F488993

General Info

Members Datasets Scaffolds Average Seq Length
1048 791 2096 317

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1008514|Ga0055536_10085144
Length 346
Sequence MELPLTRHLLKAEIHCHIEGATPPALAAIQAEIYGIDTGKVLRDGAYVWSDFSEFIVCYDAVASLFKTAGDYALLTETYLLELAAANTIYSEIIVSPDHGDRIGLGADAYLAGICDGIHAAREKTGIEARIIVTGERHFGPDRVVSAAEXAARAKXPLVTGFNMAGEERMGRVADYARAFDIARDAGLGLTIHAGEVCGAFSVSDALDLVKPSRIGHGVRAIEDPALVERLAELGIVLEVCPGSNIALNVFPDFDSHPLKRLKAAGVRVCINSDDPPFFHTSLAREYDIASVIMGMPDEEIDAMTRTAIEAAFVDEATRARLIARLDAQSIQPSRSETGDEAASRA

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
53 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
67 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
68 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
69 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
70 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
71 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
103 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
119 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
127 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
128 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
129 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
133 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
134 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
137 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
228 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
232 2509276019 Ensifer aridi TW10 Isolate Nodule
233 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
234 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
235 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
236 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
237 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
238 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
239 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
240 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
241 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
242 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
243 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
244 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
245 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
246 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
247 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
248 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
249 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
250 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
251 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
252 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
253 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
254 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
255 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
256 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
257 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
258 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
259 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
260 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
261 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
262 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
263 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
264 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
265 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
266 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
267 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
268 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
269 2516143018 Ensifer sp. BR816 Isolate Nodule
270 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
271 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
272 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
273 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
274 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
275 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
276 2519899620 Rhizobium sp. Pop5 Isolate Nodule
277 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
278 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
279 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
280 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
281 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
282 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
283 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
284 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
285 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
286 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
287 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
288 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
289 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
290 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
291 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
292 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
293 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
294 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
295 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
296 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
297 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
298 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
299 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
300 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
301 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
302 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
303 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
304 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
305 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
306 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
307 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
308 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
309 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
310 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
311 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
312 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
313 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
314 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
315 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
316 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
317 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
318 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
319 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
320 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
321 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
322 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
323 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
324 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
325 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
326 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
327 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
328 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
329 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
330 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
331 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
332 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
333 2643221557 Ensifer sp. Root558 Isolate Unclassified
334 2643221558 Rhizobium sp. Root149 Isolate Unclassified
335 2643221568 Rhizobium sp. Root564 Isolate Unclassified
336 2643221582 Rhizobium sp. Root651 Isolate Unclassified
337 2643221599 Rhizobium sp. Root708 Isolate Unclassified
338 2643221607 Rhizobium sp. Root73 Isolate Unclassified
339 2643221610 Ensifer sp. Root74 Isolate Unclassified
340 2643221618 Ensifer sp. Root231 Isolate Unclassified
341 2643221626 Ensifer sp. Root31 Isolate Unclassified
342 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
343 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
344 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
345 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
346 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
347 2643221655 Ensifer sp. Root1252 Isolate Unclassified
348 2643221659 Ensifer sp. Root127 Isolate Unclassified
349 2643221668 Ensifer sp. Root423 Isolate Unclassified
350 2643221675 Ensifer sp. Root1298 Isolate Unclassified
351 2643221680 Ensifer sp. Root1312 Isolate Unclassified
352 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
353 2643221688 Rhizobium sp. Root482 Isolate Unclassified
354 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
355 2643221693 Rhizobium sp. Root491 Isolate Unclassified
356 2643221698 Ensifer sp. Root142 Isolate Unclassified
357 2643221712 Ensifer sp. Root258 Isolate Unclassified
358 2643221718 Rhizobium sp. Root268 Isolate Unclassified
359 2643221719 Rhizobium sp. Root274 Isolate Unclassified
360 2643221723 Ensifer sp. Root278 Isolate Unclassified
361 2643221726 Ensifer sp. Root954 Isolate Unclassified
362 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
363 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
364 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
365 2718217882 Rhizobium sp. N741 Isolate Nodule
366 2718217927 Rhizobium sp. N324 Isolate Nodule
367 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
368 2718218009 Rhizobium sp. N561 Isolate Nodule
369 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
370 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
371 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
372 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
373 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
374 2718218363 Rhizobium sp. N113 Isolate Nodule
375 2718218365 Rhizobium sp. N731 Isolate Nodule
376 2718218366 Rhizobium sp. N621 Isolate Nodule
377 2718218423 Rhizobium sp. N941 Isolate Nodule
378 2721755514 Rhizobium sp. N6212 Isolate Nodule
379 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
380 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
381 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
382 2721755809 Rhizobium sp. N541 Isolate Nodule
383 2721755810 Rhizobium sp. N871 Isolate Nodule
384 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
385 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
386 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
387 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
388 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
389 2728369365 Rhizobium sp. N1341 Isolate Nodule
390 2728369397 Rhizobium sp. N1314 Isolate Nodule
391 2738541293 Rhizobium sp. GV031 Isolate Unclassified
392 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
393 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
394 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
395 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
396 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
397 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
398 2791355256 Rhizobium sp. M10 Isolate Nodule
399 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
400 2791355260 Rhizobium sp. L9 Isolate Nodule
401 2791355261 Rhizobium sp. J15 Isolate Nodule
402 2791355262 Rhizobium sp. M1 Isolate Nodule
403 2791355263 Rhizobium chutanense C5 Isolate Nodule
404 2791355264 Rhizobium sp. S9 Isolate Nodule
405 2791355265 Rhizobium sp. H4 Isolate Nodule
406 2791355266 Rhizobium sp. L43 Isolate Nodule
407 2791355267 Rhizobium sp. L18 Isolate Nodule
408 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
409 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
410 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
411 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
412 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
413 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
414 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
415 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
416 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
417 2802429633 Rhizobium anhuiense J3 Isolate Nodule
418 2802429634 Rhizobium anhuiense S10 Isolate Nodule
419 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
420 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
421 2802429637 Rhizobium anhuiense C15 Isolate Nodule
422 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
423 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
424 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
425 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
426 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
427 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
428 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
429 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
430 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
431 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
432 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
433 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
434 2838048938 Rhizobium pisi 27/80 Isolate Nodule
435 2838061910 Rhizobium phaseoli L15 Isolate Nodule
436 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
437 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
438 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
439 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
440 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
441 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
442 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
443 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
444 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
445 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
446 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
447 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
448 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
449 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
450 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
451 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
452 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
453 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
454 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
455 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
456 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
457 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
458 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
459 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
460 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
461 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
462 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
463 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
464 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
465 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
466 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
467 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
468 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
469 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
470 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
471 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
472 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
473 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
474 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
475 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
476 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
477 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
478 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
479 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
480 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
481 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
482 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
483 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
484 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
485 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
486 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
487 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
488 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
489 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
490 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
491 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
492 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
493 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
494 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
495 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
496 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
497 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
498 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
499 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
500 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
501 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
502 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
503 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
504 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
505 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
506 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
507 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
508 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
509 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
510 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
511 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
512 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
513 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
514 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
515 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
516 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
517 2844163670 Ensifer sp. 1H6 Isolate Unclassified
518 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
519 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
520 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
521 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
522 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
523 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
524 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
525 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
526 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
527 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
528 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
529 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
530 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
531 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
532 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
533 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
534 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
535 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
536 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
537 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
538 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
539 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
540 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
541 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
542 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
543 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
544 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
545 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
546 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
547 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
548 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
549 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
550 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
551 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
552 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
553 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
554 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
555 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
556 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
557 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
558 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
559 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
560 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
561 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
562 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
563 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
564 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
565 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
566 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
567 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
568 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
569 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
570 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
571 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
572 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
573 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
574 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
575 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
576 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
577 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
578 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
579 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
580 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
581 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
582 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
583 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
584 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
585 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
586 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
587 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
588 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
589 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
590 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
591 2933599457 Rhizobium phaseoli M3 Isolate Nodule
592 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
593 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
594 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
595 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
596 2936381700 Rhizobium chutanense C16 Isolate Unclassified
597 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
598 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
599 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
600 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
601 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
602 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
603 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
604 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
605 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
606 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
607 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
608 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
609 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
610 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
611 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
612 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
613 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
614 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
615 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
616 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
617 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
618 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
619 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
620 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
621 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
622 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
623 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
624 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
625 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
626 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
627 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
628 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
629 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
630 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
631 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
632 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
633 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
634 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
635 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
636 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
637 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
638 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
639 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
640 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
641 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
642 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
643 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
644 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
645 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
646 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
647 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
648 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
649 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
650 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
651 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
652 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
653 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
654 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
655 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
656 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
657 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
658 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
659 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
660 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
661 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
662 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
663 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
664 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
665 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
666 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
667 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
668 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
669 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
670 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
671 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
672 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
673 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
674 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
675 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
676 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
677 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
678 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
679 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
680 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
681 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
682 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
683 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
684 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
685 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
686 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
687 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
688 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
689 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
690 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
691 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
692 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
693 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
694 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
695 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
696 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
697 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
698 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
699 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
700 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
701 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
702 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
703 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
704 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
705 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
706 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
707 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
708 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
709 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
710 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
711 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
712 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
713 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
714 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
715 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
716 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
717 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
718 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
719 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
720 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
721 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
722 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
723 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
724 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
725 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
726 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
727 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
728 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
729 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
730 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
731 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
732 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
733 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
734 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
735 2996887358 Rhizobium sp. R711 Isolate Nodule
736 2996893221 Rhizobium sp. R635 Isolate Nodule
737 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
738 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
739 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
740 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
741 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
742 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
743 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
744 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
745 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
746 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
747 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
748 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
749 8005258706 Rhizobium sp. R693 Isolate Nodule
750 8005275841 Rhizobium sp. N4311 Isolate Nodule
751 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
752 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
753 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
754 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
755 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
756 8005321885 Rhizobium sp. R72 Isolate Nodule
757 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
758 8005382845 Rhizobium sp. R634 Isolate Nodule
759 8005395548 Rhizobium sp. R339 Isolate Nodule
760 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
761 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
762 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
763 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
764 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
765 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
766 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
767 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
768 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
769 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
770 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
771 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
772 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
773 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
774 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
775 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
776 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
777 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
778 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
779 8018176218 Rhizobium sp. N122 Isolate Nodule
780 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
781 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
782 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
783 8024501048 Rhizobium sp. H4 Isolate Nodule
784 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
785 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
786 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
787 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
788 8056382006 Rhizobium croatiense 13T Isolate Nodule
789 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
790 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
791 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.09
Metatranscriptomes 0.19
Isolates 53.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 18.61
Nodule 41.03
Rhizoplane 1.43
Rhizosphere 18.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1008514 3300003781 Bacteria 4397
2 JGI25155J39150_1000110 3300002704 Bacteria 43893
3 JGI25156J39149_1000192 3300002705 Bacteria 44040
4 JGI25162J39368_1000302 3300002737 Bacteria 45304
5 JGI25162J39368_1001906 3300002737 Bacteria 9562
6 JGI25154J39366_1000196 3300002738 Bacteria 44040
7 JGI25158J39367_1001051 3300002739 Bacteria 5027
8 JGI25158J39367_1009750 3300002739 Bacteria 1310
9 JGI25157J39369_1000228 3300002741 Bacteria 44040
10 JGI25152J39213_1000869 3300002773 Bacteria 14910
11 JGI25152J39213_1002441 3300002773 Bacteria 7070
12 JGI25152J39213_1002981 3300002773 Bacteria 6012
13 JGI25150J39212_1000266 3300002774 Bacteria 27840
14 JGI25150J39212_1006913 3300002774 Bacteria 2308
15 JGI25159J45721_1000023 3300002987 Bacteria 116643
16 JGI25159J45721_1000516 3300002987 Bacteria 17666
17 JGI25159J45721_1004235 3300002987 Bacteria 4831
18 JGI25151J46595_10000355 3300003187 Bacteria 48795
19 JGI25151J46595_10000660 3300003187 Bacteria 29371
20 JGI25151J46595_10008348 3300003187 Bacteria 4989
21 JGI25151J46595_10061657 3300003187 Bacteria 1192
22 JGI25165J46597_1000390 3300003214 Bacteria 46779
23 JGI25165J46597_1001110 3300003214 Bacteria 17044
24 JGI25165J46597_1001741 3300003214 Bacteria 9593
25 JGI25165J46597_1006106 3300003214 Bacteria 2183
26 JGI25153J46596_10003933 3300003215 Bacteria 8143
27 JGI25153J46596_10007137 3300003215 Bacteria 5543
28 JGI25153J46596_10007533 3300003215 Bacteria 5333
29 rootH1_10006497 3300003316 Bacteria 1763
30 rootH2_10025655 3300003320 Bacteria 6336
31 rootL2_10018866 3300003322 Bacteria 9681
32 rootH1_10003510 3300003323 Bacteria 2612
33 rootH1_10036427 3300003323 Bacteria 1893
34 JGI25160J50197_1000044 3300003354 Bacteria 145379
35 JGI25160J50197_1000061 3300003354 Bacteria 116643
36 JGI25160J50197_1014649 3300003354 Bacteria 2612
37 JGI25161J50226_1000028 3300003374 Bacteria 145379
38 JGI25161J50226_1000078 3300003374 Bacteria 83416
39 JGI25161J50226_1000200 3300003374 Bacteria 39159
40 Ga0055539_1008016 3300003752 Bacteria 1328
41 Ga0055526_1002887 3300003771 Bacteria 11326
42 Ga0055526_1011840 3300003771 Bacteria 3873
43 Ga0055524_1000734 3300003775 Bacteria 22502
44 Ga0055524_1002242 3300003775 Bacteria 10122
45 Ga0055524_1003047 3300003775 Bacteria 8294
46 Ga0055524_1005209 3300003775 Bacteria 5847
47 Ga0055524_1022400 3300003775 Bacteria 2065
48 Ga0055536_1006750 3300003781 Bacteria 5259
49 Ga0055528_1000113 3300003790 Bacteria 65323
50 Ga0055528_1001190 3300003790 Bacteria 16795
51 Ga0055528_1005448 3300003790 Bacteria 5930
52 Ga0055528_1011317 3300003790 Bacteria 3555
53 Ga0055528_1016169 3300003790 Bacteria 2654
54 Ga0055528_1023758 3300003790 Bacteria 1858
55 Ga0055530_10008543 3300003791 Bacteria 4084
56 Ga0055540_1001653 3300003792 Bacteria 12938
57 Ga0055540_1007093 3300003792 Bacteria 4301
58 Ga0055540_1020253 3300003792 Bacteria 1765
59 Ga0055531_10007819 3300003794 Bacteria 5756
60 Ga0055531_10008418 3300003794 Bacteria 5441
61 Ga0055543_1000054 3300004625 Bacteria 104176
62 Ga0055543_1000069 3300004625 Bacteria 94040
63 Ga0055543_1000741 3300004625 Bacteria 16504
64 Ga0055543_1002126 3300004625 Bacteria 6861
65 Ga0065165_1000047 3300005262 Bacteria 197811
66 Ga0065165_1000318 3300005262 Bacteria 78352
67 Ga0065165_1007561 3300005262 Bacteria 5303
68 Ga0065165_1008846 3300005262 Bacteria 4625
69 Ga0070670_100000105 3300005331 Bacteria 77938
70 Ga0070668_100255425 3300005347 Bacteria 1456
71 Ga0070669_100028879 3300005353 Bacteria 3995
72 Ga0070667_100115026 3300005367 Bacteria 2336
73 Ga0070667_100321385 3300005367 Bacteria 1396
74 Ga0070665_100025729 3300005548 Bacteria 5928
75 Ga0070665_100033790 3300005548 Bacteria 5145
76 Ga0070665_100065060 3300005548 Bacteria 3658
77 Ga0068854_100080902 3300005578 Bacteria 2398
78 Ga0068852_100009243 3300005616 Bacteria 7301
79 Ga0075365_10007972 3300006038 Bacteria 5974
80 Ga0075365_10019454 3300006038 Bacteria 4192
81 Ga0075365_10040474 3300006038 Bacteria 3039
82 Ga0075368_10016307 3300006042 Bacteria 2769
83 Ga0075363_100010624 3300006048 Bacteria 4382
84 Ga0075364_10000011 3300006051 Bacteria 62606
85 Ga0075364_10059133 3300006051 Bacteria 2512
86 Ga0075362_10001958 3300006177 Bacteria 6764
87 Ga0075362_10027871 3300006177 Bacteria 2421
88 Ga0075367_10011561 3300006178 Bacteria 4677
89 Ga0075369_10001934 3300006186 Bacteria 7277
90 Ga0075369_10010007 3300006186 Bacteria 3703
91 Ga0075369_10029580 3300006186 Bacteria 2302
92 Ga0075369_10051280 3300006186 Bacteria 1786
93 Ga0075369_10088993 3300006186 Bacteria 1376
94 Ga0075366_10005204 3300006195 Bacteria 7040
95 Ga0075366_10018991 3300006195 Bacteria 3973
96 Ga0075370_10000842 3300006353 Bacteria 12429
97 Ga0075370_10017277 3300006353 Bacteria 3897
98 Ga0079104_1000082 3300006946 Bacteria 137722
99 Ga0099826_10017417 3300006948 Bacteria 5425
100 Ga0099826_10026045 3300006948 Bacteria 4321
101 Ga0105251_10082448 3300009011 Bacteria 1485
102 Ga0105244_10068059 3300009036 Bacteria 1780
103 Ga0105244_10104799 3300009036 Bacteria 1380
104 Ga0105240_10001468 3300009093 Bacteria 40305
105 Ga0105248_10121100 3300009177 Bacteria 2951
106 Ga0105237_10004445 3300009545 Bacteria 16237
107 Ga0123341_1000642 3300009765 Bacteria 22722
108 Ga0123342_1010090 3300009766 Bacteria 10966
109 Ga0123342_1021337 3300009766 Bacteria 4563
110 Ga0105239_10109198 3300010375 Bacteria 3065
111 Ga0105246_10159689 3300011119 Bacteria 1716
112 Ga0157373_10015517 3300013100 Bacteria 5570
113 Ga0157371_10000004 3300013102 Bacteria 512593
114 Ga0157371_10176676 3300013102 Bacteria 1527
115 Ga0157370_10001047 3300013104 Bacteria 34825
116 Ga0157370_10001796 3300013104 Bacteria 26445
117 Ga0157370_10128074 3300013104 Bacteria 2369
118 Ga0157369_10138306 3300013105 Bacteria 2578
119 Ga0157369_10298694 3300013105 Bacteria 1675
120 Ga0171463_1001 3300013249 Bacteria 1406070
121 Ga0182008_10031273 3300014497 Bacteria 2680
122 Ga0182007_10002297 3300015262 Bacteria 9621
123 Ga0182005_1025945 3300015265 Bacteria 1599
124 Ga0183363_1185 3300015690 Bacteria 13404
125 Ga0163161_10112287 3300017792 Bacteria 2039
126 Ga0214544_1005567 3300021320 Bacteria 24246
127 Ga0214542_1004334 3300021321 Bacteria 28262
128 Ga0214543_1004000 3300021327 Bacteria 28246
129 Ga0214543_1008948 3300021327 Bacteria 15988
130 Ga0228711_1000006 3300022739 Bacteria 202437
131 Ga0228710_1000004 3300022740 Bacteria 250560
132 Ga0209435_100087 3300025206 Bacteria 44093
133 Ga0209436_100022 3300025208 Bacteria 96695
134 Ga0209436_100213 3300025208 Bacteria 26862
135 Ga0209672_102344 3300025228 Bacteria 4779
136 Ga0209563_108902 3300025230 Bacteria 1554
137 Ga0209437_100050 3300025233 Bacteria 394010
138 Ga0209437_100205 3300025233 Bacteria 115669
139 Ga0207425_1000052 3300025245 Bacteria 162123
140 Ga0207425_1001736 3300025245 Bacteria 8600
141 Ga0207425_1002984 3300025245 Bacteria 5645
142 Ga0209646_1000285 3300025246 Bacteria 44093
143 Ga0209646_1011028 3300025246 Bacteria 1405
144 Ga0209026_1000347 3300025250 Bacteria 44093
145 Ga0209677_100223 3300025253 Bacteria 40538
146 Ga0209759_1000482 3300025256 Bacteria 44093
147 Ga0209129_1000066 3300025258 Bacteria 226820
148 Ga0209129_1000141 3300025258 Bacteria 119150
149 Ga0209129_1001039 3300025258 Bacteria 16421
150 Ga0209129_1001099 3300025258 Bacteria 15766
151 Ga0209129_1001848 3300025258 Bacteria 11206
152 Ga0209129_1004007 3300025258 Bacteria 6042
153 Ga0209233_1000037 3300025261 Bacteria 554620
154 Ga0209233_1000187 3300025261 Bacteria 133091
155 Ga0209233_1000232 3300025261 Bacteria 96361
156 Ga0209673_1000024 3300025273 Bacteria 409632
157 Ga0209673_1000911 3300025273 Bacteria 37766
158 Ga0209673_1002137 3300025273 Bacteria 14721
159 Ga0209673_1002144 3300025273 Bacteria 14664
160 Ga0209673_1002283 3300025273 Bacteria 13700
161 Ga0209673_1003397 3300025273 Bacteria 9438
162 Ga0209673_1008268 3300025273 Bacteria 4649
163 Ga0209130_1000002 3300025284 Bacteria 722648
164 Ga0209130_1000005 3300025284 Bacteria 599620
165 Ga0209130_1000093 3300025284 Bacteria 145707
166 Ga0209676_1003289 3300025292 Bacteria 10132
167 Ga0209676_1008080 3300025292 Bacteria 4778
168 Ga0209025_1000144 3300025294 Bacteria 181446
169 Ga0209025_1000274 3300025294 Bacteria 119322
170 Ga0209025_1000275 3300025294 Bacteria 119220
171 Ga0209025_1000377 3300025294 Bacteria 92728
172 Ga0209025_1000553 3300025294 Bacteria 69760
173 Ga0209025_1000832 3300025294 Bacteria 49004
174 Ga0209025_1004510 3300025294 Bacteria 12026
175 Ga0209025_1006199 3300025294 Bacteria 9388
176 Ga0209025_1011140 3300025294 Bacteria 5983
177 Ga0209564_1000262 3300025295 Bacteria 112256
178 Ga0209564_1000486 3300025295 Bacteria 66011
179 Ga0209564_1000590 3300025295 Bacteria 57280
180 Ga0209564_1009772 3300025295 Bacteria 4510
181 Ga0209564_1010276 3300025295 Bacteria 4333
182 Ga0209564_1031040 3300025295 Bacteria 1642
183 Ga0209758_1000229 3300025297 Bacteria 119657
184 Ga0209758_1000383 3300025297 Bacteria 76487
185 Ga0209758_1000466 3300025297 Bacteria 66920
186 Ga0209758_1000971 3300025297 Bacteria 38600
187 Ga0209758_1001494 3300025297 Bacteria 27240
188 Ga0209758_1003684 3300025297 Bacteria 13618
189 Ga0209758_1034241 3300025297 Bacteria 2024
190 Ga0209758_1037017 3300025297 Bacteria 1893
191 Ga0209050_1005028 3300025298 Bacteria 8579
192 Ga0209256_1000715 3300025299 Bacteria 44055
193 Ga0209256_1000741 3300025299 Bacteria 42804
194 Ga0209256_1000868 3300025299 Bacteria 37527
195 Ga0209256_1003327 3300025299 Bacteria 11402
196 Ga0209256_1006818 3300025299 Bacteria 5889
197 Ga0209256_1007044 3300025299 Bacteria 5695
198 Ga0209256_1007143 3300025299 Bacteria 5625
199 Ga0209256_1016181 3300025299 Bacteria 2560
200 Ga0207426_1000012 3300025302 Bacteria 730942
201 Ga0207426_1000013 3300025302 Bacteria 721897
202 Ga0207426_1000015 3300025302 Bacteria 599316
203 Ga0207426_1000142 3300025302 Bacteria 194023
204 Ga0207426_1002277 3300025302 Bacteria 12665
205 Ga0209051_1000170 3300025303 Bacteria 119026
206 Ga0209051_1000768 3300025303 Bacteria 34059
207 Ga0209051_1002082 3300025303 Bacteria 15092
208 Ga0209051_1007516 3300025303 Bacteria 5940
209 Ga0209051_1017231 3300025303 Bacteria 3234
210 Ga0209051_1031443 3300025303 Bacteria 2042
211 Ga0209257_1001590 3300025304 Bacteria 26075
212 Ga0209257_1006763 3300025304 Bacteria 7225
213 Ga0209257_1007148 3300025304 Bacteria 6862
214 Ga0209257_1009658 3300025304 Bacteria 5100
215 Ga0207695_10000427 3300025913 Bacteria 93089
216 Ga0207671_10002841 3300025914 Bacteria 18002
217 Ga0207681_10185119 3300025923 Bacteria 1589
218 Ga0207650_10000302 3300025925 Bacteria 48702
219 Ga0207668_10051998 3300025972 Bacteria 2833
220 Ga0207640_10056804 3300025981 Bacteria 2572
221 Ga0207658_10083919 3300025986 Bacteria 2450
222 Ga0207678_10125098 3300026067 Bacteria 2193
223 Ga0209281_1000043 3300027111 Bacteria 341543
224 Ga0209281_1000102 3300027111 Bacteria 221665
225 Ga0209281_1000563 3300027111 Bacteria 44757
226 Ga0209371_1000009 3300027312 Bacteria 963030
227 Ga0209371_1000569 3300027312 Bacteria 33436
228 Ga0209371_1000597 3300027312 Bacteria 32346
229 Ga0209371_1002100 3300027312 Bacteria 11818
230 Ga0209282_1000013 3300027666 Bacteria 215053
231 Ga0209282_1019359 3300027666 Bacteria 4321
232 Ga0209282_1028987 3300027666 Bacteria 3423
233 Ga0209813_10003197 3300027866 Bacteria 3818
234 Ga0268266_10023891 3300028379 Bacteria 5202
235 Ga0268266_10031975 3300028379 Bacteria 4471
236 Ga0268266_10080689 3300028379 Bacteria 2835
237 Ga0307515_10000029 3300028794 Bacteria 365410
238 Ga0307515_10011406 3300028794 Bacteria 16865
239 Ga0307515_10066981 3300028794 Bacteria 4962
240 Ga0307515_10176303 3300028794 Bacteria 2107
241 Ga0268256_1000010 3300030500 Bacteria 963034
242 Ga0268256_1003765 3300030500 Bacteria 6646
243 Ga0268256_1004108 3300030500 Bacteria 6211
244 Ga0316181_1026626 3300030744 Bacteria 2110
245 Ga0307513_10000259 3300031456 Bacteria 76155
246 Ga0307513_10028778 3300031456 Bacteria 6346
247 Ga0307405_10001661 3300031731 Bacteria 9477
248 Ga0307410_10149355 3300031852 Bacteria 1738
249 Ga0307406_10007052 3300031901 Bacteria 6223
250 Ga0307412_10007214 3300031911 Bacteria 6306
251 Ga0315914_1000004 3300031967 Bacteria 288534
252 Ga0307409_100052793 3300031995 Bacteria 3119
253 Ga0307411_10051253 3300032005 Bacteria 2692
254 Ga0315913_1000055 3300033430 Bacteria 58182
255 Ga0315915_1000003 3300033464 Bacteria 407996
256 Ga0439436_0004700 3300041404 Bacteria 4190
257 Ga0439466_0022251 3300041411 Bacteria 2239
258 Ga0439465_0007622 3300041413 Bacteria 3434
259 Ga0451833_0456755 3300041491 Bacteria 1498
260 Ga0451835_1253214 3300041492 Bacteria 1740
261 Ga0451837_1046261 3300041494 Bacteria 1329
262 Ga0451841_0687643 3300041498 Bacteria 1807
263 Ga0451846_52794 3300041502 Bacteria 1783
264 Ga0451847_0188426 3300041503 Bacteria 2750
265 Ga0451855_0185000 3300041511 Bacteria 1183
266 Ga0451853_3392256 3300041512 Bacteria 2490
267 Ga0439449_0005847 3300042007 Bacteria 4704
268 Ga0439449_0048031 3300042007 Bacteria 1580
269 Ga0450920_003073 3300042122 Bacteria 2879
270 Ga0450900_007577 3300042136 Bacteria 1340
271 Ga0450906_005256 3300042145 Bacteria 2675
272 Ga0450907_016977 3300042146 Bacteria 1214
273 Ga0450910_003476 3300042147 Bacteria 2092
274 Ga0450918_001915 3300042531 Bacteria 4015
275 Ga0466970_0167965 3300044765 Bacteria 1215
276 Ga0466958_0198311 3300045836 Bacteria 1277
277 Ga0495592_0031923 3300046454 Bacteria 3978
278 Ga0495590_0035188 3300046457 Bacteria 1749
279 Ga0495629_0018425 3300046459 Bacteria 4998
280 Ga0495638_0000566 3300046460 Bacteria 41838
281 Ga0495650_0042907 3300046471 Bacteria 1923
282 Ga0495605_0002376 3300046474 Bacteria 11684
283 Ga0495664_0182327 3300046477 Bacteria 1273
284 Ga0495585_0012817 3300046492 Bacteria 4931
285 Ga0495585_0022306 3300046492 Bacteria 3634
286 Ga0495596_0048569 3300046500 Bacteria 1664
287 Ga0495607_0078801 3300046501 Bacteria 1817
288 Ga0495607_0124258 3300046501 Bacteria 1351
289 Ga0495583_0003929 3300046506 Bacteria 10998
290 Ga0495606_0005067 3300046507 Bacteria 12819
291 Ga0495606_0019688 3300046507 Bacteria 5008
292 Ga0495606_0026688 3300046507 Bacteria 4112
293 Ga0495606_0029657 3300046507 Bacteria 3836
294 Ga0495606_0118313 3300046507 Bacteria 1589
295 Ga0495610_0002136 3300046512 Bacteria 16832
296 Ga0495610_0050802 3300046512 Bacteria 2022
297 Ga0495610_0098729 3300046512 Bacteria 1311
298 Ga0495616_0067571 3300046513 Bacteria 1737
299 Ga0495616_0083124 3300046513 Bacteria 1528
300 Ga0495620_0060368 3300046515 Bacteria 1581
301 Ga0495631_0003763 3300046518 Bacteria 8252
302 Ga0495631_0019236 3300046518 Bacteria 3204
303 Ga0495632_0003799 3300046519 Bacteria 10538
304 Ga0495632_0034060 3300046519 Bacteria 2609
305 Ga0495632_0073112 3300046519 Bacteria 1644
306 Ga0495632_0114669 3300046519 Bacteria 1263
307 Ga0495643_0020419 3300046522 Bacteria 3817
308 Ga0495654_0000314 3300046530 Bacteria 42570
309 Ga0495654_0088198 3300046530 Bacteria 1443
310 Ga0495587_0173957 3300046536 Bacteria 1222
311 Ga0495597_0021051 3300046542 Bacteria 3033
312 Ga0495633_0010640 3300046558 Bacteria 5013
313 Ga0495633_0034902 3300046558 Bacteria 2417
314 Ga0495633_0105620 3300046558 Bacteria 1306
315 Ga0495656_0031901 3300046615 Bacteria 2140
316 Ga0495625_0021354 3300046660 Bacteria 4987
317 Ga0495625_0042441 3300046660 Bacteria 3305
318 Ga0495661_0058054 3300046665 Bacteria 2308
319 Ga0495588_0004481 3300046674 Bacteria 6172
320 Ga0495657_0017857 3300046675 Bacteria 5145
321 Ga0495671_0022472 3300046692 Bacteria 3305
322 Ga0495649_0088662 3300046694 Bacteria 1650
323 Ga0495660_0025205 3300046810 Bacteria 3379
324 Ga0495636_0016035 3300047318 Bacteria 2990
325 Ga0495672_0104297 3300047320 Bacteria 1532
326 Ga0495683_0057414 3300047323 Bacteria 1935
327 Ga0495683_0103844 3300047323 Bacteria 1364
328 Ga0495687_010351 3300047443 Bacteria 5121
329 Ga0495687_017057 3300047443 Bacteria 3636
330 Ga0495673_0046454 3300047469 Bacteria 1924
331 Ga0495681_0024243 3300047470 Bacteria 3201
332 Ga0495681_0081024 3300047470 Bacteria 1449
333 Ga0495686_0002334 3300047472 Bacteria 18121
334 Ga0495686_0005569 3300047472 Bacteria 9905
335 Ga0495686_0033205 3300047472 Bacteria 3334
336 Ga0495686_0036817 3300047472 Bacteria 3139
337 Ga0496102_0021992 3300048905 Bacteria 5648
338 Ga0496102_0044273 3300048905 Bacteria 4039
339 Ga0496104_0342776 3300048907 Bacteria 1407
340 Ga0496105_0378608 3300048908 Bacteria 1126
341 Ga0496106_0006761 3300048909 Bacteria 8490
342 Ga0496106_0196431 3300048909 Bacteria 1605
343 Ga0496110_0238870 3300048913 Bacteria 1653
344 Ga0496116_0000240 3300048919 Bacteria 100232
345 Ga0496116_0008310 3300048919 Bacteria 9020
346 Ga0496116_0017595 3300048919 Bacteria 5539
347 Ga0496116_0019568 3300048919 Bacteria 5180
348 Ga0496116_0042611 3300048919 Bacteria 3100
349 Ga0496116_0049587 3300048919 Bacteria 2805
350 Ga0496116_0054889 3300048919 Bacteria 2621
351 Ga0496116_0168251 3300048919 Bacteria 1191
352 Ga0496116_0191452 3300048919 Bacteria 1082
353 Ga0496117_0000002 3300048920 Bacteria 2483758
354 Ga0496117_0002038 3300048920 Bacteria 26746
355 Ga0496117_0005456 3300048920 Bacteria 13341
356 Ga0496117_0007245 3300048920 Bacteria 10910
357 Ga0496117_0008192 3300048920 Bacteria 9972
358 Ga0496117_0018045 3300048920 Bacteria 5868
359 Ga0496117_0065998 3300048920 Bacteria 2457
360 Ga0496118_0001167 3300048921 Bacteria 40506
361 Ga0496118_0008715 3300048921 Bacteria 10421
362 Ga0496118_0011007 3300048921 Bacteria 8884
363 Ga0496118_0015080 3300048921 Bacteria 7181
364 Ga0496118_0015751 3300048921 Bacteria 6978
365 Ga0496118_0023117 3300048921 Bacteria 5411
366 Ga0496118_0121722 3300048921 Bacteria 1699
367 Ga0496118_0131941 3300048921 Bacteria 1602
368 Ga0496119_0019600 3300048922 Bacteria 4970
369 Ga0496119_0031344 3300048922 Bacteria 3568
370 Ga0496119_0119781 3300048922 Bacteria 1449
371 Ga0496120_0002729 3300048923 Bacteria 17241
372 Ga0496120_0007537 3300048923 Bacteria 8077
373 Ga0496120_0021625 3300048923 Bacteria 4062
374 Ga0496120_0146899 3300048923 Bacteria 1190
375 Ga0496121_0000001 3300048924 Bacteria 1830318
376 Ga0496121_0000426 3300048924 Bacteria 82870
377 Ga0496121_0009474 3300048924 Bacteria 11185
378 Ga0496121_0009970 3300048924 Bacteria 10805
379 Ga0496121_0014274 3300048924 Bacteria 8446
380 Ga0496121_0025871 3300048924 Bacteria 5553
381 Ga0496121_0030224 3300048924 Bacteria 4979
382 Ga0496121_0040587 3300048924 Bacteria 4080
383 Ga0496121_0055947 3300048924 Bacteria 3281
384 Ga0496122_0000001 3300048925 Bacteria 1827766
385 Ga0496122_0000018 3300048925 Bacteria 426350
386 Ga0496122_0000321 3300048925 Bacteria 105353
387 Ga0496122_0016064 3300048925 Bacteria 7114
388 Ga0496122_0022181 3300048925 Bacteria 5654
389 Ga0496122_0023001 3300048925 Bacteria 5515
390 Ga0496122_0023695 3300048925 Bacteria 5397
391 Ga0496122_0023765 3300048925 Bacteria 5387
392 Ga0496122_0031718 3300048925 Bacteria 4388
393 Ga0496122_0064461 3300048925 Bacteria 2665
394 Ga0496122_0100646 3300048925 Bacteria 1933
395 Ga0496122_0101454 3300048925 Bacteria 1922
396 Ga0496122_0156214 3300048925 Bacteria 1399
397 Ga0496123_0000001 3300048926 Bacteria 1831497
398 Ga0496123_0000015 3300048926 Bacteria 426088
399 Ga0496123_0000454 3300048926 Bacteria 72735
400 Ga0496123_0004823 3300048926 Bacteria 13917
401 Ga0496123_0019563 3300048926 Bacteria 5333
402 Ga0496123_0025495 3300048926 Bacteria 4456
403 Ga0496123_0061554 3300048926 Bacteria 2410
404 Ga0496123_0065637 3300048926 Bacteria 2305
405 Ga0496123_0066989 3300048926 Bacteria 2270
406 Ga0496123_0069013 3300048926 Bacteria 2222
407 Ga0496123_0101625 3300048926 Bacteria 1671
408 Ga0496123_0136015 3300048926 Bacteria 1352
409 Ga0496124_0000178 3300048927 Bacteria 126118
410 Ga0496124_0006480 3300048927 Bacteria 12741
411 Ga0496124_0013026 3300048927 Bacteria 8149
412 Ga0496124_0023459 3300048927 Bacteria 5631
413 Ga0496124_0033192 3300048927 Bacteria 4543
414 Ga0496124_0058458 3300048927 Bacteria 3242
415 Ga0496124_0140246 3300048927 Bacteria 1909
416 Ga0496124_0163807 3300048927 Bacteria 1730
417 Ga0496124_0191355 3300048927 Bacteria 1565
418 Ga0496124_0197820 3300048927 Bacteria 1531
419 Ga0496125_0000001 3300048928 Bacteria 1766138
420 Ga0496125_0000628 3300048928 Bacteria 59302
421 Ga0496125_0002093 3300048928 Bacteria 26849
422 Ga0496125_0006658 3300048928 Bacteria 12436
423 Ga0496125_0045441 3300048928 Bacteria 3695
424 Ga0496125_0161085 3300048928 Bacteria 1524
425 Ga0496126_0000322 3300048929 Bacteria 102330
426 Ga0496126_0005535 3300048929 Bacteria 14379
427 Ga0496126_0247322 3300048929 Bacteria 1487
428 Ga0495678_019861 3300049459 Bacteria 2987
429 Ga0495678_022832 3300049459 Bacteria 2730
430 Ga0495678_045372 3300049459 Bacteria 1734
431 Ga0495682_0028987 3300049460 Bacteria 2050
432 Ga0501032_0108682 3300049569 Bacteria 1836
433 Ga0501033_0000260 3300049570 Bacteria 50590
434 Ga0501033_0057659 3300049570 Bacteria 2869
435 Ga0501034_0260892 3300049571 Bacteria 1675
436 Ga0501038_0023801 3300049574 Bacteria 5471
437 Ga0501038_0090395 3300049574 Bacteria 2566
438 Ga0501043_0194452 3300049579 Bacteria 1576
439 Ga0501047_0321063 3300049581 Bacteria 1388
440 Ga0501068_0115454 3300049584 Bacteria 1672
441 Ga0501083_0214200 3300049744 Bacteria 1255
442 Ga0501035_0001226 3300049822 Bacteria 26728
443 Ga0501035_0119927 3300049822 Bacteria 2300
444 Ga0501035_0220168 3300049822 Bacteria 1621
445 nmdc:mga03683_5872_c1 3300050489 Bacteria 4174
446 nmdc:mga03n38_7536_c1 3300050490 Bacteria 3856
447 nmdc:mga00v17_611_c1 3300050491 Bacteria 19769
448 nmdc:mga00v17_71_c1 3300050491 Bacteria 60964
449 nmdc:mga0yw44_149_c1 3300050492 Bacteria 21613
450 nmdc:mga0yw44_183167_c1 3300050492 Bacteria 1379
451 nmdc:mga0yw44_23616_c1 3300050492 Bacteria 3467
452 nmdc:mga0yw44_9713_c1 3300050492 Bacteria 4884
453 nmdc:mga0k408_2459_c1 3300050493 Bacteria 9850
454 nmdc:mga06z11_149024_c1 3300050494 Bacteria 1329
455 nmdc:mga07m45_14826_c1 3300050496 Bacteria 4161
456 nmdc:mga0sz30_16287_c1 3300050516 Bacteria 2950
457 nmdc:mga0sz30_2373_c1 3300050516 Bacteria 6718
458 Ga0495601_0142825 3300053077 Bacteria 1562
459 Ga0500610_0090341 3300053079 Bacteria 1591
460 Ga0495655_0025442 3300053083 Bacteria 1385
461 Ga0500578_0265265 3300053086 Bacteria 1029
462 Ga0500560_000446 3300053107 Bacteria 5689
463 Ga0500572_004466 3300053111 Bacteria 3170
464 Ga0500618_000203 3300053125 Bacteria 47421
465 Ga0500618_001422 3300053125 Bacteria 10688
466 Ga0500618_004472 3300053125 Bacteria 4452
467 Ga0500618_004683 3300053125 Bacteria 4303
468 Ga0500658_0000327 3300053134 Bacteria 21066
469 Ga0500561_0000139 3300053137 Bacteria 14052
470 Ga0500568_0001169 3300053139 Bacteria 17543
471 Ga0500568_0038762 3300053139 Bacteria 1927
472 Ga0500573_0000783 3300053140 Bacteria 14283
473 Ga0500573_0006724 3300053140 Bacteria 6239
474 Ga0500590_002075 3300053148 Bacteria 8678
475 Ga0500604_0041821 3300053151 Bacteria 1387
476 Ga0500616_0000437 3300053153 Bacteria 55094
477 Ga0500616_0002500 3300053153 Bacteria 15220
478 Ga0500616_0036949 3300053153 Bacteria 2646
479 Ga0500622_0002842 3300053156 Bacteria 12134
480 Ga0500624_001239 3300053157 Bacteria 4528
481 Ga0500634_0003970 3300053161 Bacteria 6726
482 Ga0500634_0124182 3300053161 Bacteria 1250
483 Ga0500636_0000036 3300053177 Bacteria 71714
484 Ga0500636_0001307 3300053177 Bacteria 13519
485 Ga0587080_013170 3300059503 Bacteria 1262
486 2509112199 2508501122 Bacteria 6292184
487 2509379518 2509276019 Bacteria 6802256
488 2509388989 2509276021 Bacteria 7634384
489 2509444579 2509276033 Bacteria 7180565
490 2510135674 2510065019 Bacteria 6903379
491 2510307122 2510065057 Bacteria 6649661
492 2510838866 2510461069 Bacteria 5505000
493 2510897147 2510461076 Bacteria 8618824
494 2511136852 2510917022 Bacteria 6504556
495 2511171038 2510917026 Bacteria 7046020
496 2511185318 2510917028 Bacteria 6185411
497 2511200517 2510917030 Bacteria 7460662
498 2511498731 2511231052 Bacteria 6974333
499 2512534868 2512047086 Bacteria 6850303
500 2512973304 2512875026 Bacteria 6861065
501 2513570835 2513237084 Bacteria 7231967
502 2513574950 2513237085 Bacteria 7695351
503 2513587877 2513237086 Bacteria 7265287
504 2513595621 2513237088 Bacteria 6927906
505 2513603659 2513237089 Bacteria 6553624
506 2513619427 2513237091 Bacteria 6900273
507 2513633734 2513237093 Bacteria 7545552
508 2513707581 2513237103 Bacteria 7647401
509 2513865354 2513237138 Bacteria 7368160
510 2513886025 2513237140 Bacteria 7076289
511 2513904363 2513237143 Bacteria 6664116
512 2513911003 2513237144 Bacteria 7530820
513 2513924311 2513237146 Bacteria 7166346
514 2513983367 2513237156 Bacteria 6402557
515 2513996276 2513237159 Bacteria 6810126
516 2514005899 2513237160 Bacteria 6650282
517 2514024110 2513237162 Bacteria 7468464
518 2515114838 2515075009 Bacteria 7288508
519 2515607171 2515154107 Bacteria 6795637
520 2515635805 2515154113 Bacteria 7807172
521 2515641419 2515154114 Bacteria 7848616
522 2515659308 2515154116 Bacteria 7552979
523 2515741177 2515154134 Bacteria 7220242
524 2516204944 2516143018 Bacteria 6951533
525 2516895010 2516653046 Bacteria 6989037
526 2517038456 2516653077 Bacteria 7555578
527 2517078732 2516653085 Bacteria 7346596
528 2517097474 2517093000 Bacteria 7412387
529 2517408930 2517287029 Bacteria 6905599
530 2517571693 2517487022 Bacteria 7227575
531 2520379176 2519899620 Bacteria 6499161
532 2524452578 2524023207 Bacteria 6813453
533 2524461866 2524023209 Bacteria 6679728
534 2530648339 2529292951 Bacteria 6916614
535 2535514569 2534681796 Bacteria 7146037
536 2537877278 2537561587 Bacteria 5425293
537 2551676003 2551306084 Bacteria 8942552
538 2551682886 2551306084 Bacteria 8942552
539 2551689907 2551306085 Bacteria 7347181
540 2551696294 2551306086 Bacteria 6843938
541 2551703486 2551306087 Bacteria 7351905
542 2551709233 2551306089 Bacteria 7162724
543 2551721936 2551306090 Bacteria 7953713
544 2551729191 2551306091 Bacteria 7086830
545 2551734930 2551306092 Bacteria 6992595
546 2551745168 2551306093 Bacteria 7064773
547 2554246174 2554235003 Bacteria 5877155
548 2558865916 2558860100 Bacteria 8458965
549 2558867631 2558860100 Bacteria 8458965
550 2559293397 2558860242 Bacteria 5568029
551 2585164447 2582581283 Bacteria 6030556
552 2585201289 2582581294 Bacteria 6626667
553 2585223264 2582581298 Bacteria 7315509
554 2585230954 2582581299 Bacteria 6518058
555 2585256429 2582581304 Bacteria 5831370
556 2585264745 2582581306 Bacteria 6450535
557 2585273463 2582581307 Bacteria 6597605
558 2585283175 2582581308 Bacteria 7413247
559 2585328196 2582581315 Bacteria 7318924
560 2585330607 2582581316 Bacteria 7774528
561 2585386186 2582581865 Bacteria 6644329
562 2585394798 2582581866 Bacteria 6859583
563 2585399108 2582581867 Bacteria 7184437
564 2585523953 2585427526 Bacteria 7258840
565 2585536023 2585427527 Bacteria 7273426
566 2585542097 2585427528 Bacteria 6842387
567 2585546140 2585427529 Bacteria 7395659
568 2585556649 2585427530 Bacteria 7383882
569 2585564009 2585427531 Bacteria 6992870
570 2585818742 2585427590 Bacteria 6824633
571 2585840693 2585427593 Bacteria 7141551
572 2585843689 2585427594 Bacteria 6180594
573 2585900323 2585427608 Bacteria 6544331
574 2585909283 2585427609 Bacteria 6667127
575 2585998436 2585427633 Bacteria 6413184
576 2586002999 2585427634 Bacteria 6455027
577 2587984615 2585428125 Bacteria 6662905
578 2599332431 2599185156 Bacteria 5403036
579 2599419731 2599185170 Bacteria 7295545
580 2599604281 2599185210 Bacteria 5624189
581 2599718721 2599185236 Bacteria 6875203
582 2600196677 2599185352 Bacteria 7228948
583 2600376736 2600254933 Bacteria 4750527
584 2601609583 2600255279 Bacteria 5605316
585 2601746358 2600255308 Bacteria 5611129
586 2616293956 2615840624 Bacteria 6557588
587 2616311182 2615840626 Bacteria 7921970
588 2616556084 2615840698 Bacteria 7319877
589 2617380717 2617270742 Bacteria 6808054
590 2643805651 2643221557 Bacteria 7184309
591 2643812524 2643221558 Bacteria 5460675
592 2643857414 2643221568 Bacteria 5187270
593 2643920554 2643221582 Bacteria 5804683
594 2644004412 2643221599 Bacteria 6292121
595 2644051596 2643221607 Bacteria 6314006
596 2644065826 2643221610 Bacteria 7480339
597 2644103924 2643221618 Bacteria 7717186
598 2644144805 2643221626 Bacteria 8069654
599 2644191210 2643221634 Bacteria 6705461
600 2644200094 2643221636 Bacteria 6583769
601 2644207246 2643221637 Bacteria 5345260
602 2644237670 2643221643 Bacteria 5749658
603 2644298216 2643221653 Bacteria 4569637
604 2644306854 2643221655 Bacteria 7722067
605 2644331045 2643221659 Bacteria 7890716
606 2644380131 2643221668 Bacteria 7306521
607 2644417157 2643221675 Bacteria 7473456
608 2644450553 2643221680 Bacteria 7473610
609 2644480465 2643221686 Bacteria 6310811
610 2644495441 2643221688 Bacteria 5260751
611 2644498805 2643221689 Bacteria 6042950
612 2644519637 2643221693 Bacteria 5513853
613 2644541264 2643221698 Bacteria 7756764
614 2644612465 2643221712 Bacteria 7729434
615 2644650894 2643221718 Bacteria 5345506
616 2644656468 2643221719 Bacteria 4568197
617 2644671338 2643221723 Bacteria 7095460
618 2644693022 2643221726 Bacteria 7455827
619 2657682707 2657244999 Bacteria 5946535
620 2671115831 2667528174 Bacteria 6435400
621 2692319692 2690316117 Bacteria 6800650
622 2719183337 2718217882 Bacteria 6556348
623 2719388097 2718217927 Bacteria 6972593
624 2719667720 2718217997 Bacteria 6740740
625 2719734054 2718218009 Bacteria 6478651
626 2720494140 2718218199 Bacteria 6740745
627 2720615603 2718218232 Bacteria 6720332
628 2720622386 2718218233 Bacteria 6662049
629 2720633740 2718218235 Bacteria 6630699
630 2720777440 2718218269 Bacteria 6906114
631 2721149449 2718218363 Bacteria 6524337
632 2721160852 2718218365 Bacteria 6274507
633 2721166286 2718218366 Bacteria 6425255
634 2721401730 2718218423 Bacteria 6438183
635 2722842456 2721755514 Bacteria 6424414
636 2723029037 2721755556 Bacteria 6745503
637 2723562654 2721755684 Bacteria 6859907
638 2723569347 2721755685 Bacteria 6704835
639 2724040544 2721755809 Bacteria 6438790
640 2724046810 2721755810 Bacteria 6479005
641 2724092047 2721755819 Bacteria 6906405
642 2724106612 2721755822 Bacteria 6726041
643 2724112420 2721755823 Bacteria 6752556
644 2725949662 2724679232 Bacteria 7646494
645 2730109973 2728369352 Bacteria 6745171
646 2730166572 2728369365 Bacteria 6555560
647 2730300484 2728369397 Bacteria 6274511
648 2738800764 2738541293 Bacteria 7065685
649 2738946685 2738541317 Bacteria 5340176
650 2739037346 2738541333 Bacteria 7106503
651 2766067156 2765235942 Bacteria 7445910
652 2776915975 2775507049 Bacteria 6284736
653 2778179512 2775507266 Bacteria 7392367
654 2792643404 2791355094 Bacteria 7011481
655 2793298465 2791355256 Bacteria 6798008
656 2793315695 2791355259 Bacteria 7254731
657 2793323478 2791355260 Bacteria 6598818
658 2793327576 2791355261 Bacteria 6661293
659 2793335647 2791355262 Bacteria 6774204
660 2793341041 2791355263 Bacteria 6872478
661 2793350282 2791355264 Bacteria 6429314
662 2793354777 2791355265 Bacteria 6539969
663 2793358526 2791355266 Bacteria 7116587
664 2793368978 2791355267 Bacteria 7222458
665 2802721233 2802428858 Bacteria 6636079
666 2802724546 2802428859 Bacteria 6667919
667 2802729787 2802428860 Bacteria 6525526
668 2802737133 2802428861 Bacteria 6534206
669 2802746854 2802428862 Bacteria 6633353
670 2802751750 2802428863 Bacteria 6410669
671 2804753929 2802429268 Bacteria 6094027
672 2805928902 2802429605 Bacteria 6875453
673 2805934523 2802429606 Bacteria 6346811
674 2806047073 2802429633 Bacteria 7341974
675 2806054928 2802429634 Bacteria 7083200
676 2806061844 2802429635 Bacteria 7650140
677 2806069633 2802429636 Bacteria 7597525
678 2806075996 2802429637 Bacteria 7067217
679 2808986834 2808606387 Bacteria 5697198
680 2819244203 2818991272 Bacteria 4622173
681 2819556906 2818991439 Bacteria 6907412
682 2819608874 2818991448 Bacteria 6772224
683 2819643300 2818991453 Bacteria 7181617
684 2819685827 2818991461 Bacteria 7026071
685 2821123236 2821123053 Bacteria 7836056
686 2838020947 2838016132 Bacteria 6577831
687 2838026850 2838022645 Bacteria 6494267
688 2838033960 2838029111 Bacteria 6603031
689 2838039736 2838035591 Bacteria 7166484
690 2838044851 2838042994 Bacteria 6046894
691 2838052904 2838048938 Bacteria 6044578
692 2838064697 2838061910 Bacteria 6794874
693 2838070526 2838068647 Bacteria 6208656
694 2838074762 2838074704 Bacteria 6785777
695 2838664014 2838661181 Bacteria 7385261
696 2838672526 2838668709 Bacteria 6671819
697 2838677642 2838675328 Bacteria 4909118
698 2838685589 2838680041 Bacteria 6545511
699 2838689835 2838686498 Bacteria 7807632
700 2838695955 2838694306 Bacteria 6853137
701 2838705151 2838701080 Bacteria 6669771
702 2838713354 2838707686 Bacteria 6619912
703 2838716531 2838714209 Bacteria 5525906
704 2838719669 2838719591 Bacteria 5523910
705 2838727282 2838724970 Bacteria 4908691
706 2838731469 2838729681 Bacteria 7400765
707 2838739741 2838736955 Bacteria 5760694
708 2838744410 2838742623 Bacteria 7396178
709 2841844135 2841840854 Bacteria 5761912
710 2841846600 2841846520 Bacteria 5345850
711 2841852950 2841851746 Bacteria 7532261
712 2841860871 2841859092 Bacteria 5436171
713 2841869118 2841864319 Bacteria 6742987
714 2842082588 2842077413 Bacteria 6508645
715 2842112743 2842110456 Bacteria 7656360
716 2842123853 2842118031 Bacteria 7033875
717 2842127371 2842124991 Bacteria 5346824
718 2842132535 2842130223 Bacteria 4909145
719 2842143856 2842140634 Bacteria 5759631
720 2842150145 2842146304 Bacteria 5957337
721 2842152296 2842152218 Bacteria 4908957
722 2842160277 2842156927 Bacteria 6894975
723 2842165745 2842163707 Bacteria 6916235
724 2842172777 2842170452 Bacteria 5525737
725 2842175915 2842175837 Bacteria 4908771
726 2842184057 2842180545 Bacteria 6888678
727 2842189639 2842187318 Bacteria 5524014
728 2842196359 2842192696 Bacteria 6147454
729 2842202433 2842198810 Bacteria 6608673
730 2842208915 2842205361 Bacteria 6340321
731 2842213953 2842211629 Bacteria 5523832
732 2842219421 2842217011 Bacteria 7497767
733 2842224429 2842224351 Bacteria 5524473
734 2842231639 2842229732 Bacteria 7475766
735 2842242908 2842237096 Bacteria 6620661
736 2842245892 2842243621 Bacteria 7421798
737 2842254831 2842250916 Bacteria 6579627
738 2842260270 2842257432 Bacteria 7401195
739 2842267158 2842264693 Bacteria 6472963
740 2842273681 2842271015 Bacteria 7807131
741 2842282395 2842278818 Bacteria 6340002
742 2842290065 2842285085 Bacteria 6011953
743 2842296981 2842291075 Bacteria 7076806
744 2842299932 2842298080 Bacteria 6123127
745 2842308467 2842304105 Bacteria 7023636
746 2842312229 2842311132 Bacteria 6616990
747 2842321823 2842317721 Bacteria 6793725
748 2842344651 2842341865 Bacteria 7003929
749 2842359546 2842357229 Bacteria 6485165
750 2842367774 2842363717 Bacteria 6844742
751 2842376025 2842370503 Bacteria 7038661
752 2842383235 2842377471 Bacteria 7140707
753 2842390368 2842384541 Bacteria 7057858
754 2842397836 2842395702 Bacteria 6780583
755 2842407675 2842402390 Bacteria 6681310
756 2842414306 2842409023 Bacteria 6687331
757 2842420834 2842415677 Bacteria 6596907
758 2842424140 2842422224 Bacteria 6239196
759 2842431146 2842428310 Bacteria 6767288
760 2842437481 2842434925 Bacteria 6502746
761 2842444296 2842441272 Bacteria 6769273
762 2842451277 2842447887 Bacteria 6754142
763 2842465289 2842462802 Bacteria 6588055
764 2842472242 2842469257 Bacteria 6752936
765 2842480706 2842475841 Bacteria 6603183
766 2842487250 2842482326 Bacteria 7212537
767 2842494113 2842489311 Bacteria 6620893
768 2842501242 2842495871 Bacteria 6820686
769 2842507251 2842502639 Bacteria 6604161
770 2842514525 2842509118 Bacteria 6850950
771 2842517656 2842515876 Bacteria 5436280
772 2842521234 2842521101 Bacteria 6569494
773 2842922699 2842922631 Bacteria 5824079
774 2844164874 2844163670 Bacteria 7266046
775 2844456583 2844454524 Bacteria 7952546
776 2847421083 2847417321 Bacteria 6913799
777 2848995921 2848992105 Bacteria 6810864
778 2850079300 2850079185 Bacteria 6848280
779 2852387869 2852387548 Bacteria 8025568
780 2854900853 2854896431 Bacteria 5869725
781 2854918881 2854916844 Bacteria 5725939
782 2855827643 2855825444 Bacteria 6785811
783 2855843019 2855839649 Bacteria 7135830
784 2855877638 2855872281 Bacteria 6964271
785 2857520879 2857516855 Bacteria 7787325
786 2857533812 2857531043 Bacteria 6754041
787 2858801974 2858800743 Bacteria 6603254
788 2891051044 2891048133 Bacteria 4447501
789 2891374800 2891373044 Bacteria 5202277
790 2896386098 2896384573 Bacteria 7700774
791 2899794304 2899792073 Bacteria 4926588
792 2899805881 2899803654 Bacteria 5577784
793 2899845684 2899845264 Bacteria 5672268
794 2913298505 2913295892 Bacteria 6333755
795 2913311957 2913308742 Bacteria 5350706
796 2915983230 2915980308 Bacteria 6624279
797 2915991711 2915986958 Bacteria 6739310
798 2915994211 2915993759 Bacteria 7016183
799 2916002908 2916000859 Bacteria 6865702
800 2916009102 2916007675 Bacteria 6898660
801 2916015145 2916014648 Bacteria 6946486
802 2916022385 2916021584 Bacteria 6854472
803 2916032236 2916028427 Bacteria 6748433
804 2916038133 2916035215 Bacteria 6755766
805 2916042341 2916041962 Bacteria 6820487
806 2916050066 2916048683 Bacteria 6543552
807 2916059030 2916055098 Bacteria 6758838
808 2916063541 2916061851 Bacteria 6737736
809 2916071247 2916068649 Bacteria 6943657
810 2916078523 2916076590 Bacteria 6596108
811 2919101857 2919100787 Bacteria 7710546
812 2919116748 2919114240 Bacteria 5700270
813 2919166607 2919166419 Bacteria 4952238
814 2919172473 2919171160 Bacteria 6499771
815 2919408333 2919408235 Bacteria 6149349
816 2920764047 2920760137 Bacteria 7427611
817 2920822701 2920822456 Bacteria 6897201
818 2921209274 2921208531 Bacteria 6745326
819 2921237626 2921237296 Bacteria 6876710
820 2921245065 2921244191 Bacteria 6568419
821 2921256226 2921250672 Bacteria 6677771
822 2921258729 2921257292 Bacteria 6808382
823 2921268208 2921263974 Bacteria 6864552
824 2921285245 2921282425 Bacteria 6826397
825 2921290023 2921289301 Bacteria 7316391
826 2923556173 2923556063 Bacteria 6793593
827 2924147827 2924144063 Bacteria 6883928
828 2924151890 2924150972 Bacteria 7169444
829 2924164766 2924158325 Bacteria 7188855
830 2924166425 2924165586 Bacteria 7260590
831 2924179685 2924172951 Bacteria 6749356
832 2924180419 2924179722 Bacteria 6843264
833 2924186783 2924186466 Bacteria 6876637
834 2924196269 2924193448 Bacteria 6955718
835 2924204015 2924200457 Bacteria 6757188
836 2924210681 2924207177 Bacteria 6917007
837 2924217219 2924214083 Bacteria 7080103
838 2924222713 2924221636 Bacteria 7113495
839 2924232411 2924228884 Bacteria 6633132
840 2926754758 2926754445 Bacteria 5964435
841 2926761926 2926760298 Bacteria 5505990
842 2929138885 2929138655 Bacteria 5810547
843 2933006943 2933006813 Bacteria 4912075
844 2933015467 2933011516 Bacteria 5439334
845 2933574916 2933570622 Bacteria 7023390
846 2933588368 2933586486 Bacteria 7667493
847 2933594146 2933594066 Bacteria 5594265
848 2933601331 2933599457 Bacteria 5858799
849 2935899973 2935894831 Bacteria 6620579
850 2935902330 2935901341 Bacteria 7341747
851 2936369536 2936367885 Bacteria 7324495
852 2936380277 2936375103 Bacteria 6652732
853 2936385266 2936381700 Bacteria 7006523
854 2936998842 2936996657 Bacteria 6298727
855 2937009362 2937002841 Bacteria 6934057
856 2937015992 2937009748 Bacteria 6746052
857 2937019971 2937016420 Bacteria 6782579
858 2937025567 2937023124 Bacteria 6815156
859 2937032491 2937029754 Bacteria 6424026
860 2937039154 2937036028 Bacteria 6846469
861 2937050414 2937049772 Bacteria 6757901
862 2937060718 2937056579 Bacteria 7107896
863 2937065725 2937063883 Bacteria 7199456
864 2937071752 2937071275 Bacteria 6984483
865 2937084025 2937078374 Bacteria 6610289
866 2937087362 2937084907 Bacteria 6618516
867 2937092292 2937091812 Bacteria 6979387
868 2937106336 2937098957 Bacteria 7249374
869 2937106840 2937106411 Bacteria 6947143
870 2937115962 2937113482 Bacteria 6505872
871 2937125430 2937119839 Bacteria 6597547
872 2937129183 2937126314 Bacteria 6771275
873 2941504159 2941499720 Bacteria 7599444
874 2957378119 2957375807 Bacteria 6425588
875 2957388105 2957382221 Bacteria 6737050
876 2957394282 2957388812 Bacteria 6778072
877 2957401613 2957395598 Bacteria 6822399
878 2957404980 2957402308 Bacteria 6741770
879 2957411919 2957408893 Bacteria 6558585
880 2957417159 2957415311 Bacteria 6991633
881 2957423067 2957422303 Bacteria 7172205
882 2957432985 2957430029 Bacteria 7022557
883 2957439262 2957437181 Bacteria 6568994
884 2957446596 2957443900 Bacteria 6869977
885 2957451425 2957450854 Bacteria 6765715
886 2957458239 2957457609 Bacteria 6967680
887 2957467705 2957464669 Bacteria 6568877
888 2957477923 2957471148 Bacteria 6797643
889 2957484107 2957478035 Bacteria 6756658
890 2957486998 2957484790 Bacteria 6703082
891 2957493868 2957491536 Bacteria 6695180
892 2957505446 2957498199 Bacteria 7126688
893 2957506149 2957505466 Bacteria 7253085
894 2960584692 2960584000 Bacteria 6864594
895 2960593066 2960591022 Bacteria 6622873
896 2960601197 2960597568 Bacteria 6550735
897 2960610819 2960603979 Bacteria 6898737
898 2960612254 2960610863 Bacteria 6691244
899 2960620277 2960617483 Bacteria 6727748
900 2960625994 2960624210 Bacteria 6875384
901 2960635475 2960631154 Bacteria 6732508
902 2960638599 2960637947 Bacteria 7296468
903 2960645929 2960645483 Bacteria 7211087
904 2960658723 2960652885 Bacteria 7083688
905 2960663107 2960660292 Bacteria 7041660
906 2960673463 2960667422 Bacteria 6763020
907 2960680595 2960674078 Bacteria 6609048
908 2960683837 2960680706 Bacteria 6624464
909 2960689251 2960687367 Bacteria 6535474
910 2960697070 2960693952 Bacteria 6749742
911 2964612232 2964607997 Bacteria 7101408
912 2964616393 2964615318 Bacteria 6809089
913 2964623721 2964621998 Bacteria 6834995
914 2964632067 2964628898 Bacteria 7083044
915 2964640448 2964636051 Bacteria 7091832
916 2964649499 2964643177 Bacteria 6820887
917 2964655902 2964649959 Bacteria 6675118
918 2964657885 2964656573 Bacteria 7100150
919 2964667448 2964663802 Bacteria 7019362
920 2964674232 2964670856 Bacteria 6851364
921 2964678831 2964678106 Bacteria 6792020
922 2964687839 2964685014 Bacteria 6839111
923 2964692229 2964691889 Bacteria 6802758
924 2964702338 2964698721 Bacteria 6765331
925 2964708164 2964705432 Bacteria 7114648
926 2964717444 2964712639 Bacteria 6695970
927 2964720006 2964719344 Bacteria 7286602
928 2967666234 2967664464 Bacteria 6948836
929 2967672096 2967671571 Bacteria 7021409
930 2967679148 2967678726 Bacteria 7264382
931 2967688351 2967686174 Bacteria 6678622
932 2967695738 2967693043 Bacteria 6804451
933 2967701539 2967699805 Bacteria 6854538
934 2967711282 2967706974 Bacteria 7186053
935 2967720659 2967714385 Bacteria 7000047
936 2967728531 2967721400 Bacteria 7073753
937 2967733916 2967728569 Bacteria 6641507
938 2967741589 2967735183 Bacteria 6827012
939 2967748888 2967742019 Bacteria 6794534
940 2967755074 2967748971 Bacteria 6733771
941 2967756419 2967755722 Bacteria 6814706
942 2967765349 2967762386 Bacteria 6923502
943 2967773049 2967769361 Bacteria 6587838
944 2967777385 2967775926 Bacteria 6738189
945 2970020108 2970019648 Bacteria 7072033
946 2970028842 2970026789 Bacteria 6785236
947 2970036216 2970033650 Bacteria 7118744
948 2970047517 2970040964 Bacteria 6731123
949 2970054268 2970047711 Bacteria 7088379
950 2970061481 2970054988 Bacteria 6611507
951 2970062233 2970061556 Bacteria 7099761
952 2970074344 2970068827 Bacteria 7123112
953 2970080261 2970076120 Bacteria 6697332
954 2970087624 2970082768 Bacteria 6183754
955 2970097873 2970095765 Bacteria 6936963
956 2970104360 2970102677 Bacteria 6812532
957 2970111777 2970109326 Bacteria 6863976
958 2970121965 2970116247 Bacteria 6501857
959 2970122879 2970122695 Bacteria 6625855
960 2970132286 2970129317 Bacteria 6806560
961 2970137761 2970136068 Bacteria 7207982
962 2970145404 2970143518 Bacteria 6446480
963 2970156637 2970149975 Bacteria 6779706
964 2970157745 2970156795 Bacteria 7168044
965 2970170263 2970164137 Bacteria 6861252
966 2970174573 2970170962 Bacteria 6876229
967 2970184357 2970177841 Bacteria 6768001
968 2970185253 2970184632 Bacteria 7054431
969 2970198816 2970191845 Bacteria 7032787
970 2977522241 2977516862 Bacteria 6940108
971 2977525666 2977523885 Bacteria 6960446
972 2977530799 2977530762 Bacteria 6951399
973 2977540709 2977537788 Bacteria 6929320
974 2977546826 2977544691 Bacteria 6875412
975 2977558239 2977551784 Bacteria 7125765
976 2977560986 2977558990 Bacteria 6863948
977 2977568771 2977565890 Bacteria 6901543
978 2977579281 2977572785 Bacteria 6763888
979 2977582577 2977579622 Bacteria 6772100
980 2978972996 2978969890 Bacteria 5400756
981 2979092807 2979089926 Bacteria 5670289
982 2979099804 2979095461 Bacteria 5669583
983 2979104779 2979100975 Bacteria 5423623
984 2984513421 2984509177 Bacteria 5274802
985 2984520211 2984518228 Bacteria 5277463
986 2984539507 2984537506 Bacteria 5277481
987 2984591244 2984587000 Bacteria 5263363
988 2984601734 2984601300 Bacteria 5455244
989 2989351974 2989349275 Bacteria 6349068
990 2989776826 2989776772 Bacteria 4843317
991 2995395307 2995392953 Bacteria 4539380
992 2996887960 2996887358 Bacteria 5795980
993 2996897604 2996893221 Bacteria 5823108
994 3003931337 3003930520 Bacteria 5667563
995 3005410640 3005409236 Bacteria 7188837
996 3005423292 3005416602 Bacteria 7064308
997 3005450101 3005445848 Bacteria 6906074
998 3005456327 3005452660 Bacteria 5889319
999 639646073 639633055 Bacteria 7751309
1000 648741790 648276728 Bacteria 6968865
1001 650738633 650716007 Bacteria 5573770
1002 8003572179 8003570095 Bacteria 5747666
1003 8003995598 8003992118 Bacteria 7266902
1004 8004003365 8003999396 Bacteria 7063185
1005 8005247891 8005246636 Bacteria 4933972
1006 8005261474 8005258706 Bacteria 6184835
1007 8005278299 8005275841 Bacteria 6929066
1008 8005282667 8005282627 Bacteria 6675747
1009 8005291643 8005289223 Bacteria 6634003
1010 8005305484 8005301065 Bacteria 6614431
1011 8005310260 8005307578 Bacteria 7395396
1012 8005315619 8005314921 Bacteria 7072929
1013 8005322487 8005321885 Bacteria 5795980
1014 8005378093 8005376324 Bacteria 6590079
1015 8005384103 8005382845 Bacteria 6732062
1016 8005399619 8005395548 Bacteria 6806915
1017 8005433788 8005430974 Bacteria 6689030
1018 8005465534 8005460587 Bacteria 7157962
1019 8005484472 8005484373 Bacteria 6297373
1020 8005498117 8005497431 Bacteria 6477605
1021 8005543226 8005542996 Bacteria 7077758
1022 8005559984 8005556819 Bacteria 6908598
1023 8005564521 8005563573 Bacteria 7153261
1024 8005571208 8005570704 Bacteria 6957481
1025 8005619326 8005619151 Bacteria 7030230
1026 8005627891 8005626139 Bacteria 6534237
1027 8005647392 8005645114 Bacteria 6950293
1028 8005661521 8005658619 Bacteria 4500593
1029 8005669525 8005668836 Bacteria 6953162
1030 8005687452 8005682033 Bacteria 6726518
1031 8005692763 8005688590 Bacteria 6610080
1032 8005701452 8005695170 Bacteria 6912330
1033 8018132542 8018127388 Bacteria 7351159
1034 8018153932 8018150411 Bacteria 5549903
1035 8018167598 8018163183 Bacteria 7277977
1036 8018176611 8018176218 Bacteria 6896178
1037 8023681263 8023680758 Bacteria 7729763
1038 8024481906 8024479707 Bacteria 6954785
1039 8024488586 8024486573 Bacteria 6540512
1040 8024506342 8024501048 Bacteria 6427847
1041 8046768676 8046767195 Bacteria 7547379
1042 8054461008 8054460903 Bacteria 4872905
1043 8054558907 8054558443 Bacteria 5204801
1044 8056381181 8056375014 Bacteria 7006639
1045 8056382674 8056382006 Bacteria 6408074
1046 8056878657 8056875544 Bacteria 4355797
1047 8057582451 8057575449 Bacteria 7367519
1048 8057878692 8057874678 Bacteria 7494653
1049 Ga0055536_1008514
1050 JGI25155J39150_1000110
1051 JGI25156J39149_1000192
1052 JGI25162J39368_1000302
1053 JGI25162J39368_1001906
1054 JGI25154J39366_1000196
1055 JGI25158J39367_1001051
1056 JGI25158J39367_1009750
1057 JGI25157J39369_1000228
1058 JGI25152J39213_1000869
1059 JGI25152J39213_1002441
1060 JGI25152J39213_1002981
1061 JGI25150J39212_1000266
1062 JGI25150J39212_1006913
1063 JGI25159J45721_1000023
1064 JGI25159J45721_1000516
1065 JGI25159J45721_1004235
1066 JGI25151J46595_10000355
1067 JGI25151J46595_10000660
1068 JGI25151J46595_10008348
1069 JGI25151J46595_10061657
1070 JGI25165J46597_1000390
1071 JGI25165J46597_1001110
1072 JGI25165J46597_1001741
1073 JGI25165J46597_1006106
1074 JGI25153J46596_10003933
1075 JGI25153J46596_10007137
1076 JGI25153J46596_10007533
1077 rootH1_10006497
1078 rootH2_10025655
1079 rootL2_10018866
1080 rootH1_10003510
1081 rootH1_10036427
1082 JGI25160J50197_1000044
1083 JGI25160J50197_1000061
1084 JGI25160J50197_1014649
1085 JGI25161J50226_1000028
1086 JGI25161J50226_1000078
1087 JGI25161J50226_1000200
1088 Ga0055539_1008016
1089 Ga0055526_1002887
1090 Ga0055526_1011840
1091 Ga0055524_1000734
1092 Ga0055524_1002242
1093 Ga0055524_1003047
1094 Ga0055524_1005209
1095 Ga0055524_1022400
1096 Ga0055536_1006750
1097 Ga0055528_1000113
1098 Ga0055528_1001190
1099 Ga0055528_1005448
1100 Ga0055528_1011317
1101 Ga0055528_1016169
1102 Ga0055528_1023758
1103 Ga0055530_10008543
1104 Ga0055540_1001653
1105 Ga0055540_1007093
1106 Ga0055540_1020253
1107 Ga0055531_10007819
1108 Ga0055531_10008418
1109 Ga0055543_1000054
1110 Ga0055543_1000069
1111 Ga0055543_1000741
1112 Ga0055543_1002126
1113 Ga0065165_1000047
1114 Ga0065165_1000318
1115 Ga0065165_1007561
1116 Ga0065165_1008846
1117 Ga0070670_100000105
1118 Ga0070668_100255425
1119 Ga0070669_100028879
1120 Ga0070667_100115026
1121 Ga0070667_100321385
1122 Ga0070665_100025729
1123 Ga0070665_100033790
1124 Ga0070665_100065060
1125 Ga0068854_100080902
1126 Ga0068852_100009243
1127 Ga0075365_10007972
1128 Ga0075365_10019454
1129 Ga0075365_10040474
1130 Ga0075368_10016307
1131 Ga0075363_100010624
1132 Ga0075364_10000011
1133 Ga0075364_10059133
1134 Ga0075362_10001958
1135 Ga0075362_10027871
1136 Ga0075367_10011561
1137 Ga0075369_10001934
1138 Ga0075369_10010007
1139 Ga0075369_10029580
1140 Ga0075369_10051280
1141 Ga0075369_10088993
1142 Ga0075366_10005204
1143 Ga0075366_10018991
1144 Ga0075370_10000842
1145 Ga0075370_10017277
1146 Ga0079104_1000082
1147 Ga0099826_10017417
1148 Ga0099826_10026045
1149 Ga0105251_10082448
1150 Ga0105244_10068059
1151 Ga0105244_10104799
1152 Ga0105240_10001468
1153 Ga0105248_10121100
1154 Ga0105237_10004445
1155 Ga0123341_1000642
1156 Ga0123342_1010090
1157 Ga0123342_1021337
1158 Ga0105239_10109198
1159 Ga0105246_10159689
1160 Ga0157373_10015517
1161 Ga0157371_10000004
1162 Ga0157371_10176676
1163 Ga0157370_10001047
1164 Ga0157370_10001796
1165 Ga0157370_10128074
1166 Ga0157369_10138306
1167 Ga0157369_10298694
1168 Ga0171463_1001
1169 Ga0182008_10031273
1170 Ga0182007_10002297
1171 Ga0182005_1025945
1172 Ga0183363_1185
1173 Ga0163161_10112287
1174 Ga0214544_1005567
1175 Ga0214542_1004334
1176 Ga0214543_1004000
1177 Ga0214543_1008948
1178 Ga0228711_1000006
1179 Ga0228710_1000004
1180 Ga0209435_100087
1181 Ga0209436_100022
1182 Ga0209436_100213
1183 Ga0209672_102344
1184 Ga0209563_108902
1185 Ga0209437_100050
1186 Ga0209437_100205
1187 Ga0207425_1000052
1188 Ga0207425_1001736
1189 Ga0207425_1002984
1190 Ga0209646_1000285
1191 Ga0209646_1011028
1192 Ga0209026_1000347
1193 Ga0209677_100223
1194 Ga0209759_1000482
1195 Ga0209129_1000066
1196 Ga0209129_1000141
1197 Ga0209129_1001039
1198 Ga0209129_1001099
1199 Ga0209129_1001848
1200 Ga0209129_1004007
1201 Ga0209233_1000037
1202 Ga0209233_1000187
1203 Ga0209233_1000232
1204 Ga0209673_1000024
1205 Ga0209673_1000911
1206 Ga0209673_1002137
1207 Ga0209673_1002144
1208 Ga0209673_1002283
1209 Ga0209673_1003397
1210 Ga0209673_1008268
1211 Ga0209130_1000002
1212 Ga0209130_1000005
1213 Ga0209130_1000093
1214 Ga0209676_1003289
1215 Ga0209676_1008080
1216 Ga0209025_1000144
1217 Ga0209025_1000274
1218 Ga0209025_1000275
1219 Ga0209025_1000377
1220 Ga0209025_1000553
1221 Ga0209025_1000832
1222 Ga0209025_1004510
1223 Ga0209025_1006199
1224 Ga0209025_1011140
1225 Ga0209564_1000262
1226 Ga0209564_1000486
1227 Ga0209564_1000590
1228 Ga0209564_1009772
1229 Ga0209564_1010276
1230 Ga0209564_1031040
1231 Ga0209758_1000229
1232 Ga0209758_1000383
1233 Ga0209758_1000466
1234 Ga0209758_1000971
1235 Ga0209758_1001494
1236 Ga0209758_1003684
1237 Ga0209758_1034241
1238 Ga0209758_1037017
1239 Ga0209050_1005028
1240 Ga0209256_1000715
1241 Ga0209256_1000741
1242 Ga0209256_1000868
1243 Ga0209256_1003327
1244 Ga0209256_1006818
1245 Ga0209256_1007044
1246 Ga0209256_1007143
1247 Ga0209256_1016181
1248 Ga0207426_1000012
1249 Ga0207426_1000013
1250 Ga0207426_1000015
1251 Ga0207426_1000142
1252 Ga0207426_1002277
1253 Ga0209051_1000170
1254 Ga0209051_1000768
1255 Ga0209051_1002082
1256 Ga0209051_1007516
1257 Ga0209051_1017231
1258 Ga0209051_1031443
1259 Ga0209257_1001590
1260 Ga0209257_1006763
1261 Ga0209257_1007148
1262 Ga0209257_1009658
1263 Ga0207695_10000427
1264 Ga0207671_10002841
1265 Ga0207681_10185119
1266 Ga0207650_10000302
1267 Ga0207668_10051998
1268 Ga0207640_10056804
1269 Ga0207658_10083919
1270 Ga0207678_10125098
1271 Ga0209281_1000043
1272 Ga0209281_1000102
1273 Ga0209281_1000563
1274 Ga0209371_1000009
1275 Ga0209371_1000569
1276 Ga0209371_1000597
1277 Ga0209371_1002100
1278 Ga0209282_1000013
1279 Ga0209282_1019359
1280 Ga0209282_1028987
1281 Ga0209813_10003197
1282 Ga0268266_10023891
1283 Ga0268266_10031975
1284 Ga0268266_10080689
1285 Ga0307515_10000029
1286 Ga0307515_10011406
1287 Ga0307515_10066981
1288 Ga0307515_10176303
1289 Ga0268256_1000010
1290 Ga0268256_1003765
1291 Ga0268256_1004108
1292 Ga0316181_1026626
1293 Ga0307513_10000259
1294 Ga0307513_10028778
1295 Ga0307405_10001661
1296 Ga0307410_10149355
1297 Ga0307406_10007052
1298 Ga0307412_10007214
1299 Ga0315914_1000004
1300 Ga0307409_100052793
1301 Ga0307411_10051253
1302 Ga0315913_1000055
1303 Ga0315915_1000003
1304 Ga0439436_0004700
1305 Ga0439466_0022251
1306 Ga0439465_0007622
1307 Ga0451833_0456755
1308 Ga0451835_1253214
1309 Ga0451837_1046261
1310 Ga0451841_0687643
1311 Ga0451846_52794
1312 Ga0451847_0188426
1313 Ga0451855_0185000
1314 Ga0451853_3392256
1315 Ga0439449_0005847
1316 Ga0439449_0048031
1317 Ga0450920_003073
1318 Ga0450900_007577
1319 Ga0450906_005256
1320 Ga0450907_016977
1321 Ga0450910_003476
1322 Ga0450918_001915
1323 Ga0466970_0167965
1324 Ga0466958_0198311
1325 Ga0495592_0031923
1326 Ga0495590_0035188
1327 Ga0495629_0018425
1328 Ga0495638_0000566
1329 Ga0495650_0042907
1330 Ga0495605_0002376
1331 Ga0495664_0182327
1332 Ga0495585_0012817
1333 Ga0495585_0022306
1334 Ga0495596_0048569
1335 Ga0495607_0078801
1336 Ga0495607_0124258
1337 Ga0495583_0003929
1338 Ga0495606_0005067
1339 Ga0495606_0019688
1340 Ga0495606_0026688
1341 Ga0495606_0029657
1342 Ga0495606_0118313
1343 Ga0495610_0002136
1344 Ga0495610_0050802
1345 Ga0495610_0098729
1346 Ga0495616_0067571
1347 Ga0495616_0083124
1348 Ga0495620_0060368
1349 Ga0495631_0003763
1350 Ga0495631_0019236
1351 Ga0495632_0003799
1352 Ga0495632_0034060
1353 Ga0495632_0073112
1354 Ga0495632_0114669
1355 Ga0495643_0020419
1356 Ga0495654_0000314
1357 Ga0495654_0088198
1358 Ga0495587_0173957
1359 Ga0495597_0021051
1360 Ga0495633_0010640
1361 Ga0495633_0034902
1362 Ga0495633_0105620
1363 Ga0495656_0031901
1364 Ga0495625_0021354
1365 Ga0495625_0042441
1366 Ga0495661_0058054
1367 Ga0495588_0004481
1368 Ga0495657_0017857
1369 Ga0495671_0022472
1370 Ga0495649_0088662
1371 Ga0495660_0025205
1372 Ga0495636_0016035
1373 Ga0495672_0104297
1374 Ga0495683_0057414
1375 Ga0495683_0103844
1376 Ga0495687_010351
1377 Ga0495687_017057
1378 Ga0495673_0046454
1379 Ga0495681_0024243
1380 Ga0495681_0081024
1381 Ga0495686_0002334
1382 Ga0495686_0005569
1383 Ga0495686_0033205
1384 Ga0495686_0036817
1385 Ga0496102_0021992
1386 Ga0496102_0044273
1387 Ga0496104_0342776
1388 Ga0496105_0378608
1389 Ga0496106_0006761
1390 Ga0496106_0196431
1391 Ga0496110_0238870
1392 Ga0496116_0000240
1393 Ga0496116_0008310
1394 Ga0496116_0017595
1395 Ga0496116_0019568
1396 Ga0496116_0042611
1397 Ga0496116_0049587
1398 Ga0496116_0054889
1399 Ga0496116_0168251
1400 Ga0496116_0191452
1401 Ga0496117_0000002
1402 Ga0496117_0002038
1403 Ga0496117_0005456
1404 Ga0496117_0007245
1405 Ga0496117_0008192
1406 Ga0496117_0018045
1407 Ga0496117_0065998
1408 Ga0496118_0001167
1409 Ga0496118_0008715
1410 Ga0496118_0011007
1411 Ga0496118_0015080
1412 Ga0496118_0015751
1413 Ga0496118_0023117
1414 Ga0496118_0121722
1415 Ga0496118_0131941
1416 Ga0496119_0019600
1417 Ga0496119_0031344
1418 Ga0496119_0119781
1419 Ga0496120_0002729
1420 Ga0496120_0007537
1421 Ga0496120_0021625
1422 Ga0496120_0146899
1423 Ga0496121_0000001
1424 Ga0496121_0000426
1425 Ga0496121_0009474
1426 Ga0496121_0009970
1427 Ga0496121_0014274
1428 Ga0496121_0025871
1429 Ga0496121_0030224
1430 Ga0496121_0040587
1431 Ga0496121_0055947
1432 Ga0496122_0000001
1433 Ga0496122_0000018
1434 Ga0496122_0000321
1435 Ga0496122_0016064
1436 Ga0496122_0022181
1437 Ga0496122_0023001
1438 Ga0496122_0023695
1439 Ga0496122_0023765
1440 Ga0496122_0031718
1441 Ga0496122_0064461
1442 Ga0496122_0100646
1443 Ga0496122_0101454
1444 Ga0496122_0156214
1445 Ga0496123_0000001
1446 Ga0496123_0000015
1447 Ga0496123_0000454
1448 Ga0496123_0004823
1449 Ga0496123_0019563
1450 Ga0496123_0025495
1451 Ga0496123_0061554
1452 Ga0496123_0065637
1453 Ga0496123_0066989
1454 Ga0496123_0069013
1455 Ga0496123_0101625
1456 Ga0496123_0136015
1457 Ga0496124_0000178
1458 Ga0496124_0006480
1459 Ga0496124_0013026
1460 Ga0496124_0023459
1461 Ga0496124_0033192
1462 Ga0496124_0058458
1463 Ga0496124_0140246
1464 Ga0496124_0163807
1465 Ga0496124_0191355
1466 Ga0496124_0197820
1467 Ga0496125_0000001
1468 Ga0496125_0000628
1469 Ga0496125_0002093
1470 Ga0496125_0006658
1471 Ga0496125_0045441
1472 Ga0496125_0161085
1473 Ga0496126_0000322
1474 Ga0496126_0005535
1475 Ga0496126_0247322
1476 Ga0495678_019861
1477 Ga0495678_022832
1478 Ga0495678_045372
1479 Ga0495682_0028987
1480 Ga0501032_0108682
1481 Ga0501033_0000260
1482 Ga0501033_0057659
1483 Ga0501034_0260892
1484 Ga0501038_0023801
1485 Ga0501038_0090395
1486 Ga0501043_0194452
1487 Ga0501047_0321063
1488 Ga0501068_0115454
1489 Ga0501083_0214200
1490 Ga0501035_0001226
1491 Ga0501035_0119927
1492 Ga0501035_0220168
1493 nmdc:mga03683_5872_c1
1494 nmdc:mga03n38_7536_c1
1495 nmdc:mga00v17_611_c1
1496 nmdc:mga00v17_71_c1
1497 nmdc:mga0yw44_149_c1
1498 nmdc:mga0yw44_183167_c1
1499 nmdc:mga0yw44_23616_c1
1500 nmdc:mga0yw44_9713_c1
1501 nmdc:mga0k408_2459_c1
1502 nmdc:mga06z11_149024_c1
1503 nmdc:mga07m45_14826_c1
1504 nmdc:mga0sz30_16287_c1
1505 nmdc:mga0sz30_2373_c1
1506 Ga0495601_0142825
1507 Ga0500610_0090341
1508 Ga0495655_0025442
1509 Ga0500578_0265265
1510 Ga0500560_000446
1511 Ga0500572_004466
1512 Ga0500618_000203
1513 Ga0500618_001422
1514 Ga0500618_004472
1515 Ga0500618_004683
1516 Ga0500658_0000327
1517 Ga0500561_0000139
1518 Ga0500568_0001169
1519 Ga0500568_0038762
1520 Ga0500573_0000783
1521 Ga0500573_0006724
1522 Ga0500590_002075
1523 Ga0500604_0041821
1524 Ga0500616_0000437
1525 Ga0500616_0002500
1526 Ga0500616_0036949
1527 Ga0500622_0002842
1528 Ga0500624_001239
1529 Ga0500634_0003970
1530 Ga0500634_0124182
1531 Ga0500636_0000036
1532 Ga0500636_0001307
1533 Ga0587080_013170
1534 2509112199
1535 2509379518
1536 2509388989
1537 2509444579
1538 2510135674
1539 2510307122
1540 2510838866
1541 2510897147
1542 2511136852
1543 2511171038
1544 2511185318
1545 2511200517
1546 2511498731
1547 2512534868
1548 2512973304
1549 2513570835
1550 2513574950
1551 2513587877
1552 2513595621
1553 2513603659
1554 2513619427
1555 2513633734
1556 2513707581
1557 2513865354
1558 2513886025
1559 2513904363
1560 2513911003
1561 2513924311
1562 2513983367
1563 2513996276
1564 2514005899
1565 2514024110
1566 2515114838
1567 2515607171
1568 2515635805
1569 2515641419
1570 2515659308
1571 2515741177
1572 2516204944
1573 2516895010
1574 2517038456
1575 2517078732
1576 2517097474
1577 2517408930
1578 2517571693
1579 2520379176
1580 2524452578
1581 2524461866
1582 2530648339
1583 2535514569
1584 2537877278
1585 2551676003
1586 2551682886
1587 2551689907
1588 2551696294
1589 2551703486
1590 2551709233
1591 2551721936
1592 2551729191
1593 2551734930
1594 2551745168
1595 2554246174
1596 2558865916
1597 2558867631
1598 2559293397
1599 2585164447
1600 2585201289
1601 2585223264
1602 2585230954
1603 2585256429
1604 2585264745
1605 2585273463
1606 2585283175
1607 2585328196
1608 2585330607
1609 2585386186
1610 2585394798
1611 2585399108
1612 2585523953
1613 2585536023
1614 2585542097
1615 2585546140
1616 2585556649
1617 2585564009
1618 2585818742
1619 2585840693
1620 2585843689
1621 2585900323
1622 2585909283
1623 2585998436
1624 2586002999
1625 2587984615
1626 2599332431
1627 2599419731
1628 2599604281
1629 2599718721
1630 2600196677
1631 2600376736
1632 2601609583
1633 2601746358
1634 2616293956
1635 2616311182
1636 2616556084
1637 2617380717
1638 2643805651
1639 2643812524
1640 2643857414
1641 2643920554
1642 2644004412
1643 2644051596
1644 2644065826
1645 2644103924
1646 2644144805
1647 2644191210
1648 2644200094
1649 2644207246
1650 2644237670
1651 2644298216
1652 2644306854
1653 2644331045
1654 2644380131
1655 2644417157
1656 2644450553
1657 2644480465
1658 2644495441
1659 2644498805
1660 2644519637
1661 2644541264
1662 2644612465
1663 2644650894
1664 2644656468
1665 2644671338
1666 2644693022
1667 2657682707
1668 2671115831
1669 2692319692
1670 2719183337
1671 2719388097
1672 2719667720
1673 2719734054
1674 2720494140
1675 2720615603
1676 2720622386
1677 2720633740
1678 2720777440
1679 2721149449
1680 2721160852
1681 2721166286
1682 2721401730
1683 2722842456
1684 2723029037
1685 2723562654
1686 2723569347
1687 2724040544
1688 2724046810
1689 2724092047
1690 2724106612
1691 2724112420
1692 2725949662
1693 2730109973
1694 2730166572
1695 2730300484
1696 2738800764
1697 2738946685
1698 2739037346
1699 2766067156
1700 2776915975
1701 2778179512
1702 2792643404
1703 2793298465
1704 2793315695
1705 2793323478
1706 2793327576
1707 2793335647
1708 2793341041
1709 2793350282
1710 2793354777
1711 2793358526
1712 2793368978
1713 2802721233
1714 2802724546
1715 2802729787
1716 2802737133
1717 2802746854
1718 2802751750
1719 2804753929
1720 2805928902
1721 2805934523
1722 2806047073
1723 2806054928
1724 2806061844
1725 2806069633
1726 2806075996
1727 2808986834
1728 2819244203
1729 2819556906
1730 2819608874
1731 2819643300
1732 2819685827
1733 2821123236
1734 2838020947
1735 2838026850
1736 2838033960
1737 2838039736
1738 2838044851
1739 2838052904
1740 2838064697
1741 2838070526
1742 2838074762
1743 2838664014
1744 2838672526
1745 2838677642
1746 2838685589
1747 2838689835
1748 2838695955
1749 2838705151
1750 2838713354
1751 2838716531
1752 2838719669
1753 2838727282
1754 2838731469
1755 2838739741
1756 2838744410
1757 2841844135
1758 2841846600
1759 2841852950
1760 2841860871
1761 2841869118
1762 2842082588
1763 2842112743
1764 2842123853
1765 2842127371
1766 2842132535
1767 2842143856
1768 2842150145
1769 2842152296
1770 2842160277
1771 2842165745
1772 2842172777
1773 2842175915
1774 2842184057
1775 2842189639
1776 2842196359
1777 2842202433
1778 2842208915
1779 2842213953
1780 2842219421
1781 2842224429
1782 2842231639
1783 2842242908
1784 2842245892
1785 2842254831
1786 2842260270
1787 2842267158
1788 2842273681
1789 2842282395
1790 2842290065
1791 2842296981
1792 2842299932
1793 2842308467
1794 2842312229
1795 2842321823
1796 2842344651
1797 2842359546
1798 2842367774
1799 2842376025
1800 2842383235
1801 2842390368
1802 2842397836
1803 2842407675
1804 2842414306
1805 2842420834
1806 2842424140
1807 2842431146
1808 2842437481
1809 2842444296
1810 2842451277
1811 2842465289
1812 2842472242
1813 2842480706
1814 2842487250
1815 2842494113
1816 2842501242
1817 2842507251
1818 2842514525
1819 2842517656
1820 2842521234
1821 2842922699
1822 2844164874
1823 2844456583
1824 2847421083
1825 2848995921
1826 2850079300
1827 2852387869
1828 2854900853
1829 2854918881
1830 2855827643
1831 2855843019
1832 2855877638
1833 2857520879
1834 2857533812
1835 2858801974
1836 2891051044
1837 2891374800
1838 2896386098
1839 2899794304
1840 2899805881
1841 2899845684
1842 2913298505
1843 2913311957
1844 2915983230
1845 2915991711
1846 2915994211
1847 2916002908
1848 2916009102
1849 2916015145
1850 2916022385
1851 2916032236
1852 2916038133
1853 2916042341
1854 2916050066
1855 2916059030
1856 2916063541
1857 2916071247
1858 2916078523
1859 2919101857
1860 2919116748
1861 2919166607
1862 2919172473
1863 2919408333
1864 2920764047
1865 2920822701
1866 2921209274
1867 2921237626
1868 2921245065
1869 2921256226
1870 2921258729
1871 2921268208
1872 2921285245
1873 2921290023
1874 2923556173
1875 2924147827
1876 2924151890
1877 2924164766
1878 2924166425
1879 2924179685
1880 2924180419
1881 2924186783
1882 2924196269
1883 2924204015
1884 2924210681
1885 2924217219
1886 2924222713
1887 2924232411
1888 2926754758
1889 2926761926
1890 2929138885
1891 2933006943
1892 2933015467
1893 2933574916
1894 2933588368
1895 2933594146
1896 2933601331
1897 2935899973
1898 2935902330
1899 2936369536
1900 2936380277
1901 2936385266
1902 2936998842
1903 2937009362
1904 2937015992
1905 2937019971
1906 2937025567
1907 2937032491
1908 2937039154
1909 2937050414
1910 2937060718
1911 2937065725
1912 2937071752
1913 2937084025
1914 2937087362
1915 2937092292
1916 2937106336
1917 2937106840
1918 2937115962
1919 2937125430
1920 2937129183
1921 2941504159
1922 2957378119
1923 2957388105
1924 2957394282
1925 2957401613
1926 2957404980
1927 2957411919
1928 2957417159
1929 2957423067
1930 2957432985
1931 2957439262
1932 2957446596
1933 2957451425
1934 2957458239
1935 2957467705
1936 2957477923
1937 2957484107
1938 2957486998
1939 2957493868
1940 2957505446
1941 2957506149
1942 2960584692
1943 2960593066
1944 2960601197
1945 2960610819
1946 2960612254
1947 2960620277
1948 2960625994
1949 2960635475
1950 2960638599
1951 2960645929
1952 2960658723
1953 2960663107
1954 2960673463
1955 2960680595
1956 2960683837
1957 2960689251
1958 2960697070
1959 2964612232
1960 2964616393
1961 2964623721
1962 2964632067
1963 2964640448
1964 2964649499
1965 2964655902
1966 2964657885
1967 2964667448
1968 2964674232
1969 2964678831
1970 2964687839
1971 2964692229
1972 2964702338
1973 2964708164
1974 2964717444
1975 2964720006
1976 2967666234
1977 2967672096
1978 2967679148
1979 2967688351
1980 2967695738
1981 2967701539
1982 2967711282
1983 2967720659
1984 2967728531
1985 2967733916
1986 2967741589
1987 2967748888
1988 2967755074
1989 2967756419
1990 2967765349
1991 2967773049
1992 2967777385
1993 2970020108
1994 2970028842
1995 2970036216
1996 2970047517
1997 2970054268
1998 2970061481
1999 2970062233
2000 2970074344
2001 2970080261
2002 2970087624
2003 2970097873
2004 2970104360
2005 2970111777
2006 2970121965
2007 2970122879
2008 2970132286
2009 2970137761
2010 2970145404
2011 2970156637
2012 2970157745
2013 2970170263
2014 2970174573
2015 2970184357
2016 2970185253
2017 2970198816
2018 2977522241
2019 2977525666
2020 2977530799
2021 2977540709
2022 2977546826
2023 2977558239
2024 2977560986
2025 2977568771
2026 2977579281
2027 2977582577
2028 2978972996
2029 2979092807
2030 2979099804
2031 2979104779
2032 2984513421
2033 2984520211
2034 2984539507
2035 2984591244
2036 2984601734
2037 2989351974
2038 2989776826
2039 2995395307
2040 2996887960
2041 2996897604
2042 3003931337
2043 3005410640
2044 3005423292
2045 3005450101
2046 3005456327
2047 639646073
2048 648741790
2049 650738633
2050 8003572179
2051 8003995598
2052 8004003365
2053 8005247891
2054 8005261474
2055 8005278299
2056 8005282667
2057 8005291643
2058 8005305484
2059 8005310260
2060 8005315619
2061 8005322487
2062 8005378093
2063 8005384103
2064 8005399619
2065 8005433788
2066 8005465534
2067 8005484472
2068 8005498117
2069 8005543226
2070 8005559984
2071 8005564521
2072 8005571208
2073 8005619326
2074 8005627891
2075 8005647392
2076 8005661521
2077 8005669525
2078 8005687452
2079 8005692763
2080 8005701452
2081 8018132542
2082 8018153932
2083 8018167598
2084 8018176611
2085 8023681263
2086 8024481906
2087 8024488586
2088 8024506342
2089 8046768676
2090 8054461008
2091 8054558907
2092 8056381181
2093 8056382674
2094 8056878657
2095 8057582451
2096 8057878692

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00962

A_deaminase

Adenosine deaminase

10

329

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.8996 7 297
1fkx-assembly1.cif.gz_A murine adenosine deaminase (d296a) 0.8929 6 297
3ewc-assembly1.cif.gz_A crystal structure of adenosine deaminase from plasmodial vivax in complex with mt-coformycin 0.892 3 296
2amx-assembly1.cif.gz_A crystal structure of plasmodium yoelii adenosine deaminase (py02076) 0.8889 3 296
3mvt-assembly1.cif.gz_A crystal structure of apo mada at 2.2a resolution 0.8887 6 297
ID Description Score Start End Superfamily
af_Q54KF3_1_358_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9195 3 294 3.20.20.140
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8996 7 297 3.20.20.140
af_Q54KF3_1_358_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8987 3 294 3.20.20.140
af_Q9P6I7_4_353_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8971 5 297 3.20.20.140
3ewcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.892 3 296 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3S1RTK7-F1-model_v4 Adenosine deaminase 0.9956 162 297 GO:0019239
AF-A0A545ZAP7-F1-model_v4 deleted 0.9852 1 298
AF-A0A2W4BSP4-F1-model_v4 deleted 0.985 1 298
AF-Q92T48-F1-model_v4 Adenine deaminase (ADE) (EC 3.5.4.2) (Adenine aminohydrolase) (AAH) 0.985 1 296 GO:0000034
GO:0006146
GO:0008270
GO:0009117
GO:0043103
AF-A0A0Q8NMW2-F1-model_v4 Adenine deaminase (ADE) (EC 3.5.4.2) (Adenine aminohydrolase) (AAH) 0.9839 1 298 GO:0000034
GO:0006146
GO:0008270
GO:0009117
GO:0043103

Map