F488987

General Info

Members Datasets Scaffolds Average Seq Length
1047 339 2094 193

Family's Representative Sequence

Representative Sequence 3300050005|Ga0501284_00052|Ga0501284_00052_22685_23389
Length 234
Sequence VLSVTRRRQATGHTRFTPLPVLIFGLNLPDSSIKSNQAINKMILPIVAYGAPILRTVAKDITPDYPGLAKLIEDMWETMYASNGVGLAAPQINRDIRLFVVDSSQIFENMDDDDDAKKYPDAPGIKQVFINAHIKSLNGEEWAYNEGCLSIPKIREDVYRSEEVVLEYVDENFESHTKTFNGISARVILHEYDHIEGKLFIDYLKPLKKRMLKGKLDDISKGKVRVDYKMTFQK

Samples

Sample ID Description Type Environment
1 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
227 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
228 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
289 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
290 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
295 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
296 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
308 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
309 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
310 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
311 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
312 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
313 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
314 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
315 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
318 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
319 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 2738541278 Niastella sp. CF465 Isolate Unclassified
330 2818991444 Filimonas endophytica 3197 Isolate Unclassified
331 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
332 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
333 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
334 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
335 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
336 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
337 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
338 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
339 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.64
Nodule 0
Rhizoplane 0.48
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 11.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501284_00052 3300050005 Bacteria 43054
2 JGI24740J21852_10025081 3300001979 Bacteria 2014
3 JGI24033J26618_1027915 3300002155 Bacteria 749
4 JGI24751J29686_10002768 3300002459 Bacteria 3527
5 JGI25154J39366_1000854 3300002738 Bacteria 13221
6 JGI25406J46586_10000164 3300003203 Bacteria 29453
7 JGI25153J46596_10000259 3300003215 Bacteria 42646
8 JGI25153J46596_10037826 3300003215 Bacteria 1529
9 rootH1_10049724 3300003316 Bacteria 1887
10 rootH2_10049481 3300003320 Bacteria 8238
11 rootH2_10061731 3300003320 Bacteria 8243
12 rootH2_10077478 3300003320 Bacteria 2626
13 rootH2_10231120 3300003320 Bacteria 1364
14 rootH2_10264992 3300003320 Bacteria 1687
15 rootL2_10009667 3300003322 Bacteria 12380
16 rootL2_10277905 3300003322 Bacteria 2997
17 rootH1_10005105 3300003323 Bacteria 17579
18 rootH1_10084867 3300003323 Bacteria 9308
19 rootH1_10096535 3300003323 Bacteria 2838
20 rootH1_10294837 3300003323 Bacteria 3208
21 JGI25160J50197_1000890 3300003354 Bacteria 15723
22 JGI25160J50197_1001617 3300003354 Bacteria 11069
23 JGI25160J50197_1008782 3300003354 Bacteria 3817
24 JGI25160J50197_1019271 3300003354 Bacteria 2097
25 Ga0055526_1037364 3300003771 Unclassified 1271
26 Ga0055528_1002738 3300003790 Bacteria 9236
27 Ga0055530_10001045 3300003791 Bacteria 22009
28 Ga0055543_1010568 3300004625 Unclassified 1928
29 Ga0065165_1000102 3300005262 Bacteria 140917
30 Ga0065165_1005334 3300005262 Bacteria 7305
31 Ga0065165_1008566 3300005262 Bacteria 4757
32 Ga0065714_10071790 3300005288 Bacteria 3494
33 Ga0065714_10237391 3300005288 Unclassified 802
34 Ga0065704_10076087 3300005289 Bacteria 5269
35 Ga0065704_10176799 3300005289 Bacteria 1259
36 Ga0065712_10077630 3300005290 Bacteria 3464
37 Ga0065712_10092087 3300005290 Bacteria 2344
38 Ga0065715_10005566 3300005293 Unclassified 3438
39 Ga0065707_10272871 3300005295 Bacteria 1067
40 Ga0070658_10496283 3300005327 Bacteria 1054
41 Ga0070676_10014038 3300005328 Bacteria 4395
42 Ga0070676_10416603 3300005328 Bacteria 938
43 Ga0070683_100013449 3300005329 Bacteria 7137
44 Ga0070683_100029539 3300005329 Bacteria 4964
45 Ga0070683_100050705 3300005329 Bacteria 3843
46 Ga0070683_100073584 3300005329 Unclassified 3190
47 Ga0070683_100117751 3300005329 Bacteria 2508
48 Ga0070683_100296627 3300005329 Bacteria 1537
49 Ga0070683_100347161 3300005329 Bacteria 1413
50 Ga0070690_100116466 3300005330 Unclassified 1789
51 Ga0070690_100279252 3300005330 Bacteria 1191
52 Ga0070670_100037676 3300005331 Bacteria 4160
53 Ga0070670_100090795 3300005331 Bacteria 2625
54 Ga0070670_100094000 3300005331 Bacteria 2579
55 Ga0070670_100116859 3300005331 Bacteria 2300
56 Ga0070670_100181776 3300005331 Unclassified 1826
57 Ga0070677_10061911 3300005333 Bacteria 1546
58 Ga0070677_10078169 3300005333 Bacteria 1409
59 Ga0070677_10196881 3300005333 Bacteria 970
60 Ga0070677_10202314 3300005333 Unclassified 959
61 Ga0068869_100009985 3300005334 Bacteria 6173
62 Ga0068869_100022928 3300005334 Bacteria 4306
63 Ga0068869_100055657 3300005334 Unclassified 2883
64 Ga0068869_100127384 3300005334 Bacteria 1954
65 Ga0068869_100247953 3300005334 Bacteria 1421
66 Ga0068869_100290617 3300005334 Bacteria 1317
67 Ga0068869_100299384 3300005334 Bacteria 1298
68 Ga0068869_100447076 3300005334 Bacteria 1071
69 Ga0068869_100789960 3300005334 Bacteria 815
70 Ga0068869_100832557 3300005334 Bacteria 795
71 Ga0070666_10000028 3300005335 Bacteria 144796
72 Ga0070666_10005690 3300005335 Bacteria 7645
73 Ga0070666_10057201 3300005335 Bacteria 2635
74 Ga0070666_10059242 3300005335 Bacteria 2590
75 Ga0070666_10322691 3300005335 Bacteria 1102
76 Ga0070680_100000254 3300005336 Bacteria 35204
77 Ga0070680_100442157 3300005336 Bacteria 1110
78 Ga0070680_101027924 3300005336 Bacteria 712
79 Ga0070682_100000190 3300005337 Bacteria 46394
80 Ga0070682_100000549 3300005337 Bacteria 23315
81 Ga0070682_100007803 3300005337 Bacteria 6026
82 Ga0070682_100377542 3300005337 Unclassified 1065
83 Ga0070682_100547673 3300005337 Bacteria 905
84 Ga0070682_100658926 3300005337 Bacteria 834
85 Ga0068868_100001540 3300005338 Bacteria 15748
86 Ga0068868_100010912 3300005338 Bacteria 6593
87 Ga0068868_100043201 3300005338 Bacteria 3520
88 Ga0068868_100075207 3300005338 Bacteria 2699
89 Ga0068868_100140702 3300005338 Bacteria 1981
90 Ga0068868_100149964 3300005338 Bacteria 1920
91 Ga0068868_100406995 3300005338 Bacteria 1175
92 Ga0068868_100621513 3300005338 Bacteria 959
93 Ga0070660_100095469 3300005339 Bacteria 2350
94 Ga0070660_100128342 3300005339 Bacteria 2028
95 Ga0070660_100283216 3300005339 Bacteria 1356
96 Ga0070660_100405787 3300005339 Bacteria 1127
97 Ga0070689_100001483 3300005340 Bacteria 14964
98 Ga0070689_100004391 3300005340 Bacteria 9521
99 Ga0070689_100228638 3300005340 Bacteria 1528
100 Ga0070689_100384396 3300005340 Unclassified 1184
101 Ga0070689_100419012 3300005340 Bacteria 1134
102 Ga0070691_10000748 3300005341 Bacteria 12807
103 Ga0070691_10055582 3300005341 Unclassified 1896
104 Ga0070687_100109830 3300005343 Bacteria 1559
105 Ga0070687_100156075 3300005343 Unclassified 1344
106 Ga0070661_100007303 3300005344 Bacteria 7621
107 Ga0070661_100037273 3300005344 Bacteria 3536
108 Ga0070692_10296988 3300005345 Bacteria 985
109 Ga0070692_10328003 3300005345 Bacteria 944
110 Ga0070669_100000458 3300005353 Bacteria 30951
111 Ga0070669_100026149 3300005353 Unclassified 4198
112 Ga0070669_100031608 3300005353 Bacteria 3824
113 Ga0070669_100124832 3300005353 Bacteria 1968
114 Ga0070669_100181644 3300005353 Bacteria 1646
115 Ga0070669_100678601 3300005353 Bacteria 869
116 Ga0070675_100006330 3300005354 Bacteria 9088
117 Ga0070675_100084712 3300005354 Bacteria 2647
118 Ga0070675_100141965 3300005354 Bacteria 2053
119 Ga0070675_100152186 3300005354 Bacteria 1984
120 Ga0070675_100392754 3300005354 Bacteria 1236
121 Ga0070675_100411791 3300005354 Bacteria 1207
122 Ga0070675_100855142 3300005354 Bacteria 833
123 Ga0070671_100401446 3300005355 Bacteria 1173
124 Ga0070671_100405368 3300005355 Bacteria 1167
125 Ga0070671_100517966 3300005355 Bacteria 1027
126 Ga0070671_101071431 3300005355 Bacteria 707
127 Ga0070674_100311522 3300005356 Unclassified 1259
128 Ga0070674_100638206 3300005356 Bacteria 904
129 Ga0070674_100891995 3300005356 Unclassified 774
130 Ga0070673_100006930 3300005364 Bacteria 7414
131 Ga0070673_100041630 3300005364 Bacteria 3536
132 Ga0070673_100049130 3300005364 Bacteria 3292
133 Ga0070673_100062586 3300005364 Bacteria 2957
134 Ga0070673_100131518 3300005364 Bacteria 2100
135 Ga0070673_100293197 3300005364 Bacteria 1430
136 Ga0070673_100374173 3300005364 Bacteria 1269
137 Ga0070673_101225137 3300005364 Bacteria 703
138 Ga0070688_100000687 3300005365 Bacteria 16799
139 Ga0070688_100146709 3300005365 Unclassified 1608
140 Ga0070688_100171013 3300005365 Bacteria 1500
141 Ga0070688_100516849 3300005365 Bacteria 903
142 Ga0070659_100008332 3300005366 Bacteria 7568
143 Ga0070659_100063157 3300005366 Bacteria 2929
144 Ga0070659_100290228 3300005366 Bacteria 1362
145 Ga0070659_100307568 3300005366 Bacteria 1323
146 Ga0070659_100920340 3300005366 Unclassified 765
147 Ga0070667_100011625 3300005367 Bacteria 7279
148 Ga0070667_100045885 3300005367 Bacteria 3676
149 Ga0070667_100047282 3300005367 Bacteria 3620
150 Ga0070667_100079651 3300005367 Unclassified 2800
151 Ga0070667_100746031 3300005367 Bacteria 907
152 Ga0070713_100180781 3300005436 Bacteria 1895
153 Ga0070701_10477048 3300005438 Bacteria 805
154 Ga0070700_100505080 3300005441 Unclassified 931
155 Ga0070694_100155193 3300005444 Bacteria 1675
156 Ga0070663_100076860 3300005455 Bacteria 2443
157 Ga0070663_100267077 3300005455 Bacteria 1359
158 Ga0070663_100277146 3300005455 Bacteria 1335
159 Ga0070663_100341629 3300005455 Bacteria 1210
160 Ga0070663_100441265 3300005455 Bacteria 1071
161 Ga0070678_100006600 3300005456 Bacteria 6821
162 Ga0070678_100098546 3300005456 Bacteria 2260
163 Ga0070678_100184284 3300005456 Unclassified 1712
164 Ga0070678_100361397 3300005456 Bacteria 1251
165 Ga0070662_100070054 3300005457 Bacteria 2583
166 Ga0070662_100114618 3300005457 Bacteria 2058
167 Ga0070662_100475171 3300005457 Bacteria 1040
168 Ga0070681_10017972 3300005458 Bacteria 7066
169 Ga0070681_10040427 3300005458 Bacteria 4672
170 Ga0070681_10294279 3300005458 Bacteria 1533
171 Ga0070681_10414461 3300005458 Bacteria 1259
172 Ga0068867_100022159 3300005459 Bacteria 4539
173 Ga0068867_100027695 3300005459 Unclassified 4076
174 Ga0068867_100052640 3300005459 Unclassified 3005
175 Ga0068867_100126326 3300005459 Unclassified 1982
176 Ga0068867_100233197 3300005459 Bacteria 1489
177 Ga0068867_100545865 3300005459 Bacteria 1003
178 Ga0068867_100561967 3300005459 Unclassified 990
179 Ga0068867_100784590 3300005459 Unclassified 848
180 Ga0068867_100913255 3300005459 Unclassified 791
181 Ga0070685_10004614 3300005466 Bacteria 6972
182 Ga0070685_10069690 3300005466 Bacteria 2080
183 Ga0070685_10726596 3300005466 Bacteria 726
184 Ga0070698_100000219 3300005471 Bacteria 56179
185 Ga0070698_100009802 3300005471 Bacteria 10239
186 Ga0070698_100025806 3300005471 Bacteria 6124
187 Ga0070679_100003985 3300005530 Bacteria 13601
188 Ga0070679_100057881 3300005530 Bacteria 3863
189 Ga0070679_100153326 3300005530 Bacteria 2280
190 Ga0070684_100003664 3300005535 Bacteria 11592
191 Ga0070684_100014418 3300005535 Bacteria 6404
192 Ga0070684_100252510 3300005535 Bacteria 1612
193 Ga0070684_100302277 3300005535 Bacteria 1468
194 Ga0070684_100363838 3300005535 Bacteria 1331
195 Ga0070684_100490222 3300005535 Bacteria 1138
196 Ga0068853_100001343 3300005539 Bacteria 17728
197 Ga0068853_100007345 3300005539 Bacteria 8818
198 Ga0068853_100123476 3300005539 Bacteria 2312
199 Ga0068853_100284071 3300005539 Bacteria 1526
200 Ga0068853_100290920 3300005539 Bacteria 1508
201 Ga0068853_100672050 3300005539 Bacteria 987
202 Ga0070672_100019519 3300005543 Bacteria 4921
203 Ga0070672_100031816 3300005543 Bacteria 3976
204 Ga0070672_100064678 3300005543 Bacteria 2890
205 Ga0070672_100373162 3300005543 Unclassified 1219
206 Ga0070672_100380193 3300005543 Bacteria 1208
207 Ga0070672_100565885 3300005543 Bacteria 988
208 Ga0070686_100019060 3300005544 Bacteria 4037
209 Ga0070686_100031948 3300005544 Bacteria 3224
210 Ga0070693_100003063 3300005547 Bacteria 7755
211 Ga0070693_100247695 3300005547 Bacteria 1180
212 Ga0070693_100306683 3300005547 Bacteria 1072
213 Ga0070665_100000001 3300005548 Bacteria 1083363
214 Ga0070665_100360212 3300005548 Bacteria 1460
215 Ga0068855_100000630 3300005563 Bacteria 43230
216 Ga0068855_100005487 3300005563 Bacteria 15473
217 Ga0068855_100028908 3300005563 Bacteria 6632
218 Ga0068855_100037238 3300005563 Bacteria 5787
219 Ga0068855_100073503 3300005563 Bacteria 3972
220 Ga0068855_100287554 3300005563 Bacteria 1823
221 Ga0070664_100007338 3300005564 Bacteria 8885
222 Ga0070664_100030034 3300005564 Bacteria 4532
223 Ga0070664_100036214 3300005564 Bacteria 4146
224 Ga0070664_100070880 3300005564 Bacteria 2986
225 Ga0070664_100094111 3300005564 Bacteria 2598
226 Ga0070664_100122024 3300005564 Bacteria 2283
227 Ga0070664_100179763 3300005564 Bacteria 1880
228 Ga0070664_100230408 3300005564 Bacteria 1660
229 Ga0068857_100004171 3300005577 Bacteria 12171
230 Ga0068857_100089405 3300005577 Bacteria 2756
231 Ga0068857_100090375 3300005577 Bacteria 2740
232 Ga0068857_100246128 3300005577 Bacteria 1638
233 Ga0068854_100046365 3300005578 Bacteria 3095
234 Ga0068854_100069907 3300005578 Bacteria 2565
235 Ga0068854_100103837 3300005578 Bacteria 2134
236 Ga0068854_101099045 3300005578 Bacteria 708
237 Ga0068856_100024544 3300005614 Bacteria 5870
238 Ga0068856_100122878 3300005614 Bacteria 2599
239 Ga0068856_100318760 3300005614 Bacteria 1572
240 Ga0068856_100777811 3300005614 Bacteria 977
241 Ga0068856_100845020 3300005614 Bacteria 935
242 Ga0070702_100013206 3300005615 Bacteria 4164
243 Ga0070702_100103743 3300005615 Bacteria 1749
244 Ga0070702_100284434 3300005615 Bacteria 1137
245 Ga0068852_100004976 3300005616 Bacteria 9451
246 Ga0068852_100011415 3300005616 Bacteria 6687
247 Ga0068852_100026143 3300005616 Bacteria 4740
248 Ga0068852_100120953 3300005616 Bacteria 2397
249 Ga0068852_100142563 3300005616 Bacteria 2219
250 Ga0068852_100203692 3300005616 Bacteria 1873
251 Ga0068852_100222964 3300005616 Bacteria 1794
252 Ga0068852_100386815 3300005616 Bacteria 1373
253 Ga0068852_100458946 3300005616 Bacteria 1263
254 Ga0068852_100706956 3300005616 Bacteria 1018
255 Ga0068852_100741205 3300005616 Unclassified 994
256 Ga0068852_101220381 3300005616 Bacteria 773
257 Ga0068859_100000012 3300005617 Bacteria 300376
258 Ga0068859_100004526 3300005617 Bacteria 14178
259 Ga0068859_100010347 3300005617 Bacteria 9388
260 Ga0068859_100014457 3300005617 Bacteria 7923
261 Ga0068859_100071266 3300005617 Bacteria 3511
262 Ga0068859_100120114 3300005617 Bacteria 2695
263 Ga0068859_100375174 3300005617 Bacteria 1518
264 Ga0068859_100507848 3300005617 Bacteria 1301
265 Ga0068859_100739931 3300005617 Bacteria 1072
266 Ga0068859_100747328 3300005617 Bacteria 1067
267 Ga0068864_100007320 3300005618 Bacteria 9082
268 Ga0068864_100192037 3300005618 Bacteria 1872
269 Ga0068864_100323996 3300005618 Viruses 1448
270 Ga0068864_100344148 3300005618 Unclassified 1406
271 Ga0068864_100463490 3300005618 Bacteria 1214
272 Ga0068864_100465159 3300005618 Unclassified 1212
273 Ga0068864_100688630 3300005618 Bacteria 998
274 Ga0068864_101538435 3300005618 Bacteria 669
275 Ga0068866_10206201 3300005718 Bacteria 1177
276 Ga0068866_10417001 3300005718 Bacteria 870
277 Ga0068861_100001813 3300005719 Bacteria 13764
278 Ga0068861_100011572 3300005719 Bacteria 6139
279 Ga0068861_100204084 3300005719 Unclassified 1661
280 Ga0068861_100392829 3300005719 Bacteria 1229
281 Ga0068861_100599183 3300005719 Bacteria 1011
282 Ga0068861_100860256 3300005719 Unclassified 856
283 Ga0068851_10020246 3300005834 Bacteria 3219
284 Ga0068851_10083720 3300005834 Bacteria 1670
285 Ga0068851_10086511 3300005834 Bacteria 1645
286 Ga0068851_10129479 3300005834 Viruses 1363
287 Ga0068863_100002125 3300005841 Bacteria 19657
288 Ga0068863_100009422 3300005841 Bacteria 9532
289 Ga0068863_100169946 3300005841 Bacteria 2091
290 Ga0068863_100202796 3300005841 Bacteria 1908
291 Ga0068863_100701945 3300005841 Unclassified 1006
292 Ga0068863_100712513 3300005841 Bacteria 998
293 Ga0068863_100783365 3300005841 Bacteria 950
294 Ga0068863_100807234 3300005841 Bacteria 936
295 Ga0068863_100823234 3300005841 Bacteria 926
296 Ga0068858_100090776 3300005842 Bacteria 2843
297 Ga0068858_100376187 3300005842 Unclassified 1362
298 Ga0068858_100657670 3300005842 Bacteria 1018
299 Ga0068860_100000046 3300005843 Bacteria 214800
300 Ga0068860_100015531 3300005843 Bacteria 7435
301 Ga0068860_100017189 3300005843 Bacteria 7051
302 Ga0068860_100020290 3300005843 Bacteria 6437
303 Ga0068860_100078259 3300005843 Unclassified 3144
304 Ga0068860_100206597 3300005843 Bacteria 1905
305 Ga0068860_100378120 3300005843 Bacteria 1398
306 Ga0068860_100428753 3300005843 Bacteria 1312
307 Ga0068860_100434036 3300005843 Bacteria 1304
308 Ga0068862_100003547 3300005844 Bacteria 13375
309 Ga0068862_100107535 3300005844 Bacteria 2445
310 Ga0068862_100282775 3300005844 Bacteria 1521
311 Ga0068862_100853229 3300005844 Bacteria 893
312 Ga0081540_1008965 3300005983 Bacteria 6923
313 Ga0081539_10000042 3300005985 Bacteria 289955
314 Ga0081539_10032798 3300005985 Bacteria 3174
315 Ga0070715_10222793 3300006163 Bacteria 971
316 Ga0070716_100390672 3300006173 Bacteria 997
317 Ga0097621_100057279 3300006237 Bacteria 3186
318 Ga0097621_100107620 3300006237 Unclassified 2353
319 Ga0097621_100292046 3300006237 Bacteria 1437
320 Ga0097621_100370617 3300006237 Bacteria 1277
321 Ga0068871_100081845 3300006358 Bacteria 2676
322 Ga0068871_100086180 3300006358 Bacteria 2609
323 Ga0068871_100115270 3300006358 Bacteria 2265
324 Ga0068871_100198471 3300006358 Unclassified 1731
325 Ga0068871_100220412 3300006358 Bacteria 1643
326 Ga0068871_100230205 3300006358 Bacteria 1608
327 Ga0068871_100252862 3300006358 Bacteria 1535
328 Ga0068871_100370115 3300006358 Unclassified 1271
329 Ga0068871_100425746 3300006358 Unclassified 1186
330 Ga0068871_100463045 3300006358 Bacteria 1138
331 Ga0068871_100510246 3300006358 Bacteria 1085
332 Ga0075428_100003382 3300006844 Bacteria 17450
333 Ga0075428_100030666 3300006844 Bacteria 5945
334 Ga0075428_100474460 3300006844 Bacteria 1339
335 Ga0075430_100225793 3300006846 Bacteria 1553
336 Ga0075431_100026919 3300006847 Bacteria 5898
337 Ga0075431_100036042 3300006847 Bacteria 5095
338 Ga0075433_10531426 3300006852 Bacteria 1034
339 Ga0075434_100493072 3300006871 Bacteria 1246
340 Ga0075429_100048056 3300006880 Bacteria 3711
341 Ga0068865_100047650 3300006881 Unclassified 2946
342 Ga0068865_100117865 3300006881 Bacteria 1969
343 Ga0068865_100618438 3300006881 Bacteria 917
344 Ga0097620_100000012 3300006931 Bacteria 300376
345 Ga0097620_100004526 3300006931 Bacteria 14178
346 Ga0097620_100010347 3300006931 Bacteria 9388
347 Ga0097620_100014457 3300006931 Bacteria 7923
348 Ga0097620_100071265 3300006931 Bacteria 3511
349 Ga0097620_100120114 3300006931 Bacteria 2695
350 Ga0097620_100375200 3300006931 Bacteria 1518
351 Ga0097620_100507830 3300006931 Bacteria 1301
352 Ga0097620_100739914 3300006931 Bacteria 1072
353 Ga0097620_100747387 3300006931 Bacteria 1067
354 Ga0105240_10001517 3300009093 Bacteria 39516
355 Ga0105240_10002254 3300009093 Bacteria 31303
356 Ga0105240_10002716 3300009093 Bacteria 28079
357 Ga0105240_10002823 3300009093 Bacteria 27474
358 Ga0105240_10003383 3300009093 Bacteria 24801
359 Ga0105240_10015666 3300009093 Bacteria 10295
360 Ga0105240_10021041 3300009093 Bacteria 8682
361 Ga0105240_10081433 3300009093 Bacteria 3978
362 Ga0105240_10164323 3300009093 Bacteria 2634
363 Ga0105240_10187700 3300009093 Bacteria 2433
364 Ga0105240_10273610 3300009093 Bacteria 1943
365 Ga0105240_10618002 3300009093 Unclassified 1191
366 Ga0105240_10725922 3300009093 Unclassified 1082
367 Ga0105240_10897855 3300009093 Bacteria 953
368 Ga0111539_10006834 3300009094 Bacteria 14661
369 Ga0111539_10019555 3300009094 Bacteria 8355
370 Ga0111539_10232439 3300009094 Bacteria 2147
371 Ga0111539_10234999 3300009094 Bacteria 2134
372 Ga0111539_10260807 3300009094 Unclassified 2017
373 Ga0111539_11182592 3300009094 Bacteria 888
374 Ga0105245_11719557 3300009098 Bacteria 680
375 Ga0105247_10008343 3300009101 Bacteria 6317
376 Ga0105247_10070853 3300009101 Bacteria 2179
377 Ga0114129_10027554 3300009147 Bacteria 8044
378 Ga0114129_10029791 3300009147 Bacteria 7728
379 Ga0105241_10000231 3300009174 Bacteria 42173
380 Ga0105241_10000619 3300009174 Bacteria 26737
381 Ga0105241_10001092 3300009174 Bacteria 20657
382 Ga0105241_10037436 3300009174 Bacteria 3655
383 Ga0105241_10225592 3300009174 Bacteria 1577
384 Ga0105241_10279067 3300009174 Bacteria 1426
385 Ga0105241_10554826 3300009174 Bacteria 1032
386 Ga0105241_10884921 3300009174 Bacteria 828
387 Ga0105241_10913572 3300009174 Bacteria 816
388 Ga0105242_10003805 3300009176 Bacteria 11735
389 Ga0105242_10025765 3300009176 Bacteria 4658
390 Ga0105242_10038298 3300009176 Bacteria 3855
391 Ga0105242_10071482 3300009176 Bacteria 2879
392 Ga0105248_10679772 3300009177 Unclassified 1161
393 Ga0105248_10788518 3300009177 Bacteria 1072
394 Ga0105237_10005413 3300009545 Bacteria 14415
395 Ga0105237_10007560 3300009545 Bacteria 11876
396 Ga0105237_10016964 3300009545 Bacteria 7554
397 Ga0105237_10023757 3300009545 Bacteria 6275
398 Ga0105237_10027549 3300009545 Bacteria 5798
399 Ga0105237_10086164 3300009545 Unclassified 3131
400 Ga0105237_10131036 3300009545 Bacteria 2502
401 Ga0105237_10177889 3300009545 Bacteria 2128
402 Ga0105237_10209474 3300009545 Bacteria 1949
403 Ga0105237_10385868 3300009545 Bacteria 1406
404 Ga0105238_10004513 3300009551 Bacteria 13799
405 Ga0105238_10364486 3300009551 Bacteria 1435
406 Ga0105249_10002774 3300009553 Bacteria 15117
407 Ga0105249_10014173 3300009553 Bacteria 7047
408 Ga0105249_10022623 3300009553 Bacteria 5632
409 Ga0105249_10049007 3300009553 Bacteria 3852
410 Ga0105249_10055586 3300009553 Bacteria 3622
411 Ga0105249_10103085 3300009553 Bacteria 2686
412 Ga0105249_10379783 3300009553 Bacteria 1439
413 Ga0105249_10574731 3300009553 Bacteria 1180
414 Ga0105249_10651888 3300009553 Bacteria 1110
415 Ga0105249_11113549 3300009553 Unclassified 860
416 Ga0105239_10000048 3300010375 Bacteria 177855
417 Ga0105239_10003203 3300010375 Bacteria 20233
418 Ga0105239_10008174 3300010375 Bacteria 11935
419 Ga0105239_10331963 3300010375 Bacteria 1715
420 Ga0105239_10440608 3300010375 Bacteria 1477
421 Ga0105239_10447065 3300010375 Bacteria 1466
422 Ga0105239_11050730 3300010375 Unclassified 937
423 Ga0105246_10119171 3300011119 Bacteria 1952
424 Ga0157373_10018157 3300013100 Bacteria 5123
425 Ga0157373_10035635 3300013100 Bacteria 3572
426 Ga0157373_10082332 3300013100 Bacteria 2268
427 Ga0157373_10095360 3300013100 Bacteria 2094
428 Ga0157373_10158556 3300013100 Bacteria 1592
429 Ga0157373_10371618 3300013100 Bacteria 1022
430 Ga0157371_10001955 3300013102 Bacteria 20487
431 Ga0157371_10002374 3300013102 Bacteria 18004
432 Ga0157371_10003617 3300013102 Bacteria 13918
433 Ga0157371_10007345 3300013102 Bacteria 8935
434 Ga0157371_10009513 3300013102 Bacteria 7642
435 Ga0157371_10011624 3300013102 Bacteria 6768
436 Ga0157371_10028051 3300013102 Bacteria 4079
437 Ga0157371_10029334 3300013102 Bacteria 3980
438 Ga0157371_10033466 3300013102 Bacteria 3693
439 Ga0157371_10044152 3300013102 Bacteria 3174
440 Ga0157371_10075177 3300013102 Bacteria 2392
441 Ga0157371_10112864 3300013102 Bacteria 1929
442 Ga0157371_10165955 3300013102 Unclassified 1577
443 Ga0157371_10409092 3300013102 Bacteria 993
444 Ga0157371_10798138 3300013102 Bacteria 711
445 Ga0157370_10003422 3300013104 Bacteria 18636
446 Ga0157370_10005999 3300013104 Bacteria 13518
447 Ga0157370_10009965 3300013104 Bacteria 10055
448 Ga0157370_10047147 3300013104 Bacteria 4131
449 Ga0157370_10079950 3300013104 Bacteria 3079
450 Ga0157370_10246888 3300013104 Bacteria 1651
451 Ga0157370_10413629 3300013104 Bacteria 1241
452 Ga0157370_10575451 3300013104 Unclassified 1032
453 Ga0157370_10650475 3300013104 Bacteria 963
454 Ga0157370_10732849 3300013104 Unclassified 901
455 Ga0157370_10818956 3300013104 Bacteria 847
456 Ga0157369_10019398 3300013105 Bacteria 7607
457 Ga0157369_10025207 3300013105 Bacteria 6603
458 Ga0157369_10038758 3300013105 Bacteria 5210
459 Ga0157369_10065152 3300013105 Bacteria 3922
460 Ga0157369_10082277 3300013105 Bacteria 3444
461 Ga0157369_10180385 3300013105 Bacteria 2222
462 Ga0157369_10221881 3300013105 Bacteria 1978
463 Ga0157374_10000001 3300013296 Bacteria 1077351
464 Ga0157374_10007434 3300013296 Bacteria 9343
465 Ga0157374_10040762 3300013296 Bacteria 4278
466 Ga0157374_10074742 3300013296 Bacteria 3201
467 Ga0157374_10278666 3300013296 Bacteria 1650
468 Ga0157374_10491797 3300013296 Bacteria 1231
469 Ga0157374_10618623 3300013296 Bacteria 1094
470 Ga0157374_10628975 3300013296 Bacteria 1084
471 Ga0157374_11119849 3300013296 Bacteria 808
472 Ga0157374_11249695 3300013296 Bacteria 764
473 Ga0157378_10009439 3300013297 Bacteria 8502
474 Ga0157378_10078887 3300013297 Bacteria 2971
475 Ga0157378_10090003 3300013297 Bacteria 2788
476 Ga0157378_10096036 3300013297 Bacteria 2700
477 Ga0157378_10103832 3300013297 Bacteria 2597
478 Ga0157378_10168521 3300013297 Unclassified 2052
479 Ga0157378_10336309 3300013297 Bacteria 1471
480 Ga0157378_10534639 3300013297 Bacteria 1175
481 Ga0157378_10717871 3300013297 Bacteria 1020
482 Ga0163162_10000525 3300013306 Bacteria 35526
483 Ga0163162_10000634 3300013306 Bacteria 32545
484 Ga0163162_10001998 3300013306 Bacteria 19189
485 Ga0163162_10083522 3300013306 Bacteria 3268
486 Ga0163162_10136328 3300013306 Bacteria 2565
487 Ga0163162_10146976 3300013306 Unclassified 2474
488 Ga0163162_10166450 3300013306 Bacteria 2329
489 Ga0163162_10218225 3300013306 Bacteria 2037
490 Ga0163162_10268762 3300013306 Bacteria 1837
491 Ga0163162_11085231 3300013306 Unclassified 907
492 Ga0163162_11560748 3300013306 Bacteria 753
493 Ga0163162_11654458 3300013306 Bacteria 731
494 Ga0157372_10000596 3300013307 Bacteria 39416
495 Ga0157372_10003307 3300013307 Bacteria 17410
496 Ga0157372_10023311 3300013307 Bacteria 6709
497 Ga0157372_10029574 3300013307 Bacteria 5984
498 Ga0157372_10036705 3300013307 Bacteria 5403
499 Ga0157372_10039319 3300013307 Bacteria 5220
500 Ga0157372_10044826 3300013307 Bacteria 4902
501 Ga0157372_10113417 3300013307 Bacteria 3106
502 Ga0157372_10114020 3300013307 Bacteria 3098
503 Ga0157372_10121142 3300013307 Bacteria 3005
504 Ga0157372_10147148 3300013307 Bacteria 2717
505 Ga0157372_10162507 3300013307 Bacteria 2581
506 Ga0157372_10188274 3300013307 Bacteria 2390
507 Ga0157372_10275386 3300013307 Bacteria 1956
508 Ga0157372_10400008 3300013307 Unclassified 1600
509 Ga0157372_10412383 3300013307 Bacteria 1574
510 Ga0157372_10426134 3300013307 Unclassified 1546
511 Ga0157372_10468790 3300013307 Bacteria 1468
512 Ga0157372_10556316 3300013307 Unclassified 1337
513 Ga0157372_11045040 3300013307 Bacteria 945
514 Ga0157372_11168834 3300013307 Bacteria 889
515 Ga0157375_10015917 3300013308 Bacteria 6743
516 Ga0157375_10034238 3300013308 Bacteria 4837
517 Ga0157375_10113504 3300013308 Bacteria 2810
518 Ga0157375_10128516 3300013308 Bacteria 2652
519 Ga0157375_10130103 3300013308 Bacteria 2635
520 Ga0157375_10236020 3300013308 Unclassified 1988
521 Ga0157375_10662013 3300013308 Bacteria 1200
522 Ga0157375_11222406 3300013308 Bacteria 882
523 Ga0163163_10027804 3300014325 Bacteria 5423
524 Ga0163163_10066541 3300014325 Bacteria 3579
525 Ga0163163_10207135 3300014325 Unclassified 2010
526 Ga0163163_10590682 3300014325 Bacteria 1174
527 Ga0157380_10000252 3300014326 Bacteria 32093
528 Ga0157380_10013322 3300014326 Bacteria 5992
529 Ga0157380_10352099 3300014326 Unclassified 1378
530 Ga0157380_10702348 3300014326 Unclassified 1016
531 Ga0157380_10710317 3300014326 Unclassified 1011
532 Ga0157380_11831184 3300014326 Unclassified 667
533 Ga0157377_10000289 3300014745 Bacteria 23989
534 Ga0157377_10045740 3300014745 Bacteria 2446
535 Ga0157377_10135387 3300014745 Bacteria 1509
536 Ga0157377_10247139 3300014745 Bacteria 1154
537 Ga0157379_10008718 3300014968 Bacteria 8837
538 Ga0157379_10146686 3300014968 Bacteria 2128
539 Ga0157379_10501382 3300014968 Bacteria 1125
540 Ga0157379_10510986 3300014968 Bacteria 1114
541 Ga0157379_10685989 3300014968 Bacteria 961
542 Ga0157379_10806202 3300014968 Unclassified 886
543 Ga0157376_10002300 3300014969 Bacteria 12901
544 Ga0157376_10045426 3300014969 Bacteria 3617
545 Ga0157376_10064270 3300014969 Bacteria 3094
546 Ga0157376_10083973 3300014969 Bacteria 2741
547 Ga0157376_10139443 3300014969 Bacteria 2173
548 Ga0157376_10167124 3300014969 Unclassified 2000
549 Ga0157376_10295151 3300014969 Bacteria 1532
550 Ga0157376_11466462 3300014969 Bacteria 715
551 Ga0163161_10011562 3300017792 Bacteria 6127
552 Ga0163161_10036913 3300017792 Bacteria 3501
553 Ga0209436_101851 3300025208 Bacteria 6857
554 Ga0209436_102302 3300025208 Bacteria 5853
555 Ga0209646_1000002 3300025246 Bacteria 1425781
556 Ga0209026_1000260 3300025250 Bacteria 65544
557 Ga0209673_1000530 3300025273 Bacteria 62542
558 Ga0209673_1070475 3300025273 Bacteria 834
559 Ga0209130_1006397 3300025284 Bacteria 3836
560 Ga0209564_1012160 3300025295 Unclassified 3777
561 Ga0209564_1025638 3300025295 Bacteria 1975
562 Ga0209758_1000722 3300025297 Bacteria 48485
563 Ga0209758_1016843 3300025297 Bacteria 3685
564 Ga0209050_1000134 3300025298 Bacteria 184417
565 Ga0207426_1000051 3300025302 Bacteria 391700
566 Ga0207426_1000192 3300025302 Bacteria 151680
567 Ga0207426_1000357 3300025302 Bacteria 83200
568 Ga0207426_1001446 3300025302 Bacteria 19697
569 Ga0209051_1055405 3300025303 Unclassified 1287
570 Ga0209257_1008115 3300025304 Bacteria 6098
571 Ga0207697_10010930 3300025315 Bacteria 3856
572 Ga0207697_10075712 3300025315 Unclassified 1414
573 Ga0207656_10012082 3300025321 Bacteria 3278
574 Ga0207656_10039574 3300025321 Unclassified 1995
575 Ga0207656_10056051 3300025321 Bacteria 1717
576 Ga0207656_10167513 3300025321 Bacteria 1049
577 Ga0207682_10063089 3300025893 Bacteria 1555
578 Ga0207710_10004222 3300025900 Bacteria 6296
579 Ga0207688_10059399 3300025901 Bacteria 2153
580 Ga0207688_10071579 3300025901 Bacteria 1968
581 Ga0207680_10000181 3300025903 Bacteria 30852
582 Ga0207680_10013017 3300025903 Bacteria 4256
583 Ga0207680_10216752 3300025903 Bacteria 1310
584 Ga0207680_10256989 3300025903 Unclassified 1208
585 Ga0207680_10567199 3300025903 Bacteria 811
586 Ga0207647_10002403 3300025904 Bacteria 14210
587 Ga0207647_10064246 3300025904 Bacteria 2231
588 Ga0207647_10083106 3300025904 Bacteria 1918
589 Ga0207647_10322748 3300025904 Unclassified 877
590 Ga0207685_10150542 3300025905 Bacteria 1052
591 Ga0207645_10000354 3300025907 Bacteria 38157
592 Ga0207645_10080416 3300025907 Bacteria 2089
593 Ga0207645_10376216 3300025907 Bacteria 953
594 Ga0207643_10003608 3300025908 Bacteria 8342
595 Ga0207643_10021340 3300025908 Bacteria 3557
596 Ga0207643_10141139 3300025908 Bacteria 1439
597 Ga0207705_10010065 3300025909 Bacteria 6883
598 Ga0207705_10105307 3300025909 Bacteria 2079
599 Ga0207705_10340538 3300025909 Bacteria 1154
600 Ga0207705_10419400 3300025909 Bacteria 1036
601 Ga0207705_10778317 3300025909 Bacteria 743
602 Ga0207654_10000479 3300025911 Bacteria 22913
603 Ga0207654_10017613 3300025911 Bacteria 3739
604 Ga0207654_10152349 3300025911 Bacteria 1485
605 Ga0207654_10207633 3300025911 Bacteria 1293
606 Ga0207654_10305533 3300025911 Unclassified 1083
607 Ga0207707_10000051 3300025912 Bacteria 117204
608 Ga0207707_10000490 3300025912 Bacteria 40927
609 Ga0207707_10023270 3300025912 Bacteria 5421
610 Ga0207707_10460221 3300025912 Bacteria 1088
611 Ga0207695_10000023 3300025913 Bacteria 657903
612 Ga0207695_10000110 3300025913 Bacteria 250079
613 Ga0207695_10000229 3300025913 Bacteria 149313
614 Ga0207695_10002425 3300025913 Bacteria 27622
615 Ga0207695_10007565 3300025913 Bacteria 13773
616 Ga0207695_10013891 3300025913 Bacteria 9573
617 Ga0207695_10025984 3300025913 Bacteria 6543
618 Ga0207695_10146043 3300025913 Unclassified 2309
619 Ga0207695_10148394 3300025913 Bacteria 2286
620 Ga0207695_10234931 3300025913 Bacteria 1736
621 Ga0207695_10524222 3300025913 Unclassified 1066
622 Ga0207671_10003761 3300025914 Bacteria 14941
623 Ga0207671_10004878 3300025914 Bacteria 12608
624 Ga0207671_10005499 3300025914 Bacteria 11657
625 Ga0207671_10005924 3300025914 Bacteria 11082
626 Ga0207671_10021960 3300025914 Bacteria 4834
627 Ga0207671_10022391 3300025914 Bacteria 4779
628 Ga0207671_10079793 3300025914 Bacteria 2452
629 Ga0207671_10213995 3300025914 Bacteria 1508
630 Ga0207671_10409211 3300025914 Unclassified 1079
631 Ga0207671_10672477 3300025914 Unclassified 824
632 Ga0207663_10907870 3300025916 Unclassified 704
633 Ga0207660_10011947 3300025917 Bacteria 5668
634 Ga0207660_10049724 3300025917 Bacteria 2974
635 Ga0207660_10452840 3300025917 Bacteria 1038
636 Ga0207662_10062467 3300025918 Bacteria 2238
637 Ga0207662_10126982 3300025918 Unclassified 1604
638 Ga0207662_10131192 3300025918 Bacteria 1580
639 Ga0207657_10005867 3300025919 Bacteria 12792
640 Ga0207657_10208169 3300025919 Bacteria 1571
641 Ga0207657_10215722 3300025919 Bacteria 1539
642 Ga0207657_10343606 3300025919 Unclassified 1178
643 Ga0207657_10412378 3300025919 Bacteria 1062
644 Ga0207649_10064596 3300025920 Bacteria 2314
645 Ga0207649_10079779 3300025920 Bacteria 2115
646 Ga0207652_10000844 3300025921 Bacteria 29188
647 Ga0207652_10002330 3300025921 Bacteria 16091
648 Ga0207652_10044159 3300025921 Bacteria 3796
649 Ga0207652_10153616 3300025921 Unclassified 2062
650 Ga0207652_10198471 3300025921 Bacteria 1806
651 Ga0207681_10002677 3300025923 Bacteria 11289
652 Ga0207681_10214772 3300025923 Bacteria 1485
653 Ga0207681_10257117 3300025923 Bacteria 1366
654 Ga0207681_10321418 3300025923 Bacteria 1231
655 Ga0207681_10460789 3300025923 Bacteria 1035
656 Ga0207694_10085982 3300025924 Bacteria 2475
657 Ga0207694_10223070 3300025924 Bacteria 1538
658 Ga0207650_10055745 3300025925 Bacteria 2935
659 Ga0207650_10061252 3300025925 Unclassified 2809
660 Ga0207650_10072482 3300025925 Bacteria 2592
661 Ga0207650_10182982 3300025925 Bacteria 1671
662 Ga0207650_10351422 3300025925 Bacteria 1213
663 Ga0207650_10679233 3300025925 Bacteria 869
664 Ga0207650_10901356 3300025925 Bacteria 751
665 Ga0207659_10017243 3300025926 Bacteria 4714
666 Ga0207659_10034081 3300025926 Bacteria 3509
667 Ga0207659_10065311 3300025926 Bacteria 2636
668 Ga0207659_10076730 3300025926 Bacteria 2457
669 Ga0207659_10378144 3300025926 Bacteria 1180
670 Ga0207659_10486081 3300025926 Bacteria 1043
671 Ga0207700_10186443 3300025928 Bacteria 1741
672 Ga0207644_10139740 3300025931 Bacteria 1864
673 Ga0207644_10869133 3300025931 Bacteria 755
674 Ga0207690_10020483 3300025932 Bacteria 4088
675 Ga0207690_10812084 3300025932 Bacteria 773
676 Ga0207706_10004117 3300025933 Bacteria 13721
677 Ga0207706_10019199 3300025933 Bacteria 6147
678 Ga0207706_10032095 3300025933 Bacteria 4677
679 Ga0207706_10119172 3300025933 Bacteria 2321
680 Ga0207686_10001204 3300025934 Bacteria 14998
681 Ga0207686_10004907 3300025934 Bacteria 7197
682 Ga0207686_10024746 3300025934 Bacteria 3483
683 Ga0207686_10172296 3300025934 Bacteria 1527
684 Ga0207670_10009484 3300025936 Bacteria 5556
685 Ga0207670_10417850 3300025936 Bacteria 1075
686 Ga0207670_10527184 3300025936 Bacteria 962
687 Ga0207669_10049414 3300025937 Bacteria 2507
688 Ga0207669_10400889 3300025937 Bacteria 1075
689 Ga0207669_10535996 3300025937 Bacteria 942
690 Ga0207704_10641562 3300025938 Bacteria 874
691 Ga0207691_10052281 3300025940 Bacteria 3731
692 Ga0207691_10064380 3300025940 Bacteria 3322
693 Ga0207691_10065091 3300025940 Bacteria 3301
694 Ga0207691_10164014 3300025940 Bacteria 1948
695 Ga0207691_10168047 3300025940 Unclassified 1922
696 Ga0207691_10207855 3300025940 Bacteria 1702
697 Ga0207691_11138277 3300025940 Bacteria 648
698 Ga0207711_10583650 3300025941 Bacteria 1043
699 Ga0207689_10001630 3300025942 Bacteria 21256
700 Ga0207689_10004925 3300025942 Bacteria 12028
701 Ga0207689_10017184 3300025942 Bacteria 6123
702 Ga0207689_10035703 3300025942 Bacteria 4128
703 Ga0207689_10047698 3300025942 Bacteria 3534
704 Ga0207689_10163592 3300025942 Bacteria 1833
705 Ga0207689_10305398 3300025942 Bacteria 1319
706 Ga0207689_10363717 3300025942 Bacteria 1203
707 Ga0207689_10578936 3300025942 Unclassified 944
708 Ga0207661_10065791 3300025944 Bacteria 2943
709 Ga0207661_10199729 3300025944 Bacteria 1757
710 Ga0207661_10255950 3300025944 Bacteria 1558
711 Ga0207661_10525306 3300025944 Bacteria 1083
712 Ga0207661_10606977 3300025944 Bacteria 1004
713 Ga0207679_10005876 3300025945 Bacteria 7713
714 Ga0207679_10011383 3300025945 Bacteria 5758
715 Ga0207679_10039533 3300025945 Bacteria 3369
716 Ga0207679_10078119 3300025945 Bacteria 2520
717 Ga0207679_10170624 3300025945 Bacteria 1791
718 Ga0207679_10216487 3300025945 Bacteria 1609
719 Ga0207667_10000700 3300025949 Bacteria 43461
720 Ga0207667_10000791 3300025949 Bacteria 41085
721 Ga0207667_10001278 3300025949 Bacteria 31572
722 Ga0207667_10016480 3300025949 Bacteria 8349
723 Ga0207667_10016684 3300025949 Bacteria 8288
724 Ga0207667_10053321 3300025949 Bacteria 4256
725 Ga0207667_10068860 3300025949 Unclassified 3684
726 Ga0207651_10058610 3300025960 Bacteria 2662
727 Ga0207651_10127147 3300025960 Bacteria 1944
728 Ga0207651_10207005 3300025960 Bacteria 1576
729 Ga0207651_10455731 3300025960 Unclassified 1098
730 Ga0207651_10883209 3300025960 Bacteria 795
731 Ga0207651_10929203 3300025960 Bacteria 775
732 Ga0207712_10001140 3300025961 Bacteria 18539
733 Ga0207712_10010175 3300025961 Bacteria 5964
734 Ga0207712_10011532 3300025961 Bacteria 5633
735 Ga0207712_10028607 3300025961 Bacteria 3729
736 Ga0207712_10032957 3300025961 Bacteria 3499
737 Ga0207712_10198751 3300025961 Unclassified 1588
738 Ga0207712_11057306 3300025961 Bacteria 721
739 Ga0207640_10014382 3300025981 Bacteria 4555
740 Ga0207640_10036466 3300025981 Bacteria 3087
741 Ga0207640_10305943 3300025981 Bacteria 1260
742 Ga0207640_10383778 3300025981 Unclassified 1139
743 Ga0207640_10394174 3300025981 Unclassified 1126
744 Ga0207658_10036058 3300025986 Bacteria 3545
745 Ga0207658_10055445 3300025986 Bacteria 2937
746 Ga0207658_10115285 3300025986 Bacteria 2132
747 Ga0207658_10362929 3300025986 Bacteria 1264
748 Ga0207677_10007101 3300026023 Bacteria 6166
749 Ga0207677_10105146 3300026023 Bacteria 2088
750 Ga0207677_10314456 3300026023 Unclassified 1299
751 Ga0207677_10319971 3300026023 Bacteria 1289
752 Ga0207677_10363535 3300026023 Bacteria 1216
753 Ga0207677_10523483 3300026023 Bacteria 1029
754 Ga0207703_10028673 3300026035 Bacteria 4391
755 Ga0207703_10138152 3300026035 Bacteria 2112
756 Ga0207639_10011306 3300026041 Bacteria 6196
757 Ga0207639_10094875 3300026041 Bacteria 2396
758 Ga0207639_10453180 3300026041 Bacteria 1165
759 Ga0207639_11561503 3300026041 Bacteria 619
760 Ga0207678_10043963 3300026067 Bacteria 3865
761 Ga0207678_10504724 3300026067 Bacteria 1055
762 Ga0207678_10656084 3300026067 Bacteria 922
763 Ga0207708_10242451 3300026075 Unclassified 1450
764 Ga0207702_10025423 3300026078 Bacteria 4914
765 Ga0207702_10048565 3300026078 Bacteria 3580
766 Ga0207702_10061412 3300026078 Bacteria 3205
767 Ga0207702_10061650 3300026078 Bacteria 3200
768 Ga0207702_10726446 3300026078 Unclassified 979
769 Ga0207641_10000152 3300026088 Bacteria 98311
770 Ga0207641_10008689 3300026088 Bacteria 8388
771 Ga0207641_10008722 3300026088 Bacteria 8374
772 Ga0207641_10023563 3300026088 Bacteria 5070
773 Ga0207641_10207005 3300026088 Bacteria 1812
774 Ga0207641_10781092 3300026088 Bacteria 944
775 Ga0207648_10000404 3300026089 Bacteria 48036
776 Ga0207648_10027693 3300026089 Bacteria 5029
777 Ga0207648_10031696 3300026089 Unclassified 4672
778 Ga0207648_10133294 3300026089 Bacteria 2187
779 Ga0207648_10145625 3300026089 Unclassified 2089
780 Ga0207648_10156304 3300026089 Bacteria 2013
781 Ga0207648_10188245 3300026089 Bacteria 1828
782 Ga0207648_10605990 3300026089 Bacteria 1010
783 Ga0207648_11230247 3300026089 Unclassified 703
784 Ga0207676_10040485 3300026095 Bacteria 3571
785 Ga0207676_10090400 3300026095 Bacteria 2512
786 Ga0207676_10364227 3300026095 Bacteria 1341
787 Ga0207676_10396683 3300026095 Bacteria 1288
788 Ga0207676_10397949 3300026095 Bacteria 1286
789 Ga0207676_10737921 3300026095 Bacteria 957
790 Ga0207676_10846553 3300026095 Unclassified 894
791 Ga0207674_10009204 3300026116 Bacteria 11321
792 Ga0207674_10011898 3300026116 Bacteria 9755
793 Ga0207674_10062365 3300026116 Unclassified 3765
794 Ga0207674_10069373 3300026116 Bacteria 3545
795 Ga0207674_10164138 3300026116 Bacteria 2175
796 Ga0207674_10286990 3300026116 Bacteria 1594
797 Ga0207674_11249331 3300026116 Bacteria 712
798 Ga0207675_100000386 3300026118 Bacteria 42305
799 Ga0207675_100042508 3300026118 Bacteria 4244
800 Ga0207675_100191393 3300026118 Bacteria 1962
801 Ga0207675_100312707 3300026118 Bacteria 1532
802 Ga0207675_100383627 3300026118 Unclassified 1382
803 Ga0207675_100435463 3300026118 Bacteria 1297
804 Ga0207675_100460026 3300026118 Bacteria 1262
805 Ga0207683_10004600 3300026121 Bacteria 11887
806 Ga0207683_10043009 3300026121 Bacteria 3946
807 Ga0207683_10119275 3300026121 Bacteria 2367
808 Ga0207683_10121946 3300026121 Unclassified 2341
809 Ga0207683_10168849 3300026121 Bacteria 1981
810 Ga0207683_10256877 3300026121 Bacteria 1595
811 Ga0207683_10604156 3300026121 Bacteria 1015
812 Ga0207698_10029764 3300026142 Bacteria 3916
813 Ga0207698_10044432 3300026142 Bacteria 3338
814 Ga0207698_10075417 3300026142 Bacteria 2695
815 Ga0207698_10229111 3300026142 Bacteria 1685
816 Ga0207698_10358060 3300026142 Bacteria 1381
817 Ga0207698_10768417 3300026142 Bacteria 964
818 Ga0207698_10776696 3300026142 Bacteria 959
819 Ga0207698_10785323 3300026142 Bacteria 953
820 Ga0207428_10081728 3300027907 Bacteria 2522
821 Ga0268266_10000049 3300028379 Bacteria 307763
822 Ga0268266_10376578 3300028379 Bacteria 1338
823 Ga0268265_10007727 3300028380 Bacteria 7257
824 Ga0268265_10693868 3300028380 Unclassified 983
825 Ga0268265_10922804 3300028380 Bacteria 858
826 Ga0268265_10940968 3300028380 Bacteria 851
827 Ga0268264_10000041 3300028381 Bacteria 372501
828 Ga0268264_10033350 3300028381 Bacteria 4229
829 Ga0268264_10064722 3300028381 Bacteria 3078
830 Ga0268264_10173325 3300028381 Bacteria 1953
831 Ga0268264_10480145 3300028381 Bacteria 1209
832 Ga0268264_10620258 3300028381 Bacteria 1068
833 Ga0268264_10983594 3300028381 Bacteria 850
834 Ga0307517_10006787 3300028786 Bacteria 16844
835 Ga0307517_10121308 3300028786 Unclassified 1931
836 Ga0307515_10000039 3300028794 Bacteria 323229
837 Ga0265338_10145233 3300028800 Bacteria 1852
838 Ga0307511_10000285 3300030521 Bacteria 53256
839 Ga0307512_10245539 3300030522 Bacteria 899
840 Ga0265327_10000148 3300031251 Bacteria 151952
841 Ga0265327_10020847 3300031251 Bacteria 3978
842 Ga0307513_10446257 3300031456 Bacteria 1019
843 Ga0307509_10065959 3300031507 Bacteria 3799
844 Ga0307408_101210990 3300031548 Bacteria 705
845 Ga0307508_10002192 3300031616 Bacteria 20875
846 Ga0307508_10213449 3300031616 Bacteria 1530
847 Ga0307516_10000577 3300031730 Bacteria 49482
848 Ga0307410_10435242 3300031852 Bacteria 1067
849 Ga0307410_10520084 3300031852 Unclassified 982
850 Ga0307406_10088028 3300031901 Unclassified 2083
851 Ga0307412_10225685 3300031911 Unclassified 1439
852 Ga0307414_10097259 3300032004 Bacteria 2205
853 Ga0307510_10000805 3300033180 Bacteria 32598
854 Ga0373944_0038854 3300035089 Bacteria 1463
855 Ga0373924_0007156 3300035410 Bacteria 4023
856 Ga0373937_0007249 3300036401 Bacteria 9595
857 Ga0373937_0087775 3300036401 Bacteria 2879
858 Ga0373937_0225358 3300036401 Bacteria 1765
859 Ga0373925_0858652 3300037068 Bacteria 748
860 Ga0395899_0030989 3300037312 Bacteria 4021
861 Ga0395899_0043326 3300037312 Bacteria 3357
862 Ga0395899_0067492 3300037312 Bacteria 2624
863 Ga0395899_0478465 3300037312 Bacteria 811
864 Ga0395900_0016499 3300037418 Bacteria 7533
865 Ga0395900_0027821 3300037418 Bacteria 5792
866 Ga0395900_0331484 3300037418 Bacteria 1500
867 Ga0395900_0415642 3300037418 Bacteria 1306
868 Ga0395898_0014412 3300037466 Bacteria 8121
869 Ga0395898_0087288 3300037466 Bacteria 3005
870 Ga0395898_0119138 3300037466 Bacteria 2528
871 Ga0395898_0275414 3300037466 Bacteria 1605
872 Ga0395898_0289014 3300037466 Bacteria 1564
873 Ga0395898_0493639 3300037466 Bacteria 1164
874 Ga0395905_0010221 3300037471 Bacteria 9145
875 Ga0395905_0013318 3300037471 Bacteria 7885
876 Ga0395901_0048123 3300038443 Bacteria 4428
877 Ga0395901_0118359 3300038443 Bacteria 2783
878 Ga0395901_0612385 3300038443 Bacteria 1097
879 Ga0436365_1064270 3300039437 Bacteria 3354
880 Ga0439439_0044796 3300041406 Bacteria 1153
881 Ga0451851_0662514 3300041507 Unclassified 678
882 Ga0451853_3599263 3300041512 Bacteria 956
883 Ga0439431_0002560 3300041997 Bacteria 4014
884 Ga0439445_0003796 3300042004 Bacteria 3395
885 Ga0450923_013607 3300042125 Bacteria 1497
886 Ga0439435_0034654 3300042436 Bacteria 1389
887 Ga0439444_0111500 3300042437 Unclassified 630
888 Ga0451577_0003916 3300042876 Bacteria 16080
889 Ga0451577_0363434 3300042876 Unclassified 1313
890 Ga0466972_0002253 3300044658 Bacteria 9479
891 Ga0466972_0025621 3300044658 Bacteria 2922
892 Ga0466965_0092476 3300044683 Bacteria 1540
893 Ga0466961_0286065 3300044693 Unclassified 1008
894 Ga0453684_0184530 3300044712 Bacteria 2446
895 Ga0453684_0196748 3300044712 Unclassified 2353
896 Ga0466971_0403680 3300044719 Bacteria 666
897 Ga0466968_0186228 3300044735 Unclassified 967
898 Ga0466970_0018840 3300044765 Bacteria 3576
899 Ga0466957_0608524 3300044842 Bacteria 765
900 Ga0466959_0015692 3300045049 Bacteria 5524
901 Ga0466959_0036954 3300045049 Bacteria 3608
902 Ga0466959_0135438 3300045049 Bacteria 1744
903 Ga0466959_0421704 3300045049 Bacteria 906
904 Ga0466967_0547046 3300045976 Bacteria 1139
905 Ga0495627_003482 3300046453 Bacteria 6930
906 Ga0495638_0145734 3300046460 Bacteria 1378
907 Ga0495594_0158854 3300046499 Bacteria 1285
908 Ga0495594_0180174 3300046499 Bacteria 1203
909 Ga0495606_0009028 3300046507 Bacteria 8517
910 Ga0495608_0156046 3300046511 Bacteria 1453
911 Ga0495618_0061762 3300046514 Bacteria 2377
912 Ga0495628_0204841 3300046516 Bacteria 1485
913 Ga0495630_0012812 3300046517 Bacteria 6093
914 Ga0495648_0001994 3300046524 Bacteria 19331
915 Ga0495652_0269494 3300046529 Bacteria 1252
916 Ga0495586_0025349 3300046535 Bacteria 3173
917 Ga0495633_0000080 3300046558 Bacteria 127703
918 Ga0495611_0000090 3300046648 Bacteria 63531
919 Ga0495625_0414061 3300046660 Bacteria 840
920 Ga0495625_0466255 3300046660 Bacteria 778
921 Ga0495635_0242715 3300046663 Bacteria 1215
922 Ga0495599_0063135 3300046678 Bacteria 2314
923 Ga0495658_0006053 3300046683 Bacteria 5943
924 Ga0495649_0153943 3300046694 Bacteria 1207
925 Ga0495674_0040485 3300047319 Bacteria 4168
926 Ga0495674_0044888 3300047319 Bacteria 3927
927 Ga0495674_0093062 3300047319 Bacteria 2573
928 Ga0495672_0041735 3300047320 Bacteria 2772
929 Ga0495687_000001 3300047443 Bacteria 1215582
930 Ga0495684_0450118 3300047471 Bacteria 895
931 Ga0495686_0000004 3300047472 Bacteria 869019
932 Ga0496107_0781283 3300048910 Bacteria 700
933 Ga0496109_0488707 3300048912 Bacteria 1162
934 Ga0496110_0459762 3300048913 Bacteria 1160
935 Ga0496114_1050431 3300048917 Bacteria 698
936 Ga0496115_0014866 3300048918 Bacteria 5902
937 Ga0496121_0000020 3300048924 Bacteria 498732
938 Ga0501303_041039 3300049526 Bacteria 579
939 Ga0501032_0005376 3300049569 Bacteria 9530
940 Ga0501032_0174701 3300049569 Bacteria 1408
941 Ga0501034_0004706 3300049571 Bacteria 15108
942 Ga0501034_0029971 3300049571 Bacteria 5530
943 Ga0501034_0063983 3300049571 Bacteria 3692
944 Ga0501034_0191535 3300049571 Bacteria 2007
945 Ga0501034_0608036 3300049571 Bacteria 998
946 Ga0501036_0002360 3300049572 Bacteria 14767
947 Ga0501037_0003684 3300049573 Bacteria 11123
948 Ga0501037_0530543 3300049573 Bacteria 796
949 Ga0501038_0097094 3300049574 Bacteria 2458
950 Ga0501038_0439290 3300049574 Bacteria 1005
951 Ga0501039_0021736 3300049575 Bacteria 4923
952 Ga0501039_0417981 3300049575 Bacteria 1053
953 Ga0501043_0014705 3300049579 Bacteria 6126
954 Ga0501043_0041003 3300049579 Bacteria 3638
955 Ga0501043_0054946 3300049579 Bacteria 3128
956 Ga0501046_0006183 3300049580 Bacteria 10632
957 Ga0501046_0071786 3300049580 Bacteria 2689
958 Ga0501047_0007787 3300049581 Bacteria 10089
959 Ga0501047_0017174 3300049581 Bacteria 6926
960 Ga0501047_0127626 3300049581 Unclassified 2424
961 Ga0501047_0447883 3300049581 Bacteria 1121
962 Ga0501048_0026224 3300049582 Bacteria 4243
963 Ga0501048_0210012 3300049582 Unclassified 1381
964 Ga0501067_0020072 3300049583 Unclassified 3697
965 Ga0501068_0263515 3300049584 Bacteria 1099
966 Ga0501068_0470892 3300049584 Bacteria 814
967 Ga0501069_0017918 3300049585 Unclassified 3818
968 Ga0501070_0019278 3300049586 Bacteria 5721
969 Ga0501071_0035647 3300049587 Unclassified 3545
970 Ga0501072_0190061 3300049588 Unclassified 1638
971 Ga0501073_0098141 3300049589 Unclassified 2034
972 Ga0501073_0437929 3300049589 Bacteria 903
973 Ga0501073_0615026 3300049589 Bacteria 750
974 Ga0501074_0000275 3300049590 Bacteria 29532
975 Ga0501074_0092302 3300049590 Bacteria 2168
976 Ga0501199_026574 3300049650 Bacteria 695
977 Ga0501209_185413 3300049656 Bacteria 636
978 Ga0501217_004702 3300049661 Bacteria 2816
979 Ga0501079_0074252 3300049741 Unclassified 2629
980 Ga0501080_0021404 3300049742 Bacteria 5985
981 Ga0501080_1695699 3300049742 Bacteria 533
982 Ga0501083_0002224 3300049744 Bacteria 13260
983 Ga0501266_004675 3300049763 Bacteria 1701
984 Ga0501268_036610 3300049765 Bacteria 909
985 Ga0501270_024066 3300049767 Bacteria 954
986 Ga0501035_0020207 3300049822 Bacteria 6116
987 Ga0501044_0028371 3300049823 Bacteria 5908
988 Ga0501044_0033954 3300049823 Bacteria 5356
989 Ga0501044_0249923 3300049823 Bacteria 1715
990 Ga0501044_0561200 3300049823 Bacteria 1038
991 Ga0501226_011721 3300049853 Bacteria 971
992 nmdc:mga0k408_250548_c1 3300050493 Bacteria 1057
993 nmdc:mga0k408_271357_c1 3300050493 Bacteria 1013
994 nmdc:mga05p37_111907_c1 3300050507 Bacteria 3357
995 nmdc:mga05p37_79737_c1 3300050507 Unclassified 4031
996 nmdc:mga09592_3366_c1 3300050508 Bacteria 12924
997 nmdc:mga0qj67_133146_c1 3300050509 Bacteria 2014
998 nmdc:mga06r32_46433_c1 3300050510 Bacteria 4144
999 nmdc:mga06r32_93166_c1 3300050510 Bacteria 2946
1000 nmdc:mga08y16_1117189_c1 3300050511 Bacteria 762
1001 nmdc:mga08y16_12116_c1 3300050511 Bacteria 9062
1002 nmdc:mga08y16_171833_c1 3300050511 Bacteria 2251
1003 nmdc:mga0n895_697766_c1 3300050512 Bacteria 1011
1004 nmdc:mga0n895_93002_c1 3300050512 Bacteria 3019
1005 Ga0500578_0313501 3300053086 Unclassified 927
1006 Ga0500644_0033271 3300053088 Bacteria 1654
1007 Ga0500646_0005492 3300053090 Bacteria 3206
1008 Ga0500646_0174635 3300053090 Bacteria 725
1009 Ga0500583_0002757 3300053092 Bacteria 5363
1010 Ga0500583_0009948 3300053092 Bacteria 3502
1011 Ga0500651_0061801 3300053093 Bacteria 2338
1012 Ga0500650_0123003 3300053098 Bacteria 1209
1013 Ga0500650_0123180 3300053098 Bacteria 1208
1014 Ga0500562_000062 3300053108 Bacteria 53042
1015 Ga0500569_000060 3300053109 Bacteria 19362
1016 Ga0500569_085446 3300053109 Bacteria 1015
1017 Ga0500594_0130660 3300053118 Bacteria 795
1018 Ga0500642_0136518 3300053130 Bacteria 1150
1019 Ga0500642_0284108 3300053130 Bacteria 751
1020 Ga0500652_047012 3300053131 Bacteria 1753
1021 Ga0500652_259203 3300053131 Bacteria 686
1022 Ga0500577_0012073 3300053142 Bacteria 2599
1023 Ga0500588_0030623 3300053146 Bacteria 1545
1024 Ga0500604_0018802 3300053151 Bacteria 1929
1025 Ga0500616_0020886 3300053153 Bacteria 3677
1026 Ga0500616_0329919 3300053153 Bacteria 626
1027 Ga0500622_0000337 3300053156 Bacteria 46048
1028 Ga0500622_0000900 3300053156 Bacteria 25309
1029 Ga0500637_0165470 3300053178 Bacteria 1273
1030 Ga0500645_010633 3300053730 Bacteria 3033
1031 Ga0500645_026967 3300053730 Bacteria 1745
1032 Ga0501084_0162330 3300054114 Unclassified 1885
1033 Ga0500661_001888 3300055283 Bacteria 3958
1034 Ga0501082_0028685 3300060353 Unclassified 4794
1035 Ga0501082_0155183 3300060353 Unclassified 1989
1036 Ga0466962_0012547 3300061719 Bacteria 4075
1037 2738726445 2738541278 Bacteria 9755573
1038 2819590777 2818991444 Bacteria 6968812
1039 2821137039 2821136567 Bacteria 8080116
1040 2883072661 2883068021 Bacteria 6192739
1041 2884795549 2884791551 Bacteria 8511252
1042 2896087825 2896085136 Bacteria 6129793
1043 2896112451 2896109856 Bacteria 7140722
1044 2904468219 2904467357 Bacteria 8057758
1045 2929157809 2929154850 Bacteria 6753285
1046 2929241320 2929239360 Bacteria 7745570
1047 2929923331 2929921140 Bacteria 8649150
1048 Ga0501284_00052
1049 JGI24740J21852_10025081
1050 JGI24033J26618_1027915
1051 JGI24751J29686_10002768
1052 JGI25154J39366_1000854
1053 JGI25406J46586_10000164
1054 JGI25153J46596_10000259
1055 JGI25153J46596_10037826
1056 rootH1_10049724
1057 rootH2_10049481
1058 rootH2_10061731
1059 rootH2_10077478
1060 rootH2_10231120
1061 rootH2_10264992
1062 rootL2_10009667
1063 rootL2_10277905
1064 rootH1_10005105
1065 rootH1_10084867
1066 rootH1_10096535
1067 rootH1_10294837
1068 JGI25160J50197_1000890
1069 JGI25160J50197_1001617
1070 JGI25160J50197_1008782
1071 JGI25160J50197_1019271
1072 Ga0055526_1037364
1073 Ga0055528_1002738
1074 Ga0055530_10001045
1075 Ga0055543_1010568
1076 Ga0065165_1000102
1077 Ga0065165_1005334
1078 Ga0065165_1008566
1079 Ga0065714_10071790
1080 Ga0065714_10237391
1081 Ga0065704_10076087
1082 Ga0065704_10176799
1083 Ga0065712_10077630
1084 Ga0065712_10092087
1085 Ga0065715_10005566
1086 Ga0065707_10272871
1087 Ga0070658_10496283
1088 Ga0070676_10014038
1089 Ga0070676_10416603
1090 Ga0070683_100013449
1091 Ga0070683_100029539
1092 Ga0070683_100050705
1093 Ga0070683_100073584
1094 Ga0070683_100117751
1095 Ga0070683_100296627
1096 Ga0070683_100347161
1097 Ga0070690_100116466
1098 Ga0070690_100279252
1099 Ga0070670_100037676
1100 Ga0070670_100090795
1101 Ga0070670_100094000
1102 Ga0070670_100116859
1103 Ga0070670_100181776
1104 Ga0070677_10061911
1105 Ga0070677_10078169
1106 Ga0070677_10196881
1107 Ga0070677_10202314
1108 Ga0068869_100009985
1109 Ga0068869_100022928
1110 Ga0068869_100055657
1111 Ga0068869_100127384
1112 Ga0068869_100247953
1113 Ga0068869_100290617
1114 Ga0068869_100299384
1115 Ga0068869_100447076
1116 Ga0068869_100789960
1117 Ga0068869_100832557
1118 Ga0070666_10000028
1119 Ga0070666_10005690
1120 Ga0070666_10057201
1121 Ga0070666_10059242
1122 Ga0070666_10322691
1123 Ga0070680_100000254
1124 Ga0070680_100442157
1125 Ga0070680_101027924
1126 Ga0070682_100000190
1127 Ga0070682_100000549
1128 Ga0070682_100007803
1129 Ga0070682_100377542
1130 Ga0070682_100547673
1131 Ga0070682_100658926
1132 Ga0068868_100001540
1133 Ga0068868_100010912
1134 Ga0068868_100043201
1135 Ga0068868_100075207
1136 Ga0068868_100140702
1137 Ga0068868_100149964
1138 Ga0068868_100406995
1139 Ga0068868_100621513
1140 Ga0070660_100095469
1141 Ga0070660_100128342
1142 Ga0070660_100283216
1143 Ga0070660_100405787
1144 Ga0070689_100001483
1145 Ga0070689_100004391
1146 Ga0070689_100228638
1147 Ga0070689_100384396
1148 Ga0070689_100419012
1149 Ga0070691_10000748
1150 Ga0070691_10055582
1151 Ga0070687_100109830
1152 Ga0070687_100156075
1153 Ga0070661_100007303
1154 Ga0070661_100037273
1155 Ga0070692_10296988
1156 Ga0070692_10328003
1157 Ga0070669_100000458
1158 Ga0070669_100026149
1159 Ga0070669_100031608
1160 Ga0070669_100124832
1161 Ga0070669_100181644
1162 Ga0070669_100678601
1163 Ga0070675_100006330
1164 Ga0070675_100084712
1165 Ga0070675_100141965
1166 Ga0070675_100152186
1167 Ga0070675_100392754
1168 Ga0070675_100411791
1169 Ga0070675_100855142
1170 Ga0070671_100401446
1171 Ga0070671_100405368
1172 Ga0070671_100517966
1173 Ga0070671_101071431
1174 Ga0070674_100311522
1175 Ga0070674_100638206
1176 Ga0070674_100891995
1177 Ga0070673_100006930
1178 Ga0070673_100041630
1179 Ga0070673_100049130
1180 Ga0070673_100062586
1181 Ga0070673_100131518
1182 Ga0070673_100293197
1183 Ga0070673_100374173
1184 Ga0070673_101225137
1185 Ga0070688_100000687
1186 Ga0070688_100146709
1187 Ga0070688_100171013
1188 Ga0070688_100516849
1189 Ga0070659_100008332
1190 Ga0070659_100063157
1191 Ga0070659_100290228
1192 Ga0070659_100307568
1193 Ga0070659_100920340
1194 Ga0070667_100011625
1195 Ga0070667_100045885
1196 Ga0070667_100047282
1197 Ga0070667_100079651
1198 Ga0070667_100746031
1199 Ga0070713_100180781
1200 Ga0070701_10477048
1201 Ga0070700_100505080
1202 Ga0070694_100155193
1203 Ga0070663_100076860
1204 Ga0070663_100267077
1205 Ga0070663_100277146
1206 Ga0070663_100341629
1207 Ga0070663_100441265
1208 Ga0070678_100006600
1209 Ga0070678_100098546
1210 Ga0070678_100184284
1211 Ga0070678_100361397
1212 Ga0070662_100070054
1213 Ga0070662_100114618
1214 Ga0070662_100475171
1215 Ga0070681_10017972
1216 Ga0070681_10040427
1217 Ga0070681_10294279
1218 Ga0070681_10414461
1219 Ga0068867_100022159
1220 Ga0068867_100027695
1221 Ga0068867_100052640
1222 Ga0068867_100126326
1223 Ga0068867_100233197
1224 Ga0068867_100545865
1225 Ga0068867_100561967
1226 Ga0068867_100784590
1227 Ga0068867_100913255
1228 Ga0070685_10004614
1229 Ga0070685_10069690
1230 Ga0070685_10726596
1231 Ga0070698_100000219
1232 Ga0070698_100009802
1233 Ga0070698_100025806
1234 Ga0070679_100003985
1235 Ga0070679_100057881
1236 Ga0070679_100153326
1237 Ga0070684_100003664
1238 Ga0070684_100014418
1239 Ga0070684_100252510
1240 Ga0070684_100302277
1241 Ga0070684_100363838
1242 Ga0070684_100490222
1243 Ga0068853_100001343
1244 Ga0068853_100007345
1245 Ga0068853_100123476
1246 Ga0068853_100284071
1247 Ga0068853_100290920
1248 Ga0068853_100672050
1249 Ga0070672_100019519
1250 Ga0070672_100031816
1251 Ga0070672_100064678
1252 Ga0070672_100373162
1253 Ga0070672_100380193
1254 Ga0070672_100565885
1255 Ga0070686_100019060
1256 Ga0070686_100031948
1257 Ga0070693_100003063
1258 Ga0070693_100247695
1259 Ga0070693_100306683
1260 Ga0070665_100000001
1261 Ga0070665_100360212
1262 Ga0068855_100000630
1263 Ga0068855_100005487
1264 Ga0068855_100028908
1265 Ga0068855_100037238
1266 Ga0068855_100073503
1267 Ga0068855_100287554
1268 Ga0070664_100007338
1269 Ga0070664_100030034
1270 Ga0070664_100036214
1271 Ga0070664_100070880
1272 Ga0070664_100094111
1273 Ga0070664_100122024
1274 Ga0070664_100179763
1275 Ga0070664_100230408
1276 Ga0068857_100004171
1277 Ga0068857_100089405
1278 Ga0068857_100090375
1279 Ga0068857_100246128
1280 Ga0068854_100046365
1281 Ga0068854_100069907
1282 Ga0068854_100103837
1283 Ga0068854_101099045
1284 Ga0068856_100024544
1285 Ga0068856_100122878
1286 Ga0068856_100318760
1287 Ga0068856_100777811
1288 Ga0068856_100845020
1289 Ga0070702_100013206
1290 Ga0070702_100103743
1291 Ga0070702_100284434
1292 Ga0068852_100004976
1293 Ga0068852_100011415
1294 Ga0068852_100026143
1295 Ga0068852_100120953
1296 Ga0068852_100142563
1297 Ga0068852_100203692
1298 Ga0068852_100222964
1299 Ga0068852_100386815
1300 Ga0068852_100458946
1301 Ga0068852_100706956
1302 Ga0068852_100741205
1303 Ga0068852_101220381
1304 Ga0068859_100000012
1305 Ga0068859_100004526
1306 Ga0068859_100010347
1307 Ga0068859_100014457
1308 Ga0068859_100071266
1309 Ga0068859_100120114
1310 Ga0068859_100375174
1311 Ga0068859_100507848
1312 Ga0068859_100739931
1313 Ga0068859_100747328
1314 Ga0068864_100007320
1315 Ga0068864_100192037
1316 Ga0068864_100323996
1317 Ga0068864_100344148
1318 Ga0068864_100463490
1319 Ga0068864_100465159
1320 Ga0068864_100688630
1321 Ga0068864_101538435
1322 Ga0068866_10206201
1323 Ga0068866_10417001
1324 Ga0068861_100001813
1325 Ga0068861_100011572
1326 Ga0068861_100204084
1327 Ga0068861_100392829
1328 Ga0068861_100599183
1329 Ga0068861_100860256
1330 Ga0068851_10020246
1331 Ga0068851_10083720
1332 Ga0068851_10086511
1333 Ga0068851_10129479
1334 Ga0068863_100002125
1335 Ga0068863_100009422
1336 Ga0068863_100169946
1337 Ga0068863_100202796
1338 Ga0068863_100701945
1339 Ga0068863_100712513
1340 Ga0068863_100783365
1341 Ga0068863_100807234
1342 Ga0068863_100823234
1343 Ga0068858_100090776
1344 Ga0068858_100376187
1345 Ga0068858_100657670
1346 Ga0068860_100000046
1347 Ga0068860_100015531
1348 Ga0068860_100017189
1349 Ga0068860_100020290
1350 Ga0068860_100078259
1351 Ga0068860_100206597
1352 Ga0068860_100378120
1353 Ga0068860_100428753
1354 Ga0068860_100434036
1355 Ga0068862_100003547
1356 Ga0068862_100107535
1357 Ga0068862_100282775
1358 Ga0068862_100853229
1359 Ga0081540_1008965
1360 Ga0081539_10000042
1361 Ga0081539_10032798
1362 Ga0070715_10222793
1363 Ga0070716_100390672
1364 Ga0097621_100057279
1365 Ga0097621_100107620
1366 Ga0097621_100292046
1367 Ga0097621_100370617
1368 Ga0068871_100081845
1369 Ga0068871_100086180
1370 Ga0068871_100115270
1371 Ga0068871_100198471
1372 Ga0068871_100220412
1373 Ga0068871_100230205
1374 Ga0068871_100252862
1375 Ga0068871_100370115
1376 Ga0068871_100425746
1377 Ga0068871_100463045
1378 Ga0068871_100510246
1379 Ga0075428_100003382
1380 Ga0075428_100030666
1381 Ga0075428_100474460
1382 Ga0075430_100225793
1383 Ga0075431_100026919
1384 Ga0075431_100036042
1385 Ga0075433_10531426
1386 Ga0075434_100493072
1387 Ga0075429_100048056
1388 Ga0068865_100047650
1389 Ga0068865_100117865
1390 Ga0068865_100618438
1391 Ga0097620_100000012
1392 Ga0097620_100004526
1393 Ga0097620_100010347
1394 Ga0097620_100014457
1395 Ga0097620_100071265
1396 Ga0097620_100120114
1397 Ga0097620_100375200
1398 Ga0097620_100507830
1399 Ga0097620_100739914
1400 Ga0097620_100747387
1401 Ga0105240_10001517
1402 Ga0105240_10002254
1403 Ga0105240_10002716
1404 Ga0105240_10002823
1405 Ga0105240_10003383
1406 Ga0105240_10015666
1407 Ga0105240_10021041
1408 Ga0105240_10081433
1409 Ga0105240_10164323
1410 Ga0105240_10187700
1411 Ga0105240_10273610
1412 Ga0105240_10618002
1413 Ga0105240_10725922
1414 Ga0105240_10897855
1415 Ga0111539_10006834
1416 Ga0111539_10019555
1417 Ga0111539_10232439
1418 Ga0111539_10234999
1419 Ga0111539_10260807
1420 Ga0111539_11182592
1421 Ga0105245_11719557
1422 Ga0105247_10008343
1423 Ga0105247_10070853
1424 Ga0114129_10027554
1425 Ga0114129_10029791
1426 Ga0105241_10000231
1427 Ga0105241_10000619
1428 Ga0105241_10001092
1429 Ga0105241_10037436
1430 Ga0105241_10225592
1431 Ga0105241_10279067
1432 Ga0105241_10554826
1433 Ga0105241_10884921
1434 Ga0105241_10913572
1435 Ga0105242_10003805
1436 Ga0105242_10025765
1437 Ga0105242_10038298
1438 Ga0105242_10071482
1439 Ga0105248_10679772
1440 Ga0105248_10788518
1441 Ga0105237_10005413
1442 Ga0105237_10007560
1443 Ga0105237_10016964
1444 Ga0105237_10023757
1445 Ga0105237_10027549
1446 Ga0105237_10086164
1447 Ga0105237_10131036
1448 Ga0105237_10177889
1449 Ga0105237_10209474
1450 Ga0105237_10385868
1451 Ga0105238_10004513
1452 Ga0105238_10364486
1453 Ga0105249_10002774
1454 Ga0105249_10014173
1455 Ga0105249_10022623
1456 Ga0105249_10049007
1457 Ga0105249_10055586
1458 Ga0105249_10103085
1459 Ga0105249_10379783
1460 Ga0105249_10574731
1461 Ga0105249_10651888
1462 Ga0105249_11113549
1463 Ga0105239_10000048
1464 Ga0105239_10003203
1465 Ga0105239_10008174
1466 Ga0105239_10331963
1467 Ga0105239_10440608
1468 Ga0105239_10447065
1469 Ga0105239_11050730
1470 Ga0105246_10119171
1471 Ga0157373_10018157
1472 Ga0157373_10035635
1473 Ga0157373_10082332
1474 Ga0157373_10095360
1475 Ga0157373_10158556
1476 Ga0157373_10371618
1477 Ga0157371_10001955
1478 Ga0157371_10002374
1479 Ga0157371_10003617
1480 Ga0157371_10007345
1481 Ga0157371_10009513
1482 Ga0157371_10011624
1483 Ga0157371_10028051
1484 Ga0157371_10029334
1485 Ga0157371_10033466
1486 Ga0157371_10044152
1487 Ga0157371_10075177
1488 Ga0157371_10112864
1489 Ga0157371_10165955
1490 Ga0157371_10409092
1491 Ga0157371_10798138
1492 Ga0157370_10003422
1493 Ga0157370_10005999
1494 Ga0157370_10009965
1495 Ga0157370_10047147
1496 Ga0157370_10079950
1497 Ga0157370_10246888
1498 Ga0157370_10413629
1499 Ga0157370_10575451
1500 Ga0157370_10650475
1501 Ga0157370_10732849
1502 Ga0157370_10818956
1503 Ga0157369_10019398
1504 Ga0157369_10025207
1505 Ga0157369_10038758
1506 Ga0157369_10065152
1507 Ga0157369_10082277
1508 Ga0157369_10180385
1509 Ga0157369_10221881
1510 Ga0157374_10000001
1511 Ga0157374_10007434
1512 Ga0157374_10040762
1513 Ga0157374_10074742
1514 Ga0157374_10278666
1515 Ga0157374_10491797
1516 Ga0157374_10618623
1517 Ga0157374_10628975
1518 Ga0157374_11119849
1519 Ga0157374_11249695
1520 Ga0157378_10009439
1521 Ga0157378_10078887
1522 Ga0157378_10090003
1523 Ga0157378_10096036
1524 Ga0157378_10103832
1525 Ga0157378_10168521
1526 Ga0157378_10336309
1527 Ga0157378_10534639
1528 Ga0157378_10717871
1529 Ga0163162_10000525
1530 Ga0163162_10000634
1531 Ga0163162_10001998
1532 Ga0163162_10083522
1533 Ga0163162_10136328
1534 Ga0163162_10146976
1535 Ga0163162_10166450
1536 Ga0163162_10218225
1537 Ga0163162_10268762
1538 Ga0163162_11085231
1539 Ga0163162_11560748
1540 Ga0163162_11654458
1541 Ga0157372_10000596
1542 Ga0157372_10003307
1543 Ga0157372_10023311
1544 Ga0157372_10029574
1545 Ga0157372_10036705
1546 Ga0157372_10039319
1547 Ga0157372_10044826
1548 Ga0157372_10113417
1549 Ga0157372_10114020
1550 Ga0157372_10121142
1551 Ga0157372_10147148
1552 Ga0157372_10162507
1553 Ga0157372_10188274
1554 Ga0157372_10275386
1555 Ga0157372_10400008
1556 Ga0157372_10412383
1557 Ga0157372_10426134
1558 Ga0157372_10468790
1559 Ga0157372_10556316
1560 Ga0157372_11045040
1561 Ga0157372_11168834
1562 Ga0157375_10015917
1563 Ga0157375_10034238
1564 Ga0157375_10113504
1565 Ga0157375_10128516
1566 Ga0157375_10130103
1567 Ga0157375_10236020
1568 Ga0157375_10662013
1569 Ga0157375_11222406
1570 Ga0163163_10027804
1571 Ga0163163_10066541
1572 Ga0163163_10207135
1573 Ga0163163_10590682
1574 Ga0157380_10000252
1575 Ga0157380_10013322
1576 Ga0157380_10352099
1577 Ga0157380_10702348
1578 Ga0157380_10710317
1579 Ga0157380_11831184
1580 Ga0157377_10000289
1581 Ga0157377_10045740
1582 Ga0157377_10135387
1583 Ga0157377_10247139
1584 Ga0157379_10008718
1585 Ga0157379_10146686
1586 Ga0157379_10501382
1587 Ga0157379_10510986
1588 Ga0157379_10685989
1589 Ga0157379_10806202
1590 Ga0157376_10002300
1591 Ga0157376_10045426
1592 Ga0157376_10064270
1593 Ga0157376_10083973
1594 Ga0157376_10139443
1595 Ga0157376_10167124
1596 Ga0157376_10295151
1597 Ga0157376_11466462
1598 Ga0163161_10011562
1599 Ga0163161_10036913
1600 Ga0209436_101851
1601 Ga0209436_102302
1602 Ga0209646_1000002
1603 Ga0209026_1000260
1604 Ga0209673_1000530
1605 Ga0209673_1070475
1606 Ga0209130_1006397
1607 Ga0209564_1012160
1608 Ga0209564_1025638
1609 Ga0209758_1000722
1610 Ga0209758_1016843
1611 Ga0209050_1000134
1612 Ga0207426_1000051
1613 Ga0207426_1000192
1614 Ga0207426_1000357
1615 Ga0207426_1001446
1616 Ga0209051_1055405
1617 Ga0209257_1008115
1618 Ga0207697_10010930
1619 Ga0207697_10075712
1620 Ga0207656_10012082
1621 Ga0207656_10039574
1622 Ga0207656_10056051
1623 Ga0207656_10167513
1624 Ga0207682_10063089
1625 Ga0207710_10004222
1626 Ga0207688_10059399
1627 Ga0207688_10071579
1628 Ga0207680_10000181
1629 Ga0207680_10013017
1630 Ga0207680_10216752
1631 Ga0207680_10256989
1632 Ga0207680_10567199
1633 Ga0207647_10002403
1634 Ga0207647_10064246
1635 Ga0207647_10083106
1636 Ga0207647_10322748
1637 Ga0207685_10150542
1638 Ga0207645_10000354
1639 Ga0207645_10080416
1640 Ga0207645_10376216
1641 Ga0207643_10003608
1642 Ga0207643_10021340
1643 Ga0207643_10141139
1644 Ga0207705_10010065
1645 Ga0207705_10105307
1646 Ga0207705_10340538
1647 Ga0207705_10419400
1648 Ga0207705_10778317
1649 Ga0207654_10000479
1650 Ga0207654_10017613
1651 Ga0207654_10152349
1652 Ga0207654_10207633
1653 Ga0207654_10305533
1654 Ga0207707_10000051
1655 Ga0207707_10000490
1656 Ga0207707_10023270
1657 Ga0207707_10460221
1658 Ga0207695_10000023
1659 Ga0207695_10000110
1660 Ga0207695_10000229
1661 Ga0207695_10002425
1662 Ga0207695_10007565
1663 Ga0207695_10013891
1664 Ga0207695_10025984
1665 Ga0207695_10146043
1666 Ga0207695_10148394
1667 Ga0207695_10234931
1668 Ga0207695_10524222
1669 Ga0207671_10003761
1670 Ga0207671_10004878
1671 Ga0207671_10005499
1672 Ga0207671_10005924
1673 Ga0207671_10021960
1674 Ga0207671_10022391
1675 Ga0207671_10079793
1676 Ga0207671_10213995
1677 Ga0207671_10409211
1678 Ga0207671_10672477
1679 Ga0207663_10907870
1680 Ga0207660_10011947
1681 Ga0207660_10049724
1682 Ga0207660_10452840
1683 Ga0207662_10062467
1684 Ga0207662_10126982
1685 Ga0207662_10131192
1686 Ga0207657_10005867
1687 Ga0207657_10208169
1688 Ga0207657_10215722
1689 Ga0207657_10343606
1690 Ga0207657_10412378
1691 Ga0207649_10064596
1692 Ga0207649_10079779
1693 Ga0207652_10000844
1694 Ga0207652_10002330
1695 Ga0207652_10044159
1696 Ga0207652_10153616
1697 Ga0207652_10198471
1698 Ga0207681_10002677
1699 Ga0207681_10214772
1700 Ga0207681_10257117
1701 Ga0207681_10321418
1702 Ga0207681_10460789
1703 Ga0207694_10085982
1704 Ga0207694_10223070
1705 Ga0207650_10055745
1706 Ga0207650_10061252
1707 Ga0207650_10072482
1708 Ga0207650_10182982
1709 Ga0207650_10351422
1710 Ga0207650_10679233
1711 Ga0207650_10901356
1712 Ga0207659_10017243
1713 Ga0207659_10034081
1714 Ga0207659_10065311
1715 Ga0207659_10076730
1716 Ga0207659_10378144
1717 Ga0207659_10486081
1718 Ga0207700_10186443
1719 Ga0207644_10139740
1720 Ga0207644_10869133
1721 Ga0207690_10020483
1722 Ga0207690_10812084
1723 Ga0207706_10004117
1724 Ga0207706_10019199
1725 Ga0207706_10032095
1726 Ga0207706_10119172
1727 Ga0207686_10001204
1728 Ga0207686_10004907
1729 Ga0207686_10024746
1730 Ga0207686_10172296
1731 Ga0207670_10009484
1732 Ga0207670_10417850
1733 Ga0207670_10527184
1734 Ga0207669_10049414
1735 Ga0207669_10400889
1736 Ga0207669_10535996
1737 Ga0207704_10641562
1738 Ga0207691_10052281
1739 Ga0207691_10064380
1740 Ga0207691_10065091
1741 Ga0207691_10164014
1742 Ga0207691_10168047
1743 Ga0207691_10207855
1744 Ga0207691_11138277
1745 Ga0207711_10583650
1746 Ga0207689_10001630
1747 Ga0207689_10004925
1748 Ga0207689_10017184
1749 Ga0207689_10035703
1750 Ga0207689_10047698
1751 Ga0207689_10163592
1752 Ga0207689_10305398
1753 Ga0207689_10363717
1754 Ga0207689_10578936
1755 Ga0207661_10065791
1756 Ga0207661_10199729
1757 Ga0207661_10255950
1758 Ga0207661_10525306
1759 Ga0207661_10606977
1760 Ga0207679_10005876
1761 Ga0207679_10011383
1762 Ga0207679_10039533
1763 Ga0207679_10078119
1764 Ga0207679_10170624
1765 Ga0207679_10216487
1766 Ga0207667_10000700
1767 Ga0207667_10000791
1768 Ga0207667_10001278
1769 Ga0207667_10016480
1770 Ga0207667_10016684
1771 Ga0207667_10053321
1772 Ga0207667_10068860
1773 Ga0207651_10058610
1774 Ga0207651_10127147
1775 Ga0207651_10207005
1776 Ga0207651_10455731
1777 Ga0207651_10883209
1778 Ga0207651_10929203
1779 Ga0207712_10001140
1780 Ga0207712_10010175
1781 Ga0207712_10011532
1782 Ga0207712_10028607
1783 Ga0207712_10032957
1784 Ga0207712_10198751
1785 Ga0207712_11057306
1786 Ga0207640_10014382
1787 Ga0207640_10036466
1788 Ga0207640_10305943
1789 Ga0207640_10383778
1790 Ga0207640_10394174
1791 Ga0207658_10036058
1792 Ga0207658_10055445
1793 Ga0207658_10115285
1794 Ga0207658_10362929
1795 Ga0207677_10007101
1796 Ga0207677_10105146
1797 Ga0207677_10314456
1798 Ga0207677_10319971
1799 Ga0207677_10363535
1800 Ga0207677_10523483
1801 Ga0207703_10028673
1802 Ga0207703_10138152
1803 Ga0207639_10011306
1804 Ga0207639_10094875
1805 Ga0207639_10453180
1806 Ga0207639_11561503
1807 Ga0207678_10043963
1808 Ga0207678_10504724
1809 Ga0207678_10656084
1810 Ga0207708_10242451
1811 Ga0207702_10025423
1812 Ga0207702_10048565
1813 Ga0207702_10061412
1814 Ga0207702_10061650
1815 Ga0207702_10726446
1816 Ga0207641_10000152
1817 Ga0207641_10008689
1818 Ga0207641_10008722
1819 Ga0207641_10023563
1820 Ga0207641_10207005
1821 Ga0207641_10781092
1822 Ga0207648_10000404
1823 Ga0207648_10027693
1824 Ga0207648_10031696
1825 Ga0207648_10133294
1826 Ga0207648_10145625
1827 Ga0207648_10156304
1828 Ga0207648_10188245
1829 Ga0207648_10605990
1830 Ga0207648_11230247
1831 Ga0207676_10040485
1832 Ga0207676_10090400
1833 Ga0207676_10364227
1834 Ga0207676_10396683
1835 Ga0207676_10397949
1836 Ga0207676_10737921
1837 Ga0207676_10846553
1838 Ga0207674_10009204
1839 Ga0207674_10011898
1840 Ga0207674_10062365
1841 Ga0207674_10069373
1842 Ga0207674_10164138
1843 Ga0207674_10286990
1844 Ga0207674_11249331
1845 Ga0207675_100000386
1846 Ga0207675_100042508
1847 Ga0207675_100191393
1848 Ga0207675_100312707
1849 Ga0207675_100383627
1850 Ga0207675_100435463
1851 Ga0207675_100460026
1852 Ga0207683_10004600
1853 Ga0207683_10043009
1854 Ga0207683_10119275
1855 Ga0207683_10121946
1856 Ga0207683_10168849
1857 Ga0207683_10256877
1858 Ga0207683_10604156
1859 Ga0207698_10029764
1860 Ga0207698_10044432
1861 Ga0207698_10075417
1862 Ga0207698_10229111
1863 Ga0207698_10358060
1864 Ga0207698_10768417
1865 Ga0207698_10776696
1866 Ga0207698_10785323
1867 Ga0207428_10081728
1868 Ga0268266_10000049
1869 Ga0268266_10376578
1870 Ga0268265_10007727
1871 Ga0268265_10693868
1872 Ga0268265_10922804
1873 Ga0268265_10940968
1874 Ga0268264_10000041
1875 Ga0268264_10033350
1876 Ga0268264_10064722
1877 Ga0268264_10173325
1878 Ga0268264_10480145
1879 Ga0268264_10620258
1880 Ga0268264_10983594
1881 Ga0307517_10006787
1882 Ga0307517_10121308
1883 Ga0307515_10000039
1884 Ga0265338_10145233
1885 Ga0307511_10000285
1886 Ga0307512_10245539
1887 Ga0265327_10000148
1888 Ga0265327_10020847
1889 Ga0307513_10446257
1890 Ga0307509_10065959
1891 Ga0307408_101210990
1892 Ga0307508_10002192
1893 Ga0307508_10213449
1894 Ga0307516_10000577
1895 Ga0307410_10435242
1896 Ga0307410_10520084
1897 Ga0307406_10088028
1898 Ga0307412_10225685
1899 Ga0307414_10097259
1900 Ga0307510_10000805
1901 Ga0373944_0038854
1902 Ga0373924_0007156
1903 Ga0373937_0007249
1904 Ga0373937_0087775
1905 Ga0373937_0225358
1906 Ga0373925_0858652
1907 Ga0395899_0030989
1908 Ga0395899_0043326
1909 Ga0395899_0067492
1910 Ga0395899_0478465
1911 Ga0395900_0016499
1912 Ga0395900_0027821
1913 Ga0395900_0331484
1914 Ga0395900_0415642
1915 Ga0395898_0014412
1916 Ga0395898_0087288
1917 Ga0395898_0119138
1918 Ga0395898_0275414
1919 Ga0395898_0289014
1920 Ga0395898_0493639
1921 Ga0395905_0010221
1922 Ga0395905_0013318
1923 Ga0395901_0048123
1924 Ga0395901_0118359
1925 Ga0395901_0612385
1926 Ga0436365_1064270
1927 Ga0439439_0044796
1928 Ga0451851_0662514
1929 Ga0451853_3599263
1930 Ga0439431_0002560
1931 Ga0439445_0003796
1932 Ga0450923_013607
1933 Ga0439435_0034654
1934 Ga0439444_0111500
1935 Ga0451577_0003916
1936 Ga0451577_0363434
1937 Ga0466972_0002253
1938 Ga0466972_0025621
1939 Ga0466965_0092476
1940 Ga0466961_0286065
1941 Ga0453684_0184530
1942 Ga0453684_0196748
1943 Ga0466971_0403680
1944 Ga0466968_0186228
1945 Ga0466970_0018840
1946 Ga0466957_0608524
1947 Ga0466959_0015692
1948 Ga0466959_0036954
1949 Ga0466959_0135438
1950 Ga0466959_0421704
1951 Ga0466967_0547046
1952 Ga0495627_003482
1953 Ga0495638_0145734
1954 Ga0495594_0158854
1955 Ga0495594_0180174
1956 Ga0495606_0009028
1957 Ga0495608_0156046
1958 Ga0495618_0061762
1959 Ga0495628_0204841
1960 Ga0495630_0012812
1961 Ga0495648_0001994
1962 Ga0495652_0269494
1963 Ga0495586_0025349
1964 Ga0495633_0000080
1965 Ga0495611_0000090
1966 Ga0495625_0414061
1967 Ga0495625_0466255
1968 Ga0495635_0242715
1969 Ga0495599_0063135
1970 Ga0495658_0006053
1971 Ga0495649_0153943
1972 Ga0495674_0040485
1973 Ga0495674_0044888
1974 Ga0495674_0093062
1975 Ga0495672_0041735
1976 Ga0495687_000001
1977 Ga0495684_0450118
1978 Ga0495686_0000004
1979 Ga0496107_0781283
1980 Ga0496109_0488707
1981 Ga0496110_0459762
1982 Ga0496114_1050431
1983 Ga0496115_0014866
1984 Ga0496121_0000020
1985 Ga0501303_041039
1986 Ga0501032_0005376
1987 Ga0501032_0174701
1988 Ga0501034_0004706
1989 Ga0501034_0029971
1990 Ga0501034_0063983
1991 Ga0501034_0191535
1992 Ga0501034_0608036
1993 Ga0501036_0002360
1994 Ga0501037_0003684
1995 Ga0501037_0530543
1996 Ga0501038_0097094
1997 Ga0501038_0439290
1998 Ga0501039_0021736
1999 Ga0501039_0417981
2000 Ga0501043_0014705
2001 Ga0501043_0041003
2002 Ga0501043_0054946
2003 Ga0501046_0006183
2004 Ga0501046_0071786
2005 Ga0501047_0007787
2006 Ga0501047_0017174
2007 Ga0501047_0127626
2008 Ga0501047_0447883
2009 Ga0501048_0026224
2010 Ga0501048_0210012
2011 Ga0501067_0020072
2012 Ga0501068_0263515
2013 Ga0501068_0470892
2014 Ga0501069_0017918
2015 Ga0501070_0019278
2016 Ga0501071_0035647
2017 Ga0501072_0190061
2018 Ga0501073_0098141
2019 Ga0501073_0437929
2020 Ga0501073_0615026
2021 Ga0501074_0000275
2022 Ga0501074_0092302
2023 Ga0501199_026574
2024 Ga0501209_185413
2025 Ga0501217_004702
2026 Ga0501079_0074252
2027 Ga0501080_0021404
2028 Ga0501080_1695699
2029 Ga0501083_0002224
2030 Ga0501266_004675
2031 Ga0501268_036610
2032 Ga0501270_024066
2033 Ga0501035_0020207
2034 Ga0501044_0028371
2035 Ga0501044_0033954
2036 Ga0501044_0249923
2037 Ga0501044_0561200
2038 Ga0501226_011721
2039 nmdc:mga0k408_250548_c1
2040 nmdc:mga0k408_271357_c1
2041 nmdc:mga05p37_111907_c1
2042 nmdc:mga05p37_79737_c1
2043 nmdc:mga09592_3366_c1
2044 nmdc:mga0qj67_133146_c1
2045 nmdc:mga06r32_46433_c1
2046 nmdc:mga06r32_93166_c1
2047 nmdc:mga08y16_1117189_c1
2048 nmdc:mga08y16_12116_c1
2049 nmdc:mga08y16_171833_c1
2050 nmdc:mga0n895_697766_c1
2051 nmdc:mga0n895_93002_c1
2052 Ga0500578_0313501
2053 Ga0500644_0033271
2054 Ga0500646_0005492
2055 Ga0500646_0174635
2056 Ga0500583_0002757
2057 Ga0500583_0009948
2058 Ga0500651_0061801
2059 Ga0500650_0123003
2060 Ga0500650_0123180
2061 Ga0500562_000062
2062 Ga0500569_000060
2063 Ga0500569_085446
2064 Ga0500594_0130660
2065 Ga0500642_0136518
2066 Ga0500642_0284108
2067 Ga0500652_047012
2068 Ga0500652_259203
2069 Ga0500577_0012073
2070 Ga0500588_0030623
2071 Ga0500604_0018802
2072 Ga0500616_0020886
2073 Ga0500616_0329919
2074 Ga0500622_0000337
2075 Ga0500622_0000900
2076 Ga0500637_0165470
2077 Ga0500645_010633
2078 Ga0500645_026967
2079 Ga0501084_0162330
2080 Ga0500661_001888
2081 Ga0501082_0028685
2082 Ga0501082_0155183
2083 Ga0466962_0012547
2084 2738726445
2085 2819590777
2086 2821137039
2087 2883072661
2088 2884795549
2089 2896087825
2090 2896112451
2091 2904468219
2092 2929157809
2093 2929241320
2094 2929923331

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

43

210

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.924 2 174
6jf3-assembly1.cif.gz_B actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9196 1 163
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9149 1 164
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9143 5 179
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9126 2 174
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9161 1 164 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9041 1 164 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9032 1 163 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8973 3 158 3.90.45.10
1v3yB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8965 2 180 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A7V9M0N7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9832 1 192 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A3C1CB09-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.976 1 192 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-E2NG18-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9703 1 168 GO:0042586
GO:0043686
AF-A0A1Q3N2M4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9666 1 192 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A561IL46-F1-model_v4 deleted 0.9661 1 189

Map