 3300005367 | Bacteria | 7279 |
| 148 | Ga0070667_100045885 | 3300005367 | Bacteria | 3676 |
| 149 | Ga0070667_100047282 | 3300005367 | Bacteria | 3620 |
| 150 | Ga0070667_100079651 | 3300005367 | Unclassified | 2800 |
| 151 | Ga0070667_100746031 | 3300005367 | Bacteria | 907 |
| 152 | Ga0070713_100180781 | 3300005436 | Bacteria | 1895 |
| 153 | Ga0070701_10477048 | 3300005438 | Bacteria | 805 |
| 154 | Ga0070700_100505080 | 3300005441 | Unclassified | 931 |
| 155 | Ga0070694_100155193 | 3300005444 | Bacteria | 1675 |
| 156 | Ga0070663_100076860 | 3300005455 | Bacteria | 2443 |
| 157 | Ga0070663_100267077 | 3300005455 | Bacteria | 1359 |
| 158 | Ga0070663_100277146 | 3300005455 | Bacteria | 1335 |
| 159 | Ga0070663_100341629 | 3300005455 | Bacteria | 1210 |
| 160 | Ga0070663_100441265 | 3300005455 | Bacteria | 1071 |
| 161 | Ga0070678_100006600 | 3300005456 | Bacteria | 6821 |
| 162 | Ga0070678_100098546 | 3300005456 | Bacteria | 2260 |
| 163 | Ga0070678_100184284 | 3300005456 | Unclassified | 1712 |
| 164 | Ga0070678_100361397 | 3300005456 | Bacteria | 1251 |
| 165 | Ga0070662_100070054 | 3300005457 | Bacteria | 2583 |
| 166 | Ga0070662_100114618 | 3300005457 | Bacteria | 2058 |
| 167 | Ga0070662_100475171 | 3300005457 | Bacteria | 1040 |
| 168 | Ga0070681_10017972 | 3300005458 | Bacteria | 7066 |
| 169 | Ga0070681_10040427 | 3300005458 | Bacteria | 4672 |
| 170 | Ga0070681_10294279 | 3300005458 | Bacteria | 1533 |
| 171 | Ga0070681_10414461 | 3300005458 | Bacteria | 1259 |
| 172 | Ga0068867_100022159 | 3300005459 | Bacteria | 4539 |
| 173 | Ga0068867_100027695 | 3300005459 | Unclassified | 4076 |
| 174 | Ga0068867_100052640 | 3300005459 | Unclassified | 3005 |
| 175 | Ga0068867_100126326 | 3300005459 | Unclassified | 1982 |
| 176 | Ga0068867_100233197 | 3300005459 | Bacteria | 1489 |
| 177 | Ga0068867_100545865 | 3300005459 | Bacteria | 1003 |
| 178 | Ga0068867_100561967 | 3300005459 | Unclassified | 990 |
| 179 | Ga0068867_100784590 | 3300005459 | Unclassified | 848 |
| 180 | Ga0068867_100913255 | 3300005459 | Unclassified | 791 |
| 181 | Ga0070685_10004614 | 3300005466 | Bacteria | 6972 |
| 182 | Ga0070685_10069690 | 3300005466 | Bacteria | 2080 |
| 183 | Ga0070685_10726596 | 3300005466 | Bacteria | 726 |
| 184 | Ga0070698_100000219 | 3300005471 | Bacteria | 56179 |
| 185 | Ga0070698_100009802 | 3300005471 | Bacteria | 10239 |
| 186 | Ga0070698_100025806 | 3300005471 | Bacteria | 6124 |
| 187 | Ga0070679_100003985 | 3300005530 | Bacteria | 13601 |
| 188 | Ga0070679_100057881 | 3300005530 | Bacteria | 3863 |
| 189 | Ga0070679_100153326 | 3300005530 | Bacteria | 2280 |
| 190 | Ga0070684_100003664 | 3300005535 | Bacteria | 11592 |
| 191 | Ga0070684_100014418 | 3300005535 | Bacteria | 6404 |
| 192 | Ga0070684_100252510 | 3300005535 | Bacteria | 1612 |
| 193 | Ga0070684_100302277 | 3300005535 | Bacteria | 1468 |
| 194 | Ga0070684_100363838 | 3300005535 | Bacteria | 1331 |
| 195 | Ga0070684_100490222 | 3300005535 | Bacteria | 1138 |
| 196 | Ga0068853_100001343 | 3300005539 | Bacteria | 17728 |
| 197 | Ga0068853_100007345 | 3300005539 | Bacteria | 8818 |
| 198 | Ga0068853_100123476 | 3300005539 | Bacteria | 2312 |
| 199 | Ga0068853_100284071 | 3300005539 | Bacteria | 1526 |
| 200 | Ga0068853_100290920 | 3300005539 | Bacteria | 1508 |
| 201 | Ga0068853_100672050 | 3300005539 | Bacteria | 987 |
| 202 | Ga0070672_100019519 | 3300005543 | Bacteria | 4921 |
| 203 | Ga0070672_100031816 | 3300005543 | Bacteria | 3976 |
| 204 | Ga0070672_100064678 | 3300005543 | Bacteria | 2890 |
| 205 | Ga0070672_100373162 | 3300005543 | Unclassified | 1219 |
| 206 | Ga0070672_100380193 | 3300005543 | Bacteria | 1208 |
| 207 | Ga0070672_100565885 | 3300005543 | Bacteria | 988 |
| 208 | Ga0070686_100019060 | 3300005544 | Bacteria | 4037 |
| 209 | Ga0070686_100031948 | 3300005544 | Bacteria | 3224 |
| 210 | Ga0070693_100003063 | 3300005547 | Bacteria | 7755 |
| 211 | Ga0070693_100247695 | 3300005547 | Bacteria | 1180 |
| 212 | Ga0070693_100306683 | 3300005547 | Bacteria | 1072 |
| 213 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 214 | Ga0070665_100360212 | 3300005548 | Bacteria | 1460 |
| 215 | Ga0068855_100000630 | 3300005563 | Bacteria | 43230 |
| 216 | Ga0068855_100005487 | 3300005563 | Bacteria | 15473 |
| 217 | Ga0068855_100028908 | 3300005563 | Bacteria | 6632 |
| 218 | Ga0068855_100037238 | 3300005563 | Bacteria | 5787 |
| 219 | Ga0068855_100073503 | 3300005563 | Bacteria | 3972 |
| 220 | Ga0068855_100287554 | 3300005563 | Bacteria | 1823 |
| 221 | Ga0070664_100007338 | 3300005564 | Bacteria | 8885 |
| 222 | Ga0070664_100030034 | 3300005564 | Bacteria | 4532 |
| 223 | Ga0070664_100036214 | 3300005564 | Bacteria | 4146 |
| 224 | Ga0070664_100070880 | 3300005564 | Bacteria | 2986 |
| 225 | Ga0070664_100094111 | 3300005564 | Bacteria | 2598 |
| 226 | Ga0070664_100122024 | 3300005564 | Bacteria | 2283 |
| 227 | Ga0070664_100179763 | 3300005564 | Bacteria | 1880 |
| 228 | Ga0070664_100230408 | 3300005564 | Bacteria | 1660 |
| 229 | Ga0068857_100004171 | 3300005577 | Bacteria | 12171 |
| 230 | Ga0068857_100089405 | 3300005577 | Bacteria | 2756 |
| 231 | Ga0068857_100090375 | 3300005577 | Bacteria | 2740 |
| 232 | Ga0068857_100246128 | 3300005577 | Bacteria | 1638 |
| 233 | Ga0068854_100046365 | 3300005578 | Bacteria | 3095 |
| 234 | Ga0068854_100069907 | 3300005578 | Bacteria | 2565 |
| 235 | Ga0068854_100103837 | 3300005578 | Bacteria | 2134 |
| 236 | Ga0068854_101099045 | 3300005578 | Bacteria | 708 |
| 237 | Ga0068856_100024544 | 3300005614 | Bacteria | 5870 |
| 238 | Ga0068856_100122878 | 3300005614 | Bacteria | 2599 |
| 239 | Ga0068856_100318760 | 3300005614 | Bacteria | 1572 |
| 240 | Ga0068856_100777811 | 3300005614 | Bacteria | 977 |
| 241 | Ga0068856_100845020 | 3300005614 | Bacteria | 935 |
| 242 | Ga0070702_100013206 | 3300005615 | Bacteria | 4164 |
| 243 | Ga0070702_100103743 | 3300005615 | Bacteria | 1749 |
| 244 | Ga0070702_100284434 | 3300005615 | Bacteria | 1137 |
| 245 | Ga0068852_100004976 | 3300005616 | Bacteria | 9451 |
| 246 | Ga0068852_100011415 | 3300005616 | Bacteria | 6687 |
| 247 | Ga0068852_100026143 | 3300005616 | Bacteria | 4740 |
| 248 | Ga0068852_100120953 | 3300005616 | Bacteria | 2397 |
| 249 | Ga0068852_100142563 | 3300005616 | Bacteria | 2219 |
| 250 | Ga0068852_100203692 | 3300005616 | Bacteria | 1873 |
| 251 | Ga0068852_100222964 | 3300005616 | Bacteria | 1794 |
| 252 | Ga0068852_100386815 | 3300005616 | Bacteria | 1373 |
| 253 | Ga0068852_100458946 | 3300005616 | Bacteria | 1263 |
| 254 | Ga0068852_100706956 | 3300005616 | Bacteria | 1018 |
| 255 | Ga0068852_100741205 | 3300005616 | Unclassified | 994 |
| 256 | Ga0068852_101220381 | 3300005616 | Bacteria | 773 |
| 257 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 258 | Ga0068859_100004526 | 3300005617 | Bacteria | 14178 |
| 259 | Ga0068859_100010347 | 3300005617 | Bacteria | 9388 |
| 260 | Ga0068859_100014457 | 3300005617 | Bacteria | 7923 |
| 261 | Ga0068859_100071266 | 3300005617 | Bacteria | 3511 |
| 262 | Ga0068859_100120114 | 3300005617 | Bacteria | 2695 |
| 263 | Ga0068859_100375174 | 3300005617 | Bacteria | 1518 |
| 264 | Ga0068859_100507848 | 3300005617 | Bacteria | 1301 |
| 265 | Ga0068859_100739931 | 3300005617 | Bacteria | 1072 |
| 266 | Ga0068859_100747328 | 3300005617 | Bacteria | 1067 |
| 267 | Ga0068864_100007320 | 3300005618 | Bacteria | 9082 |
| 268 | Ga0068864_100192037 | 3300005618 | Bacteria | 1872 |
| 269 | Ga0068864_100323996 | 3300005618 | Viruses | 1448 |
| 270 | Ga0068864_100344148 | 3300005618 | Unclassified | 1406 |
| 271 | Ga0068864_100463490 | 3300005618 | Bacteria | 1214 |
| 272 | Ga0068864_100465159 | 3300005618 | Unclassified | 1212 |
| 273 | Ga0068864_100688630 | 3300005618 | Bacteria | 998 |
| 274 | Ga0068864_101538435 | 3300005618 | Bacteria | 669 |
| 275 | Ga0068866_10206201 | 3300005718 | Bacteria | 1177 |
| 276 | Ga0068866_10417001 | 3300005718 | Bacteria | 870 |
| 277 | Ga0068861_100001813 | 3300005719 | Bacteria | 13764 |
| 278 | Ga0068861_100011572 | 3300005719 | Bacteria | 6139 |
| 279 | Ga0068861_100204084 | 3300005719 | Unclassified | 1661 |
| 280 | Ga0068861_100392829 | 3300005719 | Bacteria | 1229 |
| 281 | Ga0068861_100599183 | 3300005719 | Bacteria | 1011 |
| 282 | Ga0068861_100860256 | 3300005719 | Unclassified | 856 |
| 283 | Ga0068851_10020246 | 3300005834 | Bacteria | 3219 |
| 284 | Ga0068851_10083720 | 3300005834 | Bacteria | 1670 |
| 285 | Ga0068851_10086511 | 3300005834 | Bacteria | 1645 |
| 286 | Ga0068851_10129479 | 3300005834 | Viruses | 1363 |
| 287 | Ga0068863_100002125 | 3300005841 | Bacteria | 19657 |
| 288 | Ga0068863_100009422 | 3300005841 | Bacteria | 9532 |
| 289 | Ga0068863_100169946 | 3300005841 | Bacteria | 2091 |
| 290 | Ga0068863_100202796 | 3300005841 | Bacteria | 1908 |
| 291 | Ga0068863_100701945 | 3300005841 | Unclassified | 1006 |
| 292 | Ga0068863_100712513 | 3300005841 | Bacteria | 998 |
| 293 | Ga0068863_100783365 | 3300005841 | Bacteria | 950 |
| 294 | Ga0068863_100807234 | 3300005841 | Bacteria | 936 |
| 295 | Ga0068863_100823234 | 3300005841 | Bacteria | 926 |
| 296 | Ga0068858_100090776 | 3300005842 | Bacteria | 2843 |
| 297 | Ga0068858_100376187 | 3300005842 | Unclassified | 1362 |
| 298 | Ga0068858_100657670 | 3300005842 | Bacteria | 1018 |
| 299 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 300 | Ga0068860_100015531 | 3300005843 | Bacteria | 7435 |
| 301 | Ga0068860_100017189 | 3300005843 | Bacteria | 7051 |
| 302 | Ga0068860_100020290 | 3300005843 | Bacteria | 6437 |
| 303 | Ga0068860_100078259 | 3300005843 | Unclassified | 3144 |
| 304 | Ga0068860_100206597 | 3300005843 | Bacteria | 1905 |
| 305 | Ga0068860_100378120 | 3300005843 | Bacteria | 1398 |
| 306 | Ga0068860_100428753 | 3300005843 | Bacteria | 1312 |
| 307 | Ga0068860_100434036 | 3300005843 | Bacteria | 1304 |
| 308 | Ga0068862_100003547 | 3300005844 | Bacteria | 13375 |
| 309 | Ga0068862_100107535 | 3300005844 | Bacteria | 2445 |
| 310 | Ga0068862_100282775 | 3300005844 | Bacteria | 1521 |
| 311 | Ga0068862_100853229 | 3300005844 | Bacteria | 893 |
| 312 | Ga0081540_1008965 | 3300005983 | Bacteria | 6923 |
| 313 | Ga0081539_10000042 | 3300005985 | Bacteria | 289955 |
| 314 | Ga0081539_10032798 | 3300005985 | Bacteria | 3174 |
| 315 | Ga0070715_10222793 | 3300006163 | Bacteria | 971 |
| 316 | Ga0070716_100390672 | 3300006173 | Bacteria | 997 |
| 317 | Ga0097621_100057279 | 3300006237 | Bacteria | 3186 |
| 318 | Ga0097621_100107620 | 3300006237 | Unclassified | 2353 |
| 319 | Ga0097621_100292046 | 3300006237 | Bacteria | 1437 |
| 320 | Ga0097621_100370617 | 3300006237 | Bacteria | 1277 |
| 321 | Ga0068871_100081845 | 3300006358 | Bacteria | 2676 |
| 322 | Ga0068871_100086180 | 3300006358 | Bacteria | 2609 |
| 323 | Ga0068871_100115270 | 3300006358 | Bacteria | 2265 |
| 324 | Ga0068871_100198471 | 3300006358 | Unclassified | 1731 |
| 325 | Ga0068871_100220412 | 3300006358 | Bacteria | 1643 |
| 326 | Ga0068871_100230205 | 3300006358 | Bacteria | 1608 |
| 327 | Ga0068871_100252862 | 3300006358 | Bacteria | 1535 |
| 328 | Ga0068871_100370115 | 3300006358 | Unclassified | 1271 |
| 329 | Ga0068871_100425746 | 3300006358 | Unclassified | 1186 |
| 330 | Ga0068871_100463045 | 3300006358 | Bacteria | 1138 |
| 331 | Ga0068871_100510246 | 3300006358 | Bacteria | 1085 |
| 332 | Ga0075428_100003382 | 3300006844 | Bacteria | 17450 |
| 333 | Ga0075428_100030666 | 3300006844 | Bacteria | 5945 |
| 334 | Ga0075428_100474460 | 3300006844 | Bacteria | 1339 |
| 335 | Ga0075430_100225793 | 3300006846 | Bacteria | 1553 |
| 336 | Ga0075431_100026919 | 3300006847 | Bacteria | 5898 |
| 337 | Ga0075431_100036042 | 3300006847 | Bacteria | 5095 |
| 338 | Ga0075433_10531426 | 3300006852 | Bacteria | 1034 |
| 339 | Ga0075434_100493072 | 3300006871 | Bacteria | 1246 |
| 340 | Ga0075429_100048056 | 3300006880 | Bacteria | 3711 |
| 341 | Ga0068865_100047650 | 3300006881 | Unclassified | 2946 |
| 342 | Ga0068865_100117865 | 3300006881 | Bacteria | 1969 |
| 343 | Ga0068865_100618438 | 3300006881 | Bacteria | 917 |
| 344 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 345 | Ga0097620_100004526 | 3300006931 | Bacteria | 14178 |
| 346 | Ga0097620_100010347 | 3300006931 | Bacteria | 9388 |
| 347 | Ga0097620_100014457 | 3300006931 | Bacteria | 7923 |
| 348 | Ga0097620_100071265 | 3300006931 | Bacteria | 3511 |
| 349 | Ga0097620_100120114 | 3300006931 | Bacteria | 2695 |
| 350 | Ga0097620_100375200 | 3300006931 | Bacteria | 1518 |
| 351 | Ga0097620_100507830 | 3300006931 | Bacteria | 1301 |
| 352 | Ga0097620_100739914 | 3300006931 | Bacteria | 1072 |
| 353 | Ga0097620_100747387 | 3300006931 | Bacteria | 1067 |
| 354 | Ga0105240_10001517 | 3300009093 | Bacteria | 39516 |
| 355 | Ga0105240_10002254 | 3300009093 | Bacteria | 31303 |
| 356 | Ga0105240_10002716 | 3300009093 | Bacteria | 28079 |
| 357 | Ga0105240_10002823 | 3300009093 | Bacteria | 27474 |
| 358 | Ga0105240_10003383 | 3300009093 | Bacteria | 24801 |
| 359 | Ga0105240_10015666 | 3300009093 | Bacteria | 10295 |
| 360 | Ga0105240_10021041 | 3300009093 | Bacteria | 8682 |
| 361 | Ga0105240_10081433 | 3300009093 | Bacteria | 3978 |
| 362 | Ga0105240_10164323 | 3300009093 | Bacteria | 2634 |
| 363 | Ga0105240_10187700 | 3300009093 | Bacteria | 2433 |
| 364 | Ga0105240_10273610 | 3300009093 | Bacteria | 1943 |
| 365 | Ga0105240_10618002 | 3300009093 | Unclassified | 1191 |
| 366 | Ga0105240_10725922 | 3300009093 | Unclassified | 1082 |
| 367 | Ga0105240_10897855 | 3300009093 | Bacteria | 953 |
| 368 | Ga0111539_10006834 | 3300009094 | Bacteria | 14661 |
| 369 | Ga0111539_10019555 | 3300009094 | Bacteria | 8355 |
| 370 | Ga0111539_10232439 | 3300009094 | Bacteria | 2147 |
| 371 | Ga0111539_10234999 | 3300009094 | Bacteria | 2134 |
| 372 | Ga0111539_10260807 | 3300009094 | Unclassified | 2017 |
| 373 | Ga0111539_11182592 | 3300009094 | Bacteria | 888 |
| 374 | Ga0105245_11719557 | 3300009098 | Bacteria | 680 |
| 375 | Ga0105247_10008343 | 3300009101 | Bacteria | 6317 |
| 376 | Ga0105247_10070853 | 3300009101 | Bacteria | 2179 |
| 377 | Ga0114129_10027554 | 3300009147 | Bacteria | 8044 |
| 378 | Ga0114129_10029791 | 3300009147 | Bacteria | 7728 |
| 379 | Ga0105241_10000231 | 3300009174 | Bacteria | 42173 |
| 380 | Ga0105241_10000619 | 3300009174 | Bacteria | 26737 |
| 381 | Ga0105241_10001092 | 3300009174 | Bacteria | 20657 |
| 382 | Ga0105241_10037436 | 3300009174 | Bacteria | 3655 |
| 383 | Ga0105241_10225592 | 3300009174 | Bacteria | 1577 |
| 384 | Ga0105241_10279067 | 3300009174 | Bacteria | 1426 |
| 385 | Ga0105241_10554826 | 3300009174 | Bacteria | 1032 |
| 386 | Ga0105241_10884921 | 3300009174 | Bacteria | 828 |
| 387 | Ga0105241_10913572 | 3300009174 | Bacteria | 816 |
| 388 | Ga0105242_10003805 | 3300009176 | Bacteria | 11735 |
| 389 | Ga0105242_10025765 | 3300009176 | Bacteria | 4658 |
| 390 | Ga0105242_10038298 | 3300009176 | Bacteria | 3855 |
| 391 | Ga0105242_10071482 | 3300009176 | Bacteria | 2879 |
| 392 | Ga0105248_10679772 | 3300009177 | Unclassified | 1161 |
| 393 | Ga0105248_10788518 | 3300009177 | Bacteria | 1072 |
| 394 | Ga0105237_10005413 | 3300009545 | Bacteria | 14415 |
| 395 | Ga0105237_10007560 | 3300009545 | Bacteria | 11876 |
| 396 | Ga0105237_10016964 | 3300009545 | Bacteria | 7554 |
| 397 | Ga0105237_10023757 | 3300009545 | Bacteria | 6275 |
| 398 | Ga0105237_10027549 | 3300009545 | Bacteria | 5798 |
| 399 | Ga0105237_10086164 | 3300009545 | Unclassified | 3131 |
| 400 | Ga0105237_10131036 | 3300009545 | Bacteria | 2502 |
| 401 | Ga0105237_10177889 | 3300009545 | Bacteria | 2128 |
| 402 | Ga0105237_10209474 | 3300009545 | Bacteria | 1949 |
| 403 | Ga0105237_10385868 | 3300009545 | Bacteria | 1406 |
| 404 | Ga0105238_10004513 | 3300009551 | Bacteria | 13799 |
| 405 | Ga0105238_10364486 | 3300009551 | Bacteria | 1435 |
| 406 | Ga0105249_10002774 | 3300009553 | Bacteria | 15117 |
| 407 | Ga0105249_10014173 | 3300009553 | Bacteria | 7047 |
| 408 | Ga0105249_10022623 | 3300009553 | Bacteria | 5632 |
| 409 | Ga0105249_10049007 | 3300009553 | Bacteria | 3852 |
| 410 | Ga0105249_10055586 | 3300009553 | Bacteria | 3622 |
| 411 | Ga0105249_10103085 | 3300009553 | Bacteria | 2686 |
| 412 | Ga0105249_10379783 | 3300009553 | Bacteria | 1439 |
| 413 | Ga0105249_10574731 | 3300009553 | Bacteria | 1180 |
| 414 | Ga0105249_10651888 | 3300009553 | Bacteria | 1110 |
| 415 | Ga0105249_11113549 | 3300009553 | Unclassified | 860 |
| 416 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 417 | Ga0105239_10003203 | 3300010375 | Bacteria | 20233 |
| 418 | Ga0105239_10008174 | 3300010375 | Bacteria | 11935 |
| 419 | Ga0105239_10331963 | 3300010375 | Bacteria | 1715 |
| 420 | Ga0105239_10440608 | 3300010375 | Bacteria | 1477 |
| 421 | Ga0105239_10447065 | 3300010375 | Bacteria | 1466 |
| 422 | Ga0105239_11050730 | 3300010375 | Unclassified | 937 |
| 423 | Ga0105246_10119171 | 3300011119 | Bacteria | 1952 |
| 424 | Ga0157373_10018157 | 3300013100 | Bacteria | 5123 |
| 425 | Ga0157373_10035635 | 3300013100 | Bacteria | 3572 |
| 426 | Ga0157373_10082332 | 3300013100 | Bacteria | 2268 |
| 427 | Ga0157373_10095360 | 3300013100 | Bacteria | 2094 |
| 428 | Ga0157373_10158556 | 3300013100 | Bacteria | 1592 |
| 429 | Ga0157373_10371618 | 3300013100 | Bacteria | 1022 |
| 430 | Ga0157371_10001955 | 3300013102 | Bacteria | 20487 |
| 431 | Ga0157371_10002374 | 3300013102 | Bacteria | 18004 |
| 432 | Ga0157371_10003617 | 3300013102 | Bacteria | 13918 |
| 433 | Ga0157371_10007345 | 3300013102 | Bacteria | 8935 |
| 434 | Ga0157371_10009513 | 3300013102 | Bacteria | 7642 |
| 435 | Ga0157371_10011624 | 3300013102 | Bacteria | 6768 |
| 436 | Ga0157371_10028051 | 3300013102 | Bacteria | 4079 |
| 437 | Ga0157371_10029334 | 3300013102 | Bacteria | 3980 |
| 438 | Ga0157371_10033466 | 3300013102 | Bacteria | 3693 |
| 439 | Ga0157371_10044152 | 3300013102 | Bacteria | 3174 |
| 440 | Ga0157371_10075177 | 3300013102 | Bacteria | 2392 |
| 441 | Ga0157371_10112864 | 3300013102 | Bacteria | 1929 |
| 442 | Ga0157371_10165955 | 3300013102 | Unclassified | 1577 |
| 443 | Ga0157371_10409092 | 3300013102 | Bacteria | 993 |
| 444 | Ga0157371_10798138 | 3300013102 | Bacteria | 711 |
| 445 | Ga0157370_10003422 | 3300013104 | Bacteria | 18636 |
| 446 | Ga0157370_10005999 | 3300013104 | Bacteria | 13518 |
| 447 | Ga0157370_10009965 | 3300013104 | Bacteria | 10055 |
| 448 | Ga0157370_10047147 | 3300013104 | Bacteria | 4131 |
| 449 | Ga0157370_10079950 | 3300013104 | Bacteria | 3079 |
| 450 | Ga0157370_10246888 | 3300013104 | Bacteria | 1651 |
| 451 | Ga0157370_10413629 | 3300013104 | Bacteria | 1241 |
| 452 | Ga0157370_10575451 | 3300013104 | Unclassified | 1032 |
| 453 | Ga0157370_10650475 | 3300013104 | Bacteria | 963 |
| 454 | Ga0157370_10732849 | 3300013104 | Unclassified | 901 |
| 455 | Ga0157370_10818956 | 3300013104 | Bacteria | 847 |
| 456 | Ga0157369_10019398 | 3300013105 | Bacteria | 7607 |
| 457 | Ga0157369_10025207 | 3300013105 | Bacteria | 6603 |
| 458 | Ga0157369_10038758 | 3300013105 | Bacteria | 5210 |
| 459 | Ga0157369_10065152 | 3300013105 | Bacteria | 3922 |
| 460 | Ga0157369_10082277 | 3300013105 | Bacteria | 3444 |
| 461 | Ga0157369_10180385 | 3300013105 | Bacteria | 2222 |
| 462 | Ga0157369_10221881 | 3300013105 | Bacteria | 1978 |
| 463 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 464 | Ga0157374_10007434 | 3300013296 | Bacteria | 9343 |
| 465 | Ga0157374_10040762 | 3300013296 | Bacteria | 4278 |
| 466 | Ga0157374_10074742 | 3300013296 | Bacteria | 3201 |
| 467 | Ga0157374_10278666 | 3300013296 | Bacteria | 1650 |
| 468 | Ga0157374_10491797 | 3300013296 | Bacteria | 1231 |
| 469 | Ga0157374_10618623 | 3300013296 | Bacteria | 1094 |
| 470 | Ga0157374_10628975 | 3300013296 | Bacteria | 1084 |
| 471 | Ga0157374_11119849 | 3300013296 | Bacteria | 808 |
| 472 | Ga0157374_11249695 | 3300013296 | Bacteria | 764 |
| 473 | Ga0157378_10009439 | 3300013297 | Bacteria | 8502 |
| 474 | Ga0157378_10078887 | 3300013297 | Bacteria | 2971 |
| 475 | Ga0157378_10090003 | 3300013297 | Bacteria | 2788 |
| 476 | Ga0157378_10096036 | 3300013297 | Bacteria | 2700 |
| 477 | Ga0157378_10103832 | 3300013297 | Bacteria | 2597 |
| 478 | Ga0157378_10168521 | 3300013297 | Unclassified | 2052 |
| 479 | Ga0157378_10336309 | 3300013297 | Bacteria | 1471 |
| 480 | Ga0157378_10534639 | 3300013297 | Bacteria | 1175 |
| 481 | Ga0157378_10717871 | 3300013297 | Bacteria | 1020 |
| 482 | Ga0163162_10000525 | 3300013306 | Bacteria | 35526 |
| 483 | Ga0163162_10000634 | 3300013306 | Bacteria | 32545 |
| 484 | Ga0163162_10001998 | 3300013306 | Bacteria | 19189 |
| 485 | Ga0163162_10083522 | 3300013306 | Bacteria | 3268 |
| 486 | Ga0163162_10136328 | 3300013306 | Bacteria | 2565 |
| 487 | Ga0163162_10146976 | 3300013306 | Unclassified | 2474 |
| 488 | Ga0163162_10166450 | 3300013306 | Bacteria | 2329 |
| 489 | Ga0163162_10218225 | 3300013306 | Bacteria | 2037 |
| 490 | Ga0163162_10268762 | 3300013306 | Bacteria | 1837 |
| 491 | Ga0163162_11085231 | 3300013306 | Unclassified | 907 |
| 492 | Ga0163162_11560748 | 3300013306 | Bacteria | 753 |
| 493 | Ga0163162_11654458 | 3300013306 | Bacteria | 731 |
| 494 | Ga0157372_10000596 | 3300013307 | Bacteria | 39416 |
| 495 | Ga0157372_10003307 | 3300013307 | Bacteria | 17410 |
| 496 | Ga0157372_10023311 | 3300013307 | Bacteria | 6709 |
| 497 | Ga0157372_10029574 | 3300013307 | Bacteria | 5984 |
| 498 | Ga0157372_10036705 | 3300013307 | Bacteria | 5403 |
| 499 | Ga0157372_10039319 | 3300013307 | Bacteria | 5220 |
| 500 | Ga0157372_10044826 | 3300013307 | Bacteria | 4902 |
| 501 | Ga0157372_10113417 | 3300013307 | Bacteria | 3106 |
| 502 | Ga0157372_10114020 | 3300013307 | Bacteria | 3098 |
| 503 | Ga0157372_10121142 | 3300013307 | Bacteria | 3005 |
| 504 | Ga0157372_10147148 | 3300013307 | Bacteria | 2717 |
| 505 | Ga0157372_10162507 | 3300013307 | Bacteria | 2581 |
| 506 | Ga0157372_10188274 | 3300013307 | Bacteria | 2390 |
| 507 | Ga0157372_10275386 | 3300013307 | Bacteria | 1956 |
| 508 | Ga0157372_10400008 | 3300013307 | Unclassified | 1600 |
| 509 | Ga0157372_10412383 | 3300013307 | Bacteria | 1574 |
| 510 | Ga0157372_10426134 | 3300013307 | Unclassified | 1546 |
| 511 | Ga0157372_10468790 | 3300013307 | Bacteria | 1468 |
| 512 | Ga0157372_10556316 | 3300013307 | Unclassified | 1337 |
| 513 | Ga0157372_11045040 | 3300013307 | Bacteria | 945 |
| 514 | Ga0157372_11168834 | 3300013307 | Bacteria | 889 |
| 515 | Ga0157375_10015917 | 3300013308 | Bacteria | 6743 |
| 516 | Ga0157375_10034238 | 3300013308 | Bacteria | 4837 |
| 517 | Ga0157375_10113504 | 3300013308 | Bacteria | 2810 |
| 518 | Ga0157375_10128516 | 3300013308 | Bacteria | 2652 |
| 519 | Ga0157375_10130103 | 3300013308 | Bacteria | 2635 |
| 520 | Ga0157375_10236020 | 3300013308 | Unclassified | 1988 |
| 521 | Ga0157375_10662013 | 3300013308 | Bacteria | 1200 |
| 522 | Ga0157375_11222406 | 3300013308 | Bacteria | 882 |
| 523 | Ga0163163_10027804 | 3300014325 | Bacteria | 5423 |
| 524 | Ga0163163_10066541 | 3300014325 | Bacteria | 3579 |
| 525 | Ga0163163_10207135 | 3300014325 | Unclassified | 2010 |
| 526 | Ga0163163_10590682 | 3300014325 | Bacteria | 1174 |
| 527 | Ga0157380_10000252 | 3300014326 | Bacteria | 32093 |
| 528 | Ga0157380_10013322 | 3300014326 | Bacteria | 5992 |
| 529 | Ga0157380_10352099 | 3300014326 | Unclassified | 1378 |
| 530 | Ga0157380_10702348 | 3300014326 | Unclassified | 1016 |
| 531 | Ga0157380_10710317 | 3300014326 | Unclassified | 1011 |
| 532 | Ga0157380_11831184 | 3300014326 | Unclassified | 667 |
| 533 | Ga0157377_10000289 | 3300014745 | Bacteria | 23989 |
| 534 | Ga0157377_10045740 | 3300014745 | Bacteria | 2446 |
| 535 | Ga0157377_10135387 | 3300014745 | Bacteria | 1509 |
| 536 | Ga0157377_10247139 | 3300014745 | Bacteria | 1154 |
| 537 | Ga0157379_10008718 | 3300014968 | Bacteria | 8837 |
| 538 | Ga0157379_10146686 | 3300014968 | Bacteria | 2128 |
| 539 | Ga0157379_10501382 | 3300014968 | Bacteria | 1125 |
| 540 | Ga0157379_10510986 | 3300014968 | Bacteria | 1114 |
| 541 | Ga0157379_10685989 | 3300014968 | Bacteria | 961 |
| 542 | Ga0157379_10806202 | 3300014968 | Unclassified | 886 |
| 543 | Ga0157376_10002300 | 3300014969 | Bacteria | 12901 |
| 544 | Ga0157376_10045426 | 3300014969 | Bacteria | 3617 |
| 545 | Ga0157376_10064270 | 3300014969 | Bacteria | 3094 |
| 546 | Ga0157376_10083973 | 3300014969 | Bacteria | 2741 |
| 547 | Ga0157376_10139443 | 3300014969 | Bacteria | 2173 |
| 548 | Ga0157376_10167124 | 3300014969 | Unclassified | 2000 |
| 549 | Ga0157376_10295151 | 3300014969 | Bacteria | 1532 |
| 550 | Ga0157376_11466462 | 3300014969 | Bacteria | 715 |
| 551 | Ga0163161_10011562 | 3300017792 | Bacteria | 6127 |
| 552 | Ga0163161_10036913 | 3300017792 | Bacteria | 3501 |
| 553 | Ga0209436_101851 | 3300025208 | Bacteria | 6857 |
| 554 | Ga0209436_102302 | 3300025208 | Bacteria | 5853 |
| 555 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 556 | Ga0209026_1000260 | 3300025250 | Bacteria | 65544 |
| 557 | Ga0209673_1000530 | 3300025273 | Bacteria | 62542 |
| 558 | Ga0209673_1070475 | 3300025273 | Bacteria | 834 |
| 559 | Ga0209130_1006397 | 3300025284 | Bacteria | 3836 |
| 560 | Ga0209564_1012160 | 3300025295 | Unclassified | 3777 |
| 561 | Ga0209564_1025638 | 3300025295 | Bacteria | 1975 |
| 562 | Ga0209758_1000722 | 3300025297 | Bacteria | 48485 |
| 563 | Ga0209758_1016843 | 3300025297 | Bacteria | 3685 |
| 564 | Ga0209050_1000134 | 3300025298 | Bacteria | 184417 |
| 565 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 566 | Ga0207426_1000192 | 3300025302 | Bacteria | 151680 |
| 567 | Ga0207426_1000357 | 3300025302 | Bacteria | 83200 |
| 568 | Ga0207426_1001446 | 3300025302 | Bacteria | 19697 |
| 569 | Ga0209051_1055405 | 3300025303 | Unclassified | 1287 |
| 570 | Ga0209257_1008115 | 3300025304 | Bacteria | 6098 |
| 571 | Ga0207697_10010930 | 3300025315 | Bacteria | 3856 |
| 572 | Ga0207697_10075712 | 3300025315 | Unclassified | 1414 |
| 573 | Ga0207656_10012082 | 3300025321 | Bacteria | 3278 |
| 574 | Ga0207656_10039574 | 3300025321 | Unclassified | 1995 |
| 575 | Ga0207656_10056051 | 3300025321 | Bacteria | 1717 |
| 576 | Ga0207656_10167513 | 3300025321 | Bacteria | 1049 |
| 577 | Ga0207682_10063089 | 3300025893 | Bacteria | 1555 |
| 578 | Ga0207710_10004222 | 3300025900 | Bacteria | 6296 |
| 579 | Ga0207688_10059399 | 3300025901 | Bacteria | 2153 |
| 580 | Ga0207688_10071579 | 3300025901 | Bacteria | 1968 |
| 581 | Ga0207680_10000181 | 3300025903 | Bacteria | 30852 |
| 582 | Ga0207680_10013017 | 3300025903 | Bacteria | 4256 |
| 583 | Ga0207680_10216752 | 3300025903 | Bacteria | 1310 |
| 584 | Ga0207680_10256989 | 3300025903 | Unclassified | 1208 |
| 585 | Ga0207680_10567199 | 3300025903 | Bacteria | 811 |
| 586 | Ga0207647_10002403 | 3300025904 | Bacteria | 14210 |
| 587 | Ga0207647_10064246 | 3300025904 | Bacteria | 2231 |
| 588 | Ga0207647_10083106 | 3300025904 | Bacteria | 1918 |
| 589 | Ga0207647_10322748 | 3300025904 | Unclassified | 877 |
| 590 | Ga0207685_10150542 | 3300025905 | Bacteria | 1052 |
| 591 | Ga0207645_10000354 | 3300025907 | Bacteria | 38157 |
| 592 | Ga0207645_10080416 | 3300025907 | Bacteria | 2089 |
| 593 | Ga0207645_10376216 | 3300025907 | Bacteria | 953 |
| 594 | Ga0207643_10003608 | 3300025908 | Bacteria | 8342 |
| 595 | Ga0207643_10021340 | 3300025908 | Bacteria | 3557 |
| 596 | Ga0207643_10141139 | 3300025908 | Bacteria | 1439 |
| 597 | Ga0207705_10010065 | 3300025909 | Bacteria | 6883 |
| 598 | Ga0207705_10105307 | 3300025909 | Bacteria | 2079 |
| 599 | Ga0207705_10340538 | 3300025909 | Bacteria | 1154 |
| 600 | Ga0207705_10419400 | 3300025909 | Bacteria | 1036 |
| 601 | Ga0207705_10778317 | 3300025909 | Bacteria | 743 |
| 602 | Ga0207654_10000479 | 3300025911 | Bacteria | 22913 |
| 603 | Ga0207654_10017613 | 3300025911 | Bacteria | 3739 |
| 604 | Ga0207654_10152349 | 3300025911 | Bacteria | 1485 |
| 605 | Ga0207654_10207633 | 3300025911 | Bacteria | 1293 |
| 606 | Ga0207654_10305533 | 3300025911 | Unclassified | 1083 |
| 607 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 608 | Ga0207707_10000490 | 3300025912 | Bacteria | 40927 |
| 609 | Ga0207707_10023270 | 3300025912 | Bacteria | 5421 |
| 610 | Ga0207707_10460221 | 3300025912 | Bacteria | 1088 |
| 611 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 612 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 613 | Ga0207695_10000229 | 3300025913 | Bacteria | 149313 |
| 614 | Ga0207695_10002425 | 3300025913 | Bacteria | 27622 |
| 615 | Ga0207695_10007565 | 3300025913 | Bacteria | 13773 |
| 616 | Ga0207695_10013891 | 3300025913 | Bacteria | 9573 |
| 617 | Ga0207695_10025984 | 3300025913 | Bacteria | 6543 |
| 618 | Ga0207695_10146043 | 3300025913 | Unclassified | 2309 |
| 619 | Ga0207695_10148394 | 3300025913 | Bacteria | 2286 |
| 620 | Ga0207695_10234931 | 3300025913 | Bacteria | 1736 |
| 621 | Ga0207695_10524222 | 3300025913 | Unclassified | 1066 |
| 622 | Ga0207671_10003761 | 3300025914 | Bacteria | 14941 |
| 623 | Ga0207671_10004878 | 3300025914 | Bacteria | 12608 |
| 624 | Ga0207671_10005499 | 3300025914 | Bacteria | 11657 |
| 625 | Ga0207671_10005924 | 3300025914 | Bacteria | 11082 |
| 626 | Ga0207671_10021960 | 3300025914 | Bacteria | 4834 |
| 627 | Ga0207671_10022391 | 3300025914 | Bacteria | 4779 |
| 628 | Ga0207671_10079793 | 3300025914 | Bacteria | 2452 |
| 629 | Ga0207671_10213995 | 3300025914 | Bacteria | 1508 |
| 630 | Ga0207671_10409211 | 3300025914 | Unclassified | 1079 |
| 631 | Ga0207671_10672477 | 3300025914 | Unclassified | 824 |
| 632 | Ga0207663_10907870 | 3300025916 | Unclassified | 704 |
| 633 | Ga0207660_10011947 | 3300025917 | Bacteria | 5668 |
| 634 | Ga0207660_10049724 | 3300025917 | Bacteria | 2974 |
| 635 | Ga0207660_10452840 | 3300025917 | Bacteria | 1038 |
| 636 | Ga0207662_10062467 | 3300025918 | Bacteria | 2238 |
| 637 | Ga0207662_10126982 | 3300025918 | Unclassified | 1604 |
| 638 | Ga0207662_10131192 | 3300025918 | Bacteria | 1580 |
| 639 | Ga0207657_10005867 | 3300025919 | Bacteria | 12792 |
| 640 | Ga0207657_10208169 | 3300025919 | Bacteria | 1571 |
| 641 | Ga0207657_10215722 | 3300025919 | Bacteria | 1539 |
| 642 | Ga0207657_10343606 | 3300025919 | Unclassified | 1178 |
| 643 | Ga0207657_10412378 | 3300025919 | Bacteria | 1062 |
| 644 | Ga0207649_10064596 | 3300025920 | Bacteria | 2314 |
| 645 | Ga0207649_10079779 | 3300025920 | Bacteria | 2115 |
| 646 | Ga0207652_10000844 | 3300025921 | Bacteria | 29188 |
| 647 | Ga0207652_10002330 | 3300025921 | Bacteria | 16091 |
| 648 | Ga0207652_10044159 | 3300025921 | Bacteria | 3796 |
| 649 | Ga0207652_10153616 | 3300025921 | Unclassified | 2062 |
| 650 | Ga0207652_10198471 | 3300025921 | Bacteria | 1806 |
| 651 | Ga0207681_10002677 | 3300025923 | Bacteria | 11289 |
| 652 | Ga0207681_10214772 | 3300025923 | Bacteria | 1485 |
| 653 | Ga0207681_10257117 | 3300025923 | Bacteria | 1366 |
| 654 | Ga0207681_10321418 | 3300025923 | Bacteria | 1231 |
| 655 | Ga0207681_10460789 | 3300025923 | Bacteria | 1035 |
| 656 | Ga0207694_10085982 | 3300025924 | Bacteria | 2475 |
| 657 | Ga0207694_10223070 | 3300025924 | Bacteria | 1538 |
| 658 | Ga0207650_10055745 | 3300025925 | Bacteria | 2935 |
| 659 | Ga0207650_10061252 | 3300025925 | Unclassified | 2809 |
| 660 | Ga0207650_10072482 | 3300025925 | Bacteria | 2592 |
| 661 | Ga0207650_10182982 | 3300025925 | Bacteria | 1671 |
| 662 | Ga0207650_10351422 | 3300025925 | Bacteria | 1213 |
| 663 | Ga0207650_10679233 | 3300025925 | Bacteria | 869 |
| 664 | Ga0207650_10901356 | 3300025925 | Bacteria | 751 |
| 665 | Ga0207659_10017243 | 3300025926 | Bacteria | 4714 |
| 666 | Ga0207659_10034081 | 3300025926 | Bacteria | 3509 |
| 667 | Ga0207659_10065311 | 3300025926 | Bacteria | 2636 |
| 668 | Ga0207659_10076730 | 3300025926 | Bacteria | 2457 |
| 669 | Ga0207659_10378144 | 3300025926 | Bacteria | 1180 |
| 670 | Ga0207659_10486081 | 3300025926 | Bacteria | 1043 |
| 671 | Ga0207700_10186443 | 3300025928 | Bacteria | 1741 |
| 672 | Ga0207644_10139740 | 3300025931 | Bacteria | 1864 |
| 673 | Ga0207644_10869133 | 3300025931 | Bacteria | 755 |
| 674 | Ga0207690_10020483 | 3300025932 | Bacteria | 4088 |
| 675 | Ga0207690_10812084 | 3300025932 | Bacteria | 773 |
| 676 | Ga0207706_10004117 | 3300025933 | Bacteria | 13721 |
| 677 | Ga0207706_10019199 | 3300025933 | Bacteria | 6147 |
| 678 | Ga0207706_10032095 | 3300025933 | Bacteria | 4677 |
| 679 | Ga0207706_10119172 | 3300025933 | Bacteria | 2321 |
| 680 | Ga0207686_10001204 | 3300025934 | Bacteria | 14998 |
| 681 | Ga0207686_10004907 | 3300025934 | Bacteria | 7197 |
| 682 | Ga0207686_10024746 | 3300025934 | Bacteria | 3483 |
| 683 | Ga0207686_10172296 | 3300025934 | Bacteria | 1527 |
| 684 | Ga0207670_10009484 | 3300025936 | Bacteria | 5556 |
| 685 | Ga0207670_10417850 | 3300025936 | Bacteria | 1075 |
| 686 | Ga0207670_10527184 | 3300025936 | Bacteria | 962 |
| 687 | Ga0207669_10049414 | 3300025937 | Bacteria | 2507 |
| 688 | Ga0207669_10400889 | 3300025937 | Bacteria | 1075 |
| 689 | Ga0207669_10535996 | 3300025937 | Bacteria | 942 |
| 690 | Ga0207704_10641562 | 3300025938 | Bacteria | 874 |
| 691 | Ga0207691_10052281 | 3300025940 | Bacteria | 3731 |
| 692 | Ga0207691_10064380 | 3300025940 | Bacteria | 3322 |
| 693 | Ga0207691_10065091 | 3300025940 | Bacteria | 3301 |
| 694 | Ga0207691_10164014 | 3300025940 | Bacteria | 1948 |
| 695 | Ga0207691_10168047 | 3300025940 | Unclassified | 1922 |
| 696 | Ga0207691_10207855 | 3300025940 | Bacteria | 1702 |
| 697 | Ga0207691_11138277 | 3300025940 | Bacteria | 648 |
| 698 | Ga0207711_10583650 | 3300025941 | Bacteria | 1043 |
| 699 | Ga0207689_10001630 | 3300025942 | Bacteria | 21256 |
| 700 | Ga0207689_10004925 | 3300025942 | Bacteria | 12028 |
| 701 | Ga0207689_10017184 | 3300025942 | Bacteria | 6123 |
| 702 | Ga0207689_10035703 | 3300025942 | Bacteria | 4128 |
| 703 | Ga0207689_10047698 | 3300025942 | Bacteria | 3534 |
| 704 | Ga0207689_10163592 | 3300025942 | Bacteria | 1833 |
| 705 | Ga0207689_10305398 | 3300025942 | Bacteria | 1319 |
| 706 | Ga0207689_10363717 | 3300025942 | Bacteria | 1203 |
| 707 | Ga0207689_10578936 | 3300025942 | Unclassified | 944 |
| 708 | Ga0207661_10065791 | 3300025944 | Bacteria | 2943 |
| 709 | Ga0207661_10199729 | 3300025944 | Bacteria | 1757 |
| 710 | Ga0207661_10255950 | 3300025944 | Bacteria | 1558 |
| 711 | Ga0207661_10525306 | 3300025944 | Bacteria | 1083 |
| 712 | Ga0207661_10606977 | 3300025944 | Bacteria | 1004 |
| 713 | Ga0207679_10005876 | 3300025945 | Bacteria | 7713 |
| 714 | Ga0207679_10011383 | 3300025945 | Bacteria | 5758 |
| 715 | Ga0207679_10039533 | 3300025945 | Bacteria | 3369 |
| 716 | Ga0207679_10078119 | 3300025945 | Bacteria | 2520 |
| 717 | Ga0207679_10170624 | 3300025945 | Bacteria | 1791 |
| 718 | Ga0207679_10216487 | 3300025945 | Bacteria | 1609 |
| 719 | Ga0207667_10000700 | 3300025949 | Bacteria | 43461 |
| 720 | Ga0207667_10000791 | 3300025949 | Bacteria | 41085 |
| 721 | Ga0207667_10001278 | 3300025949 | Bacteria | 31572 |
| 722 | Ga0207667_10016480 | 3300025949 | Bacteria | 8349 |
| 723 | Ga0207667_10016684 | 3300025949 | Bacteria | 8288 |
| 724 | Ga0207667_10053321 | 3300025949 | Bacteria | 4256 |
| 725 | Ga0207667_10068860 | 3300025949 | Unclassified | 3684 |
| 726 | Ga0207651_10058610 | 3300025960 | Bacteria | 2662 |
| 727 | Ga0207651_10127147 | 3300025960 | Bacteria | 1944 |
| 728 | Ga0207651_10207005 | 3300025960 | Bacteria | 1576 |
| 729 | Ga0207651_10455731 | 3300025960 | Unclassified | 1098 |
| 730 | Ga0207651_10883209 | 3300025960 | Bacteria | 795 |
| 731 | Ga0207651_10929203 | 3300025960 | Bacteria | 775 |
| 732 | Ga0207712_10001140 | 3300025961 | Bacteria | 18539 |
| 733 | Ga0207712_10010175 | 3300025961 | Bacteria | 5964 |
| 734 | Ga0207712_10011532 | 3300025961 | Bacteria | 5633 |
| 735 | Ga0207712_10028607 | 3300025961 | Bacteria | 3729 |
| 736 | Ga0207712_10032957 | 3300025961 | Bacteria | 3499 |
| 737 | Ga0207712_10198751 | 3300025961 | Unclassified | 1588 |
| 738 | Ga0207712_11057306 | 3300025961 | Bacteria | 721 |
| 739 | Ga0207640_10014382 | 3300025981 | Bacteria | 4555 |
| 740 | Ga0207640_10036466 | 3300025981 | Bacteria | 3087 |
| 741 | Ga0207640_10305943 | 3300025981 | Bacteria | 1260 |
| 742 | Ga0207640_10383778 | 3300025981 | Unclassified | 1139 |
| 743 | Ga0207640_10394174 | 3300025981 | Unclassified | 1126 |
| 744 | Ga0207658_10036058 | 3300025986 | Bacteria | 3545 |
| 745 | Ga0207658_10055445 | 3300025986 | Bacteria | 2937 |
| 746 | Ga0207658_10115285 | 3300025986 | Bacteria | 2132 |
| 747 | Ga0207658_10362929 | 3300025986 | Bacteria | 1264 |
| 748 | Ga0207677_10007101 | 3300026023 | Bacteria | 6166 |
| 749 | Ga0207677_10105146 | 3300026023 | Bacteria | 2088 |
| 750 | Ga0207677_10314456 | 3300026023 | Unclassified | 1299 |
| 751 | Ga0207677_10319971 | 3300026023 | Bacteria | 1289 |
| 752 | Ga0207677_10363535 | 3300026023 | Bacteria | 1216 |
| 753 | Ga0207677_10523483 | 3300026023 | Bacteria | 1029 |
| 754 | Ga0207703_10028673 | 3300026035 | Bacteria | 4391 |
| 755 | Ga0207703_10138152 | 3300026035 | Bacteria | 2112 |
| 756 | Ga0207639_10011306 | 3300026041 | Bacteria | 6196 |
| 757 | Ga0207639_10094875 | 3300026041 | Bacteria | 2396 |
| 758 | Ga0207639_10453180 | 3300026041 | Bacteria | 1165 |
| 759 | Ga0207639_11561503 | 3300026041 | Bacteria | 619 |
| 760 | Ga0207678_10043963 | 3300026067 | Bacteria | 3865 |
| 761 | Ga0207678_10504724 | 3300026067 | Bacteria | 1055 |
| 762 | Ga0207678_10656084 | 3300026067 | Bacteria | 922 |
| 763 | Ga0207708_10242451 | 3300026075 | Unclassified | 1450 |
| 764 | Ga0207702_10025423 | 3300026078 | Bacteria | 4914 |
| 765 | Ga0207702_10048565 | 3300026078 | Bacteria | 3580 |
| 766 | Ga0207702_10061412 | 3300026078 | Bacteria | 3205 |
| 767 | Ga0207702_10061650 | 3300026078 | Bacteria | 3200 |
| 768 | Ga0207702_10726446 | 3300026078 | Unclassified | 979 |
| 769 | Ga0207641_10000152 | 3300026088 | Bacteria | 98311 |
| 770 | Ga0207641_10008689 | 3300026088 | Bacteria | 8388 |
| 771 | Ga0207641_10008722 | 3300026088 | Bacteria | 8374 |
| 772 | Ga0207641_10023563 | 3300026088 | Bacteria | 5070 |
| 773 | Ga0207641_10207005 | 3300026088 | Bacteria | 1812 |
| 774 | Ga0207641_10781092 | 3300026088 | Bacteria | 944 |
| 775 | Ga0207648_10000404 | 3300026089 | Bacteria | 48036 |
| 776 | Ga0207648_10027693 | 3300026089 | Bacteria | 5029 |
| 777 | Ga0207648_10031696 | 3300026089 | Unclassified | 4672 |
| 778 | Ga0207648_10133294 | 3300026089 | Bacteria | 2187 |
| 779 | Ga0207648_10145625 | 3300026089 | Unclassified | 2089 |
| 780 | Ga0207648_10156304 | 3300026089 | Bacteria | 2013 |
| 781 | Ga0207648_10188245 | 3300026089 | Bacteria | 1828 |
| 782 | Ga0207648_10605990 | 3300026089 | Bacteria | 1010 |
| 783 | Ga0207648_11230247 | 3300026089 | Unclassified | 703 |
| 784 | Ga0207676_10040485 | 3300026095 | Bacteria | 3571 |
| 785 | Ga0207676_10090400 | 3300026095 | Bacteria | 2512 |
| 786 | Ga0207676_10364227 | 3300026095 | Bacteria | 1341 |
| 787 | Ga0207676_10396683 | 3300026095 | Bacteria | 1288 |
| 788 | Ga0207676_10397949 | 3300026095 | Bacteria | 1286 |
| 789 | Ga0207676_10737921 | 3300026095 | Bacteria | 957 |
| 790 | Ga0207676_10846553 | 3300026095 | Unclassified | 894 |
| 791 | Ga0207674_10009204 | 3300026116 | Bacteria | 11321 |
| 792 | Ga0207674_10011898 | 3300026116 | Bacteria | 9755 |
| 793 | Ga0207674_10062365 | 3300026116 | Unclassified | 3765 |
| 794 | Ga0207674_10069373 | 3300026116 | Bacteria | 3545 |
| 795 | Ga0207674_10164138 | 3300026116 | Bacteria | 2175 |
| 796 | Ga0207674_10286990 | 3300026116 | Bacteria | 1594 |
| 797 | Ga0207674_11249331 | 3300026116 | Bacteria | 712 |
| 798 | Ga0207675_100000386 | 3300026118 | Bacteria | 42305 |
| 799 | Ga0207675_100042508 | 3300026118 | Bacteria | 4244 |
| 800 | Ga0207675_100191393 | 3300026118 | Bacteria | 1962 |
| 801 | Ga0207675_100312707 | 3300026118 | Bacteria | 1532 |
| 802 | Ga0207675_100383627 | 3300026118 | Unclassified | 1382 |
| 803 | Ga0207675_100435463 | 3300026118 | Bacteria | 1297 |
| 804 | Ga0207675_100460026 | 3300026118 | Bacteria | 1262 |
| 805 | Ga0207683_10004600 | 3300026121 | Bacteria | 11887 |
| 806 | Ga0207683_10043009 | 3300026121 | Bacteria | 3946 |
| 807 | Ga0207683_10119275 | 3300026121 | Bacteria | 2367 |
| 808 | Ga0207683_10121946 | 3300026121 | Unclassified | 2341 |
| 809 | Ga0207683_10168849 | 3300026121 | Bacteria | 1981 |
| 810 | Ga0207683_10256877 | 3300026121 | Bacteria | 1595 |
| 811 | Ga0207683_10604156 | 3300026121 | Bacteria | 1015 |
| 812 | Ga0207698_10029764 | 3300026142 | Bacteria | 3916 |
| 813 | Ga0207698_10044432 | 3300026142 | Bacteria | 3338 |
| 814 | Ga0207698_10075417 | 3300026142 | Bacteria | 2695 |
| 815 | Ga0207698_10229111 | 3300026142 | Bacteria | 1685 |
| 816 | Ga0207698_10358060 | 3300026142 | Bacteria | 1381 |
| 817 | Ga0207698_10768417 | 3300026142 | Bacteria | 964 |
| 818 | Ga0207698_10776696 | 3300026142 | Bacteria | 959 |
| 819 | Ga0207698_10785323 | 3300026142 | Bacteria | 953 |
| 820 | Ga0207428_10081728 | 3300027907 | Bacteria | 2522 |
| 821 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 822 | Ga0268266_10376578 | 3300028379 | Bacteria | 1338 |
| 823 | Ga0268265_10007727 | 3300028380 | Bacteria | 7257 |
| 824 | Ga0268265_10693868 | 3300028380 | Unclassified | 983 |
| 825 | Ga0268265_10922804 | 3300028380 | Bacteria | 858 |
| 826 | Ga0268265_10940968 | 3300028380 | Bacteria | 851 |
| 827 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 828 | Ga0268264_10033350 | 3300028381 | Bacteria | 4229 |
| 829 | Ga0268264_10064722 | 3300028381 | Bacteria | 3078 |
| 830 | Ga0268264_10173325 | 3300028381 | Bacteria | 1953 |
| 831 | Ga0268264_10480145 | 3300028381 | Bacteria | 1209 |
| 832 | Ga0268264_10620258 | 3300028381 | Bacteria | 1068 |
| 833 | Ga0268264_10983594 | 3300028381 | Bacteria | 850 |
| 834 | Ga0307517_10006787 | 3300028786 | Bacteria | 16844 |
| 835 | Ga0307517_10121308 | 3300028786 | Unclassified | 1931 |
| 836 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 837 | Ga0265338_10145233 | 3300028800 | Bacteria | 1852 |
| 838 | Ga0307511_10000285 | 3300030521 | Bacteria | 53256 |
| 839 | Ga0307512_10245539 | 3300030522 | Bacteria | 899 |
| 840 | Ga0265327_10000148 | 3300031251 | Bacteria | 151952 |
| 841 | Ga0265327_10020847 | 3300031251 | Bacteria | 3978 |
| 842 | Ga0307513_10446257 | 3300031456 | Bacteria | 1019 |
| 843 | Ga0307509_10065959 | 3300031507 | Bacteria | 3799 |
| 844 | Ga0307408_101210990 | 3300031548 | Bacteria | 705 |
| 845 | Ga0307508_10002192 | 3300031616 | Bacteria | 20875 |
| 846 | Ga0307508_10213449 | 3300031616 | Bacteria | 1530 |
| 847 | Ga0307516_10000577 | 3300031730 | Bacteria | 49482 |
| 848 | Ga0307410_10435242 | 3300031852 | Bacteria | 1067 |
| 849 | Ga0307410_10520084 | 3300031852 | Unclassified | 982 |
| 850 | Ga0307406_10088028 | 3300031901 | Unclassified | 2083 |
| 851 | Ga0307412_10225685 | 3300031911 | Unclassified | 1439 |
| 852 | Ga0307414_10097259 | 3300032004 | Bacteria | 2205 |
| 853 | Ga0307510_10000805 | 3300033180 | Bacteria | 32598 |
| 854 | Ga0373944_0038854 | 3300035089 | Bacteria | 1463 |
| 855 | Ga0373924_0007156 | 3300035410 | Bacteria | 4023 |
| 856 | Ga0373937_0007249 | 3300036401 | Bacteria | 9595 |
| 857 | Ga0373937_0087775 | 3300036401 | Bacteria | 2879 |
| 858 | Ga0373937_0225358 | 3300036401 | Bacteria | 1765 |
| 859 | Ga0373925_0858652 | 3300037068 | Bacteria | 748 |
| 860 | Ga0395899_0030989 | 3300037312 | Bacteria | 4021 |
| 861 | Ga0395899_0043326 | 3300037312 | Bacteria | 3357 |
| 862 | Ga0395899_0067492 | 3300037312 | Bacteria | 2624 |
| 863 | Ga0395899_0478465 | 3300037312 | Bacteria | 811 |
| 864 | Ga0395900_0016499 | 3300037418 | Bacteria | 7533 |
| 865 | Ga0395900_0027821 | 3300037418 | Bacteria | 5792 |
| 866 | Ga0395900_0331484 | 3300037418 | Bacteria | 1500 |
| 867 | Ga0395900_0415642 | 3300037418 | Bacteria | 1306 |
| 868 | Ga0395898_0014412 | 3300037466 | Bacteria | 8121 |
| 869 | Ga0395898_0087288 | 3300037466 | Bacteria | 3005 |
| 870 | Ga0395898_0119138 | 3300037466 | Bacteria | 2528 |
| 871 | Ga0395898_0275414 | 3300037466 | Bacteria | 1605 |
| 872 | Ga0395898_0289014 | 3300037466 | Bacteria | 1564 |
| 873 | Ga0395898_0493639 | 3300037466 | Bacteria | 1164 |
| 874 | Ga0395905_0010221 | 3300037471 | Bacteria | 9145 |
| 875 | Ga0395905_0013318 | 3300037471 | Bacteria | 7885 |
| 876 | Ga0395901_0048123 | 3300038443 | Bacteria | 4428 |
| 877 | Ga0395901_0118359 | 3300038443 | Bacteria | 2783 |
| 878 | Ga0395901_0612385 | 3300038443 | Bacteria | 1097 |
| 879 | Ga0436365_1064270 | 3300039437 | Bacteria | 3354 |
| 880 | Ga0439439_0044796 | 3300041406 | Bacteria | 1153 |
| 881 | Ga0451851_0662514 | 3300041507 | Unclassified | 678 |
| 882 | Ga0451853_3599263 | 3300041512 | Bacteria | 956 |
| 883 | Ga0439431_0002560 | 3300041997 | Bacteria | 4014 |
| 884 | Ga0439445_0003796 | 3300042004 | Bacteria | 3395 |
| 885 | Ga0450923_013607 | 3300042125 | Bacteria | 1497 |
| 886 | Ga0439435_0034654 | 3300042436 | Bacteria | 1389 |
| 887 | Ga0439444_0111500 | 3300042437 | Unclassified | 630 |
| 888 | Ga0451577_0003916 | 3300042876 | Bacteria | 16080 |
| 889 | Ga0451577_0363434 | 3300042876 | Unclassified | 1313 |
| 890 | Ga0466972_0002253 | 3300044658 | Bacteria | 9479 |
| 891 | Ga0466972_0025621 | 3300044658 | Bacteria | 2922 |
| 892 | Ga0466965_0092476 | 3300044683 | Bacteria | 1540 |
| 893 | Ga0466961_0286065 | 3300044693 | Unclassified | 1008 |
| 894 | Ga0453684_0184530 | 3300044712 | Bacteria | 2446 |
| 895 | Ga0453684_0196748 | 3300044712 | Unclassified | 2353 |
| 896 | Ga0466971_0403680 | 3300044719 | Bacteria | 666 |
| 897 | Ga0466968_0186228 | 3300044735 | Unclassified | 967 |
| 898 | Ga0466970_0018840 | 3300044765 | Bacteria | 3576 |
| 899 | Ga0466957_0608524 | 3300044842 | Bacteria | 765 |
| 900 | Ga0466959_0015692 | 3300045049 | Bacteria | 5524 |
| 901 | Ga0466959_0036954 | 3300045049 | Bacteria | 3608 |
| 902 | Ga0466959_0135438 | 3300045049 | Bacteria | 1744 |
| 903 | Ga0466959_0421704 | 3300045049 | Bacteria | 906 |
| 904 | Ga0466967_0547046 | 3300045976 | Bacteria | 1139 |
| 905 | Ga0495627_003482 | 3300046453 | Bacteria | 6930 |
| 906 | Ga0495638_0145734 | 3300046460 | Bacteria | 1378 |
| 907 | Ga0495594_0158854 | 3300046499 | Bacteria | 1285 |
| 908 | Ga0495594_0180174 | 3300046499 | Bacteria | 1203 |
| 909 | Ga0495606_0009028 | 3300046507 | Bacteria | 8517 |
| 910 | Ga0495608_0156046 | 3300046511 | Bacteria | 1453 |
| 911 | Ga0495618_0061762 | 3300046514 | Bacteria | 2377 |
| 912 | Ga0495628_0204841 | 3300046516 | Bacteria | 1485 |
| 913 | Ga0495630_0012812 | 3300046517 | Bacteria | 6093 |
| 914 | Ga0495648_0001994 | 3300046524 | Bacteria | 19331 |
| 915 | Ga0495652_0269494 | 3300046529 | Bacteria | 1252 |
| 916 | Ga0495586_0025349 | 3300046535 | Bacteria | 3173 |
| 917 | Ga0495633_0000080 | 3300046558 | Bacteria | 127703 |
| 918 | Ga0495611_0000090 | 3300046648 | Bacteria | 63531 |
| 919 | Ga0495625_0414061 | 3300046660 | Bacteria | 840 |
| 920 | Ga0495625_0466255 | 3300046660 | Bacteria | 778 |
| 921 | Ga0495635_0242715 | 3300046663 | Bacteria | 1215 |
| 922 | Ga0495599_0063135 | 3300046678 | Bacteria | 2314 |
| 923 | Ga0495658_0006053 | 3300046683 | Bacteria | 5943 |
| 924 | Ga0495649_0153943 | 3300046694 | Bacteria | 1207 |
| 925 | Ga0495674_0040485 | 3300047319 | Bacteria | 4168 |
| 926 | Ga0495674_0044888 | 3300047319 | Bacteria | 3927 |
| 927 | Ga0495674_0093062 | 3300047319 | Bacteria | 2573 |
| 928 | Ga0495672_0041735 | 3300047320 | Bacteria | 2772 |
| 929 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 930 | Ga0495684_0450118 | 3300047471 | Bacteria | 895 |
| 931 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 932 | Ga0496107_0781283 | 3300048910 | Bacteria | 700 |
| 933 | Ga0496109_0488707 | 3300048912 | Bacteria | 1162 |
| 934 | Ga0496110_0459762 | 3300048913 | Bacteria | 1160 |
| 935 | Ga0496114_1050431 | 3300048917 | Bacteria | 698 |
| 936 | Ga0496115_0014866 | 3300048918 | Bacteria | 5902 |
| 937 | Ga0496121_0000020 | 3300048924 | Bacteria | 498732 |
| 938 | Ga0501303_041039 | 3300049526 | Bacteria | 579 |
| 939 | Ga0501032_0005376 | 3300049569 | Bacteria | 9530 |
| 940 | Ga0501032_0174701 | 3300049569 | Bacteria | 1408 |
| 941 | Ga0501034_0004706 | 3300049571 | Bacteria | 15108 |
| 942 | Ga0501034_0029971 | 3300049571 | Bacteria | 5530 |
| 943 | Ga0501034_0063983 | 3300049571 | Bacteria | 3692 |
| 944 | Ga0501034_0191535 | 3300049571 | Bacteria | 2007 |
| 945 | Ga0501034_0608036 | 3300049571 | Bacteria | 998 |
| 946 | Ga0501036_0002360 | 3300049572 | Bacteria | 14767 |
| 947 | Ga0501037_0003684 | 3300049573 | Bacteria | 11123 |
| 948 | Ga0501037_0530543 | 3300049573 | Bacteria | 796 |
| 949 | Ga0501038_0097094 | 3300049574 | Bacteria | 2458 |
| 950 | Ga0501038_0439290 | 3300049574 | Bacteria | 1005 |
| 951 | Ga0501039_0021736 | 3300049575 | Bacteria | 4923 |
| 952 | Ga0501039_0417981 | 3300049575 | Bacteria | 1053 |
| 953 | Ga0501043_0014705 | 3300049579 | Bacteria | 6126 |
| 954 | Ga0501043_0041003 | 3300049579 | Bacteria | 3638 |
| 955 | Ga0501043_0054946 | 3300049579 | Bacteria | 3128 |
| 956 | Ga0501046_0006183 | 3300049580 | Bacteria | 10632 |
| 957 | Ga0501046_0071786 | 3300049580 | Bacteria | 2689 |
| 958 | Ga0501047_0007787 | 3300049581 | Bacteria | 10089 |
| 959 | Ga0501047_0017174 | 3300049581 | Bacteria | 6926 |
| 960 | Ga0501047_0127626 | 3300049581 | Unclassified | 2424 |
| 961 | Ga0501047_0447883 | 3300049581 | Bacteria | 1121 |
| 962 | Ga0501048_0026224 | 3300049582 | Bacteria | 4243 |
| 963 | Ga0501048_0210012 | 3300049582 | Unclassified | 1381 |
| 964 | Ga0501067_0020072 | 3300049583 | Unclassified | 3697 |
| 965 | Ga0501068_0263515 | 3300049584 | Bacteria | 1099 |
| 966 | Ga0501068_0470892 | 3300049584 | Bacteria | 814 |
| 967 | Ga0501069_0017918 | 3300049585 | Unclassified | 3818 |
| 968 | Ga0501070_0019278 | 3300049586 | Bacteria | 5721 |
| 969 | Ga0501071_0035647 | 3300049587 | Unclassified | 3545 |
| 970 | Ga0501072_0190061 | 3300049588 | Unclassified | 1638 |
| 971 | Ga0501073_0098141 | 3300049589 | Unclassified | 2034 |
| 972 | Ga0501073_0437929 | 3300049589 | Bacteria | 903 |
| 973 | Ga0501073_0615026 | 3300049589 | Bacteria | 750 |
| 974 | Ga0501074_0000275 | 3300049590 | Bacteria | 29532 |
| 975 | Ga0501074_0092302 | 3300049590 | Bacteria | 2168 |
| 976 | Ga0501199_026574 | 3300049650 | Bacteria | 695 |
| 977 | Ga0501209_185413 | 3300049656 | Bacteria | 636 |
| 978 | Ga0501217_004702 | 3300049661 | Bacteria | 2816 |
| 979 | Ga0501079_0074252 | 3300049741 | Unclassified | 2629 |
| 980 | Ga0501080_0021404 | 3300049742 | Bacteria | 5985 |
| 981 | Ga0501080_1695699 | 3300049742 | Bacteria | 533 |
| 982 | Ga0501083_0002224 | 3300049744 | Bacteria | 13260 |
| 983 | Ga0501266_004675 | 3300049763 | Bacteria | 1701 |
| 984 | Ga0501268_036610 | 3300049765 | Bacteria | 909 |
| 985 | Ga0501270_024066 | 3300049767 | Bacteria | 954 |
| 986 | Ga0501035_0020207 | 3300049822 | Bacteria | 6116 |
| 987 | Ga0501044_0028371 | 3300049823 | Bacteria | 5908 |
| 988 | Ga0501044_0033954 | 3300049823 | Bacteria | 5356 |
| 989 | Ga0501044_0249923 | 3300049823 | Bacteria | 1715 |
| 990 | Ga0501044_0561200 | 3300049823 | Bacteria | 1038 |
| 991 | Ga0501226_011721 | 3300049853 | Bacteria | 971 |
| 992 | nmdc:mga0k408_250548_c1 | 3300050493 | Bacteria | 1057 |
| 993 | nmdc:mga0k408_271357_c1 | 3300050493 | Bacteria | 1013 |
| 994 | nmdc:mga05p37_111907_c1 | 3300050507 | Bacteria | 3357 |
| 995 | nmdc:mga05p37_79737_c1 | 3300050507 | Unclassified | 4031 |
| 996 | nmdc:mga09592_3366_c1 | 3300050508 | Bacteria | 12924 |
| 997 | nmdc:mga0qj67_133146_c1 | 3300050509 | Bacteria | 2014 |
| 998 | nmdc:mga06r32_46433_c1 | 3300050510 | Bacteria | 4144 |
| 999 | nmdc:mga06r32_93166_c1 | 3300050510 | Bacteria | 2946 |
| 1000 | nmdc:mga08y16_1117189_c1 | 3300050511 | Bacteria | 762 |
| 1001 | nmdc:mga08y16_12116_c1 | 3300050511 | Bacteria | 9062 |
| 1002 | nmdc:mga08y16_171833_c1 | 3300050511 | Bacteria | 2251 |
| 1003 | nmdc:mga0n895_697766_c1 | 3300050512 | Bacteria | 1011 |
| 1004 | nmdc:mga0n895_93002_c1 | 3300050512 | Bacteria | 3019 |
| 1005 | Ga0500578_0313501 | 3300053086 | Unclassified | 927 |
| 1006 | Ga0500644_0033271 | 3300053088 | Bacteria | 1654 |
| 1007 | Ga0500646_0005492 | 3300053090 | Bacteria | 3206 |
| 1008 | Ga0500646_0174635 | 3300053090 | Bacteria | 725 |
| 1009 | Ga0500583_0002757 | 3300053092 | Bacteria | 5363 |
| 1010 | Ga0500583_0009948 | 3300053092 | Bacteria | 3502 |
| 1011 | Ga0500651_0061801 | 3300053093 | Bacteria | 2338 |
| 1012 | Ga0500650_0123003 | 3300053098 | Bacteria | 1209 |
| 1013 | Ga0500650_0123180 | 3300053098 | Bacteria | 1208 |
| 1014 | Ga0500562_000062 | 3300053108 | Bacteria | 53042 |
| 1015 | Ga0500569_000060 | 3300053109 | Bacteria | 19362 |
| 1016 | Ga0500569_085446 | 3300053109 | Bacteria | 1015 |
| 1017 | Ga0500594_0130660 | 3300053118 | Bacteria | 795 |
| 1018 | Ga0500642_0136518 | 3300053130 | Bacteria | 1150 |
| 1019 | Ga0500642_0284108 | 3300053130 | Bacteria | 751 |
| 1020 | Ga0500652_047012 | 3300053131 | Bacteria | 1753 |
| 1021 | Ga0500652_259203 | 3300053131 | Bacteria | 686 |
| 1022 | Ga0500577_0012073 | 3300053142 | Bacteria | 2599 |
| 1023 | Ga0500588_0030623 | 3300053146 | Bacteria | 1545 |
| 1024 | Ga0500604_0018802 | 3300053151 | Bacteria | 1929 |
| 1025 | Ga0500616_0020886 | 3300053153 | Bacteria | 3677 |
| 1026 | Ga0500616_0329919 | 3300053153 | Bacteria | 626 |
| 1027 | Ga0500622_0000337 | 3300053156 | Bacteria | 46048 |
| 1028 | Ga0500622_0000900 | 3300053156 | Bacteria | 25309 |
| 1029 | Ga0500637_0165470 | 3300053178 | Bacteria | 1273 |
| 1030 | Ga0500645_010633 | 3300053730 | Bacteria | 3033 |
| 1031 | Ga0500645_026967 | 3300053730 | Bacteria | 1745 |
| 1032 | Ga0501084_0162330 | 3300054114 | Unclassified | 1885 |
| 1033 | Ga0500661_001888 | 3300055283 | Bacteria | 3958 |
| 1034 | Ga0501082_0028685 | 3300060353 | Unclassified | 4794 |
| 1035 | Ga0501082_0155183 | 3300060353 | Unclassified | 1989 |
| 1036 | Ga0466962_0012547 | 3300061719 | Bacteria | 4075 |
| 1037 | 2738726445 | 2738541278 | Bacteria | 9755573 |
| 1038 | 2819590777 | 2818991444 | Bacteria | 6968812 |
| 1039 | 2821137039 | 2821136567 | Bacteria | 8080116 |
| 1040 | 2883072661 | 2883068021 | Bacteria | 6192739 |
| 1041 | 2884795549 | 2884791551 | Bacteria | 8511252 |
| 1042 | 2896087825 | 2896085136 | Bacteria | 6129793 |
| 1043 | 2896112451 | 2896109856 | Bacteria | 7140722 |
| 1044 | 2904468219 | 2904467357 | Bacteria | 8057758 |
| 1045 | 2929157809 | 2929154850 | Bacteria | 6753285 |
| 1046 | 2929241320 | 2929239360 | Bacteria | 7745570 |
| 1047 | 2929923331 | 2929921140 | Bacteria | 8649150 |
| 1048 | Ga0501284_00052 | |||
| 1049 | JGI24740J21852_10025081 | |||
| 1050 | JGI24033J26618_1027915 | |||
| 1051 | JGI24751J29686_10002768 | |||
| 1052 | JGI25154J39366_1000854 | |||
| 1053 | JGI25406J46586_10000164 | |||
| 1054 | JGI25153J46596_10000259 | |||
| 1055 | JGI25153J46596_10037826 | |||
| 1056 | rootH1_10049724 | |||
| 1057 | rootH2_10049481 | |||
| 1058 | rootH2_10061731 | |||
| 1059 | rootH2_10077478 | |||
| 1060 | rootH2_10231120 | |||
| 1061 | rootH2_10264992 | |||
| 1062 | rootL2_10009667 | |||
| 1063 | rootL2_10277905 | |||
| 1064 | rootH1_10005105 | |||
| 1065 | rootH1_10084867 | |||
| 1066 | rootH1_10096535 | |||
| 1067 | rootH1_10294837 | |||
| 1068 | JGI25160J50197_1000890 | |||
| 1069 | JGI25160J50197_1001617 | |||
| 1070 | JGI25160J50197_1008782 | |||
| 1071 | JGI25160J50197_1019271 | |||
| 1072 | Ga0055526_1037364 | |||
| 1073 | Ga0055528_1002738 | |||
| 1074 | Ga0055530_10001045 | |||
| 1075 | Ga0055543_1010568 | |||
| 1076 | Ga0065165_1000102 | |||
| 1077 | Ga0065165_1005334 | |||
| 1078 | Ga0065165_1008566 | |||
| 1079 | Ga0065714_10071790 | |||
| 1080 | Ga0065714_10237391 | |||
| 1081 | Ga0065704_10076087 | |||
| 1082 | Ga0065704_10176799 | |||
| 1083 | Ga0065712_10077630 | |||
| 1084 | Ga0065712_10092087 | |||
| 1085 | Ga0065715_10005566 | |||
| 1086 | Ga0065707_10272871 | |||
| 1087 | Ga0070658_10496283 | |||
| 1088 | Ga0070676_10014038 | |||
| 1089 | Ga0070676_10416603 | |||
| 1090 | Ga0070683_100013449 | |||
| 1091 | Ga0070683_100029539 | |||
| 1092 | Ga0070683_100050705 | |||
| 1093 | Ga0070683_100073584 | |||
| 1094 | Ga0070683_100117751 | |||
| 1095 | Ga0070683_100296627 | |||
| 1096 | Ga0070683_100347161 | |||
| 1097 | Ga0070690_100116466 | |||
| 1098 | Ga0070690_100279252 | |||
| 1099 | Ga0070670_100037676 | |||
| 1100 | Ga0070670_100090795 | |||
| 1101 | Ga0070670_100094000 | |||
| 1102 | Ga0070670_100116859 | |||
| 1103 | Ga0070670_100181776 | |||
| 1104 | Ga0070677_10061911 | |||
| 1105 | Ga0070677_10078169 | |||
| 1106 | Ga0070677_10196881 | |||
| 1107 | Ga0070677_10202314 | |||
| 1108 | Ga0068869_100009985 | |||
| 1109 | Ga0068869_100022928 | |||
| 1110 | Ga0068869_100055657 | |||
| 1111 | Ga0068869_100127384 | |||
| 1112 | Ga0068869_100247953 | |||
| 1113 | Ga0068869_100290617 | |||
| 1114 | Ga0068869_100299384 | |||
| 1115 | Ga0068869_100447076 | |||
| 1116 | Ga0068869_100789960 | |||
| 1117 | Ga0068869_100832557 | |||
| 1118 | Ga0070666_10000028 | |||
| 1119 | Ga0070666_10005690 | |||
| 1120 | Ga0070666_10057201 | |||
| 1121 | Ga0070666_10059242 | |||
| 1122 | Ga0070666_10322691 | |||
| 1123 | Ga0070680_100000254 | |||
| 1124 | Ga0070680_100442157 | |||
| 1125 | Ga0070680_101027924 | |||
| 1126 | Ga0070682_100000190 | |||
| 1127 | Ga0070682_100000549 | |||
| 1128 | Ga0070682_100007803 | |||
| 1129 | Ga0070682_100377542 | |||
| 1130 | Ga0070682_100547673 | |||
| 1131 | Ga0070682_100658926 | |||
| 1132 | Ga0068868_100001540 | |||
| 1133 | Ga0068868_100010912 | |||
| 1134 | Ga0068868_100043201 | |||
| 1135 | Ga0068868_100075207 | |||
| 1136 | Ga0068868_100140702 | |||
| 1137 | Ga0068868_100149964 | |||
| 1138 | Ga0068868_100406995 | |||
| 1139 | Ga0068868_100621513 | |||
| 1140 | Ga0070660_100095469 | |||
| 1141 | Ga0070660_100128342 | |||
| 1142 | Ga0070660_100283216 | |||
| 1143 | Ga0070660_100405787 | |||
| 1144 | Ga0070689_100001483 | |||
| 1145 | Ga0070689_100004391 | |||
| 1146 | Ga0070689_100228638 | |||
| 1147 | Ga0070689_100384396 | |||
| 1148 | Ga0070689_100419012 | |||
| 1149 | Ga0070691_10000748 | |||
| 1150 | Ga0070691_10055582 | |||
| 1151 | Ga0070687_100109830 | |||
| 1152 | Ga0070687_100156075 | |||
| 1153 | Ga0070661_100007303 | |||
| 1154 | Ga0070661_100037273 | |||
| 1155 | Ga0070692_10296988 | |||
| 1156 | Ga0070692_10328003 | |||
| 1157 | Ga0070669_100000458 | |||
| 1158 | Ga0070669_100026149 | |||
| 1159 | Ga0070669_100031608 | |||
| 1160 | Ga0070669_100124832 | |||
| 1161 | Ga0070669_100181644 | |||
| 1162 | Ga0070669_100678601 | |||
| 1163 | Ga0070675_100006330 | |||
| 1164 | Ga0070675_100084712 | |||
| 1165 | Ga0070675_100141965 | |||
| 1166 | Ga0070675_100152186 | |||
| 1167 | Ga0070675_100392754 | |||
| 1168 | Ga0070675_100411791 | |||
| 1169 | Ga0070675_100855142 | |||
| 1170 | Ga0070671_100401446 | |||
| 1171 | Ga0070671_100405368 | |||
| 1172 | Ga0070671_100517966 | |||
| 1173 | Ga0070671_101071431 | |||
| 1174 | Ga0070674_100311522 | |||
| 1175 | Ga0070674_100638206 | |||
| 1176 | Ga0070674_100891995 | |||
| 1177 | Ga0070673_100006930 | |||
| 1178 | Ga0070673_100041630 | |||
| 1179 | Ga0070673_100049130 | |||
| 1180 | Ga0070673_100062586 | |||
| 1181 | Ga0070673_100131518 | |||
| 1182 | Ga0070673_100293197 | |||
| 1183 | Ga0070673_100374173 | |||
| 1184 | Ga0070673_101225137 | |||
| 1185 | Ga0070688_100000687 | |||
| 1186 | Ga0070688_100146709 | |||
| 1187 | Ga0070688_100171013 | |||
| 1188 | Ga0070688_100516849 | |||
| 1189 | Ga0070659_100008332 | |||
| 1190 | Ga0070659_100063157 | |||
| 1191 | Ga0070659_100290228 | |||
| 1192 | Ga0070659_100307568 | |||
| 1193 | Ga0070659_100920340 | |||
| 1194 | Ga0070667_100011625 | |||
| 1195 | Ga0070667_100045885 | |||
| 1196 | Ga0070667_100047282 | |||
| 1197 | Ga0070667_100079651 | |||
| 1198 | Ga0070667_100746031 | |||
| 1199 | Ga0070713_100180781 | |||
| 1200 | Ga0070701_10477048 | |||
| 1201 | Ga0070700_100505080 | |||
| 1202 | Ga0070694_100155193 | |||
| 1203 | Ga0070663_100076860 | |||
| 1204 | Ga0070663_100267077 | |||
| 1205 | Ga0070663_100277146 | |||
| 1206 | Ga0070663_100341629 | |||
| 1207 | Ga0070663_100441265 | |||
| 1208 | Ga0070678_100006600 | |||
| 1209 | Ga0070678_100098546 | |||
| 1210 | Ga0070678_100184284 | |||
| 1211 | Ga0070678_100361397 | |||
| 1212 | Ga0070662_100070054 | |||
| 1213 | Ga0070662_100114618 | |||
| 1214 | Ga0070662_100475171 | |||
| 1215 | Ga0070681_10017972 | |||
| 1216 | Ga0070681_10040427 | |||
| 1217 | Ga0070681_10294279 | |||
| 1218 | Ga0070681_10414461 | |||
| 1219 | Ga0068867_100022159 | |||
| 1220 | Ga0068867_100027695 | |||
| 1221 | Ga0068867_100052640 | |||
| 1222 | Ga0068867_100126326 | |||
| 1223 | Ga0068867_100233197 | |||
| 1224 | Ga0068867_100545865 | |||
| 1225 | Ga0068867_100561967 | |||
| 1226 | Ga0068867_100784590 | |||
| 1227 | Ga0068867_100913255 | |||
| 1228 | Ga0070685_10004614 | |||
| 1229 | Ga0070685_10069690 | |||
| 1230 | Ga0070685_10726596 | |||
| 1231 | Ga0070698_100000219 | |||
| 1232 | Ga0070698_100009802 | |||
| 1233 | Ga0070698_100025806 | |||
| 1234 | Ga0070679_100003985 | |||
| 1235 | Ga0070679_100057881 | |||
| 1236 | Ga0070679_100153326 | |||
| 1237 | Ga0070684_100003664 | |||
| 1238 | Ga0070684_100014418 | |||
| 1239 | Ga0070684_100252510 | |||
| 1240 | Ga0070684_100302277 | |||
| 1241 | Ga0070684_100363838 | |||
| 1242 | Ga0070684_100490222 | |||
| 1243 | Ga0068853_100001343 | |||
| 1244 | Ga0068853_100007345 | |||
| 1245 | Ga0068853_100123476 | |||
| 1246 | Ga0068853_100284071 | |||
| 1247 | Ga0068853_100290920 | |||
| 1248 | Ga0068853_100672050 | |||
| 1249 | Ga0070672_100019519 | |||
| 1250 | Ga0070672_100031816 | |||
| 1251 | Ga0070672_100064678 | |||
| 1252 | Ga0070672_100373162 | |||
| 1253 | Ga0070672_100380193 | |||
| 1254 | Ga0070672_100565885 | |||
| 1255 | Ga0070686_100019060 | |||
| 1256 | Ga0070686_100031948 | |||
| 1257 | Ga0070693_100003063 | |||
| 1258 | Ga0070693_100247695 | |||
| 1259 | Ga0070693_100306683 | |||
| 1260 | Ga0070665_100000001 | |||
| 1261 | Ga0070665_100360212 | |||
| 1262 | Ga0068855_100000630 | |||
| 1263 | Ga0068855_100005487 | |||
| 1264 | Ga0068855_100028908 | |||
| 1265 | Ga0068855_100037238 | |||
| 1266 | Ga0068855_100073503 | |||
| 1267 | Ga0068855_100287554 | |||
| 1268 | Ga0070664_100007338 | |||
| 1269 | Ga0070664_100030034 | |||
| 1270 | Ga0070664_100036214 | |||
| 1271 | Ga0070664_100070880 | |||
| 1272 | Ga0070664_100094111 | |||
| 1273 | Ga0070664_100122024 | |||
| 1274 | Ga0070664_100179763 | |||
| 1275 | Ga0070664_100230408 | |||
| 1276 | Ga0068857_100004171 | |||
| 1277 | Ga0068857_100089405 | |||
| 1278 | Ga0068857_100090375 | |||
| 1279 | Ga0068857_100246128 | |||
| 1280 | Ga0068854_100046365 | |||
| 1281 | Ga0068854_100069907 | |||
| 1282 | Ga0068854_100103837 | |||
| 1283 | Ga0068854_101099045 | |||
| 1284 | Ga0068856_100024544 | |||
| 1285 | Ga0068856_100122878 | |||
| 1286 | Ga0068856_100318760 | |||
| 1287 | Ga0068856_100777811 | |||
| 1288 | Ga0068856_100845020 | |||
| 1289 | Ga0070702_100013206 | |||
| 1290 | Ga0070702_100103743 | |||
| 1291 | Ga0070702_100284434 | |||
| 1292 | Ga0068852_100004976 | |||
| 1293 | Ga0068852_100011415 | |||
| 1294 | Ga0068852_100026143 | |||
| 1295 | Ga0068852_100120953 | |||
| 1296 | Ga0068852_100142563 | |||
| 1297 | Ga0068852_100203692 | |||
| 1298 | Ga0068852_100222964 | |||
| 1299 | Ga0068852_100386815 | |||
| 1300 | Ga0068852_100458946 | |||
| 1301 | Ga0068852_100706956 | |||
| 1302 | Ga0068852_100741205 | |||
| 1303 | Ga0068852_101220381 | |||
| 1304 | Ga0068859_100000012 | |||
| 1305 | Ga0068859_100004526 | |||
| 1306 | Ga0068859_100010347 | |||
| 1307 | Ga0068859_100014457 | |||
| 1308 | Ga0068859_100071266 | |||
| 1309 | Ga0068859_100120114 | |||
| 1310 | Ga0068859_100375174 | |||
| 1311 | Ga0068859_100507848 | |||
| 1312 | Ga0068859_100739931 | |||
| 1313 | Ga0068859_100747328 | |||
| 1314 | Ga0068864_100007320 | |||
| 1315 | Ga0068864_100192037 | |||
| 1316 | Ga0068864_100323996 | |||
| 1317 | Ga0068864_100344148 | |||
| 1318 | Ga0068864_100463490 | |||
| 1319 | Ga0068864_100465159 | |||
| 1320 | Ga0068864_100688630 | |||
| 1321 | Ga0068864_101538435 | |||
| 1322 | Ga0068866_10206201 | |||
| 1323 | Ga0068866_10417001 | |||
| 1324 | Ga0068861_100001813 | |||
| 1325 | Ga0068861_100011572 | |||
| 1326 | Ga0068861_100204084 | |||
| 1327 | Ga0068861_100392829 | |||
| 1328 | Ga0068861_100599183 | |||
| 1329 | Ga0068861_100860256 | |||
| 1330 | Ga0068851_10020246 | |||
| 1331 | Ga0068851_10083720 | |||
| 1332 | Ga0068851_10086511 | |||
| 1333 | Ga0068851_10129479 | |||
| 1334 | Ga0068863_100002125 | |||
| 1335 | Ga0068863_100009422 | |||
| 1336 | Ga0068863_100169946 | |||
| 1337 | Ga0068863_100202796 | |||
| 1338 | Ga0068863_100701945 | |||
| 1339 | Ga0068863_100712513 | |||
| 1340 | Ga0068863_100783365 | |||
| 1341 | Ga0068863_100807234 | |||
| 1342 | Ga0068863_100823234 | |||
| 1343 | Ga0068858_100090776 | |||
| 1344 | Ga0068858_100376187 | |||
| 1345 | Ga0068858_100657670 | |||
| 1346 | Ga0068860_100000046 | |||
| 1347 | Ga0068860_100015531 | |||
| 1348 | Ga0068860_100017189 | |||
| 1349 | Ga0068860_100020290 | |||
| 1350 | Ga0068860_100078259 | |||
| 1351 | Ga0068860_100206597 | |||
| 1352 | Ga0068860_100378120 | |||
| 1353 | Ga0068860_100428753 | |||
| 1354 | Ga0068860_100434036 | |||
| 1355 | Ga0068862_100003547 | |||
| 1356 | Ga0068862_100107535 | |||
| 1357 | Ga0068862_100282775 | |||
| 1358 | Ga0068862_100853229 | |||
| 1359 | Ga0081540_1008965 | |||
| 1360 | Ga0081539_10000042 | |||
| 1361 | Ga0081539_10032798 | |||
| 1362 | Ga0070715_10222793 | |||
| 1363 | Ga0070716_100390672 | |||
| 1364 | Ga0097621_100057279 | |||
| 1365 | Ga0097621_100107620 | |||
| 1366 | Ga0097621_100292046 | |||
| 1367 | Ga0097621_100370617 | |||
| 1368 | Ga0068871_100081845 | |||
| 1369 | Ga0068871_100086180 | |||
| 1370 | Ga0068871_100115270 | |||
| 1371 | Ga0068871_100198471 | |||
| 1372 | Ga0068871_100220412 | |||
| 1373 | Ga0068871_100230205 | |||
| 1374 | Ga0068871_100252862 | |||
| 1375 | Ga0068871_100370115 | |||
| 1376 | Ga0068871_100425746 | |||
| 1377 | Ga0068871_100463045 | |||
| 1378 | Ga0068871_100510246 | |||
| 1379 | Ga0075428_100003382 | |||
| 1380 | Ga0075428_100030666 | |||
| 1381 | Ga0075428_100474460 | |||
| 1382 | Ga0075430_100225793 | |||
| 1383 | Ga0075431_100026919 | |||
| 1384 | Ga0075431_100036042 | |||
| 1385 | Ga0075433_10531426 | |||
| 1386 | Ga0075434_100493072 | |||
| 1387 | Ga0075429_100048056 | |||
| 1388 | Ga0068865_100047650 | |||
| 1389 | Ga0068865_100117865 | |||
| 1390 | Ga0068865_100618438 | |||
| 1391 | Ga0097620_100000012 | |||
| 1392 | Ga0097620_100004526 | |||
| 1393 | Ga0097620_100010347 | |||
| 1394 | Ga0097620_100014457 | |||
| 1395 | Ga0097620_100071265 | |||
| 1396 | Ga0097620_100120114 | |||
| 1397 | Ga0097620_100375200 | |||
| 1398 | Ga0097620_100507830 | |||
| 1399 | Ga0097620_100739914 | |||
| 1400 | Ga0097620_100747387 | |||
| 1401 | Ga0105240_10001517 | |||
| 1402 | Ga0105240_10002254 | |||
| 1403 | Ga0105240_10002716 | |||
| 1404 | Ga0105240_10002823 | |||
| 1405 | Ga0105240_10003383 | |||
| 1406 | Ga0105240_10015666 | |||
| 1407 | Ga0105240_10021041 | |||
| 1408 | Ga0105240_10081433 | |||
| 1409 | Ga0105240_10164323 | |||
| 1410 | Ga0105240_10187700 | |||
| 1411 | Ga0105240_10273610 | |||
| 1412 | Ga0105240_10618002 | |||
| 1413 | Ga0105240_10725922 | |||
| 1414 | Ga0105240_10897855 | |||
| 1415 | Ga0111539_10006834 | |||
| 1416 | Ga0111539_10019555 | |||
| 1417 | Ga0111539_10232439 | |||
| 1418 | Ga0111539_10234999 | |||
| 1419 | Ga0111539_10260807 | |||
| 1420 | Ga0111539_11182592 | |||
| 1421 | Ga0105245_11719557 | |||
| 1422 | Ga0105247_10008343 | |||
| 1423 | Ga0105247_10070853 | |||
| 1424 | Ga0114129_10027554 | |||
| 1425 | Ga0114129_10029791 | |||
| 1426 | Ga0105241_10000231 | |||
| 1427 | Ga0105241_10000619 | |||
| 1428 | Ga0105241_10001092 | |||
| 1429 | Ga0105241_10037436 | |||
| 1430 | Ga0105241_10225592 | |||
| 1431 | Ga0105241_10279067 | |||
| 1432 | Ga0105241_10554826 | |||
| 1433 | Ga0105241_10884921 | |||
| 1434 | Ga0105241_10913572 | |||
| 1435 | Ga0105242_10003805 | |||
| 1436 | Ga0105242_10025765 | |||
| 1437 | Ga0105242_10038298 | |||
| 1438 | Ga0105242_10071482 | |||
| 1439 | Ga0105248_10679772 | |||
| 1440 | Ga0105248_10788518 | |||
| 1441 | Ga0105237_10005413 | |||
| 1442 | Ga0105237_10007560 | |||
| 1443 | Ga0105237_10016964 | |||
| 1444 | Ga0105237_10023757 | |||
| 1445 | Ga0105237_10027549 | |||
| 1446 | Ga0105237_10086164 | |||
| 1447 | Ga0105237_10131036 | |||
| 1448 | Ga0105237_10177889 | |||
| 1449 | Ga0105237_10209474 | |||
| 1450 | Ga0105237_10385868 | |||
| 1451 | Ga0105238_10004513 | |||
| 1452 | Ga0105238_10364486 | |||
| 1453 | Ga0105249_10002774 | |||
| 1454 | Ga0105249_10014173 | |||
| 1455 | Ga0105249_10022623 | |||
| 1456 | Ga0105249_10049007 | |||
| 1457 | Ga0105249_10055586 | |||
| 1458 | Ga0105249_10103085 | |||
| 1459 | Ga0105249_10379783 | |||
| 1460 | Ga0105249_10574731 | |||
| 1461 | Ga0105249_10651888 | |||
| 1462 | Ga0105249_11113549 | |||
| 1463 | Ga0105239_10000048 | |||
| 1464 | Ga0105239_10003203 | |||
| 1465 | Ga0105239_10008174 | |||
| 1466 | Ga0105239_10331963 | |||
| 1467 | Ga0105239_10440608 | |||
| 1468 | Ga0105239_10447065 | |||
| 1469 | Ga0105239_11050730 | |||
| 1470 | Ga0105246_10119171 | |||
| 1471 | Ga0157373_10018157 | |||
| 1472 | Ga0157373_10035635 | |||
| 1473 | Ga0157373_10082332 | |||
| 1474 | Ga0157373_10095360 | |||
| 1475 | Ga0157373_10158556 | |||
| 1476 | Ga0157373_10371618 | |||
| 1477 | Ga0157371_10001955 | |||
| 1478 | Ga0157371_10002374 | |||
| 1479 | Ga0157371_10003617 | |||
| 1480 | Ga0157371_10007345 | |||
| 1481 | Ga0157371_10009513 | |||
| 1482 | Ga0157371_10011624 | |||
| 1483 | Ga0157371_10028051 | |||
| 1484 | Ga0157371_10029334 | |||
| 1485 | Ga0157371_10033466 | |||
| 1486 | Ga0157371_10044152 | |||
| 1487 | Ga0157371_10075177 | |||
| 1488 | Ga0157371_10112864 | |||
| 1489 | Ga0157371_10165955 | |||
| 1490 | Ga0157371_10409092 | |||
| 1491 | Ga0157371_10798138 | |||
| 1492 | Ga0157370_10003422 | |||
| 1493 | Ga0157370_10005999 | |||
| 1494 | Ga0157370_10009965 | |||
| 1495 | Ga0157370_10047147 | |||
| 1496 | Ga0157370_10079950 | |||
| 1497 | Ga0157370_10246888 | |||
| 1498 | Ga0157370_10413629 | |||
| 1499 | Ga0157370_10575451 | |||
| 1500 | Ga0157370_10650475 | |||
| 1501 | Ga0157370_10732849 | |||
| 1502 | Ga0157370_10818956 | |||
| 1503 | Ga0157369_10019398 | |||
| 1504 | Ga0157369_10025207 | |||
| 1505 | Ga0157369_10038758 | |||
| 1506 | Ga0157369_10065152 | |||
| 1507 | Ga0157369_10082277 | |||
| 1508 | Ga0157369_10180385 | |||
| 1509 | Ga0157369_10221881 | |||
| 1510 | Ga0157374_10000001 | |||
| 1511 | Ga0157374_10007434 | |||
| 1512 | Ga0157374_10040762 | |||
| 1513 | Ga0157374_10074742 | |||
| 1514 | Ga0157374_10278666 | |||
| 1515 | Ga0157374_10491797 | |||
| 1516 | Ga0157374_10618623 | |||
| 1517 | Ga0157374_10628975 | |||
| 1518 | Ga0157374_11119849 | |||
| 1519 | Ga0157374_11249695 | |||
| 1520 | Ga0157378_10009439 | |||
| 1521 | Ga0157378_10078887 | |||
| 1522 | Ga0157378_10090003 | |||
| 1523 | Ga0157378_10096036 | |||
| 1524 | Ga0157378_10103832 | |||
| 1525 | Ga0157378_10168521 | |||
| 1526 | Ga0157378_10336309 | |||
| 1527 | Ga0157378_10534639 | |||
| 1528 | Ga0157378_10717871 | |||
| 1529 | Ga0163162_10000525 | |||
| 1530 | Ga0163162_10000634 | |||
| 1531 | Ga0163162_10001998 | |||
| 1532 | Ga0163162_10083522 | |||
| 1533 | Ga0163162_10136328 | |||
| 1534 | Ga0163162_10146976 | |||
| 1535 | Ga0163162_10166450 | |||
| 1536 | Ga0163162_10218225 | |||
| 1537 | Ga0163162_10268762 | |||
| 1538 | Ga0163162_11085231 | |||
| 1539 | Ga0163162_11560748 | |||
| 1540 | Ga0163162_11654458 | |||
| 1541 | Ga0157372_10000596 | |||
| 1542 | Ga0157372_10003307 | |||
| 1543 | Ga0157372_10023311 | |||
| 1544 | Ga0157372_10029574 | |||
| 1545 | Ga0157372_10036705 | |||
| 1546 | Ga0157372_10039319 | |||
| 1547 | Ga0157372_10044826 | |||
| 1548 | Ga0157372_10113417 | |||
| 1549 | Ga0157372_10114020 | |||
| 1550 | Ga0157372_10121142 | |||
| 1551 | Ga0157372_10147148 | |||
| 1552 | Ga0157372_10162507 | |||
| 1553 | Ga0157372_10188274 | |||
| 1554 | Ga0157372_10275386 | |||
| 1555 | Ga0157372_10400008 | |||
| 1556 | Ga0157372_10412383 | |||
| 1557 | Ga0157372_10426134 | |||
| 1558 | Ga0157372_10468790 | |||
| 1559 | Ga0157372_10556316 | |||
| 1560 | Ga0157372_11045040 | |||
| 1561 | Ga0157372_11168834 | |||
| 1562 | Ga0157375_10015917 | |||
| 1563 | Ga0157375_10034238 | |||
| 1564 | Ga0157375_10113504 | |||
| 1565 | Ga0157375_10128516 | |||
| 1566 | Ga0157375_10130103 | |||
| 1567 | Ga0157375_10236020 | |||
| 1568 | Ga0157375_10662013 | |||
| 1569 | Ga0157375_11222406 | |||
| 1570 | Ga0163163_10027804 | |||
| 1571 | Ga0163163_10066541 | |||
| 1572 | Ga0163163_10207135 | |||
| 1573 | Ga0163163_10590682 | |||
| 1574 | Ga0157380_10000252 | |||
| 1575 | Ga0157380_10013322 | |||
| 1576 | Ga0157380_10352099 | |||
| 1577 | Ga0157380_10702348 | |||
| 1578 | Ga0157380_10710317 | |||
| 1579 | Ga0157380_11831184 | |||
| 1580 | Ga0157377_10000289 | |||
| 1581 | Ga0157377_10045740 | |||
| 1582 | Ga0157377_10135387 | |||
| 1583 | Ga0157377_10247139 | |||
| 1584 | Ga0157379_10008718 | |||
| 1585 | Ga0157379_10146686 | |||
| 1586 | Ga0157379_10501382 | |||
| 1587 | Ga0157379_10510986 | |||
| 1588 | Ga0157379_10685989 | |||
| 1589 | Ga0157379_10806202 | |||
| 1590 | Ga0157376_10002300 | |||
| 1591 | Ga0157376_10045426 | |||
| 1592 | Ga0157376_10064270 | |||
| 1593 | Ga0157376_10083973 | |||
| 1594 | Ga0157376_10139443 | |||
| 1595 | Ga0157376_10167124 | |||
| 1596 | Ga0157376_10295151 | |||
| 1597 | Ga0157376_11466462 | |||
| 1598 | Ga0163161_10011562 | |||
| 1599 | Ga0163161_10036913 | |||
| 1600 | Ga0209436_101851 | |||
| 1601 | Ga0209436_102302 | |||
| 1602 | Ga0209646_1000002 | |||
| 1603 | Ga0209026_1000260 | |||
| 1604 | Ga0209673_1000530 | |||
| 1605 | Ga0209673_1070475 | |||
| 1606 | Ga0209130_1006397 | |||
| 1607 | Ga0209564_1012160 | |||
| 1608 | Ga0209564_1025638 | |||
| 1609 | Ga0209758_1000722 | |||
| 1610 | Ga0209758_1016843 | |||
| 1611 | Ga0209050_1000134 | |||
| 1612 | Ga0207426_1000051 | |||
| 1613 | Ga0207426_1000192 | |||
| 1614 | Ga0207426_1000357 | |||
| 1615 | Ga0207426_1001446 | |||
| 1616 | Ga0209051_1055405 | |||
| 1617 | Ga0209257_1008115 | |||
| 1618 | Ga0207697_10010930 | |||
| 1619 | Ga0207697_10075712 | |||
| 1620 | Ga0207656_10012082 | |||
| 1621 | Ga0207656_10039574 | |||
| 1622 | Ga0207656_10056051 | |||
| 1623 | Ga0207656_10167513 | |||
| 1624 | Ga0207682_10063089 | |||
| 1625 | Ga0207710_10004222 | |||
| 1626 | Ga0207688_10059399 | |||
| 1627 | Ga0207688_10071579 | |||
| 1628 | Ga0207680_10000181 | |||
| 1629 | Ga0207680_10013017 | |||
| 1630 | Ga0207680_10216752 | |||
| 1631 | Ga0207680_10256989 | |||
| 1632 | Ga0207680_10567199 | |||
| 1633 | Ga0207647_10002403 | |||
| 1634 | Ga0207647_10064246 | |||
| 1635 | Ga0207647_10083106 | |||
| 1636 | Ga0207647_10322748 | |||
| 1637 | Ga0207685_10150542 | |||
| 1638 | Ga0207645_10000354 | |||
| 1639 | Ga0207645_10080416 | |||
| 1640 | Ga0207645_10376216 | |||
| 1641 | Ga0207643_10003608 | |||
| 1642 | Ga0207643_10021340 | |||
| 1643 | Ga0207643_10141139 | |||
| 1644 | Ga0207705_10010065 | |||
| 1645 | Ga0207705_10105307 | |||
| 1646 | Ga0207705_10340538 | |||
| 1647 | Ga0207705_10419400 | |||
| 1648 | Ga0207705_10778317 | |||
| 1649 | Ga0207654_10000479 | |||
| 1650 | Ga0207654_10017613 | |||
| 1651 | Ga0207654_10152349 | |||
| 1652 | Ga0207654_10207633 | |||
| 1653 | Ga0207654_10305533 | |||
| 1654 | Ga0207707_10000051 | |||
| 1655 | Ga0207707_10000490 | |||
| 1656 | Ga0207707_10023270 | |||
| 1657 | Ga0207707_10460221 | |||
| 1658 | Ga0207695_10000023 | |||
| 1659 | Ga0207695_10000110 | |||
| 1660 | Ga0207695_10000229 | |||
| 1661 | Ga0207695_10002425 | |||
| 1662 | Ga0207695_10007565 | |||
| 1663 | Ga0207695_10013891 | |||
| 1664 | Ga0207695_10025984 | |||
| 1665 | Ga0207695_10146043 | |||
| 1666 | Ga0207695_10148394 | |||
| 1667 | Ga0207695_10234931 | |||
| 1668 | Ga0207695_10524222 | |||
| 1669 | Ga0207671_10003761 | |||
| 1670 | Ga0207671_10004878 | |||
| 1671 | Ga0207671_10005499 | |||
| 1672 | Ga0207671_10005924 | |||
| 1673 | Ga0207671_10021960 | |||
| 1674 | Ga0207671_10022391 | |||
| 1675 | Ga0207671_10079793 | |||
| 1676 | Ga0207671_10213995 | |||
| 1677 | Ga0207671_10409211 | |||
| 1678 | Ga0207671_10672477 | |||
| 1679 | Ga0207663_10907870 | |||
| 1680 | Ga0207660_10011947 | |||
| 1681 | Ga0207660_10049724 | |||
| 1682 | Ga0207660_10452840 | |||
| 1683 | Ga0207662_10062467 | |||
| 1684 | Ga0207662_10126982 | |||
| 1685 | Ga0207662_10131192 | |||
| 1686 | Ga0207657_10005867 | |||
| 1687 | Ga0207657_10208169 | |||
| 1688 | Ga0207657_10215722 | |||
| 1689 | Ga0207657_10343606 | |||
| 1690 | Ga0207657_10412378 | |||
| 1691 | Ga0207649_10064596 | |||
| 1692 | Ga0207649_10079779 | |||
| 1693 | Ga0207652_10000844 | |||
| 1694 | Ga0207652_10002330 | |||
| 1695 | Ga0207652_10044159 | |||
| 1696 | Ga0207652_10153616 | |||
| 1697 | Ga0207652_10198471 | |||
| 1698 | Ga0207681_10002677 | |||
| 1699 | Ga0207681_10214772 | |||
| 1700 | Ga0207681_10257117 | |||
| 1701 | Ga0207681_10321418 | |||
| 1702 | Ga0207681_10460789 | |||
| 1703 | Ga0207694_10085982 | |||
| 1704 | Ga0207694_10223070 | |||
| 1705 | Ga0207650_10055745 | |||
| 1706 | Ga0207650_10061252 | |||
| 1707 | Ga0207650_10072482 | |||
| 1708 | Ga0207650_10182982 | |||
| 1709 | Ga0207650_10351422 | |||
| 1710 | Ga0207650_10679233 | |||
| 1711 | Ga0207650_10901356 | |||
| 1712 | Ga0207659_10017243 | |||
| 1713 | Ga0207659_10034081 | |||
| 1714 | Ga0207659_10065311 | |||
| 1715 | Ga0207659_10076730 | |||
| 1716 | Ga0207659_10378144 | |||
| 1717 | Ga0207659_10486081 | |||
| 1718 | Ga0207700_10186443 | |||
| 1719 | Ga0207644_10139740 | |||
| 1720 | Ga0207644_10869133 | |||
| 1721 | Ga0207690_10020483 | |||
| 1722 | Ga0207690_10812084 | |||
| 1723 | Ga0207706_10004117 | |||
| 1724 | Ga0207706_10019199 | |||
| 1725 | Ga0207706_10032095 | |||
| 1726 | Ga0207706_10119172 | |||
| 1727 | Ga0207686_10001204 | |||
| 1728 | Ga0207686_10004907 | |||
| 1729 | Ga0207686_10024746 | |||
| 1730 | Ga0207686_10172296 | |||
| 1731 | Ga0207670_10009484 | |||
| 1732 | Ga0207670_10417850 | |||
| 1733 | Ga0207670_10527184 | |||
| 1734 | Ga0207669_10049414 | |||
| 1735 | Ga0207669_10400889 | |||
| 1736 | Ga0207669_10535996 | |||
| 1737 | Ga0207704_10641562 | |||
| 1738 | Ga0207691_10052281 | |||
| 1739 | Ga0207691_10064380 | |||
| 1740 | Ga0207691_10065091 | |||
| 1741 | Ga0207691_10164014 | |||
| 1742 | Ga0207691_10168047 | |||
| 1743 | Ga0207691_10207855 | |||
| 1744 | Ga0207691_11138277 | |||
| 1745 | Ga0207711_10583650 | |||
| 1746 | Ga0207689_10001630 | |||
| 1747 | Ga0207689_10004925 | |||
| 1748 | Ga0207689_10017184 | |||
| 1749 | Ga0207689_10035703 | |||
| 1750 | Ga0207689_10047698 | |||
| 1751 | Ga0207689_10163592 | |||
| 1752 | Ga0207689_10305398 | |||
| 1753 | Ga0207689_10363717 | |||
| 1754 | Ga0207689_10578936 | |||
| 1755 | Ga0207661_10065791 | |||
| 1756 | Ga0207661_10199729 | |||
| 1757 | Ga0207661_10255950 | |||
| 1758 | Ga0207661_10525306 | |||
| 1759 | Ga0207661_10606977 | |||
| 1760 | Ga0207679_10005876 | |||
| 1761 | Ga0207679_10011383 | |||
| 1762 | Ga0207679_10039533 | |||
| 1763 | Ga0207679_10078119 | |||
| 1764 | Ga0207679_10170624 | |||
| 1765 | Ga0207679_10216487 | |||
| 1766 | Ga0207667_10000700 | |||
| 1767 | Ga0207667_10000791 | |||
| 1768 | Ga0207667_10001278 | |||
| 1769 | Ga0207667_10016480 | |||
| 1770 | Ga0207667_10016684 | |||
| 1771 | Ga0207667_10053321 | |||
| 1772 | Ga0207667_10068860 | |||
| 1773 | Ga0207651_10058610 | |||
| 1774 | Ga0207651_10127147 | |||
| 1775 | Ga0207651_10207005 | |||
| 1776 | Ga0207651_10455731 | |||
| 1777 | Ga0207651_10883209 | |||
| 1778 | Ga0207651_10929203 | |||
| 1779 | Ga0207712_10001140 | |||
| 1780 | Ga0207712_10010175 | |||
| 1781 | Ga0207712_10011532 | |||
| 1782 | Ga0207712_10028607 | |||
| 1783 | Ga0207712_10032957 | |||
| 1784 | Ga0207712_10198751 | |||
| 1785 | Ga0207712_11057306 | |||
| 1786 | Ga0207640_10014382 | |||
| 1787 | Ga0207640_10036466 | |||
| 1788 | Ga0207640_10305943 | |||
| 1789 | Ga0207640_10383778 | |||
| 1790 | Ga0207640_10394174 | |||
| 1791 | Ga0207658_10036058 | |||
| 1792 | Ga0207658_10055445 | |||
| 1793 | Ga0207658_10115285 | |||
| 1794 | Ga0207658_10362929 | |||
| 1795 | Ga0207677_10007101 | |||
| 1796 | Ga0207677_10105146 | |||
| 1797 | Ga0207677_10314456 | |||
| 1798 | Ga0207677_10319971 | |||
| 1799 | Ga0207677_10363535 | |||
| 1800 | Ga0207677_10523483 | |||
| 1801 | Ga0207703_10028673 | |||
| 1802 | Ga0207703_10138152 | |||
| 1803 | Ga0207639_10011306 | |||
| 1804 | Ga0207639_10094875 | |||
| 1805 | Ga0207639_10453180 | |||
| 1806 | Ga0207639_11561503 | |||
| 1807 | Ga0207678_10043963 | |||
| 1808 | Ga0207678_10504724 | |||
| 1809 | Ga0207678_10656084 | |||
| 1810 | Ga0207708_10242451 | |||
| 1811 | Ga0207702_10025423 | |||
| 1812 | Ga0207702_10048565 | |||
| 1813 | Ga0207702_10061412 | |||
| 1814 | Ga0207702_10061650 | |||
| 1815 | Ga0207702_10726446 | |||
| 1816 | Ga0207641_10000152 | |||
| 1817 | Ga0207641_10008689 | |||
| 1818 | Ga0207641_10008722 | |||
| 1819 | Ga0207641_10023563 | |||
| 1820 | Ga0207641_10207005 | |||
| 1821 | Ga0207641_10781092 | |||
| 1822 | Ga0207648_10000404 | |||
| 1823 | Ga0207648_10027693 | |||
| 1824 | Ga0207648_10031696 | |||
| 1825 | Ga0207648_10133294 | |||
| 1826 | Ga0207648_10145625 | |||
| 1827 | Ga0207648_10156304 | |||
| 1828 | Ga0207648_10188245 | |||
| 1829 | Ga0207648_10605990 | |||
| 1830 | Ga0207648_11230247 | |||
| 1831 | Ga0207676_10040485 | |||
| 1832 | Ga0207676_10090400 | |||
| 1833 | Ga0207676_10364227 | |||
| 1834 | Ga0207676_10396683 | |||
| 1835 | Ga0207676_10397949 | |||
| 1836 | Ga0207676_10737921 | |||
| 1837 | Ga0207676_10846553 | |||
| 1838 | Ga0207674_10009204 | |||
| 1839 | Ga0207674_10011898 | |||
| 1840 | Ga0207674_10062365 | |||
| 1841 | Ga0207674_10069373 | |||
| 1842 | Ga0207674_10164138 | |||
| 1843 | Ga0207674_10286990 | |||
| 1844 | Ga0207674_11249331 | |||
| 1845 | Ga0207675_100000386 | |||
| 1846 | Ga0207675_100042508 | |||
| 1847 | Ga0207675_100191393 | |||
| 1848 | Ga0207675_100312707 | |||
| 1849 | Ga0207675_100383627 | |||
| 1850 | Ga0207675_100435463 | |||
| 1851 | Ga0207675_100460026 | |||
| 1852 | Ga0207683_10004600 | |||
| 1853 | Ga0207683_10043009 | |||
| 1854 | Ga0207683_10119275 | |||
| 1855 | Ga0207683_10121946 | |||
| 1856 | Ga0207683_10168849 | |||
| 1857 | Ga0207683_10256877 | |||
| 1858 | Ga0207683_10604156 | |||
| 1859 | Ga0207698_10029764 | |||
| 1860 | Ga0207698_10044432 | |||
| 1861 | Ga0207698_10075417 | |||
| 1862 | Ga0207698_10229111 | |||
| 1863 | Ga0207698_10358060 | |||
| 1864 | Ga0207698_10768417 | |||
| 1865 | Ga0207698_10776696 | |||
| 1866 | Ga0207698_10785323 | |||
| 1867 | Ga0207428_10081728 | |||
| 1868 | Ga0268266_10000049 | |||
| 1869 | Ga0268266_10376578 | |||
| 1870 | Ga0268265_10007727 | |||
| 1871 | Ga0268265_10693868 | |||
| 1872 | Ga0268265_10922804 | |||
| 1873 | Ga0268265_10940968 | |||
| 1874 | Ga0268264_10000041 | |||
| 1875 | Ga0268264_10033350 | |||
| 1876 | Ga0268264_10064722 | |||
| 1877 | Ga0268264_10173325 | |||
| 1878 | Ga0268264_10480145 | |||
| 1879 | Ga0268264_10620258 | |||
| 1880 | Ga0268264_10983594 | |||
| 1881 | Ga0307517_10006787 | |||
| 1882 | Ga0307517_10121308 | |||
| 1883 | Ga0307515_10000039 | |||
| 1884 | Ga0265338_10145233 | |||
| 1885 | Ga0307511_10000285 | |||
| 1886 | Ga0307512_10245539 | |||
| 1887 | Ga0265327_10000148 | |||
| 1888 | Ga0265327_10020847 | |||
| 1889 | Ga0307513_10446257 | |||
| 1890 | Ga0307509_10065959 | |||
| 1891 | Ga0307408_101210990 | |||
| 1892 | Ga0307508_10002192 | |||
| 1893 | Ga0307508_10213449 | |||
| 1894 | Ga0307516_10000577 | |||
| 1895 | Ga0307410_10435242 | |||
| 1896 | Ga0307410_10520084 | |||
| 1897 | Ga0307406_10088028 | |||
| 1898 | Ga0307412_10225685 | |||
| 1899 | Ga0307414_10097259 | |||
| 1900 | Ga0307510_10000805 | |||
| 1901 | Ga0373944_0038854 | |||
| 1902 | Ga0373924_0007156 | |||
| 1903 | Ga0373937_0007249 | |||
| 1904 | Ga0373937_0087775 | |||
| 1905 | Ga0373937_0225358 | |||
| 1906 | Ga0373925_0858652 | |||
| 1907 | Ga0395899_0030989 | |||
| 1908 | Ga0395899_0043326 | |||
| 1909 | Ga0395899_0067492 | |||
| 1910 | Ga0395899_0478465 | |||
| 1911 | Ga0395900_0016499 | |||
| 1912 | Ga0395900_0027821 | |||
| 1913 | Ga0395900_0331484 | |||
| 1914 | Ga0395900_0415642 | |||
| 1915 | Ga0395898_0014412 | |||
| 1916 | Ga0395898_0087288 | |||
| 1917 | Ga0395898_0119138 | |||
| 1918 | Ga0395898_0275414 | |||
| 1919 | Ga0395898_0289014 | |||
| 1920 | Ga0395898_0493639 | |||
| 1921 | Ga0395905_0010221 | |||
| 1922 | Ga0395905_0013318 | |||
| 1923 | Ga0395901_0048123 | |||
| 1924 | Ga0395901_0118359 | |||
| 1925 | Ga0395901_0612385 | |||
| 1926 | Ga0436365_1064270 | |||
| 1927 | Ga0439439_0044796 | |||
| 1928 | Ga0451851_0662514 | |||
| 1929 | Ga0451853_3599263 | |||
| 1930 | Ga0439431_0002560 | |||
| 1931 | Ga0439445_0003796 | |||
| 1932 | Ga0450923_013607 | |||
| 1933 | Ga0439435_0034654 | |||
| 1934 | Ga0439444_0111500 | |||
| 1935 | Ga0451577_0003916 | |||
| 1936 | Ga0451577_0363434 | |||
| 1937 | Ga0466972_0002253 | |||
| 1938 | Ga0466972_0025621 | |||
| 1939 | Ga0466965_0092476 | |||
| 1940 | Ga0466961_0286065 | |||
| 1941 | Ga0453684_0184530 | |||
| 1942 | Ga0453684_0196748 | |||
| 1943 | Ga0466971_0403680 | |||
| 1944 | Ga0466968_0186228 | |||
| 1945 | Ga0466970_0018840 | |||
| 1946 | Ga0466957_0608524 | |||
| 1947 | Ga0466959_0015692 | |||
| 1948 | Ga0466959_0036954 | |||
| 1949 | Ga0466959_0135438 | |||
| 1950 | Ga0466959_0421704 | |||
| 1951 | Ga0466967_0547046 | |||
| 1952 | Ga0495627_003482 | |||
| 1953 | Ga0495638_0145734 | |||
| 1954 | Ga0495594_0158854 | |||
| 1955 | Ga0495594_0180174 | |||
| 1956 | Ga0495606_0009028 | |||
| 1957 | Ga0495608_0156046 | |||
| 1958 | Ga0495618_0061762 | |||
| 1959 | Ga0495628_0204841 | |||
| 1960 | Ga0495630_0012812 | |||
| 1961 | Ga0495648_0001994 | |||
| 1962 | Ga0495652_0269494 | |||
| 1963 | Ga0495586_0025349 | |||
| 1964 | Ga0495633_0000080 | |||
| 1965 | Ga0495611_0000090 | |||
| 1966 | Ga0495625_0414061 | |||
| 1967 | Ga0495625_0466255 | |||
| 1968 | Ga0495635_0242715 | |||
| 1969 | Ga0495599_0063135 | |||
| 1970 | Ga0495658_0006053 | |||
| 1971 | Ga0495649_0153943 | |||
| 1972 | Ga0495674_0040485 | |||
| 1973 | Ga0495674_0044888 | |||
| 1974 | Ga0495674_0093062 | |||
| 1975 | Ga0495672_0041735 | |||
| 1976 | Ga0495687_000001 | |||
| 1977 | Ga0495684_0450118 | |||
| 1978 | Ga0495686_0000004 | |||
| 1979 | Ga0496107_0781283 | |||
| 1980 | Ga0496109_0488707 | |||
| 1981 | Ga0496110_0459762 | |||
| 1982 | Ga0496114_1050431 | |||
| 1983 | Ga0496115_0014866 | |||
| 1984 | Ga0496121_0000020 | |||
| 1985 | Ga0501303_041039 | |||
| 1986 | Ga0501032_0005376 | |||
| 1987 | Ga0501032_0174701 | |||
| 1988 | Ga0501034_0004706 | |||
| 1989 | Ga0501034_0029971 | |||
| 1990 | Ga0501034_0063983 | |||
| 1991 | Ga0501034_0191535 | |||
| 1992 | Ga0501034_0608036 | |||
| 1993 | Ga0501036_0002360 | |||
| 1994 | Ga0501037_0003684 | |||
| 1995 | Ga0501037_0530543 | |||
| 1996 | Ga0501038_0097094 | |||
| 1997 | Ga0501038_0439290 | |||
| 1998 | Ga0501039_0021736 | |||
| 1999 | Ga0501039_0417981 | |||
| 2000 | Ga0501043_0014705 | |||
| 2001 | Ga0501043_0041003 | |||
| 2002 | Ga0501043_0054946 | |||
| 2003 | Ga0501046_0006183 | |||
| 2004 | Ga0501046_0071786 | |||
| 2005 | Ga0501047_0007787 | |||
| 2006 | Ga0501047_0017174 | |||
| 2007 | Ga0501047_0127626 | |||
| 2008 | Ga0501047_0447883 | |||
| 2009 | Ga0501048_0026224 | |||
| 2010 | Ga0501048_0210012 | |||
| 2011 | Ga0501067_0020072 | |||
| 2012 | Ga0501068_0263515 | |||
| 2013 | Ga0501068_0470892 | |||
| 2014 | Ga0501069_0017918 | |||
| 2015 | Ga0501070_0019278 | |||
| 2016 | Ga0501071_0035647 | |||
| 2017 | Ga0501072_0190061 | |||
| 2018 | Ga0501073_0098141 | |||
| 2019 | Ga0501073_0437929 | |||
| 2020 | Ga0501073_0615026 | |||
| 2021 | Ga0501074_0000275 | |||
| 2022 | Ga0501074_0092302 | |||
| 2023 | Ga0501199_026574 | |||
| 2024 | Ga0501209_185413 | |||
| 2025 | Ga0501217_004702 | |||
| 2026 | Ga0501079_0074252 | |||
| 2027 | Ga0501080_0021404 | |||
| 2028 | Ga0501080_1695699 | |||
| 2029 | Ga0501083_0002224 | |||
| 2030 | Ga0501266_004675 | |||
| 2031 | Ga0501268_036610 | |||
| 2032 | Ga0501270_024066 | |||
| 2033 | Ga0501035_0020207 | |||
| 2034 | Ga0501044_0028371 | |||
| 2035 | Ga0501044_0033954 | |||
| 2036 | Ga0501044_0249923 | |||
| 2037 | Ga0501044_0561200 | |||
| 2038 | Ga0501226_011721 | |||
| 2039 | nmdc:mga0k408_250548_c1 | |||
| 2040 | nmdc:mga0k408_271357_c1 | |||
| 2041 | nmdc:mga05p37_111907_c1 | |||
| 2042 | nmdc:mga05p37_79737_c1 | |||
| 2043 | nmdc:mga09592_3366_c1 | |||
| 2044 | nmdc:mga0qj67_133146_c1 | |||
| 2045 | nmdc:mga06r32_46433_c1 | |||
| 2046 | nmdc:mga06r32_93166_c1 | |||
| 2047 | nmdc:mga08y16_1117189_c1 | |||
| 2048 | nmdc:mga08y16_12116_c1 | |||
| 2049 | nmdc:mga08y16_171833_c1 | |||
| 2050 | nmdc:mga0n895_697766_c1 | |||
| 2051 | nmdc:mga0n895_93002_c1 | |||
| 2052 | Ga0500578_0313501 | |||
| 2053 | Ga0500644_0033271 | |||
| 2054 | Ga0500646_0005492 | |||
| 2055 | Ga0500646_0174635 | |||
| 2056 | Ga0500583_0002757 | |||
| 2057 | Ga0500583_0009948 | |||
| 2058 | Ga0500651_0061801 | |||
| 2059 | Ga0500650_0123003 | |||
| 2060 | Ga0500650_0123180 | |||
| 2061 | Ga0500562_000062 | |||
| 2062 | Ga0500569_000060 | |||
| 2063 | Ga0500569_085446 | |||
| 2064 | Ga0500594_0130660 | |||
| 2065 | Ga0500642_0136518 | |||
| 2066 | Ga0500642_0284108 | |||
| 2067 | Ga0500652_047012 | |||
| 2068 | Ga0500652_259203 | |||
| 2069 | Ga0500577_0012073 | |||
| 2070 | Ga0500588_0030623 | |||
| 2071 | Ga0500604_0018802 | |||
| 2072 | Ga0500616_0020886 | |||
| 2073 | Ga0500616_0329919 | |||
| 2074 | Ga0500622_0000337 | |||
| 2075 | Ga0500622_0000900 | |||
| 2076 | Ga0500637_0165470 | |||
| 2077 | Ga0500645_010633 | |||
| 2078 | Ga0500645_026967 | |||
| 2079 | Ga0501084_0162330 | |||
| 2080 | Ga0500661_001888 | |||
| 2081 | Ga0501082_0028685 | |||
| 2082 | Ga0501082_0155183 | |||
| 2083 | Ga0466962_0012547 | |||
| 2084 | 2738726445 | |||
| 2085 | 2819590777 | |||
| 2086 | 2821137039 | |||
| 2087 | 2883072661 | |||
| 2088 | 2884795549 | |||
| 2089 | 2896087825 | |||
| 2090 | 2896112451 | |||
| 2091 | 2904468219 | |||
| 2092 | 2929157809 | |||
| 2093 | 2929241320 | |||
| 2094 | 2929923331 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.924 | 2 | 174 |
| 6jf3-assembly1.cif.gz_B | actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii | 0.9196 | 1 | 163 |
| 1lme-assembly2.cif.gz_B | crystal structure of peptide deformylase from thermotoga maritima | 0.9149 | 1 | 164 |
| 1rl4-assembly1.cif.gz_A | plasmodium falciparum peptide deformylase complex with inhibitor | 0.9143 | 5 | 179 |
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9126 | 2 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9161 | 1 | 164 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9041 | 1 | 164 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9032 | 1 | 163 | 3.90.45.10 |
| 5mtdB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.8973 | 3 | 158 | 3.90.45.10 |
| 1v3yB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.8965 | 2 | 180 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9M0N7-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9832 | 1 | 192 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A3C1CB09-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.976 | 1 | 192 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-E2NG18-F1-model_v4 | Peptide deformylase (EC 3.5.1.88) | 0.9703 | 1 | 168 |
GO:0042586
GO:0043686 |
| AF-A0A1Q3N2M4-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9666 | 1 | 192 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A561IL46-F1-model_v4 | deleted | 0.9661 | 1 | 189 |
|