F489048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1050 | 462 | 1023 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300006058|Ga0075432_10002406|Ga0075432_100024066 |
| Length | 142 |
| Sequence | MAAKWVETLTGSLEQKKQYKQYKARIGALPEPYGSVAKALQRYFLYYGGVTDGETALTMLGDFADLWERAAADGTPVREIVGDDPVEFAETFAQAYTGTQWIDKERARLTKAIEDAERGHRNDSGDTDPGAGPGEAYKELNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 3 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 4 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 5 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 6 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 7 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 8 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 9 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 10 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 11 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 12 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 13 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 14 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 15 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 16 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 17 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 18 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 19 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 20 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 21 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 22 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 27 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 28 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 139 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 140 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 141 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 142 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 143 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 144 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 145 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 146 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 147 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 148 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 149 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 150 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 151 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 243 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 248 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 249 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 253 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 254 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 262 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 293 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 298 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 299 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 300 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 301 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 302 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 303 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 304 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 305 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 306 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 307 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 308 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 309 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 310 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 311 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 312 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 313 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 314 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 315 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 316 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 317 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 318 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 319 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 320 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 321 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 322 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 323 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 324 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 325 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 332 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 393 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 394 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 395 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 396 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 397 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 398 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 401 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 402 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 403 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 404 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 405 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 406 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 407 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 408 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 409 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 410 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 413 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 414 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 415 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 416 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 429 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 432 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 433 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 435 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 437 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 452 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 453 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 454 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 456 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 459 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 460 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 461 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 462 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.38 |
| Metatranscriptomes | 1.05 |
| Isolates | 2.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.81 |
| Nodule | 0 |
| Rhizoplane | 12.86 |
| Rhizosphere | 77.14 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 6.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001702 | 3300001979 | Bacteria | 10095 |
| 2 | JGI24740J21852_10049945 | 3300001979 | Bacteria | 1205 |
| 3 | JGI24739J22299_10030520 | 3300001989 | Bacteria | 1868 |
| 4 | JGI24739J22299_10241777 | 3300001989 | Bacteria | 529 |
| 5 | JGI25165J46597_1000005 | 3300003214 | Bacteria | 623702 |
| 6 | JGI25407J50210_10067815 | 3300003373 | Bacteria | 892 |
| 7 | Ga0006562J51391_1096029 | 3300003578 | Bacteria | 10820 |
| 8 | JGI25405J52794_10167215 | 3300003911 | Bacteria | 504 |
| 9 | Ga0070658_10007993 | 3300005327 | Bacteria | 8508 |
| 10 | Ga0070658_10056365 | 3300005327 | Bacteria | 3193 |
| 11 | Ga0070658_10118563 | 3300005327 | Bacteria | 2197 |
| 12 | Ga0070658_10135184 | 3300005327 | Bacteria | 2056 |
| 13 | Ga0070658_10138813 | 3300005327 | Bacteria | 2030 |
| 14 | Ga0070676_10348733 | 3300005328 | Bacteria | 1017 |
| 15 | Ga0070683_100263723 | 3300005329 | Bacteria | 1639 |
| 16 | Ga0070683_100307129 | 3300005329 | Bacteria | 1509 |
| 17 | Ga0070683_100508465 | 3300005329 | Bacteria | 1151 |
| 18 | Ga0070683_101123266 | 3300005329 | Bacteria | 755 |
| 19 | Ga0070690_100166208 | 3300005330 | Bacteria | 1515 |
| 20 | Ga0070690_100556914 | 3300005330 | Bacteria | 865 |
| 21 | Ga0070670_100403612 | 3300005331 | Bacteria | 1207 |
| 22 | Ga0068869_100324390 | 3300005334 | Bacteria | 1249 |
| 23 | Ga0068869_100500207 | 3300005334 | Bacteria | 1015 |
| 24 | Ga0068869_101787756 | 3300005334 | Bacteria | 549 |
| 25 | Ga0070666_10196361 | 3300005335 | Bacteria | 1419 |
| 26 | Ga0070666_11037913 | 3300005335 | Bacteria | 608 |
| 27 | Ga0070680_100298706 | 3300005336 | Bacteria | 1365 |
| 28 | Ga0070680_101248772 | 3300005336 | Bacteria | 643 |
| 29 | Ga0070682_100009835 | 3300005337 | Bacteria | 5416 |
| 30 | Ga0070682_100062986 | 3300005337 | Bacteria | 2350 |
| 31 | Ga0070682_100105294 | 3300005337 | Bacteria | 1870 |
| 32 | Ga0070682_100469656 | 3300005337 | Bacteria | 968 |
| 33 | Ga0070682_100637344 | 3300005337 | Bacteria | 847 |
| 34 | Ga0070682_100991648 | 3300005337 | Bacteria | 696 |
| 35 | Ga0070682_101639315 | 3300005337 | Bacteria | 557 |
| 36 | Ga0068868_100528702 | 3300005338 | Bacteria | 1036 |
| 37 | Ga0068868_100802076 | 3300005338 | Bacteria | 849 |
| 38 | Ga0070660_100018494 | 3300005339 | Bacteria | 5092 |
| 39 | Ga0070660_100060151 | 3300005339 | Bacteria | 2948 |
| 40 | Ga0070660_100178014 | 3300005339 | Bacteria | 1720 |
| 41 | Ga0070660_101072463 | 3300005339 | Bacteria | 681 |
| 42 | Ga0070689_100112351 | 3300005340 | Bacteria | 2168 |
| 43 | Ga0070691_10015980 | 3300005341 | Bacteria | 3448 |
| 44 | Ga0070691_10222633 | 3300005341 | Bacteria | 1001 |
| 45 | Ga0070691_10467729 | 3300005341 | Bacteria | 723 |
| 46 | Ga0070687_100249766 | 3300005343 | Bacteria | 1101 |
| 47 | Ga0070687_100876685 | 3300005343 | Bacteria | 642 |
| 48 | Ga0070661_100012837 | 3300005344 | Bacteria | 5867 |
| 49 | Ga0070661_100489515 | 3300005344 | Bacteria | 983 |
| 50 | Ga0070661_100620410 | 3300005344 | Bacteria | 876 |
| 51 | Ga0070692_10158006 | 3300005345 | Bacteria | 1296 |
| 52 | Ga0070692_10185682 | 3300005345 | Bacteria | 1208 |
| 53 | Ga0070668_100385965 | 3300005347 | Bacteria | 1193 |
| 54 | Ga0070668_100437081 | 3300005347 | Bacteria | 1123 |
| 55 | Ga0070668_100499652 | 3300005347 | Bacteria | 1053 |
| 56 | Ga0070669_100274260 | 3300005353 | Bacteria | 1350 |
| 57 | Ga0070669_100721500 | 3300005353 | Bacteria | 843 |
| 58 | Ga0070675_100387727 | 3300005354 | Bacteria | 1244 |
| 59 | Ga0070675_100707147 | 3300005354 | Bacteria | 918 |
| 60 | Ga0070671_100066508 | 3300005355 | Bacteria | 3004 |
| 61 | Ga0070674_100088680 | 3300005356 | Bacteria | 2227 |
| 62 | Ga0070674_100174023 | 3300005356 | Bacteria | 1644 |
| 63 | Ga0070674_100477392 | 3300005356 | Bacteria | 1034 |
| 64 | Ga0070674_101023314 | 3300005356 | Bacteria | 726 |
| 65 | Ga0070673_100076293 | 3300005364 | Bacteria | 2706 |
| 66 | Ga0070673_101354834 | 3300005364 | Bacteria | 669 |
| 67 | Ga0070688_100479389 | 3300005365 | Bacteria | 935 |
| 68 | Ga0070688_101400926 | 3300005365 | Bacteria | 567 |
| 69 | Ga0070659_100000863 | 3300005366 | Bacteria | 22157 |
| 70 | Ga0070659_100151219 | 3300005366 | Bacteria | 1894 |
| 71 | Ga0070659_100855779 | 3300005366 | Bacteria | 793 |
| 72 | Ga0070659_101694997 | 3300005366 | Bacteria | 565 |
| 73 | Ga0070667_100030955 | 3300005367 | Bacteria | 4462 |
| 74 | Ga0070709_10609271 | 3300005434 | Bacteria | 841 |
| 75 | Ga0070709_11225659 | 3300005434 | Bacteria | 603 |
| 76 | Ga0070714_100033819 | 3300005435 | Bacteria | 4277 |
| 77 | Ga0070714_100466811 | 3300005435 | Bacteria | 1200 |
| 78 | Ga0070714_100473939 | 3300005435 | Bacteria | 1191 |
| 79 | Ga0070714_101831436 | 3300005435 | Bacteria | 592 |
| 80 | Ga0070713_100032549 | 3300005436 | Bacteria | 4165 |
| 81 | Ga0070710_10628048 | 3300005437 | Bacteria | 750 |
| 82 | Ga0070710_11220522 | 3300005437 | Bacteria | 556 |
| 83 | Ga0070701_10029301 | 3300005438 | Bacteria | 2713 |
| 84 | Ga0070711_100004587 | 3300005439 | Bacteria | 8176 |
| 85 | Ga0070711_101055046 | 3300005439 | Bacteria | 699 |
| 86 | Ga0070711_101759420 | 3300005439 | Bacteria | 543 |
| 87 | Ga0070705_100606615 | 3300005440 | Bacteria | 847 |
| 88 | Ga0070700_100197780 | 3300005441 | Bacteria | 1410 |
| 89 | Ga0070700_100370534 | 3300005441 | Bacteria | 1068 |
| 90 | Ga0070700_100417604 | 3300005441 | Bacteria | 1013 |
| 91 | Ga0070700_100637639 | 3300005441 | Bacteria | 840 |
| 92 | Ga0070694_100015894 | 3300005444 | Bacteria | 4736 |
| 93 | Ga0070694_100535408 | 3300005444 | Bacteria | 936 |
| 94 | Ga0070708_100175445 | 3300005445 | Bacteria | 2002 |
| 95 | Ga0070663_100157623 | 3300005455 | Bacteria | 1745 |
| 96 | Ga0070663_101387941 | 3300005455 | Bacteria | 622 |
| 97 | Ga0070678_100311470 | 3300005456 | Bacteria | 1341 |
| 98 | Ga0070678_102400080 | 3300005456 | Bacteria | 501 |
| 99 | Ga0070662_100037264 | 3300005457 | Bacteria | 3447 |
| 100 | Ga0070662_100510230 | 3300005457 | Bacteria | 1004 |
| 101 | Ga0070662_100898434 | 3300005457 | Bacteria | 756 |
| 102 | Ga0070681_11144103 | 3300005458 | Bacteria | 700 |
| 103 | Ga0068867_100114089 | 3300005459 | Bacteria | 2080 |
| 104 | Ga0068867_100421220 | 3300005459 | Bacteria | 1131 |
| 105 | Ga0070685_10058281 | 3300005466 | Bacteria | 2251 |
| 106 | Ga0070685_10066899 | 3300005466 | Bacteria | 2119 |
| 107 | Ga0070685_10564111 | 3300005466 | Bacteria | 814 |
| 108 | Ga0070685_11040744 | 3300005466 | Bacteria | 616 |
| 109 | Ga0070706_100435330 | 3300005467 | Bacteria | 1220 |
| 110 | Ga0070699_100296728 | 3300005518 | Bacteria | 1450 |
| 111 | Ga0070679_100547796 | 3300005530 | Bacteria | 1100 |
| 112 | Ga0070679_100729066 | 3300005530 | Bacteria | 934 |
| 113 | Ga0070684_100001103 | 3300005535 | Bacteria | 19349 |
| 114 | Ga0070684_100002388 | 3300005535 | Bacteria | 13835 |
| 115 | Ga0068853_100006583 | 3300005539 | Bacteria | 9251 |
| 116 | Ga0068853_100059888 | 3300005539 | Bacteria | 3289 |
| 117 | Ga0068853_100216380 | 3300005539 | Bacteria | 1748 |
| 118 | Ga0068853_100666422 | 3300005539 | Bacteria | 991 |
| 119 | Ga0070672_100189874 | 3300005543 | Bacteria | 1715 |
| 120 | Ga0070672_100456964 | 3300005543 | Bacteria | 1100 |
| 121 | Ga0070672_100496916 | 3300005543 | Bacteria | 1055 |
| 122 | Ga0070686_100433319 | 3300005544 | Bacteria | 1007 |
| 123 | Ga0070695_100598073 | 3300005545 | Bacteria | 865 |
| 124 | Ga0070696_100104735 | 3300005546 | Bacteria | 2031 |
| 125 | Ga0070696_100311037 | 3300005546 | Bacteria | 1209 |
| 126 | Ga0070696_101349092 | 3300005546 | Bacteria | 607 |
| 127 | Ga0070693_100074539 | 3300005547 | Bacteria | 2008 |
| 128 | Ga0070693_100114455 | 3300005547 | Bacteria | 1664 |
| 129 | Ga0070665_100253572 | 3300005548 | Bacteria | 1760 |
| 130 | Ga0070665_100577842 | 3300005548 | Bacteria | 1137 |
| 131 | Ga0070665_101257530 | 3300005548 | Bacteria | 750 |
| 132 | Ga0070704_100164776 | 3300005549 | Bacteria | 1756 |
| 133 | Ga0070704_101858764 | 3300005549 | Bacteria | 558 |
| 134 | Ga0070704_101873800 | 3300005549 | Bacteria | 555 |
| 135 | Ga0068855_100258065 | 3300005563 | Bacteria | 1942 |
| 136 | Ga0068855_101814449 | 3300005563 | Bacteria | 619 |
| 137 | Ga0070664_100136572 | 3300005564 | Bacteria | 2157 |
| 138 | Ga0068857_100001573 | 3300005577 | Bacteria | 18293 |
| 139 | Ga0068857_100014391 | 3300005577 | Bacteria | 6897 |
| 140 | Ga0068857_100091617 | 3300005577 | Bacteria | 2721 |
| 141 | Ga0068854_100014310 | 3300005578 | Bacteria | 5228 |
| 142 | Ga0068854_100655850 | 3300005578 | Bacteria | 901 |
| 143 | Ga0068856_100036544 | 3300005614 | Bacteria | 4815 |
| 144 | Ga0068856_100036931 | 3300005614 | Bacteria | 4791 |
| 145 | Ga0068856_100178550 | 3300005614 | Bacteria | 2136 |
| 146 | Ga0068856_100349140 | 3300005614 | Bacteria | 1498 |
| 147 | Ga0068856_100623165 | 3300005614 | Bacteria | 1100 |
| 148 | Ga0070702_100125631 | 3300005615 | Bacteria | 1612 |
| 149 | Ga0070702_100187117 | 3300005615 | Bacteria | 1359 |
| 150 | Ga0068852_100000597 | 3300005616 | Bacteria | 23714 |
| 151 | Ga0068852_100048864 | 3300005616 | Bacteria | 3617 |
| 152 | Ga0068852_100079677 | 3300005616 | Bacteria | 2902 |
| 153 | Ga0068852_100251785 | 3300005616 | Bacteria | 1692 |
| 154 | Ga0068852_101247754 | 3300005616 | Bacteria | 765 |
| 155 | Ga0068852_102341947 | 3300005616 | Bacteria | 555 |
| 156 | Ga0068859_100131751 | 3300005617 | Bacteria | 2572 |
| 157 | Ga0068864_100008378 | 3300005618 | Bacteria | 8529 |
| 158 | Ga0068864_100105778 | 3300005618 | Bacteria | 2501 |
| 159 | Ga0068866_10035542 | 3300005718 | Bacteria | 2435 |
| 160 | Ga0068866_10156972 | 3300005718 | Bacteria | 1323 |
| 161 | Ga0068866_10325107 | 3300005718 | Bacteria | 969 |
| 162 | Ga0068861_100227597 | 3300005719 | Bacteria | 1580 |
| 163 | Ga0068861_100493125 | 3300005719 | Bacteria | 1106 |
| 164 | Ga0068861_101210994 | 3300005719 | Bacteria | 731 |
| 165 | Ga0068851_10000020 | 3300005834 | Bacteria | 133551 |
| 166 | Ga0068851_10482748 | 3300005834 | Bacteria | 741 |
| 167 | Ga0068870_10148610 | 3300005840 | Bacteria | 1378 |
| 168 | Ga0068863_100309046 | 3300005841 | Bacteria | 1534 |
| 169 | Ga0068863_101396625 | 3300005841 | Bacteria | 708 |
| 170 | Ga0068858_100000233 | 3300005842 | Bacteria | 60097 |
| 171 | Ga0068858_100587726 | 3300005842 | Bacteria | 1079 |
| 172 | Ga0068858_101660799 | 3300005842 | Bacteria | 631 |
| 173 | Ga0068862_100354671 | 3300005844 | Bacteria | 1362 |
| 174 | Ga0081455_10001475 | 3300005937 | Bacteria | 29104 |
| 175 | Ga0081455_10005778 | 3300005937 | Bacteria | 13485 |
| 176 | Ga0081455_10009290 | 3300005937 | Bacteria | 10125 |
| 177 | Ga0081455_10111098 | 3300005937 | Bacteria | 2178 |
| 178 | Ga0081538_10004076 | 3300005981 | Bacteria | 13588 |
| 179 | Ga0081538_10013765 | 3300005981 | Bacteria | 6389 |
| 180 | Ga0081540_1000051 | 3300005983 | Bacteria | 126311 |
| 181 | Ga0070717_10159243 | 3300006028 | Bacteria | 1958 |
| 182 | Ga0075365_10318441 | 3300006038 | Bacteria | 1095 |
| 183 | Ga0075368_10036445 | 3300006042 | Bacteria | 1921 |
| 184 | Ga0075363_100730336 | 3300006048 | Bacteria | 599 |
| 185 | Ga0075363_101042222 | 3300006048 | Bacteria | 505 |
| 186 | Ga0075364_10045196 | 3300006051 | Bacteria | 2866 |
| 187 | Ga0075364_10421120 | 3300006051 | Bacteria | 912 |
| 188 | Ga0075432_10000136 | 3300006058 | Bacteria | 17018 |
| 189 | Ga0075432_10002406 | 3300006058 | Bacteria | 6231 |
| 190 | Ga0070716_100029558 | 3300006173 | Bacteria | 2964 |
| 191 | Ga0070716_100106037 | 3300006173 | Bacteria | 1732 |
| 192 | Ga0070712_100008557 | 3300006175 | Bacteria | 6438 |
| 193 | Ga0070712_100025252 | 3300006175 | Bacteria | 3947 |
| 194 | Ga0070712_100682729 | 3300006175 | Bacteria | 874 |
| 195 | Ga0070712_101717600 | 3300006175 | Bacteria | 549 |
| 196 | Ga0075367_10082328 | 3300006178 | Bacteria | 1948 |
| 197 | Ga0075369_10075257 | 3300006186 | Bacteria | 1491 |
| 198 | Ga0075369_10129325 | 3300006186 | Bacteria | 1147 |
| 199 | Ga0097621_100518667 | 3300006237 | Bacteria | 1081 |
| 200 | Ga0097621_100561538 | 3300006237 | Bacteria | 1040 |
| 201 | Ga0097621_101426630 | 3300006237 | Bacteria | 656 |
| 202 | Ga0075370_10028796 | 3300006353 | Bacteria | 3090 |
| 203 | Ga0068871_101005833 | 3300006358 | Bacteria | 776 |
| 204 | Ga0068871_101580778 | 3300006358 | Bacteria | 620 |
| 205 | Ga0075428_100028282 | 3300006844 | Bacteria | 6201 |
| 206 | Ga0075428_100075810 | 3300006844 | Bacteria | 3672 |
| 207 | Ga0075428_100922769 | 3300006844 | Bacteria | 926 |
| 208 | Ga0075430_100341679 | 3300006846 | Bacteria | 1236 |
| 209 | Ga0075431_100984329 | 3300006847 | Bacteria | 811 |
| 210 | Ga0075433_10005449 | 3300006852 | Bacteria | 9997 |
| 211 | Ga0075433_10007152 | 3300006852 | Bacteria | 8838 |
| 212 | Ga0075433_11035133 | 3300006852 | Bacteria | 715 |
| 213 | Ga0075434_100004021 | 3300006871 | Bacteria | 13177 |
| 214 | Ga0075434_100015459 | 3300006871 | Bacteria | 7319 |
| 215 | Ga0075434_100162022 | 3300006871 | Bacteria | 2256 |
| 216 | Ga0075434_101498932 | 3300006871 | Bacteria | 684 |
| 217 | Ga0075429_100099381 | 3300006880 | Bacteria | 2539 |
| 218 | Ga0068865_100029131 | 3300006881 | Bacteria | 3660 |
| 219 | Ga0068865_100075309 | 3300006881 | Bacteria | 2406 |
| 220 | Ga0068865_100110050 | 3300006881 | Bacteria | 2031 |
| 221 | Ga0075436_100001576 | 3300006914 | Bacteria | 15562 |
| 222 | Ga0075436_100302031 | 3300006914 | Bacteria | 1147 |
| 223 | Ga0097620_100131762 | 3300006931 | Bacteria | 2572 |
| 224 | Ga0075435_100010337 | 3300007076 | Bacteria | 6822 |
| 225 | Ga0075435_100044819 | 3300007076 | Bacteria | 3544 |
| 226 | Ga0075435_100185626 | 3300007076 | Bacteria | 1758 |
| 227 | Ga0105240_10186255 | 3300009093 | Bacteria | 2445 |
| 228 | Ga0105240_10239816 | 3300009093 | Bacteria | 2102 |
| 229 | Ga0105240_10450382 | 3300009093 | Bacteria | 1440 |
| 230 | Ga0105240_10813681 | 3300009093 | Bacteria | 1011 |
| 231 | Ga0111539_10001727 | 3300009094 | Bacteria | 29086 |
| 232 | Ga0111539_10049845 | 3300009094 | Bacteria | 4990 |
| 233 | Ga0111539_12044160 | 3300009094 | Bacteria | 664 |
| 234 | Ga0105245_10003836 | 3300009098 | Bacteria | 13372 |
| 235 | Ga0105245_10117363 | 3300009098 | Bacteria | 2482 |
| 236 | Ga0105245_10210002 | 3300009098 | Bacteria | 1873 |
| 237 | Ga0105245_10333868 | 3300009098 | Bacteria | 1497 |
| 238 | Ga0105245_10726273 | 3300009098 | Bacteria | 1028 |
| 239 | Ga0105245_11201862 | 3300009098 | Bacteria | 806 |
| 240 | Ga0105247_10106159 | 3300009101 | Bacteria | 1801 |
| 241 | Ga0105247_10349118 | 3300009101 | Bacteria | 1040 |
| 242 | Ga0105247_10406399 | 3300009101 | Bacteria | 971 |
| 243 | Ga0105247_10654935 | 3300009101 | Bacteria | 785 |
| 244 | Ga0114129_10018326 | 3300009147 | Bacteria | 9973 |
| 245 | Ga0114129_11904435 | 3300009147 | Bacteria | 721 |
| 246 | Ga0105243_10038474 | 3300009148 | Bacteria | 3725 |
| 247 | Ga0105243_10060820 | 3300009148 | Bacteria | 3018 |
| 248 | Ga0105243_10068606 | 3300009148 | Bacteria | 2858 |
| 249 | Ga0105243_10251316 | 3300009148 | Bacteria | 1579 |
| 250 | Ga0105243_10514474 | 3300009148 | Bacteria | 1137 |
| 251 | Ga0105243_11329718 | 3300009148 | Bacteria | 737 |
| 252 | Ga0105243_11578757 | 3300009148 | Bacteria | 682 |
| 253 | Ga0105241_10689295 | 3300009174 | Bacteria | 931 |
| 254 | Ga0105242_10719661 | 3300009176 | Bacteria | 979 |
| 255 | Ga0105242_10840842 | 3300009176 | Bacteria | 912 |
| 256 | Ga0105242_10959733 | 3300009176 | Bacteria | 860 |
| 257 | Ga0105242_10974875 | 3300009176 | Bacteria | 854 |
| 258 | Ga0105242_11326578 | 3300009176 | Bacteria | 744 |
| 259 | Ga0105242_11485796 | 3300009176 | Bacteria | 708 |
| 260 | Ga0105242_12139855 | 3300009176 | Bacteria | 604 |
| 261 | Ga0105248_10000714 | 3300009177 | Bacteria | 37567 |
| 262 | Ga0105248_10124344 | 3300009177 | Bacteria | 2910 |
| 263 | Ga0105248_10779460 | 3300009177 | Bacteria | 1079 |
| 264 | Ga0105248_11173624 | 3300009177 | Bacteria | 868 |
| 265 | Ga0105248_12473920 | 3300009177 | Bacteria | 592 |
| 266 | Ga0105237_10004850 | 3300009545 | Bacteria | 15451 |
| 267 | Ga0105237_10017606 | 3300009545 | Bacteria | 7404 |
| 268 | Ga0105237_10275379 | 3300009545 | Bacteria | 1686 |
| 269 | Ga0105237_10342803 | 3300009545 | Bacteria | 1498 |
| 270 | Ga0105237_11637515 | 3300009545 | Bacteria | 651 |
| 271 | Ga0105237_12213485 | 3300009545 | Bacteria | 559 |
| 272 | Ga0105238_10025081 | 3300009551 | Bacteria | 6077 |
| 273 | Ga0105238_10671091 | 3300009551 | Bacteria | 1047 |
| 274 | Ga0105238_10798224 | 3300009551 | Bacteria | 959 |
| 275 | Ga0105238_10802593 | 3300009551 | Bacteria | 957 |
| 276 | Ga0105238_11973357 | 3300009551 | Bacteria | 617 |
| 277 | Ga0105249_10062245 | 3300009553 | Bacteria | 3426 |
| 278 | Ga0105249_11116102 | 3300009553 | Bacteria | 859 |
| 279 | Ga0105249_11792198 | 3300009553 | Bacteria | 686 |
| 280 | Ga0105239_10025612 | 3300010375 | Bacteria | 6495 |
| 281 | Ga0105239_10085922 | 3300010375 | Bacteria | 3468 |
| 282 | Ga0105239_10199323 | 3300010375 | Bacteria | 2242 |
| 283 | Ga0105239_11720509 | 3300010375 | Bacteria | 726 |
| 284 | Ga0105246_10003686 | 3300011119 | Bacteria | 9277 |
| 285 | Ga0105246_10015493 | 3300011119 | Bacteria | 4819 |
| 286 | Ga0105246_11984245 | 3300011119 | Bacteria | 561 |
| 287 | Ga0157340_1001221 | 3300012473 | Bacteria | 1143 |
| 288 | Ga0157320_1005023 | 3300012481 | Bacteria | 866 |
| 289 | Ga0157318_1016339 | 3300012482 | Bacteria | 616 |
| 290 | Ga0157337_1006937 | 3300012483 | Bacteria | 797 |
| 291 | Ga0157343_1013878 | 3300012488 | Bacteria | 655 |
| 292 | Ga0157322_1005288 | 3300012490 | Bacteria | 881 |
| 293 | Ga0157329_1008807 | 3300012491 | Bacteria | 761 |
| 294 | Ga0157319_1017147 | 3300012497 | Bacteria | 666 |
| 295 | Ga0157345_1013134 | 3300012498 | Bacteria | 757 |
| 296 | Ga0157314_1003428 | 3300012500 | Bacteria | 1126 |
| 297 | Ga0157342_1007024 | 3300012507 | Bacteria | 1083 |
| 298 | Ga0157315_1005632 | 3300012508 | Bacteria | 948 |
| 299 | Ga0157315_1006045 | 3300012508 | Bacteria | 932 |
| 300 | Ga0157316_1000680 | 3300012510 | Bacteria | 1867 |
| 301 | Ga0157338_1019928 | 3300012515 | Bacteria | 772 |
| 302 | Ga0157373_10044700 | 3300013100 | Bacteria | 3162 |
| 303 | Ga0157371_10003246 | 3300013102 | Bacteria | 14919 |
| 304 | Ga0157371_10056380 | 3300013102 | Bacteria | 2787 |
| 305 | Ga0157371_10420247 | 3300013102 | Bacteria | 980 |
| 306 | Ga0157371_10575141 | 3300013102 | Bacteria | 836 |
| 307 | Ga0157370_10210527 | 3300013104 | Bacteria | 1802 |
| 308 | Ga0157370_11638624 | 3300013104 | Bacteria | 578 |
| 309 | Ga0157369_10000356 | 3300013105 | Bacteria | 60939 |
| 310 | Ga0157369_10249574 | 3300013105 | Bacteria | 1852 |
| 311 | Ga0157369_10532775 | 3300013105 | Bacteria | 1214 |
| 312 | Ga0157369_10826210 | 3300013105 | Bacteria | 951 |
| 313 | Ga0157369_11057607 | 3300013105 | Bacteria | 830 |
| 314 | Ga0157369_11258305 | 3300013105 | Bacteria | 755 |
| 315 | Ga0157369_11825763 | 3300013105 | Bacteria | 617 |
| 316 | Ga0157374_10211363 | 3300013296 | Bacteria | 1902 |
| 317 | Ga0157374_10574927 | 3300013296 | Bacteria | 1136 |
| 318 | Ga0157378_10649626 | 3300013297 | Bacteria | 1070 |
| 319 | Ga0157378_10790561 | 3300013297 | Bacteria | 974 |
| 320 | Ga0157378_12182629 | 3300013297 | Bacteria | 605 |
| 321 | Ga0163162_10019044 | 3300013306 | Bacteria | 6732 |
| 322 | Ga0163162_10104782 | 3300013306 | Bacteria | 2923 |
| 323 | Ga0163162_10138023 | 3300013306 | Bacteria | 2550 |
| 324 | Ga0163162_10335330 | 3300013306 | Bacteria | 1645 |
| 325 | Ga0163162_10405006 | 3300013306 | Bacteria | 1497 |
| 326 | Ga0163162_10809828 | 3300013306 | Bacteria | 1054 |
| 327 | Ga0163162_11501573 | 3300013306 | Bacteria | 768 |
| 328 | Ga0157372_10004567 | 3300013307 | Bacteria | 14738 |
| 329 | Ga0157372_10077075 | 3300013307 | Bacteria | 3764 |
| 330 | Ga0157372_10095359 | 3300013307 | Bacteria | 3390 |
| 331 | Ga0157372_10221925 | 3300013307 | Bacteria | 2191 |
| 332 | Ga0157372_10449594 | 3300013307 | Bacteria | 1501 |
| 333 | Ga0157372_12374444 | 3300013307 | Bacteria | 609 |
| 334 | Ga0157372_12432769 | 3300013307 | Bacteria | 601 |
| 335 | Ga0157372_12512721 | 3300013307 | Bacteria | 591 |
| 336 | Ga0157372_12679278 | 3300013307 | Bacteria | 572 |
| 337 | Ga0157375_10004900 | 3300013308 | Bacteria | 11635 |
| 338 | Ga0157375_10276183 | 3300013308 | Bacteria | 1843 |
| 339 | Ga0157375_10378896 | 3300013308 | Bacteria | 1581 |
| 340 | Ga0157375_10714588 | 3300013308 | Bacteria | 1155 |
| 341 | Ga0157375_10789082 | 3300013308 | Bacteria | 1099 |
| 342 | Ga0157375_11219451 | 3300013308 | Bacteria | 883 |
| 343 | Ga0157375_12870329 | 3300013308 | Bacteria | 576 |
| 344 | Ga0163163_10098983 | 3300014325 | Bacteria | 2937 |
| 345 | Ga0163163_10234479 | 3300014325 | Bacteria | 1884 |
| 346 | Ga0163163_10327849 | 3300014325 | Bacteria | 1585 |
| 347 | Ga0163163_10400000 | 3300014325 | Bacteria | 1432 |
| 348 | Ga0163163_13020501 | 3300014325 | Bacteria | 525 |
| 349 | Ga0157380_10185669 | 3300014326 | Bacteria | 1831 |
| 350 | Ga0157380_10397255 | 3300014326 | Bacteria | 1307 |
| 351 | Ga0157380_10920471 | 3300014326 | Bacteria | 902 |
| 352 | Ga0157380_11026023 | 3300014326 | Bacteria | 860 |
| 353 | Ga0157380_11431003 | 3300014326 | Bacteria | 742 |
| 354 | Ga0157380_11727725 | 3300014326 | Bacteria | 684 |
| 355 | Ga0157380_12014725 | 3300014326 | Bacteria | 639 |
| 356 | Ga0157377_10296253 | 3300014745 | Bacteria | 1066 |
| 357 | Ga0157377_10361854 | 3300014745 | Bacteria | 977 |
| 358 | Ga0157379_10003043 | 3300014968 | Bacteria | 14169 |
| 359 | Ga0157379_10005293 | 3300014968 | Bacteria | 11087 |
| 360 | Ga0157379_10017466 | 3300014968 | Bacteria | 6317 |
| 361 | Ga0157379_10240080 | 3300014968 | Bacteria | 1644 |
| 362 | Ga0157379_10787179 | 3300014968 | Bacteria | 897 |
| 363 | Ga0157376_10334593 | 3300014969 | Bacteria | 1444 |
| 364 | Ga0157376_10838136 | 3300014969 | Bacteria | 934 |
| 365 | Ga0157376_11259618 | 3300014969 | Bacteria | 769 |
| 366 | Ga0163161_10098660 | 3300017792 | Bacteria | 2172 |
| 367 | Ga0163161_10185510 | 3300017792 | Bacteria | 1597 |
| 368 | Ga0163161_10221502 | 3300017792 | Bacteria | 1465 |
| 369 | Ga0163161_10396224 | 3300017792 | Bacteria | 1106 |
| 370 | Ga0163161_10621271 | 3300017792 | Bacteria | 893 |
| 371 | Ga0197907_10557023 | 3300020069 | Bacteria | 1350 |
| 372 | Ga0197907_10825227 | 3300020069 | Bacteria | 771 |
| 373 | Ga0206356_10605762 | 3300020070 | Bacteria | 1731 |
| 374 | Ga0206351_10698115 | 3300020077 | Bacteria | 797 |
| 375 | Ga0206350_10376196 | 3300020080 | Bacteria | 2563 |
| 376 | Ga0206354_10711242 | 3300020081 | Bacteria | 1673 |
| 377 | Ga0206354_11605514 | 3300020081 | Bacteria | 874 |
| 378 | Ga0206353_11910771 | 3300020082 | Bacteria | 4430 |
| 379 | Ga0206353_11952588 | 3300020082 | Bacteria | 927 |
| 380 | Ga0224712_10079355 | 3300022467 | Bacteria | 1351 |
| 381 | Ga0209674_116786 | 3300025226 | Bacteria | 605 |
| 382 | Ga0207427_100028 | 3300025231 | Bacteria | 388949 |
| 383 | Ga0209437_100211 | 3300025233 | Bacteria | 108544 |
| 384 | Ga0207425_1019162 | 3300025245 | Bacteria | 1477 |
| 385 | Ga0209677_101239 | 3300025253 | Bacteria | 11548 |
| 386 | Ga0209129_1000047 | 3300025258 | Bacteria | 270566 |
| 387 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 388 | Ga0209025_1005871 | 3300025294 | Bacteria | 9814 |
| 389 | Ga0207656_10000012 | 3300025321 | Bacteria | 190545 |
| 390 | Ga0207656_10332594 | 3300025321 | Bacteria | 756 |
| 391 | Ga0207653_10011989 | 3300025885 | Bacteria | 2703 |
| 392 | Ga0207692_10013072 | 3300025898 | Bacteria | 3590 |
| 393 | Ga0207692_10018048 | 3300025898 | Bacteria | 3159 |
| 394 | Ga0207692_10044198 | 3300025898 | Bacteria | 2221 |
| 395 | Ga0207642_10031172 | 3300025899 | Bacteria | 2230 |
| 396 | Ga0207642_10051070 | 3300025899 | Bacteria | 1869 |
| 397 | Ga0207642_10597308 | 3300025899 | Bacteria | 686 |
| 398 | Ga0207710_10027788 | 3300025900 | Bacteria | 2453 |
| 399 | Ga0207710_10041006 | 3300025900 | Bacteria | 2052 |
| 400 | Ga0207710_10285023 | 3300025900 | Bacteria | 832 |
| 401 | Ga0207710_10419779 | 3300025900 | Bacteria | 688 |
| 402 | Ga0207710_10578528 | 3300025900 | Bacteria | 586 |
| 403 | Ga0207688_10018593 | 3300025901 | Bacteria | 3780 |
| 404 | Ga0207688_10094911 | 3300025901 | Bacteria | 1716 |
| 405 | Ga0207688_10162278 | 3300025901 | Bacteria | 1325 |
| 406 | Ga0207688_10762337 | 3300025901 | Bacteria | 613 |
| 407 | Ga0207680_10400175 | 3300025903 | Bacteria | 970 |
| 408 | Ga0207680_10519559 | 3300025903 | Bacteria | 849 |
| 409 | Ga0207647_10088566 | 3300025904 | Bacteria | 1848 |
| 410 | Ga0207685_10011766 | 3300025905 | Bacteria | 2645 |
| 411 | Ga0207699_10003399 | 3300025906 | Bacteria | 7591 |
| 412 | Ga0207699_10164054 | 3300025906 | Bacteria | 1481 |
| 413 | Ga0207643_10082713 | 3300025908 | Bacteria | 1862 |
| 414 | Ga0207705_10013430 | 3300025909 | Bacteria | 5908 |
| 415 | Ga0207705_10039084 | 3300025909 | Bacteria | 3400 |
| 416 | Ga0207705_10048348 | 3300025909 | Bacteria | 3060 |
| 417 | Ga0207705_10068281 | 3300025909 | Bacteria | 2574 |
| 418 | Ga0207705_10077282 | 3300025909 | Bacteria | 2421 |
| 419 | Ga0207705_10101254 | 3300025909 | Bacteria | 2119 |
| 420 | Ga0207707_10183231 | 3300025912 | Bacteria | 1828 |
| 421 | Ga0207695_10008321 | 3300025913 | Bacteria | 13000 |
| 422 | Ga0207695_10525711 | 3300025913 | Bacteria | 1065 |
| 423 | Ga0207695_11020018 | 3300025913 | Bacteria | 707 |
| 424 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 425 | Ga0207671_10056397 | 3300025914 | Bacteria | 2911 |
| 426 | Ga0207671_10350979 | 3300025914 | Bacteria | 1170 |
| 427 | Ga0207693_10006333 | 3300025915 | Bacteria | 9811 |
| 428 | Ga0207663_10021359 | 3300025916 | Bacteria | 3684 |
| 429 | Ga0207662_10061831 | 3300025918 | Bacteria | 2249 |
| 430 | Ga0207662_10693281 | 3300025918 | Bacteria | 713 |
| 431 | Ga0207662_11052102 | 3300025918 | Bacteria | 578 |
| 432 | Ga0207657_10004024 | 3300025919 | Bacteria | 15609 |
| 433 | Ga0207657_10025831 | 3300025919 | Bacteria | 5408 |
| 434 | Ga0207657_10067466 | 3300025919 | Bacteria | 3042 |
| 435 | Ga0207657_10911982 | 3300025919 | Bacteria | 677 |
| 436 | Ga0207649_10038640 | 3300025920 | Bacteria | 2891 |
| 437 | Ga0207649_10128504 | 3300025920 | Bacteria | 1718 |
| 438 | Ga0207649_10202859 | 3300025920 | Bacteria | 1402 |
| 439 | Ga0207652_10531999 | 3300025921 | Bacteria | 1057 |
| 440 | Ga0207652_10757483 | 3300025921 | Bacteria | 864 |
| 441 | Ga0207681_10321877 | 3300025923 | Bacteria | 1230 |
| 442 | Ga0207694_10000433 | 3300025924 | Bacteria | 38856 |
| 443 | Ga0207694_10690380 | 3300025924 | Bacteria | 861 |
| 444 | Ga0207694_11017336 | 3300025924 | Bacteria | 701 |
| 445 | Ga0207659_10179001 | 3300025926 | Bacteria | 1678 |
| 446 | Ga0207687_10015948 | 3300025927 | Bacteria | 4930 |
| 447 | Ga0207687_10239696 | 3300025927 | Bacteria | 1437 |
| 448 | Ga0207687_10349185 | 3300025927 | Bacteria | 1205 |
| 449 | Ga0207687_10374773 | 3300025927 | Bacteria | 1165 |
| 450 | Ga0207687_10977145 | 3300025927 | Bacteria | 726 |
| 451 | Ga0207700_10004680 | 3300025928 | Bacteria | 8106 |
| 452 | Ga0207700_10012617 | 3300025928 | Bacteria | 5458 |
| 453 | Ga0207700_10327400 | 3300025928 | Bacteria | 1329 |
| 454 | Ga0207664_10012310 | 3300025929 | Bacteria | 6110 |
| 455 | Ga0207664_10016720 | 3300025929 | Bacteria | 5358 |
| 456 | Ga0207664_11754587 | 3300025929 | Bacteria | 543 |
| 457 | Ga0207644_10126877 | 3300025931 | Bacteria | 1948 |
| 458 | Ga0207690_10000690 | 3300025932 | Bacteria | 21704 |
| 459 | Ga0207690_10059613 | 3300025932 | Bacteria | 2586 |
| 460 | Ga0207690_11572467 | 3300025932 | Bacteria | 550 |
| 461 | Ga0207706_10067163 | 3300025933 | Bacteria | 3155 |
| 462 | Ga0207706_10182308 | 3300025933 | Bacteria | 1844 |
| 463 | Ga0207706_11098540 | 3300025933 | Bacteria | 665 |
| 464 | Ga0207686_10138383 | 3300025934 | Bacteria | 1679 |
| 465 | Ga0207686_11650509 | 3300025934 | Bacteria | 530 |
| 466 | Ga0207709_10123794 | 3300025935 | Bacteria | 1750 |
| 467 | Ga0207709_10230553 | 3300025935 | Bacteria | 1341 |
| 468 | Ga0207709_10352947 | 3300025935 | Bacteria | 1111 |
| 469 | Ga0207709_11674224 | 3300025935 | Bacteria | 529 |
| 470 | Ga0207670_10132602 | 3300025936 | Bacteria | 1827 |
| 471 | Ga0207669_10502704 | 3300025937 | Bacteria | 970 |
| 472 | Ga0207669_11761622 | 3300025937 | Bacteria | 529 |
| 473 | Ga0207704_10200751 | 3300025938 | Bacteria | 1459 |
| 474 | Ga0207704_11259609 | 3300025938 | Bacteria | 631 |
| 475 | Ga0207665_10010148 | 3300025939 | Bacteria | 6182 |
| 476 | Ga0207665_10078675 | 3300025939 | Bacteria | 2265 |
| 477 | Ga0207665_11345684 | 3300025939 | Bacteria | 569 |
| 478 | Ga0207691_10073900 | 3300025940 | Bacteria | 3075 |
| 479 | Ga0207691_10221732 | 3300025940 | Bacteria | 1639 |
| 480 | Ga0207691_10371589 | 3300025940 | Bacteria | 1221 |
| 481 | Ga0207691_11196157 | 3300025940 | Bacteria | 630 |
| 482 | Ga0207711_10001344 | 3300025941 | Bacteria | 23198 |
| 483 | Ga0207711_10150846 | 3300025941 | Bacteria | 2097 |
| 484 | Ga0207711_11048847 | 3300025941 | Bacteria | 755 |
| 485 | Ga0207689_10017378 | 3300025942 | Bacteria | 6087 |
| 486 | Ga0207689_10934128 | 3300025942 | Bacteria | 732 |
| 487 | Ga0207661_10122938 | 3300025944 | Bacteria | 2212 |
| 488 | Ga0207661_11385065 | 3300025944 | Bacteria | 645 |
| 489 | Ga0207661_11803525 | 3300025944 | Bacteria | 557 |
| 490 | Ga0207661_12168249 | 3300025944 | Bacteria | 502 |
| 491 | Ga0207679_10139893 | 3300025945 | Bacteria | 1955 |
| 492 | Ga0207667_10003648 | 3300025949 | Bacteria | 18980 |
| 493 | Ga0207667_10142518 | 3300025949 | Bacteria | 2467 |
| 494 | Ga0207667_11306193 | 3300025949 | Bacteria | 702 |
| 495 | Ga0207712_10100114 | 3300025961 | Bacteria | 2153 |
| 496 | Ga0207712_11638582 | 3300025961 | Bacteria | 577 |
| 497 | Ga0207712_12005523 | 3300025961 | Bacteria | 518 |
| 498 | Ga0207668_10082992 | 3300025972 | Bacteria | 2331 |
| 499 | Ga0207668_10214236 | 3300025972 | Bacteria | 1542 |
| 500 | Ga0207640_10069912 | 3300025981 | Bacteria | 2359 |
| 501 | Ga0207658_10025692 | 3300025986 | Bacteria | 4124 |
| 502 | Ga0207658_10139643 | 3300025986 | Bacteria | 1959 |
| 503 | Ga0207658_11264201 | 3300025986 | Bacteria | 675 |
| 504 | Ga0207677_10384459 | 3300026023 | Bacteria | 1185 |
| 505 | Ga0207677_10712085 | 3300026023 | Bacteria | 892 |
| 506 | Ga0207703_10000044 | 3300026035 | Bacteria | 158471 |
| 507 | Ga0207703_10669170 | 3300026035 | Bacteria | 986 |
| 508 | Ga0207639_10029843 | 3300026041 | Bacteria | 3996 |
| 509 | Ga0207639_10081260 | 3300026041 | Bacteria | 2567 |
| 510 | Ga0207639_10114593 | 3300026041 | Bacteria | 2203 |
| 511 | Ga0207639_10373779 | 3300026041 | Bacteria | 1278 |
| 512 | Ga0207639_10953785 | 3300026041 | Bacteria | 803 |
| 513 | Ga0207639_11227981 | 3300026041 | Bacteria | 703 |
| 514 | Ga0207678_10005013 | 3300026067 | Bacteria | 11879 |
| 515 | Ga0207678_10264120 | 3300026067 | Bacteria | 1475 |
| 516 | Ga0207678_10760526 | 3300026067 | Bacteria | 854 |
| 517 | Ga0207678_11124316 | 3300026067 | Bacteria | 695 |
| 518 | Ga0207708_10050227 | 3300026075 | Bacteria | 3175 |
| 519 | Ga0207708_10058881 | 3300026075 | Bacteria | 2931 |
| 520 | Ga0207708_10074252 | 3300026075 | Bacteria | 2606 |
| 521 | Ga0207702_10013174 | 3300026078 | Bacteria | 6875 |
| 522 | Ga0207702_10222140 | 3300026078 | Bacteria | 1761 |
| 523 | Ga0207702_10548597 | 3300026078 | Bacteria | 1130 |
| 524 | Ga0207702_10577580 | 3300026078 | Bacteria | 1101 |
| 525 | Ga0207702_10774554 | 3300026078 | Bacteria | 948 |
| 526 | Ga0207702_11067570 | 3300026078 | Bacteria | 801 |
| 527 | Ga0207641_10001733 | 3300026088 | Bacteria | 21055 |
| 528 | Ga0207641_10034591 | 3300026088 | Bacteria | 4205 |
| 529 | Ga0207641_10367700 | 3300026088 | Bacteria | 1374 |
| 530 | Ga0207641_11761506 | 3300026088 | Bacteria | 621 |
| 531 | Ga0207648_10019076 | 3300026089 | Bacteria | 6193 |
| 532 | Ga0207648_10544573 | 3300026089 | Bacteria | 1065 |
| 533 | Ga0207648_10823358 | 3300026089 | Bacteria | 865 |
| 534 | Ga0207676_10304754 | 3300026095 | Bacteria | 1456 |
| 535 | Ga0207676_10350780 | 3300026095 | Bacteria | 1364 |
| 536 | Ga0207676_12149845 | 3300026095 | Bacteria | 556 |
| 537 | Ga0207674_10005505 | 3300026116 | Bacteria | 15034 |
| 538 | Ga0207674_10013706 | 3300026116 | Bacteria | 8977 |
| 539 | Ga0207674_10078956 | 3300026116 | Bacteria | 3296 |
| 540 | Ga0207675_100109807 | 3300026118 | Bacteria | 2603 |
| 541 | Ga0207675_100160490 | 3300026118 | Bacteria | 2144 |
| 542 | Ga0207675_100251852 | 3300026118 | Bacteria | 1709 |
| 543 | Ga0207675_100483873 | 3300026118 | Bacteria | 1230 |
| 544 | Ga0207683_10002264 | 3300026121 | Bacteria | 16869 |
| 545 | Ga0207683_10360498 | 3300026121 | Bacteria | 1335 |
| 546 | Ga0207683_10765696 | 3300026121 | Bacteria | 896 |
| 547 | Ga0207683_11036628 | 3300026121 | Bacteria | 761 |
| 548 | Ga0207683_11746088 | 3300026121 | Bacteria | 571 |
| 549 | Ga0207698_10000269 | 3300026142 | Bacteria | 31515 |
| 550 | Ga0207698_10008328 | 3300026142 | Bacteria | 6551 |
| 551 | Ga0207698_10124834 | 3300026142 | Bacteria | 2187 |
| 552 | Ga0207698_10598033 | 3300026142 | Bacteria | 1087 |
| 553 | Ga0207698_11602754 | 3300026142 | Bacteria | 666 |
| 554 | Ga0209813_10202294 | 3300027866 | Bacteria | 736 |
| 555 | Ga0207428_10001284 | 3300027907 | Bacteria | 26882 |
| 556 | Ga0207428_10001525 | 3300027907 | Bacteria | 24188 |
| 557 | Ga0207428_11040371 | 3300027907 | Bacteria | 574 |
| 558 | Ga0268266_12135880 | 3300028379 | Bacteria | 532 |
| 559 | Ga0268265_10563962 | 3300028380 | Bacteria | 1083 |
| 560 | Ga0268264_10584575 | 3300028381 | Bacteria | 1099 |
| 561 | Ga0268264_10708198 | 3300028381 | Bacteria | 1000 |
| 562 | Ga0268264_10751506 | 3300028381 | Bacteria | 971 |
| 563 | Ga0265320_10039832 | 3300031240 | Bacteria | 2347 |
| 564 | Ga0265327_10238976 | 3300031251 | Bacteria | 812 |
| 565 | Ga0307408_100015791 | 3300031548 | Bacteria | 5031 |
| 566 | Ga0307408_100593880 | 3300031548 | Bacteria | 983 |
| 567 | Ga0307408_100731909 | 3300031548 | Bacteria | 892 |
| 568 | Ga0307514_10076490 | 3300031649 | Bacteria | 2493 |
| 569 | Ga0307405_10117806 | 3300031731 | Bacteria | 1811 |
| 570 | Ga0307405_10269253 | 3300031731 | Bacteria | 1276 |
| 571 | Ga0307413_10006705 | 3300031824 | Bacteria | 5285 |
| 572 | Ga0307413_10084939 | 3300031824 | Bacteria | 2042 |
| 573 | Ga0307413_11077281 | 3300031824 | Bacteria | 693 |
| 574 | Ga0307413_11461864 | 3300031824 | Bacteria | 603 |
| 575 | Ga0307410_10007959 | 3300031852 | Bacteria | 5843 |
| 576 | Ga0307410_10051292 | 3300031852 | Bacteria | 2780 |
| 577 | Ga0307410_11083223 | 3300031852 | Bacteria | 694 |
| 578 | Ga0307410_11642353 | 3300031852 | Bacteria | 568 |
| 579 | Ga0307406_10002700 | 3300031901 | Bacteria | 9673 |
| 580 | Ga0307406_10007635 | 3300031901 | Bacteria | 6005 |
| 581 | Ga0307406_10033716 | 3300031901 | Bacteria | 3136 |
| 582 | Ga0307406_10679537 | 3300031901 | Bacteria | 857 |
| 583 | Ga0307406_10765884 | 3300031901 | Bacteria | 812 |
| 584 | Ga0307407_10025529 | 3300031903 | Bacteria | 3115 |
| 585 | Ga0307407_10041438 | 3300031903 | Bacteria | 2575 |
| 586 | Ga0307407_10238290 | 3300031903 | Bacteria | 1240 |
| 587 | Ga0307407_10270955 | 3300031903 | Bacteria | 1172 |
| 588 | Ga0307407_10393425 | 3300031903 | Bacteria | 992 |
| 589 | Ga0307412_10484887 | 3300031911 | Bacteria | 1026 |
| 590 | Ga0307409_100012048 | 3300031995 | Bacteria | 5489 |
| 591 | Ga0307409_100354787 | 3300031995 | Bacteria | 1385 |
| 592 | Ga0307409_100375535 | 3300031995 | Bacteria | 1350 |
| 593 | Ga0307409_100414271 | 3300031995 | Bacteria | 1291 |
| 594 | Ga0307409_100753840 | 3300031995 | Bacteria | 977 |
| 595 | Ga0307409_102648302 | 3300031995 | Bacteria | 530 |
| 596 | Ga0307416_100053296 | 3300032002 | Bacteria | 3244 |
| 597 | Ga0307416_100517581 | 3300032002 | Bacteria | 1261 |
| 598 | Ga0307416_100575660 | 3300032002 | Bacteria | 1202 |
| 599 | Ga0307416_100772248 | 3300032002 | Bacteria | 1055 |
| 600 | Ga0307416_100798496 | 3300032002 | Bacteria | 1039 |
| 601 | Ga0307416_101275772 | 3300032002 | Bacteria | 840 |
| 602 | Ga0307416_102365648 | 3300032002 | Bacteria | 631 |
| 603 | Ga0307414_10015974 | 3300032004 | Bacteria | 4549 |
| 604 | Ga0307414_10446593 | 3300032004 | Bacteria | 1133 |
| 605 | Ga0307414_10719458 | 3300032004 | Bacteria | 905 |
| 606 | Ga0307414_10934712 | 3300032004 | Bacteria | 796 |
| 607 | Ga0307414_11207095 | 3300032004 | Bacteria | 700 |
| 608 | Ga0307414_11313065 | 3300032004 | Bacteria | 671 |
| 609 | Ga0307411_10090170 | 3300032005 | Bacteria | 2138 |
| 610 | Ga0307411_10231714 | 3300032005 | Bacteria | 1440 |
| 611 | Ga0307411_10287120 | 3300032005 | Bacteria | 1313 |
| 612 | Ga0307411_10329979 | 3300032005 | Bacteria | 1236 |
| 613 | Ga0307411_10330455 | 3300032005 | Bacteria | 1235 |
| 614 | Ga0307411_11582496 | 3300032005 | Bacteria | 604 |
| 615 | Ga0307415_100139679 | 3300032126 | Bacteria | 1848 |
| 616 | Ga0307415_100501717 | 3300032126 | Bacteria | 1061 |
| 617 | Ga0307415_101694917 | 3300032126 | Bacteria | 609 |
| 618 | Ga0373926_0010531 | 3300035083 | Bacteria | 3100 |
| 619 | Ga0373934_0007671 | 3300035086 | Bacteria | 4008 |
| 620 | Ga0373944_0001860 | 3300035089 | Bacteria | 5325 |
| 621 | Ga0373949_0018196 | 3300035090 | Bacteria | 1591 |
| 622 | Ga0373952_0116896 | 3300035092 | Bacteria | 719 |
| 623 | Ga0373952_0211338 | 3300035092 | Bacteria | 572 |
| 624 | Ga0373923_0000367 | 3300035111 | Bacteria | 10260 |
| 625 | Ga0373936_0000674 | 3300035113 | Bacteria | 11861 |
| 626 | Ga0373939_0046555 | 3300035114 | Bacteria | 1328 |
| 627 | Ga0373941_0020839 | 3300035115 | Bacteria | 1843 |
| 628 | Ga0373945_0000598 | 3300035116 | Bacteria | 10357 |
| 629 | Ga0373953_0004098 | 3300035117 | Bacteria | 4617 |
| 630 | Ga0373954_0006760 | 3300035118 | Bacteria | 5005 |
| 631 | Ga0373956_0096518 | 3300035119 | Bacteria | 1367 |
| 632 | Ga0373960_0021419 | 3300035121 | Bacteria | 1719 |
| 633 | Ga0373960_0137873 | 3300035121 | Bacteria | 824 |
| 634 | Ga0373943_0000724 | 3300035170 | Bacteria | 14450 |
| 635 | Ga0373943_0610386 | 3300035170 | Bacteria | 643 |
| 636 | Ga0373946_0086963 | 3300035171 | Bacteria | 1379 |
| 637 | Ga0373955_0009172 | 3300035172 | Bacteria | 4625 |
| 638 | Ga0373942_0040588 | 3300035207 | Bacteria | 1270 |
| 639 | Ga0373961_0294062 | 3300035241 | Bacteria | 599 |
| 640 | Ga0373924_0000394 | 3300035410 | Bacteria | 13412 |
| 641 | Ga0373931_0035754 | 3300035691 | Bacteria | 2584 |
| 642 | Ga0373931_1164342 | 3300035691 | Bacteria | 527 |
| 643 | Ga0373935_0001407 | 3300035692 | Bacteria | 13333 |
| 644 | Ga0373935_1485371 | 3300035692 | Bacteria | 507 |
| 645 | Ga0373927_0001565 | 3300035695 | Bacteria | 17144 |
| 646 | Ga0373927_0350619 | 3300035695 | Bacteria | 973 |
| 647 | Ga0373927_0426119 | 3300035695 | Bacteria | 876 |
| 648 | Ga0373933_0008451 | 3300035724 | Bacteria | 5615 |
| 649 | Ga0373947_0001322 | 3300035725 | Bacteria | 15249 |
| 650 | Ga0373947_0227788 | 3300035725 | Bacteria | 1227 |
| 651 | Ga0373937_0016605 | 3300036401 | Bacteria | 6540 |
| 652 | Ga0373925_0021520 | 3300037068 | Bacteria | 4699 |
| 653 | Ga0395899_0018679 | 3300037312 | Bacteria | 5268 |
| 654 | Ga0395900_0003464 | 3300037418 | Bacteria | 17036 |
| 655 | Ga0395900_0619137 | 3300037418 | Bacteria | 1021 |
| 656 | Ga0395900_1318181 | 3300037418 | Bacteria | 636 |
| 657 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 658 | Ga0395898_0392224 | 3300037466 | Bacteria | 1324 |
| 659 | Ga0395898_1413127 | 3300037466 | Bacteria | 623 |
| 660 | Ga0395901_0050789 | 3300038443 | Bacteria | 4307 |
| 661 | Ga0395901_0284798 | 3300038443 | Bacteria | 1716 |
| 662 | Ga0439465_0019640 | 3300041413 | Bacteria | 2113 |
| 663 | Ga0451787_604139 | 3300041441 | Bacteria | 521 |
| 664 | Ga0451787_605597 | 3300041441 | Bacteria | 884 |
| 665 | Ga0451787_737160 | 3300041441 | Bacteria | 527 |
| 666 | Ga0451789_0430189 | 3300041443 | Bacteria | 891 |
| 667 | Ga0451789_1286349 | 3300041443 | Bacteria | 555 |
| 668 | Ga0451793_1667579 | 3300041452 | Bacteria | 546 |
| 669 | Ga0451797_0677432 | 3300041453 | Bacteria | 706 |
| 670 | Ga0451835_0010124 | 3300041492 | Bacteria | 522 |
| 671 | Ga0451837_0275620 | 3300041494 | Bacteria | 725 |
| 672 | Ga0451841_0562518 | 3300041498 | Bacteria | 708 |
| 673 | Ga0451847_0140216 | 3300041503 | Bacteria | 672 |
| 674 | Ga0451843_0069868 | 3300041509 | Bacteria | 1048 |
| 675 | Ga0451843_0448277 | 3300041509 | Bacteria | 668 |
| 676 | Ga0451843_0669537 | 3300041509 | Bacteria | 605 |
| 677 | Ga0451843_0797638 | 3300041509 | Bacteria | 630 |
| 678 | Ga0451853_0890225 | 3300041512 | Bacteria | 640 |
| 679 | Ga0451853_1028530 | 3300041512 | Bacteria | 1253 |
| 680 | Ga0439442_006204 | 3300042002 | Bacteria | 2398 |
| 681 | Ga0439442_006466 | 3300042002 | Bacteria | 2353 |
| 682 | Ga0439445_0231550 | 3300042004 | Bacteria | 550 |
| 683 | Ga0439448_0025669 | 3300042005 | Bacteria | 1849 |
| 684 | Ga0439448_0071739 | 3300042005 | Bacteria | 1154 |
| 685 | Ga0439449_0100329 | 3300042007 | Bacteria | 1070 |
| 686 | Ga0439449_0312434 | 3300042007 | Bacteria | 594 |
| 687 | Ga0439450_004633 | 3300042008 | Bacteria | 2362 |
| 688 | Ga0439454_055028 | 3300042011 | Bacteria | 680 |
| 689 | Ga0439455_0025634 | 3300042012 | Bacteria | 1434 |
| 690 | Ga0439455_0133469 | 3300042012 | Bacteria | 701 |
| 691 | Ga0439463_002010 | 3300042016 | Bacteria | 5284 |
| 692 | Ga0439463_086646 | 3300042016 | Bacteria | 806 |
| 693 | Ga0450920_035566 | 3300042122 | Bacteria | 986 |
| 694 | Ga0450923_044497 | 3300042125 | Bacteria | 941 |
| 695 | Ga0450890_042401 | 3300042127 | Bacteria | 677 |
| 696 | Ga0450906_048511 | 3300042145 | Bacteria | 749 |
| 697 | Ga0450908_108353 | 3300042184 | Bacteria | 512 |
| 698 | Ga0439444_0016296 | 3300042437 | Bacteria | 1264 |
| 699 | Ga0439464_0066057 | 3300042439 | Bacteria | 1065 |
| 700 | Ga0439460_0198318 | 3300042461 | Bacteria | 683 |
| 701 | Ga0450901_021754 | 3300042533 | Bacteria | 690 |
| 702 | Ga0451577_0653749 | 3300042876 | Bacteria | 953 |
| 703 | Ga0466972_0012105 | 3300044658 | Bacteria | 4334 |
| 704 | Ga0466972_0127277 | 3300044658 | Bacteria | 1200 |
| 705 | Ga0453683_0053958 | 3300044673 | Bacteria | 2516 |
| 706 | Ga0466965_0000016 | 3300044683 | Bacteria | 81402 |
| 707 | Ga0466965_0061263 | 3300044683 | Bacteria | 1881 |
| 708 | Ga0466966_0035728 | 3300044684 | Bacteria | 3209 |
| 709 | Ga0466961_0019240 | 3300044693 | Bacteria | 4395 |
| 710 | Ga0466968_0003766 | 3300044735 | Bacteria | 5619 |
| 711 | Ga0466970_0014509 | 3300044765 | Bacteria | 4046 |
| 712 | Ga0466957_0013971 | 3300044842 | Bacteria | 4669 |
| 713 | Ga0466960_0280481 | 3300044901 | Bacteria | 934 |
| 714 | Ga0466959_0028311 | 3300045049 | Bacteria | 4155 |
| 715 | Ga0451576_1584131 | 3300045051 | Bacteria | 680 |
| 716 | Ga0495592_0028688 | 3300046454 | Bacteria | 4212 |
| 717 | Ga0495603_0001187 | 3300046455 | Bacteria | 15195 |
| 718 | Ga0495603_0355256 | 3300046455 | Bacteria | 841 |
| 719 | Ga0495629_0001672 | 3300046459 | Bacteria | 17412 |
| 720 | Ga0495638_0254418 | 3300046460 | Bacteria | 967 |
| 721 | Ga0495641_0003984 | 3300046461 | Bacteria | 10713 |
| 722 | Ga0495641_0067898 | 3300046461 | Bacteria | 1603 |
| 723 | Ga0495651_0003789 | 3300046462 | Bacteria | 11566 |
| 724 | Ga0495653_0041688 | 3300046463 | Bacteria | 3581 |
| 725 | Ga0495653_0350770 | 3300046463 | Bacteria | 949 |
| 726 | Ga0495580_0006947 | 3300046472 | Bacteria | 9131 |
| 727 | Ga0495582_0002389 | 3300046473 | Bacteria | 10493 |
| 728 | Ga0495582_0802875 | 3300046473 | Bacteria | 544 |
| 729 | Ga0495639_0010448 | 3300046475 | Bacteria | 3999 |
| 730 | Ga0495639_0222399 | 3300046475 | Bacteria | 928 |
| 731 | Ga0495662_0008459 | 3300046476 | Bacteria | 5062 |
| 732 | Ga0495664_0004030 | 3300046477 | Bacteria | 8014 |
| 733 | Ga0495664_0060441 | 3300046477 | Bacteria | 2256 |
| 734 | Ga0495594_0195282 | 3300046499 | Bacteria | 1153 |
| 735 | Ga0495594_0383329 | 3300046499 | Bacteria | 800 |
| 736 | Ga0495596_0191182 | 3300046500 | Bacteria | 796 |
| 737 | Ga0495607_0327574 | 3300046501 | Bacteria | 713 |
| 738 | Ga0495608_0040941 | 3300046511 | Bacteria | 3102 |
| 739 | Ga0495616_0405294 | 3300046513 | Bacteria | 560 |
| 740 | Ga0495618_0003119 | 3300046514 | Bacteria | 10437 |
| 741 | Ga0495628_0025750 | 3300046516 | Bacteria | 4803 |
| 742 | Ga0495630_0028520 | 3300046517 | Bacteria | 4147 |
| 743 | Ga0495631_0091325 | 3300046518 | Bacteria | 1311 |
| 744 | Ga0495637_0348268 | 3300046520 | Bacteria | 520 |
| 745 | Ga0495643_0497387 | 3300046522 | Bacteria | 525 |
| 746 | Ga0495644_0162405 | 3300046523 | Bacteria | 857 |
| 747 | Ga0495666_0159731 | 3300046526 | Bacteria | 1045 |
| 748 | Ga0495652_0008982 | 3300046529 | Bacteria | 9092 |
| 749 | Ga0495665_0004883 | 3300046531 | Bacteria | 7227 |
| 750 | Ga0495640_0023607 | 3300046533 | Bacteria | 4476 |
| 751 | Ga0495586_0014085 | 3300046535 | Bacteria | 4248 |
| 752 | Ga0495586_0173486 | 3300046535 | Bacteria | 1218 |
| 753 | Ga0495587_0006125 | 3300046536 | Bacteria | 7851 |
| 754 | Ga0495598_0384669 | 3300046537 | Bacteria | 546 |
| 755 | Ga0495598_0416206 | 3300046537 | Bacteria | 527 |
| 756 | Ga0495645_0012237 | 3300046543 | Bacteria | 6043 |
| 757 | Ga0495645_0211264 | 3300046543 | Bacteria | 1310 |
| 758 | Ga0495622_0288725 | 3300046557 | Bacteria | 716 |
| 759 | Ga0495667_0014137 | 3300046559 | Bacteria | 5387 |
| 760 | Ga0495634_0045885 | 3300046642 | Bacteria | 2951 |
| 761 | Ga0495635_0016436 | 3300046663 | Bacteria | 5168 |
| 762 | Ga0495588_0217201 | 3300046674 | Bacteria | 1009 |
| 763 | Ga0495588_0548106 | 3300046674 | Bacteria | 606 |
| 764 | Ga0495657_0015830 | 3300046675 | Bacteria | 5508 |
| 765 | Ga0495599_0004443 | 3300046678 | Bacteria | 8300 |
| 766 | Ga0495623_0006192 | 3300046679 | Bacteria | 7776 |
| 767 | Ga0495646_0013069 | 3300046680 | Bacteria | 5276 |
| 768 | Ga0495647_0181720 | 3300046681 | Bacteria | 915 |
| 769 | Ga0495658_0003027 | 3300046683 | Bacteria | 8420 |
| 770 | Ga0495658_0684990 | 3300046683 | Bacteria | 657 |
| 771 | Ga0495658_0739174 | 3300046683 | Bacteria | 630 |
| 772 | Ga0495613_0008109 | 3300046689 | Bacteria | 7809 |
| 773 | Ga0495613_0238942 | 3300046689 | Bacteria | 1271 |
| 774 | Ga0495624_0004181 | 3300046690 | Bacteria | 10611 |
| 775 | Ga0495671_0401055 | 3300046692 | Bacteria | 657 |
| 776 | Ga0495600_0004051 | 3300046809 | Bacteria | 8711 |
| 777 | Ga0495600_0442402 | 3300046809 | Bacteria | 805 |
| 778 | Ga0495581_0003256 | 3300047315 | Bacteria | 9309 |
| 779 | Ga0495604_0004523 | 3300047317 | Bacteria | 11014 |
| 780 | Ga0495674_0129631 | 3300047319 | Bacteria | 2125 |
| 781 | Ga0495674_0334710 | 3300047319 | Bacteria | 1231 |
| 782 | Ga0495672_0140544 | 3300047320 | Bacteria | 1261 |
| 783 | Ga0495676_0003026 | 3300047321 | Bacteria | 15199 |
| 784 | Ga0495676_0530742 | 3300047321 | Bacteria | 770 |
| 785 | Ga0495677_0259950 | 3300047445 | Bacteria | 680 |
| 786 | Ga0495684_0008710 | 3300047471 | Bacteria | 7845 |
| 787 | Ga0495686_0067133 | 3300047472 | Bacteria | 2215 |
| 788 | Ga0495686_0249070 | 3300047472 | Bacteria | 999 |
| 789 | Ga0495593_0001731 | 3300047673 | Bacteria | 12927 |
| 790 | Ga0495593_0050313 | 3300047673 | Bacteria | 2208 |
| 791 | Ga0495602_0010671 | 3300048088 | Bacteria | 9530 |
| 792 | Ga0495614_0051345 | 3300048089 | Bacteria | 1767 |
| 793 | Ga0496100_0002276 | 3300048903 | Bacteria | 9702 |
| 794 | Ga0496100_0060723 | 3300048903 | Bacteria | 2488 |
| 795 | Ga0496100_0109283 | 3300048903 | Bacteria | 1918 |
| 796 | Ga0496100_0510828 | 3300048903 | Bacteria | 927 |
| 797 | Ga0496101_0003922 | 3300048904 | Bacteria | 9298 |
| 798 | Ga0496101_0016066 | 3300048904 | Bacteria | 5053 |
| 799 | Ga0496101_0064914 | 3300048904 | Bacteria | 2660 |
| 800 | Ga0496101_0094865 | 3300048904 | Bacteria | 2224 |
| 801 | Ga0496101_0103951 | 3300048904 | Bacteria | 2130 |
| 802 | Ga0496101_0182095 | 3300048904 | Bacteria | 1618 |
| 803 | Ga0496101_0575078 | 3300048904 | Bacteria | 891 |
| 804 | Ga0496101_0589141 | 3300048904 | Bacteria | 879 |
| 805 | Ga0496101_0725201 | 3300048904 | Bacteria | 785 |
| 806 | Ga0496102_0000017 | 3300048905 | Bacteria | 284200 |
| 807 | Ga0496102_0004090 | 3300048905 | Bacteria | 12362 |
| 808 | Ga0496102_0017204 | 3300048905 | Bacteria | 6330 |
| 809 | Ga0496102_0063643 | 3300048905 | Bacteria | 3378 |
| 810 | Ga0496102_0160514 | 3300048905 | Bacteria | 2114 |
| 811 | Ga0496102_0163030 | 3300048905 | Bacteria | 2097 |
| 812 | Ga0496102_0407209 | 3300048905 | Bacteria | 1278 |
| 813 | Ga0496102_0498331 | 3300048905 | Bacteria | 1140 |
| 814 | Ga0496102_1591864 | 3300048905 | Bacteria | 572 |
| 815 | Ga0496103_0000041 | 3300048906 | Bacteria | 169542 |
| 816 | Ga0496103_0040842 | 3300048906 | Bacteria | 2851 |
| 817 | Ga0496103_0049332 | 3300048906 | Bacteria | 2603 |
| 818 | Ga0496103_0119576 | 3300048906 | Bacteria | 1677 |
| 819 | Ga0496103_0324799 | 3300048906 | Bacteria | 990 |
| 820 | Ga0496103_0494846 | 3300048906 | Bacteria | 783 |
| 821 | Ga0496104_0001879 | 3300048907 | Bacteria | 18186 |
| 822 | Ga0496104_0008855 | 3300048907 | Bacteria | 8945 |
| 823 | Ga0496104_0068414 | 3300048907 | Bacteria | 3375 |
| 824 | Ga0496104_0169506 | 3300048907 | Bacteria | 2093 |
| 825 | Ga0496104_0388797 | 3300048907 | Bacteria | 1307 |
| 826 | Ga0496104_0493559 | 3300048907 | Bacteria | 1136 |
| 827 | Ga0496104_0725594 | 3300048907 | Bacteria | 901 |
| 828 | Ga0496104_1201460 | 3300048907 | Bacteria | 661 |
| 829 | Ga0496104_1373897 | 3300048907 | Bacteria | 609 |
| 830 | Ga0496105_0001766 | 3300048908 | Bacteria | 15463 |
| 831 | Ga0496105_0009627 | 3300048908 | Bacteria | 7563 |
| 832 | Ga0496105_0011284 | 3300048908 | Bacteria | 7052 |
| 833 | Ga0496105_0037487 | 3300048908 | Bacteria | 3992 |
| 834 | Ga0496105_0067927 | 3300048908 | Bacteria | 2944 |
| 835 | Ga0496105_0089820 | 3300048908 | Bacteria | 2538 |
| 836 | Ga0496105_0133549 | 3300048908 | Bacteria | 2045 |
| 837 | Ga0496105_0134802 | 3300048908 | Bacteria | 2034 |
| 838 | Ga0496105_0266567 | 3300048908 | Bacteria | 1384 |
| 839 | Ga0496106_0006289 | 3300048909 | Bacteria | 8792 |
| 840 | Ga0496106_1039035 | 3300048909 | Bacteria | 643 |
| 841 | Ga0496107_0011513 | 3300048910 | Bacteria | 6162 |
| 842 | Ga0496107_0018120 | 3300048910 | Bacteria | 4954 |
| 843 | Ga0496107_0046146 | 3300048910 | Bacteria | 3135 |
| 844 | Ga0496107_0069628 | 3300048910 | Bacteria | 2554 |
| 845 | Ga0496107_0071209 | 3300048910 | Bacteria | 2526 |
| 846 | Ga0496107_0327491 | 3300048910 | Bacteria | 1140 |
| 847 | Ga0496108_0002013 | 3300048911 | Bacteria | 16278 |
| 848 | Ga0496108_0002520 | 3300048911 | Bacteria | 14655 |
| 849 | Ga0496108_0023704 | 3300048911 | Bacteria | 5050 |
| 850 | Ga0496108_0119728 | 3300048911 | Bacteria | 2257 |
| 851 | Ga0496108_0202211 | 3300048911 | Bacteria | 1724 |
| 852 | Ga0496108_0293672 | 3300048911 | Bacteria | 1415 |
| 853 | Ga0496108_0442988 | 3300048911 | Bacteria | 1135 |
| 854 | Ga0496108_0517783 | 3300048911 | Bacteria | 1041 |
| 855 | Ga0496108_0633775 | 3300048911 | Bacteria | 930 |
| 856 | Ga0496108_0936314 | 3300048911 | Bacteria | 742 |
| 857 | Ga0496108_1064257 | 3300048911 | Bacteria | 689 |
| 858 | Ga0496108_1613647 | 3300048911 | Bacteria | 536 |
| 859 | Ga0496109_0036204 | 3300048912 | Bacteria | 4454 |
| 860 | Ga0496109_0066031 | 3300048912 | Bacteria | 3312 |
| 861 | Ga0496109_0110390 | 3300048912 | Bacteria | 2557 |
| 862 | Ga0496109_0141753 | 3300048912 | Bacteria | 2247 |
| 863 | Ga0496109_0178250 | 3300048912 | Bacteria | 1995 |
| 864 | Ga0496109_0346851 | 3300048912 | Bacteria | 1402 |
| 865 | Ga0496109_0372903 | 3300048912 | Bacteria | 1348 |
| 866 | Ga0496109_0483898 | 3300048912 | Bacteria | 1168 |
| 867 | Ga0496109_1470597 | 3300048912 | Bacteria | 616 |
| 868 | Ga0496109_1971554 | 3300048912 | Bacteria | 516 |
| 869 | Ga0496110_0002211 | 3300048913 | Bacteria | 14540 |
| 870 | Ga0496110_0006460 | 3300048913 | Bacteria | 9289 |
| 871 | Ga0496110_0010855 | 3300048913 | Bacteria | 7428 |
| 872 | Ga0496110_0097958 | 3300048913 | Bacteria | 2627 |
| 873 | Ga0496110_0109033 | 3300048913 | Bacteria | 2486 |
| 874 | Ga0496110_0185434 | 3300048913 | Bacteria | 1889 |
| 875 | Ga0496110_0983943 | 3300048913 | Bacteria | 751 |
| 876 | Ga0496111_0000481 | 3300048914 | Bacteria | 20447 |
| 877 | Ga0496111_0064765 | 3300048914 | Bacteria | 2652 |
| 878 | Ga0496111_0122802 | 3300048914 | Bacteria | 1918 |
| 879 | Ga0496111_0170158 | 3300048914 | Bacteria | 1619 |
| 880 | Ga0496111_0312240 | 3300048914 | Bacteria | 1165 |
| 881 | Ga0496111_0397223 | 3300048914 | Bacteria | 1019 |
| 882 | Ga0496111_0430079 | 3300048914 | Bacteria | 975 |
| 883 | Ga0496111_0736629 | 3300048914 | Bacteria | 716 |
| 884 | Ga0496111_1111893 | 3300048914 | Bacteria | 563 |
| 885 | Ga0496112_0007896 | 3300048915 | Bacteria | 9479 |
| 886 | Ga0496112_0091055 | 3300048915 | Bacteria | 3019 |
| 887 | Ga0496112_0185216 | 3300048915 | Bacteria | 2045 |
| 888 | Ga0496112_0347519 | 3300048915 | Bacteria | 1426 |
| 889 | Ga0496113_0065170 | 3300048916 | Bacteria | 2756 |
| 890 | Ga0496113_0124461 | 3300048916 | Bacteria | 2018 |
| 891 | Ga0496113_0162548 | 3300048916 | Bacteria | 1766 |
| 892 | Ga0496113_0375339 | 3300048916 | Bacteria | 1141 |
| 893 | Ga0496114_0004969 | 3300048917 | Bacteria | 10371 |
| 894 | Ga0496114_0009643 | 3300048917 | Bacteria | 7668 |
| 895 | Ga0496114_0038495 | 3300048917 | Bacteria | 3957 |
| 896 | Ga0496114_0058447 | 3300048917 | Bacteria | 3220 |
| 897 | Ga0496114_0105577 | 3300048917 | Bacteria | 2409 |
| 898 | Ga0496114_0135406 | 3300048917 | Bacteria | 2130 |
| 899 | Ga0496114_0148871 | 3300048917 | Bacteria | 2030 |
| 900 | Ga0496114_0267808 | 3300048917 | Bacteria | 1505 |
| 901 | Ga0496114_0275019 | 3300048917 | Bacteria | 1484 |
| 902 | Ga0496114_0319135 | 3300048917 | Bacteria | 1372 |
| 903 | Ga0496114_0342852 | 3300048917 | Bacteria | 1321 |
| 904 | Ga0496114_0362624 | 3300048917 | Bacteria | 1282 |
| 905 | Ga0496114_0389006 | 3300048917 | Bacteria | 1235 |
| 906 | Ga0496114_0394639 | 3300048917 | Bacteria | 1225 |
| 907 | Ga0496114_0400609 | 3300048917 | Bacteria | 1215 |
| 908 | Ga0496114_0453716 | 3300048917 | Bacteria | 1135 |
| 909 | Ga0496114_0500835 | 3300048917 | Bacteria | 1074 |
| 910 | Ga0496114_0852297 | 3300048917 | Bacteria | 791 |
| 911 | Ga0496114_1136690 | 3300048917 | Bacteria | 666 |
| 912 | Ga0496115_0021354 | 3300048918 | Bacteria | 5001 |
| 913 | Ga0496115_0036198 | 3300048918 | Bacteria | 3907 |
| 914 | Ga0496115_0051666 | 3300048918 | Bacteria | 3295 |
| 915 | Ga0496115_0071864 | 3300048918 | Bacteria | 2806 |
| 916 | Ga0496115_0091204 | 3300048918 | Bacteria | 2490 |
| 917 | Ga0496115_0175562 | 3300048918 | Bacteria | 1771 |
| 918 | Ga0496115_0264995 | 3300048918 | Bacteria | 1412 |
| 919 | Ga0496115_0470497 | 3300048918 | Bacteria | 1013 |
| 920 | Ga0496115_0827928 | 3300048918 | Bacteria | 718 |
| 921 | Ga0496116_0000121 | 3300048919 | Bacteria | 166606 |
| 922 | Ga0496117_0000084 | 3300048920 | Bacteria | 214308 |
| 923 | Ga0496117_0000163 | 3300048920 | Bacteria | 140644 |
| 924 | Ga0496117_0006658 | 3300048920 | Bacteria | 11578 |
| 925 | Ga0496117_0107087 | 3300048920 | Bacteria | 1752 |
| 926 | Ga0496117_0119388 | 3300048920 | Bacteria | 1623 |
| 927 | Ga0496117_0510275 | 3300048920 | Bacteria | 581 |
| 928 | Ga0496118_0000057 | 3300048921 | Bacteria | 228315 |
| 929 | Ga0496118_0039278 | 3300048921 | Bacteria | 3779 |
| 930 | Ga0496118_0055293 | 3300048921 | Bacteria | 2997 |
| 931 | Ga0496118_0247370 | 3300048921 | Bacteria | 1016 |
| 932 | Ga0496119_0005258 | 3300048922 | Bacteria | 12479 |
| 933 | Ga0496119_0236784 | 3300048922 | Bacteria | 926 |
| 934 | Ga0496120_0001463 | 3300048923 | Bacteria | 28189 |
| 935 | Ga0496120_0012737 | 3300048923 | Bacteria | 5703 |
| 936 | Ga0496120_0061739 | 3300048923 | Bacteria | 2090 |
| 937 | Ga0496121_0003923 | 3300048924 | Bacteria | 20623 |
| 938 | Ga0496121_0007250 | 3300048924 | Bacteria | 13422 |
| 939 | Ga0496122_0009222 | 3300048925 | Bacteria | 10443 |
| 940 | Ga0496122_0054789 | 3300048925 | Bacteria | 2991 |
| 941 | Ga0496122_0119691 | 3300048925 | Bacteria | 1702 |
| 942 | Ga0496122_0156462 | 3300048925 | Bacteria | 1398 |
| 943 | Ga0496123_0009772 | 3300048926 | Bacteria | 8573 |
| 944 | Ga0496123_0010117 | 3300048926 | Bacteria | 8386 |
| 945 | Ga0496123_0509208 | 3300048926 | Bacteria | 524 |
| 946 | Ga0496124_0113217 | 3300048927 | Bacteria | 2180 |
| 947 | Ga0496124_0153440 | 3300048927 | Bacteria | 1804 |
| 948 | Ga0496124_0298588 | 3300048927 | Bacteria | 1165 |
| 949 | Ga0496124_0349403 | 3300048927 | Bacteria | 1047 |
| 950 | Ga0496125_0061576 | 3300048928 | Bacteria | 3008 |
| 951 | Ga0496125_0256621 | 3300048928 | Bacteria | 1099 |
| 952 | Ga0496125_0586879 | 3300048928 | Bacteria | 611 |
| 953 | Ga0496126_0000135 | 3300048929 | Bacteria | 169551 |
| 954 | Ga0496126_0001669 | 3300048929 | Bacteria | 33303 |
| 955 | Ga0496126_0027360 | 3300048929 | Bacteria | 5448 |
| 956 | Ga0496126_0198808 | 3300048929 | Bacteria | 1694 |
| 957 | Ga0496126_0208866 | 3300048929 | Bacteria | 1645 |
| 958 | Ga0496126_0223397 | 3300048929 | Bacteria | 1581 |
| 959 | Ga0496126_0511642 | 3300048929 | Bacteria | 958 |
| 960 | Ga0501031_0540692 | 3300049568 | Bacteria | 751 |
| 961 | Ga0501032_0040496 | 3300049569 | Bacteria | 3167 |
| 962 | Ga0501032_0757167 | 3300049569 | Bacteria | 614 |
| 963 | Ga0501033_0161417 | 3300049570 | Bacteria | 1613 |
| 964 | Ga0501034_0001761 | 3300049571 | Bacteria | 27727 |
| 965 | Ga0501034_0827167 | 3300049571 | Bacteria | 817 |
| 966 | Ga0501037_0535650 | 3300049573 | Bacteria | 791 |
| 967 | Ga0501038_0172701 | 3300049574 | Bacteria | 1748 |
| 968 | Ga0501039_0062359 | 3300049575 | Bacteria | 2888 |
| 969 | Ga0501039_0364228 | 3300049575 | Bacteria | 1136 |
| 970 | Ga0501043_0294241 | 3300049579 | Bacteria | 1242 |
| 971 | Ga0501046_0088447 | 3300049580 | Bacteria | 2385 |
| 972 | Ga0501047_0270821 | 3300049581 | Bacteria | 1544 |
| 973 | Ga0501070_0001101 | 3300049586 | Bacteria | 24235 |
| 974 | Ga0501070_0049085 | 3300049586 | Bacteria | 3505 |
| 975 | Ga0501282_030085 | 3300049778 | Bacteria | 620 |
| 976 | Ga0501035_0120750 | 3300049822 | Bacteria | 2291 |
| 977 | Ga0501035_0420223 | 3300049822 | Bacteria | 1110 |
| 978 | Ga0501044_0138867 | 3300049823 | Bacteria | 2419 |
| 979 | Ga0501044_0380440 | 3300049823 | Bacteria | 1327 |
| 980 | nmdc:mga03683_417542_c1 | 3300050489 | Bacteria | 642 |
| 981 | nmdc:mga03n38_116147_c1 | 3300050490 | Bacteria | 1309 |
| 982 | nmdc:mga00v17_196980_c1 | 3300050491 | Bacteria | 1302 |
| 983 | nmdc:mga0yw44_196464_c1 | 3300050492 | Bacteria | 1331 |
| 984 | nmdc:mga0yw44_319336_c1 | 3300050492 | Bacteria | 1043 |
| 985 | nmdc:mga0yw44_341161_c1 | 3300050492 | Bacteria | 1008 |
| 986 | nmdc:mga06z11_240180_c1 | 3300050494 | Bacteria | 1064 |
| 987 | nmdc:mga04h51_71376_c1 | 3300050495 | Bacteria | 1213 |
| 988 | nmdc:mga07m45_31881_c1 | 3300050496 | Bacteria | 2921 |
| 989 | nmdc:mga07m45_492315_c1 | 3300050496 | Bacteria | 710 |
| 990 | nmdc:mga05p37_23752_c1 | 3300050507 | Bacteria | 7445 |
| 991 | nmdc:mga09592_1620630_c1 | 3300050508 | Bacteria | 524 |
| 992 | nmdc:mga08y16_1901977_c1 | 3300050511 | Bacteria | 546 |
| 993 | nmdc:mga08y16_33806_c1 | 3300050511 | Bacteria | 5371 |
| 994 | nmdc:mga08y16_827806_c1 | 3300050511 | Bacteria | 916 |
| 995 | nmdc:mga0n895_160103_c1 | 3300050512 | Bacteria | 2283 |
| 996 | nmdc:mga0n895_19256_c1 | 3300050512 | Bacteria | 6340 |
| 997 | nmdc:mga0n895_415041_c1 | 3300050512 | Bacteria | 1361 |
| 998 | nmdc:mga0rr50_53114_c1 | 3300050513 | Bacteria | 3014 |
| 999 | nmdc:mga0rr50_60982_c1 | 3300050513 | Bacteria | 2840 |
| 1000 | nmdc:mga08x19_114880_c1 | 3300050514 | Bacteria | 1799 |
| 1001 | nmdc:mga08x19_116411_c1 | 3300050514 | Bacteria | 1787 |
| 1002 | nmdc:mga08x19_13651_c1 | 3300050514 | Bacteria | 4915 |
| 1003 | nmdc:mga0a205_5837_c1 | 3300050515 | Bacteria | 11092 |
| 1004 | nmdc:mga0a205_7200_c1 | 3300050515 | Bacteria | 10059 |
| 1005 | nmdc:mga0a205_750712_c1 | 3300050515 | Bacteria | 824 |
| 1006 | nmdc:mga0sz30_463020_c1 | 3300050516 | Bacteria | 569 |
| 1007 | nmdc:mga0sz30_70580_c1 | 3300050516 | Bacteria | 1503 |
| 1008 | Ga0495601_0048053 | 3300053077 | Bacteria | 2687 |
| 1009 | Ga0495601_0359617 | 3300053077 | Bacteria | 946 |
| 1010 | Ga0495612_0010119 | 3300053078 | Bacteria | 3815 |
| 1011 | Ga0495595_0474361 | 3300053084 | Bacteria | 637 |
| 1012 | Ga0495619_0006190 | 3300053085 | Bacteria | 7583 |
| 1013 | Ga0500556_0000768 | 3300053104 | Bacteria | 19015 |
| 1014 | Ga0500562_000448 | 3300053108 | Bacteria | 10042 |
| 1015 | Ga0500568_0000327 | 3300053139 | Bacteria | 37336 |
| 1016 | Ga0500568_0219679 | 3300053139 | Bacteria | 694 |
| 1017 | Ga0500573_0394685 | 3300053140 | Bacteria | 657 |
| 1018 | Ga0500616_0000071 | 3300053153 | Bacteria | 232527 |
| 1019 | Ga0500620_104173 | 3300053155 | Bacteria | 993 |
| 1020 | Ga0500645_038792 | 3300053730 | Bacteria | 1412 |
| 1021 | Ga0501084_0435010 | 3300054114 | Bacteria | 1109 |
| 1022 | Ga0530510_1476878 | 3300061734 | Bacteria | 522 |
| 1023 | Ga0530510_1518701 | 3300061734 | Bacteria | 514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0610386 | Ga0373943_0610386_102_452 | 109 |
| 2 | 3300035692 | Ga0373935_1485371 | Ga0373935_1485371_75_425 | 109 |
| 3 | 3300035695 | Ga0373927_0350619 | Ga0373927_0350619_478_828 | 109 |
| 4 | 3300035725 | Ga0373947_0227788 | Ga0373947_0227788_21_371 | 109 |
| 5 | 3300046461 | Ga0495641_0067898 | Ga0495641_0067898_1101_1451 | 109 |
| 6 | 3300046499 | Ga0495594_0383329 | Ga0495594_0383329_393_743 | 109 |
| 7 | 3300046689 | Ga0495613_0238942 | Ga0495613_0238942_424_774 | 109 |
| 8 | 3300047321 | Ga0495676_0530742 | Ga0495676_0530742_61_411 | 109 |
| 9 | 3300005356 | Ga0070674_101023314 | Ga0070674_1010233141 | 114 |
| 10 | 3300006852 | Ga0075433_11035133 | Ga0075433_110351332 | 114 |
| 11 | 3300009148 | Ga0105243_11578757 | Ga0105243_115787571 | 114 |
| 12 | 3300041441 | Ga0451787_737160 | Ga0451787_737160_35_400 | 114 |
| 13 | 3300053108 | Ga0500562_000448 | Ga0500562_000448_1716_2081 | 114 |
| 14 | 3300017792 | Ga0163161_10621271 | Ga0163161_106212712 | 116 |
| 15 | 3300046543 | Ga0495645_0211264 | Ga0495645_0211264_233_583 | 116 |
| 16 | 3300048908 | Ga0496105_0067927 | Ga0496105_0067927_1891_2241 | 116 |
| 17 | 3300048917 | Ga0496114_0453716 | Ga0496114_0453716_656_1006 | 116 |
| 18 | iso_pu_bacteria | 2643221616 | 2644097763 | 116 |
| 19 | iso_pu_bacteria | 2808606368 | 2808883450 | 116 |
| 20 | iso_pu_bacteria | 2852677369 | 2852677597 | 116 |
| 21 | iso_pu_bacteria | 2884763398 | 2884766983 | 116 |
| 22 | 3300013105 | Ga0157369_11258305 | Ga0157369_112583052 | 117 |
| 23 | 3300013308 | Ga0157375_11219451 | Ga0157375_112194512 | 117 |
| 24 | 3300017792 | Ga0163161_10396224 | Ga0163161_103962242 | 117 |
| 25 | 3300026118 | Ga0207675_100483873 | Ga0207675_1004838733 | 117 |
| 26 | 3300031649 | Ga0307514_10076490 | Ga0307514_100764901 | 117 |
| 27 | 3300050492 | nmdc:mga0yw44_196464_c1 | nmdc:mga0yw44_196464_c1_864_1232 | 117 |
| 28 | 3300053104 | Ga0500556_0000768 | Ga0500556_0000768_9908_10276 | 117 |
| 29 | 3300053139 | Ga0500568_0219679 | Ga0500568_0219679_35_403 | 117 |
| 30 | iso_pu_bacteria | 2585428094 | 2587861828 | 117 |
| 31 | iso_pu_bacteria | 2585428157 | 2588107165 | 117 |
| 32 | iso_pu_bacteria | 2643221575 | 2643886697 | 117 |
| 33 | iso_pu_bacteria | 2643221632 | 2644183769 | 117 |
| 34 | iso_pu_bacteria | 2643221649 | 2644280253 | 117 |
| 35 | iso_pu_bacteria | 2643221724 | 2644678536 | 117 |
| 36 | iso_pu_bacteria | 2721755702 | 2723643466 | 117 |
| 37 | iso_pu_bacteria | 2728369380 | 2730228037 | 117 |
| 38 | iso_pu_bacteria | 2747842429 | 2747955180 | 117 |
| 39 | iso_pu_bacteria | 2773857763 | 2774399659 | 117 |
| 40 | iso_pu_bacteria | 2808606360 | 2808851504 | 117 |
| 41 | iso_pu_bacteria | 2808606372 | 2808899979 | 117 |
| 42 | iso_pu_bacteria | 2811994872 | 2812324385 | 117 |
| 43 | iso_pu_bacteria | 2844841374 | 2844843109 | 117 |
| 44 | iso_pu_bacteria | 2919055335 | 2919058621 | 117 |
| 45 | iso_pu_bacteria | 2928153084 | 2928153271 | 117 |
| 46 | iso_pu_bacteria | 2945941187 | 2945943430 | 117 |
| 47 | iso_pu_bacteria | 2945941187 | 2945944143 | 117 |
| 48 | iso_pu_bacteria | 2946024296 | 2946025781 | 117 |
| 49 | iso_pu_bacteria | 8004182704 | 8004182911 | 117 |
| 50 | iso_pu_bacteria | 8054107350 | 8054108866 | 117 |
| 51 | iso_pu_bacteria | 8055034563 | 8055037024 | 117 |
| 52 | iso_pu_bacteria | 8057345674 | 8057349564 | 117 |
| 53 | 3300003373 | JGI25407J50210_10067815 | JGI25407J50210_100678152 | 118 |
| 54 | 3300005981 | Ga0081538_10013765 | Ga0081538_100137652 | 118 |
| 55 | 3300006844 | Ga0075428_100028282 | Ga0075428_1000282821 | 118 |
| 56 | 3300048914 | Ga0496111_0736629 | Ga0496111_0736629_40_405 | 119 |
| 57 | 3300053077 | Ga0495601_0359617 | Ga0495601_0359617_109_477 | 119 |
| 58 | 3300003214 | JGI25165J46597_1000005 | JGI25165J46597_100000575 | 120 |
| 59 | 3300005337 | Ga0070682_101639315 | Ga0070682_1016393151 | 120 |
| 60 | 3300005341 | Ga0070691_10222633 | Ga0070691_102226332 | 120 |
| 61 | 3300005466 | Ga0070685_11040744 | Ga0070685_110407442 | 120 |
| 62 | 3300005616 | Ga0068852_102341947 | Ga0068852_1023419472 | 120 |
| 63 | 3300005981 | Ga0081538_10004076 | Ga0081538_100040763 | 120 |
| 64 | 3300006353 | Ga0075370_10028796 | Ga0075370_100287963 | 120 |
| 65 | 3300007076 | Ga0075435_100185626 | Ga0075435_1001856264 | 120 |
| 66 | 3300009177 | Ga0105248_12473920 | Ga0105248_124739202 | 120 |
| 67 | 3300009545 | Ga0105237_10275379 | Ga0105237_102753793 | 120 |
| 68 | 3300010375 | Ga0105239_10085922 | Ga0105239_100859227 | 120 |
| 69 | 3300012508 | Ga0157315_1005632 | Ga0157315_10056321 | 120 |
| 70 | 3300013105 | Ga0157369_10826210 | Ga0157369_108262102 | 120 |
| 71 | 3300013306 | Ga0163162_10019044 | Ga0163162_100190447 | 120 |
| 72 | 3300013307 | Ga0157372_10095359 | Ga0157372_100953596 | 120 |
| 73 | 3300013307 | Ga0157372_12679278 | Ga0157372_126792782 | 120 |
| 74 | 3300025231 | Ga0207427_100028 | Ga0207427_10002877 | 120 |
| 75 | 3300025233 | Ga0209437_100211 | Ga0209437_10021161 | 120 |
| 76 | 3300025261 | Ga0209233_1000001 | Ga0209233_1000001575 | 120 |
| 77 | 3300025914 | Ga0207671_10350979 | Ga0207671_103509792 | 120 |
| 78 | 3300027907 | Ga0207428_11040371 | Ga0207428_110403711 | 120 |
| 79 | 3300031548 | Ga0307408_100015791 | Ga0307408_1000157914 | 120 |
| 80 | 3300031731 | Ga0307405_10117806 | Ga0307405_101178062 | 120 |
| 81 | 3300031824 | Ga0307413_10084939 | Ga0307413_100849393 | 120 |
| 82 | 3300031852 | Ga0307410_11083223 | Ga0307410_110832232 | 120 |
| 83 | 3300031901 | Ga0307406_10679537 | Ga0307406_106795371 | 120 |
| 84 | 3300031903 | Ga0307407_10041438 | Ga0307407_100414384 | 120 |
| 85 | 3300032002 | Ga0307416_100517581 | Ga0307416_1005175813 | 120 |
| 86 | 3300032004 | Ga0307414_10446593 | Ga0307414_104465931 | 120 |
| 87 | 3300032005 | Ga0307411_10090170 | Ga0307411_100901703 | 120 |
| 88 | 3300032005 | Ga0307411_11582496 | Ga0307411_115824961 | 120 |
| 89 | 3300041443 | Ga0451789_1286349 | Ga0451789_1286349_66_434 | 120 |
| 90 | 3300041494 | Ga0451837_0275620 | Ga0451837_0275620_268_633 | 120 |
| 91 | 3300041498 | Ga0451841_0562518 | Ga0451841_0562518_206_574 | 120 |
| 92 | 3300041503 | Ga0451847_0140216 | Ga0451847_0140216_100_468 | 120 |
| 93 | 3300041509 | Ga0451843_0797638 | Ga0451843_0797638_173_541 | 120 |
| 94 | 3300042145 | Ga0450906_048511 | Ga0450906_048511_169_543 | 120 |
| 95 | 3300042876 | Ga0451577_0653749 | Ga0451577_0653749_465_830 | 120 |
| 96 | 3300044673 | Ga0453683_0053958 | Ga0453683_0053958_483_848 | 120 |
| 97 | 3300044683 | Ga0466965_0000016 | Ga0466965_0000016_34703_35068 | 120 |
| 98 | 3300046455 | Ga0495603_0355256 | Ga0495603_0355256_109_474 | 120 |
| 99 | 3300046473 | Ga0495582_0802875 | Ga0495582_0802875_75_440 | 120 |
| 100 | 3300046537 | Ga0495598_0416206 | Ga0495598_0416206_33_401 | 120 |
| 101 | 3300046683 | Ga0495658_0684990 | Ga0495658_0684990_24_389 | 120 |
| 102 | 3300048903 | Ga0496100_0060723 | Ga0496100_0060723_20_385 | 120 |
| 103 | 3300048904 | Ga0496101_0064914 | Ga0496101_0064914_1607_1972 | 120 |
| 104 | 3300048905 | Ga0496102_0163030 | Ga0496102_0163030_1340_1705 | 120 |
| 105 | 3300048906 | Ga0496103_0049332 | Ga0496103_0049332_1576_1941 | 120 |
| 106 | 3300048908 | Ga0496105_0134802 | Ga0496105_0134802_412_777 | 120 |
| 107 | 3300048910 | Ga0496107_0011513 | Ga0496107_0011513_1760_2125 | 120 |
| 108 | 3300048911 | Ga0496108_0202211 | Ga0496108_0202211_817_1182 | 120 |
| 109 | 3300048912 | Ga0496109_0110390 | Ga0496109_0110390_1896_2261 | 120 |
| 110 | 3300048912 | Ga0496109_1971554 | Ga0496109_1971554_17_385 | 120 |
| 111 | 3300048913 | Ga0496110_0109033 | Ga0496110_0109033_366_731 | 120 |
| 112 | 3300048913 | Ga0496110_0983943 | Ga0496110_0983943_112_480 | 120 |
| 113 | 3300048914 | Ga0496111_0064765 | Ga0496111_0064765_1585_1950 | 120 |
| 114 | 3300048915 | Ga0496112_0091055 | Ga0496112_0091055_208_573 | 120 |
| 115 | 3300048916 | Ga0496113_0065170 | Ga0496113_0065170_2365_2730 | 120 |
| 116 | 3300048917 | Ga0496114_0105577 | Ga0496114_0105577_1610_1975 | 120 |
| 117 | 3300048917 | Ga0496114_0267808 | Ga0496114_0267808_898_1266 | 120 |
| 118 | 3300048917 | Ga0496114_0394639 | Ga0496114_0394639_152_520 | 120 |
| 119 | 3300048918 | Ga0496115_0051666 | Ga0496115_0051666_2598_2963 | 120 |
| 120 | 3300048920 | Ga0496117_0107087 | Ga0496117_0107087_944_1318 | 120 |
| 121 | 3300048921 | Ga0496118_0055293 | Ga0496118_0055293_1057_1431 | 120 |
| 122 | 3300048923 | Ga0496120_0061739 | Ga0496120_0061739_1038_1403 | 120 |
| 123 | 3300048924 | Ga0496121_0003923 | Ga0496121_0003923_9615_9977 | 120 |
| 124 | 3300048925 | Ga0496122_0054789 | Ga0496122_0054789_1746_2120 | 120 |
| 125 | 3300048926 | Ga0496123_0009772 | Ga0496123_0009772_1217_1591 | 120 |
| 126 | 3300048927 | Ga0496124_0298588 | Ga0496124_0298588_87_461 | 120 |
| 127 | 3300048929 | Ga0496126_0027360 | Ga0496126_0027360_1269_1631 | 120 |
| 128 | 3300048929 | Ga0496126_0223397 | Ga0496126_0223397_127_501 | 120 |
| 129 | 3300049568 | Ga0501031_0540692 | Ga0501031_0540692_140_505 | 120 |
| 130 | 3300049569 | Ga0501032_0040496 | Ga0501032_0040496_2263_2628 | 120 |
| 131 | 3300049569 | Ga0501032_0757167 | Ga0501032_0757167_145_513 | 120 |
| 132 | 3300049570 | Ga0501033_0161417 | Ga0501033_0161417_477_845 | 120 |
| 133 | 3300049571 | Ga0501034_0827167 | Ga0501034_0827167_151_516 | 120 |
| 134 | 3300049573 | Ga0501037_0535650 | Ga0501037_0535650_29_394 | 120 |
| 135 | 3300049574 | Ga0501038_0172701 | Ga0501038_0172701_1297_1662 | 120 |
| 136 | 3300049575 | Ga0501039_0062359 | Ga0501039_0062359_1086_1451 | 120 |
| 137 | 3300049579 | Ga0501043_0294241 | Ga0501043_0294241_213_578 | 120 |
| 138 | 3300049580 | Ga0501046_0088447 | Ga0501046_0088447_57_425 | 120 |
| 139 | 3300049581 | Ga0501047_0270821 | Ga0501047_0270821_783_1151 | 120 |
| 140 | 3300049586 | Ga0501070_0049085 | Ga0501070_0049085_1793_2161 | 120 |
| 141 | 3300049822 | Ga0501035_0420223 | Ga0501035_0420223_199_564 | 120 |
| 142 | 3300049823 | Ga0501044_0138867 | Ga0501044_0138867_1135_1503 | 120 |
| 143 | 3300049823 | Ga0501044_0380440 | Ga0501044_0380440_397_762 | 120 |
| 144 | 3300050496 | nmdc:mga07m45_31881_c1 | nmdc:mga07m45_31881_c1_1263_1625 | 120 |
| 145 | 3300050511 | nmdc:mga08y16_827806_c1 | nmdc:mga08y16_827806_c1_228_593 | 120 |
| 146 | 3300054114 | Ga0501084_0435010 | Ga0501084_0435010_698_1063 | 120 |
| 147 | 3300001979 | JGI24740J21852_10001702 | JGI24740J21852_1000170210 | 121 |
| 148 | 3300001979 | JGI24740J21852_10049945 | JGI24740J21852_100499452 | 121 |
| 149 | 3300001989 | JGI24739J22299_10030520 | JGI24739J22299_100305203 | 121 |
| 150 | 3300001989 | JGI24739J22299_10241777 | JGI24739J22299_102417772 | 121 |
| 151 | 3300003578 | Ga0006562J51391_1096029 | Ga0006562J51391_10960295 | 121 |
| 152 | 3300003911 | JGI25405J52794_10167215 | JGI25405J52794_101672152 | 121 |
| 153 | 3300005327 | Ga0070658_10007993 | Ga0070658_1000799310 | 121 |
| 154 | 3300005327 | Ga0070658_10056365 | Ga0070658_100563652 | 121 |
| 155 | 3300005327 | Ga0070658_10118563 | Ga0070658_101185632 | 121 |
| 156 | 3300005327 | Ga0070658_10135184 | Ga0070658_101351842 | 121 |
| 157 | 3300005327 | Ga0070658_10138813 | Ga0070658_101388132 | 121 |
| 158 | 3300005328 | Ga0070676_10348733 | Ga0070676_103487332 | 121 |
| 159 | 3300005329 | Ga0070683_100263723 | Ga0070683_1002637232 | 121 |
| 160 | 3300005329 | Ga0070683_100307129 | Ga0070683_1003071291 | 121 |
| 161 | 3300005329 | Ga0070683_100508465 | Ga0070683_1005084653 | 121 |
| 162 | 3300005329 | Ga0070683_101123266 | Ga0070683_1011232662 | 121 |
| 163 | 3300005330 | Ga0070690_100166208 | Ga0070690_1001662082 | 121 |
| 164 | 3300005330 | Ga0070690_100556914 | Ga0070690_1005569141 | 121 |
| 165 | 3300005331 | Ga0070670_100403612 | Ga0070670_1004036121 | 121 |
| 166 | 3300005334 | Ga0068869_100324390 | Ga0068869_1003243902 | 121 |
| 167 | 3300005334 | Ga0068869_100500207 | Ga0068869_1005002072 | 121 |
| 168 | 3300005334 | Ga0068869_101787756 | Ga0068869_1017877561 | 121 |
| 169 | 3300005335 | Ga0070666_10196361 | Ga0070666_101963612 | 121 |
| 170 | 3300005335 | Ga0070666_11037913 | Ga0070666_110379131 | 121 |
| 171 | 3300005336 | Ga0070680_100298706 | Ga0070680_1002987062 | 121 |
| 172 | 3300005336 | Ga0070680_101248772 | Ga0070680_1012487722 | 121 |
| 173 | 3300005337 | Ga0070682_100009835 | Ga0070682_1000098355 | 121 |
| 174 | 3300005337 | Ga0070682_100062986 | Ga0070682_1000629863 | 121 |
| 175 | 3300005337 | Ga0070682_100105294 | Ga0070682_1001052942 | 121 |
| 176 | 3300005337 | Ga0070682_100469656 | Ga0070682_1004696562 | 121 |
| 177 | 3300005337 | Ga0070682_100637344 | Ga0070682_1006373442 | 121 |
| 178 | 3300005337 | Ga0070682_100991648 | Ga0070682_1009916482 | 121 |
| 179 | 3300005338 | Ga0068868_100528702 | Ga0068868_1005287022 | 121 |
| 180 | 3300005338 | Ga0068868_100802076 | Ga0068868_1008020762 | 121 |
| 181 | 3300005339 | Ga0070660_100018494 | Ga0070660_1000184947 | 121 |
| 182 | 3300005339 | Ga0070660_100060151 | Ga0070660_1000601514 | 121 |
| 183 | 3300005339 | Ga0070660_100178014 | Ga0070660_1001780142 | 121 |
| 184 | 3300005339 | Ga0070660_101072463 | Ga0070660_1010724631 | 121 |
| 185 | 3300005340 | Ga0070689_100112351 | Ga0070689_1001123513 | 121 |
| 186 | 3300005341 | Ga0070691_10015980 | Ga0070691_100159804 | 121 |
| 187 | 3300005341 | Ga0070691_10467729 | Ga0070691_104677292 | 121 |
| 188 | 3300005343 | Ga0070687_100249766 | Ga0070687_1002497661 | 121 |
| 189 | 3300005343 | Ga0070687_100876685 | Ga0070687_1008766852 | 121 |
| 190 | 3300005344 | Ga0070661_100012837 | Ga0070661_1000128375 | 121 |
| 191 | 3300005344 | Ga0070661_100489515 | Ga0070661_1004895152 | 121 |
| 192 | 3300005344 | Ga0070661_100620410 | Ga0070661_1006204102 | 121 |
| 193 | 3300005345 | Ga0070692_10158006 | Ga0070692_101580063 | 121 |
| 194 | 3300005345 | Ga0070692_10185682 | Ga0070692_101856822 | 121 |
| 195 | 3300005347 | Ga0070668_100385965 | Ga0070668_1003859652 | 121 |
| 196 | 3300005347 | Ga0070668_100437081 | Ga0070668_1004370812 | 121 |
| 197 | 3300005347 | Ga0070668_100499652 | Ga0070668_1004996523 | 121 |
| 198 | 3300005353 | Ga0070669_100274260 | Ga0070669_1002742602 | 121 |
| 199 | 3300005353 | Ga0070669_100721500 | Ga0070669_1007215002 | 121 |
| 200 | 3300005354 | Ga0070675_100387727 | Ga0070675_1003877272 | 121 |
| 201 | 3300005354 | Ga0070675_100707147 | Ga0070675_1007071472 | 121 |
| 202 | 3300005355 | Ga0070671_100066508 | Ga0070671_1000665084 | 121 |
| 203 | 3300005356 | Ga0070674_100088680 | Ga0070674_1000886804 | 121 |
| 204 | 3300005356 | Ga0070674_100174023 | Ga0070674_1001740232 | 121 |
| 205 | 3300005356 | Ga0070674_100477392 | Ga0070674_1004773922 | 121 |
| 206 | 3300005364 | Ga0070673_100076293 | Ga0070673_1000762932 | 121 |
| 207 | 3300005364 | Ga0070673_101354834 | Ga0070673_1013548342 | 121 |
| 208 | 3300005365 | Ga0070688_100479389 | Ga0070688_1004793892 | 121 |
| 209 | 3300005365 | Ga0070688_101400926 | Ga0070688_1014009262 | 121 |
| 210 | 3300005366 | Ga0070659_100000863 | Ga0070659_10000086326 | 121 |
| 211 | 3300005366 | Ga0070659_100151219 | Ga0070659_1001512192 | 121 |
| 212 | 3300005366 | Ga0070659_100855779 | Ga0070659_1008557792 | 121 |
| 213 | 3300005366 | Ga0070659_101694997 | Ga0070659_1016949971 | 121 |
| 214 | 3300005367 | Ga0070667_100030955 | Ga0070667_1000309554 | 121 |
| 215 | 3300005434 | Ga0070709_10609271 | Ga0070709_106092712 | 121 |
| 216 | 3300005434 | Ga0070709_11225659 | Ga0070709_112256591 | 121 |
| 217 | 3300005435 | Ga0070714_100033819 | Ga0070714_1000338194 | 121 |
| 218 | 3300005435 | Ga0070714_100466811 | Ga0070714_1004668112 | 121 |
| 219 | 3300005435 | Ga0070714_100473939 | Ga0070714_1004739392 | 121 |
| 220 | 3300005435 | Ga0070714_101831436 | Ga0070714_1018314361 | 121 |
| 221 | 3300005436 | Ga0070713_100032549 | Ga0070713_1000325491 | 121 |
| 222 | 3300005437 | Ga0070710_10628048 | Ga0070710_106280482 | 121 |
| 223 | 3300005437 | Ga0070710_11220522 | Ga0070710_112205221 | 121 |
| 224 | 3300005438 | Ga0070701_10029301 | Ga0070701_100293012 | 121 |
| 225 | 3300005439 | Ga0070711_100004587 | Ga0070711_1000045873 | 121 |
| 226 | 3300005439 | Ga0070711_101055046 | Ga0070711_1010550462 | 121 |
| 227 | 3300005439 | Ga0070711_101759420 | Ga0070711_1017594201 | 121 |
| 228 | 3300005440 | Ga0070705_100606615 | Ga0070705_1006066152 | 121 |
| 229 | 3300005441 | Ga0070700_100197780 | Ga0070700_1001977801 | 121 |
| 230 | 3300005441 | Ga0070700_100370534 | Ga0070700_1003705342 | 121 |
| 231 | 3300005441 | Ga0070700_100417604 | Ga0070700_1004176042 | 121 |
| 232 | 3300005441 | Ga0070700_100637639 | Ga0070700_1006376391 | 121 |
| 233 | 3300005444 | Ga0070694_100015894 | Ga0070694_1000158942 | 121 |
| 234 | 3300005444 | Ga0070694_100535408 | Ga0070694_1005354081 | 121 |
| 235 | 3300005445 | Ga0070708_100175445 | Ga0070708_1001754452 | 121 |
| 236 | 3300005455 | Ga0070663_100157623 | Ga0070663_1001576234 | 121 |
| 237 | 3300005455 | Ga0070663_101387941 | Ga0070663_1013879411 | 121 |
| 238 | 3300005456 | Ga0070678_100311470 | Ga0070678_1003114702 | 121 |
| 239 | 3300005456 | Ga0070678_102400080 | Ga0070678_1024000801 | 121 |
| 240 | 3300005457 | Ga0070662_100037264 | Ga0070662_1000372643 | 121 |
| 241 | 3300005457 | Ga0070662_100510230 | Ga0070662_1005102302 | 121 |
| 242 | 3300005457 | Ga0070662_100898434 | Ga0070662_1008984342 | 121 |
| 243 | 3300005458 | Ga0070681_11144103 | Ga0070681_111441031 | 121 |
| 244 | 3300005459 | Ga0068867_100114089 | Ga0068867_1001140893 | 121 |
| 245 | 3300005459 | Ga0068867_100421220 | Ga0068867_1004212202 | 121 |
| 246 | 3300005466 | Ga0070685_10058281 | Ga0070685_100582812 | 121 |
| 247 | 3300005466 | Ga0070685_10066899 | Ga0070685_100668991 | 121 |
| 248 | 3300005466 | Ga0070685_10564111 | Ga0070685_105641112 | 121 |
| 249 | 3300005467 | Ga0070706_100435330 | Ga0070706_1004353302 | 121 |
| 250 | 3300005518 | Ga0070699_100296728 | Ga0070699_1002967282 | 121 |
| 251 | 3300005530 | Ga0070679_100547796 | Ga0070679_1005477962 | 121 |
| 252 | 3300005530 | Ga0070679_100729066 | Ga0070679_1007290662 | 121 |
| 253 | 3300005535 | Ga0070684_100001103 | Ga0070684_10000110310 | 121 |
| 254 | 3300005535 | Ga0070684_100002388 | Ga0070684_1000023882 | 121 |
| 255 | 3300005539 | Ga0068853_100006583 | Ga0068853_1000065839 | 121 |
| 256 | 3300005539 | Ga0068853_100059888 | Ga0068853_1000598882 | 121 |
| 257 | 3300005539 | Ga0068853_100216380 | Ga0068853_1002163803 | 121 |
| 258 | 3300005539 | Ga0068853_100666422 | Ga0068853_1006664222 | 121 |
| 259 | 3300005543 | Ga0070672_100189874 | Ga0070672_1001898743 | 121 |
| 260 | 3300005543 | Ga0070672_100456964 | Ga0070672_1004569642 | 121 |
| 261 | 3300005543 | Ga0070672_100496916 | Ga0070672_1004969163 | 121 |
| 262 | 3300005544 | Ga0070686_100433319 | Ga0070686_1004333192 | 121 |
| 263 | 3300005545 | Ga0070695_100598073 | Ga0070695_1005980732 | 121 |
| 264 | 3300005546 | Ga0070696_100104735 | Ga0070696_1001047352 | 121 |
| 265 | 3300005546 | Ga0070696_100311037 | Ga0070696_1003110372 | 121 |
| 266 | 3300005546 | Ga0070696_101349092 | Ga0070696_1013490921 | 121 |
| 267 | 3300005547 | Ga0070693_100074539 | Ga0070693_1000745392 | 121 |
| 268 | 3300005547 | Ga0070693_100114455 | Ga0070693_1001144552 | 121 |
| 269 | 3300005548 | Ga0070665_100253572 | Ga0070665_1002535723 | 121 |
| 270 | 3300005548 | Ga0070665_100577842 | Ga0070665_1005778423 | 121 |
| 271 | 3300005548 | Ga0070665_101257530 | Ga0070665_1012575302 | 121 |
| 272 | 3300005549 | Ga0070704_100164776 | Ga0070704_1001647762 | 121 |
| 273 | 3300005549 | Ga0070704_101858764 | Ga0070704_1018587642 | 121 |
| 274 | 3300005549 | Ga0070704_101873800 | Ga0070704_1018738001 | 121 |
| 275 | 3300005563 | Ga0068855_100258065 | Ga0068855_1002580652 | 121 |
| 276 | 3300005563 | Ga0068855_101814449 | Ga0068855_1018144492 | 121 |
| 277 | 3300005564 | Ga0070664_100136572 | Ga0070664_1001365723 | 121 |
| 278 | 3300005577 | Ga0068857_100001573 | Ga0068857_10000157320 | 121 |
| 279 | 3300005577 | Ga0068857_100014391 | Ga0068857_1000143915 | 121 |
| 280 | 3300005577 | Ga0068857_100091617 | Ga0068857_1000916174 | 121 |
| 281 | 3300005578 | Ga0068854_100014310 | Ga0068854_1000143104 | 121 |
| 282 | 3300005578 | Ga0068854_100655850 | Ga0068854_1006558502 | 121 |
| 283 | 3300005614 | Ga0068856_100036544 | Ga0068856_1000365445 | 121 |
| 284 | 3300005614 | Ga0068856_100036931 | Ga0068856_1000369316 | 121 |
| 285 | 3300005614 | Ga0068856_100178550 | Ga0068856_1001785505 | 121 |
| 286 | 3300005614 | Ga0068856_100349140 | Ga0068856_1003491403 | 121 |
| 287 | 3300005614 | Ga0068856_100623165 | Ga0068856_1006231652 | 121 |
| 288 | 3300005615 | Ga0070702_100125631 | Ga0070702_1001256312 | 121 |
| 289 | 3300005615 | Ga0070702_100187117 | Ga0070702_1001871172 | 121 |
| 290 | 3300005616 | Ga0068852_100000597 | Ga0068852_10000059711 | 121 |
| 291 | 3300005616 | Ga0068852_100048864 | Ga0068852_1000488642 | 121 |
| 292 | 3300005616 | Ga0068852_100079677 | Ga0068852_1000796774 | 121 |
| 293 | 3300005616 | Ga0068852_100251785 | Ga0068852_1002517852 | 121 |
| 294 | 3300005616 | Ga0068852_101247754 | Ga0068852_1012477542 | 121 |
| 295 | 3300005617 | Ga0068859_100131751 | Ga0068859_1001317512 | 121 |
| 296 | 3300005618 | Ga0068864_100008378 | Ga0068864_1000083785 | 121 |
| 297 | 3300005618 | Ga0068864_100105778 | Ga0068864_1001057785 | 121 |
| 298 | 3300005718 | Ga0068866_10035542 | Ga0068866_100355423 | 121 |
| 299 | 3300005718 | Ga0068866_10156972 | Ga0068866_101569722 | 121 |
| 300 | 3300005718 | Ga0068866_10325107 | Ga0068866_103251072 | 121 |
| 301 | 3300005719 | Ga0068861_100227597 | Ga0068861_1002275972 | 121 |
| 302 | 3300005719 | Ga0068861_100493125 | Ga0068861_1004931253 | 121 |
| 303 | 3300005719 | Ga0068861_101210994 | Ga0068861_1012109942 | 121 |
| 304 | 3300005834 | Ga0068851_10000020 | Ga0068851_1000002052 | 121 |
| 305 | 3300005834 | Ga0068851_10482748 | Ga0068851_104827482 | 121 |
| 306 | 3300005840 | Ga0068870_10148610 | Ga0068870_101486102 | 121 |
| 307 | 3300005841 | Ga0068863_100309046 | Ga0068863_1003090462 | 121 |
| 308 | 3300005841 | Ga0068863_101396625 | Ga0068863_1013966252 | 121 |
| 309 | 3300005842 | Ga0068858_100000233 | Ga0068858_10000023330 | 121 |
| 310 | 3300005842 | Ga0068858_100587726 | Ga0068858_1005877262 | 121 |
| 311 | 3300005842 | Ga0068858_101660799 | Ga0068858_1016607992 | 121 |
| 312 | 3300005844 | Ga0068862_100354671 | Ga0068862_1003546713 | 121 |
| 313 | 3300005937 | Ga0081455_10001475 | Ga0081455_1000147530 | 121 |
| 314 | 3300005937 | Ga0081455_10005778 | Ga0081455_100057786 | 121 |
| 315 | 3300005937 | Ga0081455_10009290 | Ga0081455_100092902 | 121 |
| 316 | 3300005937 | Ga0081455_10111098 | Ga0081455_101110982 | 121 |
| 317 | 3300005983 | Ga0081540_1000051 | Ga0081540_1000051125 | 121 |
| 318 | 3300006028 | Ga0070717_10159243 | Ga0070717_101592432 | 121 |
| 319 | 3300006038 | Ga0075365_10318441 | Ga0075365_103184412 | 121 |
| 320 | 3300006042 | Ga0075368_10036445 | Ga0075368_100364453 | 121 |
| 321 | 3300006048 | Ga0075363_100730336 | Ga0075363_1007303362 | 121 |
| 322 | 3300006048 | Ga0075363_101042222 | Ga0075363_1010422222 | 121 |
| 323 | 3300006051 | Ga0075364_10045196 | Ga0075364_100451962 | 121 |
| 324 | 3300006051 | Ga0075364_10421120 | Ga0075364_104211202 | 121 |
| 325 | 3300006058 | Ga0075432_10000136 | Ga0075432_1000013618 | 121 |
| 326 | 3300006058 | Ga0075432_10002406 | Ga0075432_100024066 | 121 |
| 327 | 3300006173 | Ga0070716_100029558 | Ga0070716_1000295582 | 121 |
| 328 | 3300006173 | Ga0070716_100106037 | Ga0070716_1001060375 | 121 |
| 329 | 3300006175 | Ga0070712_100008557 | Ga0070712_1000085572 | 121 |
| 330 | 3300006175 | Ga0070712_100025252 | Ga0070712_1000252524 | 121 |
| 331 | 3300006175 | Ga0070712_100682729 | Ga0070712_1006827292 | 121 |
| 332 | 3300006175 | Ga0070712_101717600 | Ga0070712_1017176002 | 121 |
| 333 | 3300006178 | Ga0075367_10082328 | Ga0075367_100823282 | 121 |
| 334 | 3300006186 | Ga0075369_10075257 | Ga0075369_100752572 | 121 |
| 335 | 3300006186 | Ga0075369_10129325 | Ga0075369_101293253 | 121 |
| 336 | 3300006237 | Ga0097621_100518667 | Ga0097621_1005186672 | 121 |
| 337 | 3300006237 | Ga0097621_100561538 | Ga0097621_1005615382 | 121 |
| 338 | 3300006237 | Ga0097621_101426630 | Ga0097621_1014266302 | 121 |
| 339 | 3300006358 | Ga0068871_101005833 | Ga0068871_1010058332 | 121 |
| 340 | 3300006358 | Ga0068871_101580778 | Ga0068871_1015807782 | 121 |
| 341 | 3300006844 | Ga0075428_100075810 | Ga0075428_1000758101 | 121 |
| 342 | 3300006844 | Ga0075428_100922769 | Ga0075428_1009227692 | 121 |
| 343 | 3300006846 | Ga0075430_100341679 | Ga0075430_1003416792 | 121 |
| 344 | 3300006847 | Ga0075431_100984329 | Ga0075431_1009843292 | 121 |
| 345 | 3300006852 | Ga0075433_10005449 | Ga0075433_100054498 | 121 |
| 346 | 3300006852 | Ga0075433_10007152 | Ga0075433_100071527 | 121 |
| 347 | 3300006871 | Ga0075434_100004021 | Ga0075434_10000402114 | 121 |
| 348 | 3300006871 | Ga0075434_100015459 | Ga0075434_1000154596 | 121 |
| 349 | 3300006871 | Ga0075434_100162022 | Ga0075434_1001620222 | 121 |
| 350 | 3300006871 | Ga0075434_101498932 | Ga0075434_1014989322 | 121 |
| 351 | 3300006880 | Ga0075429_100099381 | Ga0075429_1000993815 | 121 |
| 352 | 3300006881 | Ga0068865_100029131 | Ga0068865_1000291313 | 121 |
| 353 | 3300006881 | Ga0068865_100075309 | Ga0068865_1000753093 | 121 |
| 354 | 3300006881 | Ga0068865_100110050 | Ga0068865_1001100503 | 121 |
| 355 | 3300006914 | Ga0075436_100001576 | Ga0075436_10000157614 | 121 |
| 356 | 3300006914 | Ga0075436_100302031 | Ga0075436_1003020312 | 121 |
| 357 | 3300006931 | Ga0097620_100131762 | Ga0097620_1001317622 | 121 |
| 358 | 3300007076 | Ga0075435_100010337 | Ga0075435_1000103376 | 121 |
| 359 | 3300007076 | Ga0075435_100044819 | Ga0075435_1000448193 | 121 |
| 360 | 3300009093 | Ga0105240_10186255 | Ga0105240_101862553 | 121 |
| 361 | 3300009093 | Ga0105240_10239816 | Ga0105240_102398163 | 121 |
| 362 | 3300009093 | Ga0105240_10450382 | Ga0105240_104503822 | 121 |
| 363 | 3300009093 | Ga0105240_10813681 | Ga0105240_108136812 | 121 |
| 364 | 3300009094 | Ga0111539_10001727 | Ga0111539_1000172740 | 121 |
| 365 | 3300009094 | Ga0111539_10049845 | Ga0111539_100498458 | 121 |
| 366 | 3300009094 | Ga0111539_12044160 | Ga0111539_120441602 | 121 |
| 367 | 3300009098 | Ga0105245_10003836 | Ga0105245_100038368 | 121 |
| 368 | 3300009098 | Ga0105245_10117363 | Ga0105245_101173633 | 121 |
| 369 | 3300009098 | Ga0105245_10210002 | Ga0105245_102100022 | 121 |
| 370 | 3300009098 | Ga0105245_10333868 | Ga0105245_103338681 | 121 |
| 371 | 3300009098 | Ga0105245_10726273 | Ga0105245_107262732 | 121 |
| 372 | 3300009098 | Ga0105245_11201862 | Ga0105245_112018622 | 121 |
| 373 | 3300009101 | Ga0105247_10106159 | Ga0105247_101061593 | 121 |
| 374 | 3300009101 | Ga0105247_10349118 | Ga0105247_103491182 | 121 |
| 375 | 3300009101 | Ga0105247_10406399 | Ga0105247_104063992 | 121 |
| 376 | 3300009101 | Ga0105247_10654935 | Ga0105247_106549352 | 121 |
| 377 | 3300009147 | Ga0114129_10018326 | Ga0114129_1001832613 | 121 |
| 378 | 3300009147 | Ga0114129_11904435 | Ga0114129_119044352 | 121 |
| 379 | 3300009148 | Ga0105243_10038474 | Ga0105243_100384742 | 121 |
| 380 | 3300009148 | Ga0105243_10060820 | Ga0105243_100608203 | 121 |
| 381 | 3300009148 | Ga0105243_10068606 | Ga0105243_100686063 | 121 |
| 382 | 3300009148 | Ga0105243_10251316 | Ga0105243_102513161 | 121 |
| 383 | 3300009148 | Ga0105243_10514474 | Ga0105243_105144742 | 121 |
| 384 | 3300009148 | Ga0105243_11329718 | Ga0105243_113297182 | 121 |
| 385 | 3300009174 | Ga0105241_10689295 | Ga0105241_106892952 | 121 |
| 386 | 3300009176 | Ga0105242_10719661 | Ga0105242_107196612 | 121 |
| 387 | 3300009176 | Ga0105242_10840842 | Ga0105242_108408422 | 121 |
| 388 | 3300009176 | Ga0105242_10959733 | Ga0105242_109597332 | 121 |
| 389 | 3300009176 | Ga0105242_10974875 | Ga0105242_109748752 | 121 |
| 390 | 3300009176 | Ga0105242_11326578 | Ga0105242_113265782 | 121 |
| 391 | 3300009176 | Ga0105242_11485796 | Ga0105242_114857962 | 121 |
| 392 | 3300009176 | Ga0105242_12139855 | Ga0105242_121398552 | 121 |
| 393 | 3300009177 | Ga0105248_10000714 | Ga0105248_100007148 | 121 |
| 394 | 3300009177 | Ga0105248_10124344 | Ga0105248_101243442 | 121 |
| 395 | 3300009177 | Ga0105248_10779460 | Ga0105248_107794602 | 121 |
| 396 | 3300009177 | Ga0105248_11173624 | Ga0105248_111736242 | 121 |
| 397 | 3300009545 | Ga0105237_10004850 | Ga0105237_100048506 | 121 |
| 398 | 3300009545 | Ga0105237_10017606 | Ga0105237_100176063 | 121 |
| 399 | 3300009545 | Ga0105237_10342803 | Ga0105237_103428031 | 121 |
| 400 | 3300009545 | Ga0105237_11637515 | Ga0105237_116375151 | 121 |
| 401 | 3300009545 | Ga0105237_12213485 | Ga0105237_122134852 | 121 |
| 402 | 3300009551 | Ga0105238_10025081 | Ga0105238_100250814 | 121 |
| 403 | 3300009551 | Ga0105238_10671091 | Ga0105238_106710913 | 121 |
| 404 | 3300009551 | Ga0105238_10798224 | Ga0105238_107982242 | 121 |
| 405 | 3300009551 | Ga0105238_10802593 | Ga0105238_108025932 | 121 |
| 406 | 3300009551 | Ga0105238_11973357 | Ga0105238_119733572 | 121 |
| 407 | 3300009553 | Ga0105249_10062245 | Ga0105249_100622455 | 121 |
| 408 | 3300009553 | Ga0105249_11116102 | Ga0105249_111161022 | 121 |
| 409 | 3300009553 | Ga0105249_11792198 | Ga0105249_117921982 | 121 |
| 410 | 3300010375 | Ga0105239_10025612 | Ga0105239_100256125 | 121 |
| 411 | 3300010375 | Ga0105239_10199323 | Ga0105239_101993234 | 121 |
| 412 | 3300010375 | Ga0105239_11720509 | Ga0105239_117205092 | 121 |
| 413 | 3300011119 | Ga0105246_10003686 | Ga0105246_100036866 | 121 |
| 414 | 3300011119 | Ga0105246_10015493 | Ga0105246_100154935 | 121 |
| 415 | 3300011119 | Ga0105246_11984245 | Ga0105246_119842452 | 121 |
| 416 | 3300012473 | Ga0157340_1001221 | Ga0157340_10012212 | 121 |
| 417 | 3300012481 | Ga0157320_1005023 | Ga0157320_10050232 | 121 |
| 418 | 3300012482 | Ga0157318_1016339 | Ga0157318_10163392 | 121 |
| 419 | 3300012483 | Ga0157337_1006937 | Ga0157337_10069372 | 121 |
| 420 | 3300012488 | Ga0157343_1013878 | Ga0157343_10138782 | 121 |
| 421 | 3300012490 | Ga0157322_1005288 | Ga0157322_10052882 | 121 |
| 422 | 3300012491 | Ga0157329_1008807 | Ga0157329_10088072 | 121 |
| 423 | 3300012497 | Ga0157319_1017147 | Ga0157319_10171472 | 121 |
| 424 | 3300012498 | Ga0157345_1013134 | Ga0157345_10131342 | 121 |
| 425 | 3300012500 | Ga0157314_1003428 | Ga0157314_10034282 | 121 |
| 426 | 3300012507 | Ga0157342_1007024 | Ga0157342_10070243 | 121 |
| 427 | 3300012508 | Ga0157315_1006045 | Ga0157315_10060452 | 121 |
| 428 | 3300012510 | Ga0157316_1000680 | Ga0157316_10006803 | 121 |
| 429 | 3300012515 | Ga0157338_1019928 | Ga0157338_10199282 | 121 |
| 430 | 3300013100 | Ga0157373_10044700 | Ga0157373_100447002 | 121 |
| 431 | 3300013102 | Ga0157371_10003246 | Ga0157371_1000324613 | 121 |
| 432 | 3300013102 | Ga0157371_10056380 | Ga0157371_100563802 | 121 |
| 433 | 3300013102 | Ga0157371_10420247 | Ga0157371_104202472 | 121 |
| 434 | 3300013102 | Ga0157371_10575141 | Ga0157371_105751412 | 121 |
| 435 | 3300013104 | Ga0157370_10210527 | Ga0157370_102105273 | 121 |
| 436 | 3300013104 | Ga0157370_11638624 | Ga0157370_116386241 | 121 |
| 437 | 3300013105 | Ga0157369_10000356 | Ga0157369_100003562 | 121 |
| 438 | 3300013105 | Ga0157369_10249574 | Ga0157369_102495742 | 121 |
| 439 | 3300013105 | Ga0157369_10532775 | Ga0157369_105327752 | 121 |
| 440 | 3300013105 | Ga0157369_11057607 | Ga0157369_110576072 | 121 |
| 441 | 3300013105 | Ga0157369_11825763 | Ga0157369_118257631 | 121 |
| 442 | 3300013296 | Ga0157374_10211363 | Ga0157374_102113633 | 121 |
| 443 | 3300013296 | Ga0157374_10574927 | Ga0157374_105749271 | 121 |
| 444 | 3300013297 | Ga0157378_10649626 | Ga0157378_106496262 | 121 |
| 445 | 3300013297 | Ga0157378_10790561 | Ga0157378_107905612 | 121 |
| 446 | 3300013297 | Ga0157378_12182629 | Ga0157378_121826292 | 121 |
| 447 | 3300013306 | Ga0163162_10104782 | Ga0163162_101047825 | 121 |
| 448 | 3300013306 | Ga0163162_10138023 | Ga0163162_101380232 | 121 |
| 449 | 3300013306 | Ga0163162_10335330 | Ga0163162_103353302 | 121 |
| 450 | 3300013306 | Ga0163162_10405006 | Ga0163162_104050063 | 121 |
| 451 | 3300013306 | Ga0163162_10809828 | Ga0163162_108098283 | 121 |
| 452 | 3300013306 | Ga0163162_11501573 | Ga0163162_115015732 | 121 |
| 453 | 3300013307 | Ga0157372_10004567 | Ga0157372_100045675 | 121 |
| 454 | 3300013307 | Ga0157372_10077075 | Ga0157372_100770754 | 121 |
| 455 | 3300013307 | Ga0157372_10221925 | Ga0157372_102219253 | 121 |
| 456 | 3300013307 | Ga0157372_10449594 | Ga0157372_104495942 | 121 |
| 457 | 3300013307 | Ga0157372_12374444 | Ga0157372_123744442 | 121 |
| 458 | 3300013307 | Ga0157372_12432769 | Ga0157372_124327691 | 121 |
| 459 | 3300013307 | Ga0157372_12512721 | Ga0157372_125127211 | 121 |
| 460 | 3300013308 | Ga0157375_10004900 | Ga0157375_100049005 | 121 |
| 461 | 3300013308 | Ga0157375_10276183 | Ga0157375_102761833 | 121 |
| 462 | 3300013308 | Ga0157375_10378896 | Ga0157375_103788962 | 121 |
| 463 | 3300013308 | Ga0157375_10714588 | Ga0157375_107145883 | 121 |
| 464 | 3300013308 | Ga0157375_10789082 | Ga0157375_107890823 | 121 |
| 465 | 3300013308 | Ga0157375_12870329 | Ga0157375_128703291 | 121 |
| 466 | 3300014325 | Ga0163163_10098983 | Ga0163163_100989834 | 121 |
| 467 | 3300014325 | Ga0163163_10234479 | Ga0163163_102344792 | 121 |
| 468 | 3300014325 | Ga0163163_10327849 | Ga0163163_103278493 | 121 |
| 469 | 3300014325 | Ga0163163_10400000 | Ga0163163_104000003 | 121 |
| 470 | 3300014325 | Ga0163163_13020501 | Ga0163163_130205011 | 121 |
| 471 | 3300014326 | Ga0157380_10185669 | Ga0157380_101856692 | 121 |
| 472 | 3300014326 | Ga0157380_10397255 | Ga0157380_103972552 | 121 |
| 473 | 3300014326 | Ga0157380_10920471 | Ga0157380_109204712 | 121 |
| 474 | 3300014326 | Ga0157380_11026023 | Ga0157380_110260232 | 121 |
| 475 | 3300014326 | Ga0157380_11431003 | Ga0157380_114310032 | 121 |
| 476 | 3300014326 | Ga0157380_11727725 | Ga0157380_117277251 | 121 |
| 477 | 3300014326 | Ga0157380_12014725 | Ga0157380_120147251 | 121 |
| 478 | 3300014745 | Ga0157377_10296253 | Ga0157377_102962532 | 121 |
| 479 | 3300014745 | Ga0157377_10361854 | Ga0157377_103618542 | 121 |
| 480 | 3300014968 | Ga0157379_10003043 | Ga0157379_100030434 | 121 |
| 481 | 3300014968 | Ga0157379_10005293 | Ga0157379_1000529310 | 121 |
| 482 | 3300014968 | Ga0157379_10017466 | Ga0157379_100174665 | 121 |
| 483 | 3300014968 | Ga0157379_10240080 | Ga0157379_102400802 | 121 |
| 484 | 3300014968 | Ga0157379_10787179 | Ga0157379_107871792 | 121 |
| 485 | 3300014969 | Ga0157376_10334593 | Ga0157376_103345932 | 121 |
| 486 | 3300014969 | Ga0157376_10838136 | Ga0157376_108381362 | 121 |
| 487 | 3300014969 | Ga0157376_11259618 | Ga0157376_112596181 | 121 |
| 488 | 3300017792 | Ga0163161_10098660 | Ga0163161_100986604 | 121 |
| 489 | 3300017792 | Ga0163161_10185510 | Ga0163161_101855102 | 121 |
| 490 | 3300017792 | Ga0163161_10221502 | Ga0163161_102215022 | 121 |
| 491 | 3300020069 | Ga0197907_10557023 | Ga0197907_105570232 | 121 |
| 492 | 3300020069 | Ga0197907_10825227 | Ga0197907_108252272 | 121 |
| 493 | 3300020070 | Ga0206356_10605762 | Ga0206356_106057622 | 121 |
| 494 | 3300020077 | Ga0206351_10698115 | Ga0206351_106981152 | 121 |
| 495 | 3300020080 | Ga0206350_10376196 | Ga0206350_103761963 | 121 |
| 496 | 3300020081 | Ga0206354_10711242 | Ga0206354_107112422 | 121 |
| 497 | 3300020081 | Ga0206354_11605514 | Ga0206354_116055141 | 121 |
| 498 | 3300020082 | Ga0206353_11910771 | Ga0206353_119107715 | 121 |
| 499 | 3300020082 | Ga0206353_11952588 | Ga0206353_119525882 | 121 |
| 500 | 3300022467 | Ga0224712_10079355 | Ga0224712_100793552 | 121 |
| 501 | 3300025226 | Ga0209674_116786 | Ga0209674_1167862 | 121 |
| 502 | 3300025245 | Ga0207425_1019162 | Ga0207425_10191621 | 121 |
| 503 | 3300025253 | Ga0209677_101239 | Ga0209677_10123911 | 121 |
| 504 | 3300025258 | Ga0209129_1000047 | Ga0209129_100004788 | 121 |
| 505 | 3300025294 | Ga0209025_1005871 | Ga0209025_10058714 | 121 |
| 506 | 3300025321 | Ga0207656_10000012 | Ga0207656_1000001227 | 121 |
| 507 | 3300025321 | Ga0207656_10332594 | Ga0207656_103325942 | 121 |
| 508 | 3300025885 | Ga0207653_10011989 | Ga0207653_100119893 | 121 |
| 509 | 3300025898 | Ga0207692_10013072 | Ga0207692_100130724 | 121 |
| 510 | 3300025898 | Ga0207692_10018048 | Ga0207692_100180483 | 121 |
| 511 | 3300025898 | Ga0207692_10044198 | Ga0207692_100441983 | 121 |
| 512 | 3300025899 | Ga0207642_10031172 | Ga0207642_100311722 | 121 |
| 513 | 3300025899 | Ga0207642_10051070 | Ga0207642_100510702 | 121 |
| 514 | 3300025899 | Ga0207642_10597308 | Ga0207642_105973082 | 121 |
| 515 | 3300025900 | Ga0207710_10027788 | Ga0207710_100277882 | 121 |
| 516 | 3300025900 | Ga0207710_10041006 | Ga0207710_100410063 | 121 |
| 517 | 3300025900 | Ga0207710_10285023 | Ga0207710_102850232 | 121 |
| 518 | 3300025900 | Ga0207710_10419779 | Ga0207710_104197792 | 121 |
| 519 | 3300025900 | Ga0207710_10578528 | Ga0207710_105785282 | 121 |
| 520 | 3300025901 | Ga0207688_10018593 | Ga0207688_100185934 | 121 |
| 521 | 3300025901 | Ga0207688_10094911 | Ga0207688_100949112 | 121 |
| 522 | 3300025901 | Ga0207688_10162278 | Ga0207688_101622782 | 121 |
| 523 | 3300025901 | Ga0207688_10762337 | Ga0207688_107623371 | 121 |
| 524 | 3300025903 | Ga0207680_10400175 | Ga0207680_104001752 | 121 |
| 525 | 3300025903 | Ga0207680_10519559 | Ga0207680_105195592 | 121 |
| 526 | 3300025904 | Ga0207647_10088566 | Ga0207647_100885664 | 121 |
| 527 | 3300025905 | Ga0207685_10011766 | Ga0207685_100117663 | 121 |
| 528 | 3300025906 | Ga0207699_10003399 | Ga0207699_100033995 | 121 |
| 529 | 3300025906 | Ga0207699_10164054 | Ga0207699_101640542 | 121 |
| 530 | 3300025908 | Ga0207643_10082713 | Ga0207643_100827132 | 121 |
| 531 | 3300025909 | Ga0207705_10013430 | Ga0207705_100134308 | 121 |
| 532 | 3300025909 | Ga0207705_10039084 | Ga0207705_100390844 | 121 |
| 533 | 3300025909 | Ga0207705_10048348 | Ga0207705_100483481 | 121 |
| 534 | 3300025909 | Ga0207705_10068281 | Ga0207705_100682811 | 121 |
| 535 | 3300025909 | Ga0207705_10077282 | Ga0207705_100772822 | 121 |
| 536 | 3300025909 | Ga0207705_10101254 | Ga0207705_101012542 | 121 |
| 537 | 3300025912 | Ga0207707_10183231 | Ga0207707_101832312 | 121 |
| 538 | 3300025913 | Ga0207695_10008321 | Ga0207695_100083215 | 121 |
| 539 | 3300025913 | Ga0207695_10525711 | Ga0207695_105257111 | 121 |
| 540 | 3300025913 | Ga0207695_11020018 | Ga0207695_110200182 | 121 |
| 541 | 3300025914 | Ga0207671_10000002 | Ga0207671_10000002135 | 121 |
| 542 | 3300025914 | Ga0207671_10056397 | Ga0207671_100563974 | 121 |
| 543 | 3300025915 | Ga0207693_10006333 | Ga0207693_100063337 | 121 |
| 544 | 3300025916 | Ga0207663_10021359 | Ga0207663_100213594 | 121 |
| 545 | 3300025918 | Ga0207662_10061831 | Ga0207662_100618312 | 121 |
| 546 | 3300025918 | Ga0207662_10693281 | Ga0207662_106932812 | 121 |
| 547 | 3300025918 | Ga0207662_11052102 | Ga0207662_110521021 | 121 |
| 548 | 3300025919 | Ga0207657_10004024 | Ga0207657_1000402415 | 121 |
| 549 | 3300025919 | Ga0207657_10025831 | Ga0207657_100258312 | 121 |
| 550 | 3300025919 | Ga0207657_10067466 | Ga0207657_100674664 | 121 |
| 551 | 3300025919 | Ga0207657_10911982 | Ga0207657_109119822 | 121 |
| 552 | 3300025920 | Ga0207649_10038640 | Ga0207649_100386407 | 121 |
| 553 | 3300025920 | Ga0207649_10128504 | Ga0207649_101285042 | 121 |
| 554 | 3300025920 | Ga0207649_10202859 | Ga0207649_102028592 | 121 |
| 555 | 3300025921 | Ga0207652_10531999 | Ga0207652_105319992 | 121 |
| 556 | 3300025921 | Ga0207652_10757483 | Ga0207652_107574831 | 121 |
| 557 | 3300025923 | Ga0207681_10321877 | Ga0207681_103218772 | 121 |
| 558 | 3300025924 | Ga0207694_10000433 | Ga0207694_1000043313 | 121 |
| 559 | 3300025924 | Ga0207694_10690380 | Ga0207694_106903802 | 121 |
| 560 | 3300025924 | Ga0207694_11017336 | Ga0207694_110173362 | 121 |
| 561 | 3300025926 | Ga0207659_10179001 | Ga0207659_101790013 | 121 |
| 562 | 3300025927 | Ga0207687_10015948 | Ga0207687_100159485 | 121 |
| 563 | 3300025927 | Ga0207687_10239696 | Ga0207687_102396963 | 121 |
| 564 | 3300025927 | Ga0207687_10349185 | Ga0207687_103491852 | 121 |
| 565 | 3300025927 | Ga0207687_10374773 | Ga0207687_103747731 | 121 |
| 566 | 3300025927 | Ga0207687_10977145 | Ga0207687_109771452 | 121 |
| 567 | 3300025928 | Ga0207700_10004680 | Ga0207700_100046806 | 121 |
| 568 | 3300025928 | Ga0207700_10012617 | Ga0207700_100126174 | 121 |
| 569 | 3300025928 | Ga0207700_10327400 | Ga0207700_103274002 | 121 |
| 570 | 3300025929 | Ga0207664_10012310 | Ga0207664_100123104 | 121 |
| 571 | 3300025929 | Ga0207664_10016720 | Ga0207664_100167205 | 121 |
| 572 | 3300025929 | Ga0207664_11754587 | Ga0207664_117545871 | 121 |
| 573 | 3300025931 | Ga0207644_10126877 | Ga0207644_101268772 | 121 |
| 574 | 3300025932 | Ga0207690_10000690 | Ga0207690_100006902 | 121 |
| 575 | 3300025932 | Ga0207690_10059613 | Ga0207690_100596132 | 121 |
| 576 | 3300025932 | Ga0207690_11572467 | Ga0207690_115724672 | 121 |
| 577 | 3300025933 | Ga0207706_10067163 | Ga0207706_100671632 | 121 |
| 578 | 3300025933 | Ga0207706_10182308 | Ga0207706_101823082 | 121 |
| 579 | 3300025933 | Ga0207706_11098540 | Ga0207706_110985402 | 121 |
| 580 | 3300025934 | Ga0207686_10138383 | Ga0207686_101383832 | 121 |
| 581 | 3300025934 | Ga0207686_11650509 | Ga0207686_116505092 | 121 |
| 582 | 3300025935 | Ga0207709_10123794 | Ga0207709_101237943 | 121 |
| 583 | 3300025935 | Ga0207709_10230553 | Ga0207709_102305532 | 121 |
| 584 | 3300025935 | Ga0207709_10352947 | Ga0207709_103529472 | 121 |
| 585 | 3300025935 | Ga0207709_11674224 | Ga0207709_116742241 | 121 |
| 586 | 3300025936 | Ga0207670_10132602 | Ga0207670_101326023 | 121 |
| 587 | 3300025937 | Ga0207669_10502704 | Ga0207669_105027042 | 121 |
| 588 | 3300025937 | Ga0207669_11761622 | Ga0207669_117616222 | 121 |
| 589 | 3300025938 | Ga0207704_10200751 | Ga0207704_102007512 | 121 |
| 590 | 3300025938 | Ga0207704_11259609 | Ga0207704_112596092 | 121 |
| 591 | 3300025939 | Ga0207665_10010148 | Ga0207665_100101483 | 121 |
| 592 | 3300025939 | Ga0207665_10078675 | Ga0207665_100786752 | 121 |
| 593 | 3300025939 | Ga0207665_11345684 | Ga0207665_113456841 | 121 |
| 594 | 3300025940 | Ga0207691_10073900 | Ga0207691_100739003 | 121 |
| 595 | 3300025940 | Ga0207691_10221732 | Ga0207691_102217322 | 121 |
| 596 | 3300025940 | Ga0207691_10371589 | Ga0207691_103715892 | 121 |
| 597 | 3300025940 | Ga0207691_11196157 | Ga0207691_111961572 | 121 |
| 598 | 3300025941 | Ga0207711_10001344 | Ga0207711_1000134422 | 121 |
| 599 | 3300025941 | Ga0207711_10150846 | Ga0207711_101508463 | 121 |
| 600 | 3300025941 | Ga0207711_11048847 | Ga0207711_110488472 | 121 |
| 601 | 3300025942 | Ga0207689_10017378 | Ga0207689_100173784 | 121 |
| 602 | 3300025942 | Ga0207689_10934128 | Ga0207689_109341282 | 121 |
| 603 | 3300025944 | Ga0207661_10122938 | Ga0207661_101229383 | 121 |
| 604 | 3300025944 | Ga0207661_11385065 | Ga0207661_113850652 | 121 |
| 605 | 3300025944 | Ga0207661_11803525 | Ga0207661_118035251 | 121 |
| 606 | 3300025944 | Ga0207661_12168249 | Ga0207661_121682492 | 121 |
| 607 | 3300025945 | Ga0207679_10139893 | Ga0207679_101398932 | 121 |
| 608 | 3300025949 | Ga0207667_10003648 | Ga0207667_1000364812 | 121 |
| 609 | 3300025949 | Ga0207667_10142518 | Ga0207667_101425184 | 121 |
| 610 | 3300025949 | Ga0207667_11306193 | Ga0207667_113061932 | 121 |
| 611 | 3300025961 | Ga0207712_10100114 | Ga0207712_101001141 | 121 |
| 612 | 3300025961 | Ga0207712_11638582 | Ga0207712_116385822 | 121 |
| 613 | 3300025961 | Ga0207712_12005523 | Ga0207712_120055232 | 121 |
| 614 | 3300025972 | Ga0207668_10082992 | Ga0207668_100829923 | 121 |
| 615 | 3300025972 | Ga0207668_10214236 | Ga0207668_102142363 | 121 |
| 616 | 3300025981 | Ga0207640_10069912 | Ga0207640_100699122 | 121 |
| 617 | 3300025986 | Ga0207658_10025692 | Ga0207658_100256927 | 121 |
| 618 | 3300025986 | Ga0207658_10139643 | Ga0207658_101396432 | 121 |
| 619 | 3300025986 | Ga0207658_11264201 | Ga0207658_112642012 | 121 |
| 620 | 3300026023 | Ga0207677_10384459 | Ga0207677_103844592 | 121 |
| 621 | 3300026023 | Ga0207677_10712085 | Ga0207677_107120851 | 121 |
| 622 | 3300026035 | Ga0207703_10000044 | Ga0207703_1000004444 | 121 |
| 623 | 3300026035 | Ga0207703_10669170 | Ga0207703_106691702 | 121 |
| 624 | 3300026041 | Ga0207639_10029843 | Ga0207639_100298435 | 121 |
| 625 | 3300026041 | Ga0207639_10081260 | Ga0207639_100812602 | 121 |
| 626 | 3300026041 | Ga0207639_10114593 | Ga0207639_101145932 | 121 |
| 627 | 3300026041 | Ga0207639_10373779 | Ga0207639_103737792 | 121 |
| 628 | 3300026041 | Ga0207639_10953785 | Ga0207639_109537852 | 121 |
| 629 | 3300026041 | Ga0207639_11227981 | Ga0207639_112279812 | 121 |
| 630 | 3300026067 | Ga0207678_10005013 | Ga0207678_100050136 | 121 |
| 631 | 3300026067 | Ga0207678_10264120 | Ga0207678_102641202 | 121 |
| 632 | 3300026067 | Ga0207678_10760526 | Ga0207678_107605262 | 121 |
| 633 | 3300026067 | Ga0207678_11124316 | Ga0207678_111243161 | 121 |
| 634 | 3300026075 | Ga0207708_10050227 | Ga0207708_100502273 | 121 |
| 635 | 3300026075 | Ga0207708_10058881 | Ga0207708_100588813 | 121 |
| 636 | 3300026075 | Ga0207708_10074252 | Ga0207708_100742523 | 121 |
| 637 | 3300026078 | Ga0207702_10013174 | Ga0207702_100131743 | 121 |
| 638 | 3300026078 | Ga0207702_10222140 | Ga0207702_102221402 | 121 |
| 639 | 3300026078 | Ga0207702_10548597 | Ga0207702_105485972 | 121 |
| 640 | 3300026078 | Ga0207702_10577580 | Ga0207702_105775802 | 121 |
| 641 | 3300026078 | Ga0207702_10774554 | Ga0207702_107745542 | 121 |
| 642 | 3300026078 | Ga0207702_11067570 | Ga0207702_110675702 | 121 |
| 643 | 3300026088 | Ga0207641_10001733 | Ga0207641_1000173313 | 121 |
| 644 | 3300026088 | Ga0207641_10034591 | Ga0207641_100345913 | 121 |
| 645 | 3300026088 | Ga0207641_10367700 | Ga0207641_103677003 | 121 |
| 646 | 3300026088 | Ga0207641_11761506 | Ga0207641_117615062 | 121 |
| 647 | 3300026089 | Ga0207648_10019076 | Ga0207648_100190766 | 121 |
| 648 | 3300026089 | Ga0207648_10544573 | Ga0207648_105445732 | 121 |
| 649 | 3300026089 | Ga0207648_10823358 | Ga0207648_108233582 | 121 |
| 650 | 3300026095 | Ga0207676_10304754 | Ga0207676_103047542 | 121 |
| 651 | 3300026095 | Ga0207676_10350780 | Ga0207676_103507803 | 121 |
| 652 | 3300026095 | Ga0207676_12149845 | Ga0207676_121498452 | 121 |
| 653 | 3300026116 | Ga0207674_10005505 | Ga0207674_100055055 | 121 |
| 654 | 3300026116 | Ga0207674_10013706 | Ga0207674_100137062 | 121 |
| 655 | 3300026116 | Ga0207674_10078956 | Ga0207674_100789562 | 121 |
| 656 | 3300026118 | Ga0207675_100109807 | Ga0207675_1001098072 | 121 |
| 657 | 3300026118 | Ga0207675_100160490 | Ga0207675_1001604903 | 121 |
| 658 | 3300026118 | Ga0207675_100251852 | Ga0207675_1002518523 | 121 |
| 659 | 3300026121 | Ga0207683_10002264 | Ga0207683_100022645 | 121 |
| 660 | 3300026121 | Ga0207683_10360498 | Ga0207683_103604982 | 121 |
| 661 | 3300026121 | Ga0207683_10765696 | Ga0207683_107656962 | 121 |
| 662 | 3300026121 | Ga0207683_11036628 | Ga0207683_110366282 | 121 |
| 663 | 3300026121 | Ga0207683_11746088 | Ga0207683_117460881 | 121 |
| 664 | 3300026142 | Ga0207698_10000269 | Ga0207698_1000026922 | 121 |
| 665 | 3300026142 | Ga0207698_10008328 | Ga0207698_1000832810 | 121 |
| 666 | 3300026142 | Ga0207698_10124834 | Ga0207698_101248344 | 121 |
| 667 | 3300026142 | Ga0207698_10598033 | Ga0207698_105980332 | 121 |
| 668 | 3300026142 | Ga0207698_11602754 | Ga0207698_116027542 | 121 |
| 669 | 3300027866 | Ga0209813_10202294 | Ga0209813_102022942 | 121 |
| 670 | 3300027907 | Ga0207428_10001284 | Ga0207428_1000128422 | 121 |
| 671 | 3300027907 | Ga0207428_10001525 | Ga0207428_100015256 | 121 |
| 672 | 3300028379 | Ga0268266_12135880 | Ga0268266_121358801 | 121 |
| 673 | 3300028380 | Ga0268265_10563962 | Ga0268265_105639621 | 121 |
| 674 | 3300028381 | Ga0268264_10584575 | Ga0268264_105845752 | 121 |
| 675 | 3300028381 | Ga0268264_10708198 | Ga0268264_107081982 | 121 |
| 676 | 3300028381 | Ga0268264_10751506 | Ga0268264_107515062 | 121 |
| 677 | 3300031240 | Ga0265320_10039832 | Ga0265320_100398324 | 121 |
| 678 | 3300031251 | Ga0265327_10238976 | Ga0265327_102389762 | 121 |
| 679 | 3300031548 | Ga0307408_100593880 | Ga0307408_1005938802 | 121 |
| 680 | 3300031548 | Ga0307408_100731909 | Ga0307408_1007319092 | 121 |
| 681 | 3300031731 | Ga0307405_10269253 | Ga0307405_102692532 | 121 |
| 682 | 3300031824 | Ga0307413_10006705 | Ga0307413_100067055 | 121 |
| 683 | 3300031824 | Ga0307413_11077281 | Ga0307413_110772812 | 121 |
| 684 | 3300031824 | Ga0307413_11461864 | Ga0307413_114618641 | 121 |
| 685 | 3300031852 | Ga0307410_10007959 | Ga0307410_1000795910 | 121 |
| 686 | 3300031852 | Ga0307410_10051292 | Ga0307410_100512925 | 121 |
| 687 | 3300031852 | Ga0307410_11642353 | Ga0307410_116423531 | 121 |
| 688 | 3300031901 | Ga0307406_10002700 | Ga0307406_100027006 | 121 |
| 689 | 3300031901 | Ga0307406_10007635 | Ga0307406_100076355 | 121 |
| 690 | 3300031901 | Ga0307406_10033716 | Ga0307406_100337162 | 121 |
| 691 | 3300031901 | Ga0307406_10765884 | Ga0307406_107658842 | 121 |
| 692 | 3300031903 | Ga0307407_10025529 | Ga0307407_100255296 | 121 |
| 693 | 3300031903 | Ga0307407_10238290 | Ga0307407_102382902 | 121 |
| 694 | 3300031903 | Ga0307407_10270955 | Ga0307407_102709552 | 121 |
| 695 | 3300031903 | Ga0307407_10393425 | Ga0307407_103934252 | 121 |
| 696 | 3300031911 | Ga0307412_10484887 | Ga0307412_104848871 | 121 |
| 697 | 3300031995 | Ga0307409_100012048 | Ga0307409_10001204810 | 121 |
| 698 | 3300031995 | Ga0307409_100354787 | Ga0307409_1003547874 | 121 |
| 699 | 3300031995 | Ga0307409_100375535 | Ga0307409_1003755352 | 121 |
| 700 | 3300031995 | Ga0307409_100414271 | Ga0307409_1004142712 | 121 |
| 701 | 3300031995 | Ga0307409_100753840 | Ga0307409_1007538402 | 121 |
| 702 | 3300031995 | Ga0307409_102648302 | Ga0307409_1026483021 | 121 |
| 703 | 3300032002 | Ga0307416_100053296 | Ga0307416_1000532966 | 121 |
| 704 | 3300032002 | Ga0307416_100575660 | Ga0307416_1005756602 | 121 |
| 705 | 3300032002 | Ga0307416_100772248 | Ga0307416_1007722481 | 121 |
| 706 | 3300032002 | Ga0307416_100798496 | Ga0307416_1007984963 | 121 |
| 707 | 3300032002 | Ga0307416_101275772 | Ga0307416_1012757722 | 121 |
| 708 | 3300032002 | Ga0307416_102365648 | Ga0307416_1023656482 | 121 |
| 709 | 3300032004 | Ga0307414_10015974 | Ga0307414_100159744 | 121 |
| 710 | 3300032004 | Ga0307414_10719458 | Ga0307414_107194582 | 121 |
| 711 | 3300032004 | Ga0307414_10934712 | Ga0307414_109347122 | 121 |
| 712 | 3300032004 | Ga0307414_11207095 | Ga0307414_112070951 | 121 |
| 713 | 3300032004 | Ga0307414_11313065 | Ga0307414_113130652 | 121 |
| 714 | 3300032005 | Ga0307411_10231714 | Ga0307411_102317143 | 121 |
| 715 | 3300032005 | Ga0307411_10287120 | Ga0307411_102871202 | 121 |
| 716 | 3300032005 | Ga0307411_10329979 | Ga0307411_103299792 | 121 |
| 717 | 3300032005 | Ga0307411_10330455 | Ga0307411_103304552 | 121 |
| 718 | 3300032126 | Ga0307415_100139679 | Ga0307415_1001396792 | 121 |
| 719 | 3300032126 | Ga0307415_100501717 | Ga0307415_1005017172 | 121 |
| 720 | 3300032126 | Ga0307415_101694917 | Ga0307415_1016949172 | 121 |
| 721 | 3300035083 | Ga0373926_0010531 | Ga0373926_0010531_342_710 | 121 |
| 722 | 3300035086 | Ga0373934_0007671 | Ga0373934_0007671_2896_3264 | 121 |
| 723 | 3300035089 | Ga0373944_0001860 | Ga0373944_0001860_216_584 | 121 |
| 724 | 3300035090 | Ga0373949_0018196 | Ga0373949_0018196_259_627 | 121 |
| 725 | 3300035092 | Ga0373952_0116896 | Ga0373952_0116896_119_487 | 121 |
| 726 | 3300035092 | Ga0373952_0211338 | Ga0373952_0211338_188_556 | 121 |
| 727 | 3300035111 | Ga0373923_0000367 | Ga0373923_0000367_1722_2090 | 121 |
| 728 | 3300035113 | Ga0373936_0000674 | Ga0373936_0000674_2648_3016 | 121 |
| 729 | 3300035114 | Ga0373939_0046555 | Ga0373939_0046555_347_715 | 121 |
| 730 | 3300035115 | Ga0373941_0020839 | Ga0373941_0020839_997_1365 | 121 |
| 731 | 3300035116 | Ga0373945_0000598 | Ga0373945_0000598_7326_7694 | 121 |
| 732 | 3300035117 | Ga0373953_0004098 | Ga0373953_0004098_423_791 | 121 |
| 733 | 3300035118 | Ga0373954_0006760 | Ga0373954_0006760_1657_2025 | 121 |
| 734 | 3300035119 | Ga0373956_0096518 | Ga0373956_0096518_89_457 | 121 |
| 735 | 3300035121 | Ga0373960_0021419 | Ga0373960_0021419_318_686 | 121 |
| 736 | 3300035121 | Ga0373960_0137873 | Ga0373960_0137873_277_645 | 121 |
| 737 | 3300035170 | Ga0373943_0000724 | Ga0373943_0000724_6539_6907 | 121 |
| 738 | 3300035171 | Ga0373946_0086963 | Ga0373946_0086963_130_498 | 121 |
| 739 | 3300035172 | Ga0373955_0009172 | Ga0373955_0009172_2535_2903 | 121 |
| 740 | 3300035207 | Ga0373942_0040588 | Ga0373942_0040588_566_934 | 121 |
| 741 | 3300035241 | Ga0373961_0294062 | Ga0373961_0294062_28_396 | 121 |
| 742 | 3300035410 | Ga0373924_0000394 | Ga0373924_0000394_7185_7553 | 121 |
| 743 | 3300035691 | Ga0373931_0035754 | Ga0373931_0035754_2144_2512 | 121 |
| 744 | 3300035691 | Ga0373931_1164342 | Ga0373931_1164342_25_393 | 121 |
| 745 | 3300035692 | Ga0373935_0001407 | Ga0373935_0001407_5561_5929 | 121 |
| 746 | 3300035695 | Ga0373927_0001565 | Ga0373927_0001565_8948_9316 | 121 |
| 747 | 3300035695 | Ga0373927_0426119 | Ga0373927_0426119_30_398 | 121 |
| 748 | 3300035724 | Ga0373933_0008451 | Ga0373933_0008451_1589_1957 | 121 |
| 749 | 3300035725 | Ga0373947_0001322 | Ga0373947_0001322_6046_6414 | 121 |
| 750 | 3300036401 | Ga0373937_0016605 | Ga0373937_0016605_3193_3561 | 121 |
| 751 | 3300037068 | Ga0373925_0021520 | Ga0373925_0021520_446_814 | 121 |
| 752 | 3300037312 | Ga0395899_0018679 | Ga0395899_0018679_1493_1861 | 121 |
| 753 | 3300037418 | Ga0395900_0003464 | Ga0395900_0003464_12270_12659 | 121 |
| 754 | 3300037418 | Ga0395900_0619137 | Ga0395900_0619137_54_422 | 121 |
| 755 | 3300037418 | Ga0395900_1318181 | Ga0395900_1318181_79_447 | 121 |
| 756 | 3300037466 | Ga0395898_0000015 | Ga0395898_0000015_314067_314456 | 121 |
| 757 | 3300037466 | Ga0395898_0392224 | Ga0395898_0392224_524_901 | 121 |
| 758 | 3300037466 | Ga0395898_1413127 | Ga0395898_1413127_168_536 | 121 |
| 759 | 3300038443 | Ga0395901_0050789 | Ga0395901_0050789_2720_3097 | 121 |
| 760 | 3300038443 | Ga0395901_0284798 | Ga0395901_0284798_575_943 | 121 |
| 761 | 3300041413 | Ga0439465_0019640 | Ga0439465_0019640_1012_1392 | 121 |
| 762 | 3300041441 | Ga0451787_604139 | Ga0451787_604139_140_508 | 121 |
| 763 | 3300041441 | Ga0451787_605597 | Ga0451787_605597_100_468 | 121 |
| 764 | 3300041443 | Ga0451789_0430189 | Ga0451789_0430189_465_839 | 121 |
| 765 | 3300041452 | Ga0451793_1667579 | Ga0451793_1667579_141_509 | 121 |
| 766 | 3300041453 | Ga0451797_0677432 | Ga0451797_0677432_135_506 | 121 |
| 767 | 3300041492 | Ga0451835_0010124 | Ga0451835_0010124_88_456 | 121 |
| 768 | 3300041509 | Ga0451843_0069868 | Ga0451843_0069868_128_526 | 121 |
| 769 | 3300041509 | Ga0451843_0448277 | Ga0451843_0448277_36_407 | 121 |
| 770 | 3300041509 | Ga0451843_0669537 | Ga0451843_0669537_96_464 | 121 |
| 771 | 3300041512 | Ga0451853_0890225 | Ga0451853_0890225_48_416 | 121 |
| 772 | 3300041512 | Ga0451853_1028530 | Ga0451853_1028530_260_628 | 121 |
| 773 | 3300042002 | Ga0439442_006204 | Ga0439442_006204_1095_1469 | 121 |
| 774 | 3300042002 | Ga0439442_006466 | Ga0439442_006466_889_1269 | 121 |
| 775 | 3300042004 | Ga0439445_0231550 | Ga0439445_0231550_17_391 | 121 |
| 776 | 3300042005 | Ga0439448_0025669 | Ga0439448_0025669_555_923 | 121 |
| 777 | 3300042005 | Ga0439448_0071739 | Ga0439448_0071739_286_654 | 121 |
| 778 | 3300042007 | Ga0439449_0100329 | Ga0439449_0100329_203_571 | 121 |
| 779 | 3300042007 | Ga0439449_0312434 | Ga0439449_0312434_36_404 | 121 |
| 780 | 3300042008 | Ga0439450_004633 | Ga0439450_004633_619_987 | 121 |
| 781 | 3300042011 | Ga0439454_055028 | Ga0439454_055028_232_600 | 121 |
| 782 | 3300042012 | Ga0439455_0025634 | Ga0439455_0025634_853_1221 | 121 |
| 783 | 3300042012 | Ga0439455_0133469 | Ga0439455_0133469_245_613 | 121 |
| 784 | 3300042016 | Ga0439463_002010 | Ga0439463_002010_3148_3516 | 121 |
| 785 | 3300042016 | Ga0439463_086646 | Ga0439463_086646_201_569 | 121 |
| 786 | 3300042122 | Ga0450920_035566 | Ga0450920_035566_214_588 | 121 |
| 787 | 3300042125 | Ga0450923_044497 | Ga0450923_044497_143_517 | 121 |
| 788 | 3300042127 | Ga0450890_042401 | Ga0450890_042401_251_619 | 121 |
| 789 | 3300042184 | Ga0450908_108353 | Ga0450908_108353_74_442 | 121 |
| 790 | 3300042437 | Ga0439444_0016296 | Ga0439444_0016296_723_1091 | 121 |
| 791 | 3300042439 | Ga0439464_0066057 | Ga0439464_0066057_249_617 | 121 |
| 792 | 3300042461 | Ga0439460_0198318 | Ga0439460_0198318_256_624 | 121 |
| 793 | 3300042533 | Ga0450901_021754 | Ga0450901_021754_312_680 | 121 |
| 794 | 3300044658 | Ga0466972_0012105 | Ga0466972_0012105_1725_2096 | 121 |
| 795 | 3300044658 | Ga0466972_0127277 | Ga0466972_0127277_610_975 | 121 |
| 796 | 3300044683 | Ga0466965_0061263 | Ga0466965_0061263_1445_1816 | 121 |
| 797 | 3300044684 | Ga0466966_0035728 | Ga0466966_0035728_987_1358 | 121 |
| 798 | 3300044693 | Ga0466961_0019240 | Ga0466961_0019240_2054_2425 | 121 |
| 799 | 3300044735 | Ga0466968_0003766 | Ga0466968_0003766_101_472 | 121 |
| 800 | 3300044765 | Ga0466970_0014509 | Ga0466970_0014509_1778_2149 | 121 |
| 801 | 3300044842 | Ga0466957_0013971 | Ga0466957_0013971_1819_2190 | 121 |
| 802 | 3300044901 | Ga0466960_0280481 | Ga0466960_0280481_287_655 | 121 |
| 803 | 3300045049 | Ga0466959_0028311 | Ga0466959_0028311_274_645 | 121 |
| 804 | 3300045051 | Ga0451576_1584131 | Ga0451576_1584131_154_519 | 121 |
| 805 | 3300046454 | Ga0495592_0028688 | Ga0495592_0028688_881_1249 | 121 |
| 806 | 3300046455 | Ga0495603_0001187 | Ga0495603_0001187_7613_7981 | 121 |
| 807 | 3300046459 | Ga0495629_0001672 | Ga0495629_0001672_11392_11760 | 121 |
| 808 | 3300046460 | Ga0495638_0254418 | Ga0495638_0254418_285_656 | 121 |
| 809 | 3300046461 | Ga0495641_0003984 | Ga0495641_0003984_7391_7759 | 121 |
| 810 | 3300046462 | Ga0495651_0003789 | Ga0495651_0003789_3001_3369 | 121 |
| 811 | 3300046463 | Ga0495653_0041688 | Ga0495653_0041688_2896_3264 | 121 |
| 812 | 3300046463 | Ga0495653_0350770 | Ga0495653_0350770_546_914 | 121 |
| 813 | 3300046472 | Ga0495580_0006947 | Ga0495580_0006947_2690_3058 | 121 |
| 814 | 3300046473 | Ga0495582_0002389 | Ga0495582_0002389_7462_7830 | 121 |
| 815 | 3300046475 | Ga0495639_0010448 | Ga0495639_0010448_920_1288 | 121 |
| 816 | 3300046475 | Ga0495639_0222399 | Ga0495639_0222399_241_609 | 121 |
| 817 | 3300046476 | Ga0495662_0008459 | Ga0495662_0008459_3323_3691 | 121 |
| 818 | 3300046477 | Ga0495664_0004030 | Ga0495664_0004030_4545_4913 | 121 |
| 819 | 3300046477 | Ga0495664_0060441 | Ga0495664_0060441_752_1120 | 121 |
| 820 | 3300046499 | Ga0495594_0195282 | Ga0495594_0195282_628_996 | 121 |
| 821 | 3300046500 | Ga0495596_0191182 | Ga0495596_0191182_261_629 | 121 |
| 822 | 3300046501 | Ga0495607_0327574 | Ga0495607_0327574_283_663 | 121 |
| 823 | 3300046511 | Ga0495608_0040941 | Ga0495608_0040941_446_814 | 121 |
| 824 | 3300046513 | Ga0495616_0405294 | Ga0495616_0405294_22_405 | 121 |
| 825 | 3300046514 | Ga0495618_0003119 | Ga0495618_0003119_2397_2765 | 121 |
| 826 | 3300046516 | Ga0495628_0025750 | Ga0495628_0025750_1328_1696 | 121 |
| 827 | 3300046517 | Ga0495630_0028520 | Ga0495630_0028520_3056_3424 | 121 |
| 828 | 3300046518 | Ga0495631_0091325 | Ga0495631_0091325_100_483 | 121 |
| 829 | 3300046520 | Ga0495637_0348268 | Ga0495637_0348268_78_461 | 121 |
| 830 | 3300046522 | Ga0495643_0497387 | Ga0495643_0497387_138_506 | 121 |
| 831 | 3300046523 | Ga0495644_0162405 | Ga0495644_0162405_219_587 | 121 |
| 832 | 3300046526 | Ga0495666_0159731 | Ga0495666_0159731_328_696 | 121 |
| 833 | 3300046529 | Ga0495652_0008982 | Ga0495652_0008982_2561_2929 | 121 |
| 834 | 3300046531 | Ga0495665_0004883 | Ga0495665_0004883_3890_4258 | 121 |
| 835 | 3300046533 | Ga0495640_0023607 | Ga0495640_0023607_1025_1393 | 121 |
| 836 | 3300046535 | Ga0495586_0014085 | Ga0495586_0014085_1333_1701 | 121 |
| 837 | 3300046535 | Ga0495586_0173486 | Ga0495586_0173486_265_633 | 121 |
| 838 | 3300046536 | Ga0495587_0006125 | Ga0495587_0006125_3973_4341 | 121 |
| 839 | 3300046537 | Ga0495598_0384669 | Ga0495598_0384669_123_506 | 121 |
| 840 | 3300046543 | Ga0495645_0012237 | Ga0495645_0012237_2889_3257 | 121 |
| 841 | 3300046557 | Ga0495622_0288725 | Ga0495622_0288725_16_384 | 121 |
| 842 | 3300046559 | Ga0495667_0014137 | Ga0495667_0014137_4702_5070 | 121 |
| 843 | 3300046642 | Ga0495634_0045885 | Ga0495634_0045885_577_945 | 121 |
| 844 | 3300046663 | Ga0495635_0016436 | Ga0495635_0016436_3487_3855 | 121 |
| 845 | 3300046674 | Ga0495588_0217201 | Ga0495588_0217201_205_573 | 121 |
| 846 | 3300046674 | Ga0495588_0548106 | Ga0495588_0548106_225_593 | 121 |
| 847 | 3300046675 | Ga0495657_0015830 | Ga0495657_0015830_2980_3348 | 121 |
| 848 | 3300046678 | Ga0495599_0004443 | Ga0495599_0004443_4757_5125 | 121 |
| 849 | 3300046679 | Ga0495623_0006192 | Ga0495623_0006192_5973_6341 | 121 |
| 850 | 3300046680 | Ga0495646_0013069 | Ga0495646_0013069_3469_3837 | 121 |
| 851 | 3300046681 | Ga0495647_0181720 | Ga0495647_0181720_515_883 | 121 |
| 852 | 3300046683 | Ga0495658_0003027 | Ga0495658_0003027_2194_2562 | 121 |
| 853 | 3300046683 | Ga0495658_0739174 | Ga0495658_0739174_223_597 | 121 |
| 854 | 3300046689 | Ga0495613_0008109 | Ga0495613_0008109_3929_4297 | 121 |
| 855 | 3300046690 | Ga0495624_0004181 | Ga0495624_0004181_2980_3348 | 121 |
| 856 | 3300046692 | Ga0495671_0401055 | Ga0495671_0401055_271_639 | 121 |
| 857 | 3300046809 | Ga0495600_0004051 | Ga0495600_0004051_6905_7273 | 121 |
| 858 | 3300046809 | Ga0495600_0442402 | Ga0495600_0442402_22_390 | 121 |
| 859 | 3300047315 | Ga0495581_0003256 | Ga0495581_0003256_6046_6414 | 121 |
| 860 | 3300047317 | Ga0495604_0004523 | Ga0495604_0004523_7361_7729 | 121 |
| 861 | 3300047319 | Ga0495674_0129631 | Ga0495674_0129631_318_686 | 121 |
| 862 | 3300047319 | Ga0495674_0334710 | Ga0495674_0334710_418_786 | 121 |
| 863 | 3300047320 | Ga0495672_0140544 | Ga0495672_0140544_183_554 | 121 |
| 864 | 3300047321 | Ga0495676_0003026 | Ga0495676_0003026_11935_12303 | 121 |
| 865 | 3300047445 | Ga0495677_0259950 | Ga0495677_0259950_121_504 | 121 |
| 866 | 3300047471 | Ga0495684_0008710 | Ga0495684_0008710_1314_1682 | 121 |
| 867 | 3300047472 | Ga0495686_0067133 | Ga0495686_0067133_411_785 | 121 |
| 868 | 3300047472 | Ga0495686_0249070 | Ga0495686_0249070_109_480 | 121 |
| 869 | 3300047673 | Ga0495593_0001731 | Ga0495593_0001731_6537_6905 | 121 |
| 870 | 3300047673 | Ga0495593_0050313 | Ga0495593_0050313_603_971 | 121 |
| 871 | 3300048088 | Ga0495602_0010671 | Ga0495602_0010671_2624_2992 | 121 |
| 872 | 3300048089 | Ga0495614_0051345 | Ga0495614_0051345_309_677 | 121 |
| 873 | 3300048903 | Ga0496100_0002276 | Ga0496100_0002276_6178_6546 | 121 |
| 874 | 3300048903 | Ga0496100_0109283 | Ga0496100_0109283_351_719 | 121 |
| 875 | 3300048903 | Ga0496100_0510828 | Ga0496100_0510828_511_879 | 121 |
| 876 | 3300048904 | Ga0496101_0003922 | Ga0496101_0003922_7465_7833 | 121 |
| 877 | 3300048904 | Ga0496101_0016066 | Ga0496101_0016066_4110_4481 | 121 |
| 878 | 3300048904 | Ga0496101_0094865 | Ga0496101_0094865_1469_1837 | 121 |
| 879 | 3300048904 | Ga0496101_0103951 | Ga0496101_0103951_1489_1857 | 121 |
| 880 | 3300048904 | Ga0496101_0182095 | Ga0496101_0182095_451_822 | 121 |
| 881 | 3300048904 | Ga0496101_0575078 | Ga0496101_0575078_12_380 | 121 |
| 882 | 3300048904 | Ga0496101_0589141 | Ga0496101_0589141_386_751 | 121 |
| 883 | 3300048904 | Ga0496101_0725201 | Ga0496101_0725201_286_654 | 121 |
| 884 | 3300048905 | Ga0496102_0000017 | Ga0496102_0000017_104360_104728 | 121 |
| 885 | 3300048905 | Ga0496102_0004090 | Ga0496102_0004090_3604_3969 | 121 |
| 886 | 3300048905 | Ga0496102_0017204 | Ga0496102_0017204_5410_5778 | 121 |
| 887 | 3300048905 | Ga0496102_0063643 | Ga0496102_0063643_309_677 | 121 |
| 888 | 3300048905 | Ga0496102_0160514 | Ga0496102_0160514_1085_1453 | 121 |
| 889 | 3300048905 | Ga0496102_0407209 | Ga0496102_0407209_405_776 | 121 |
| 890 | 3300048905 | Ga0496102_0498331 | Ga0496102_0498331_202_576 | 121 |
| 891 | 3300048905 | Ga0496102_1591864 | Ga0496102_1591864_74_439 | 121 |
| 892 | 3300048906 | Ga0496103_0000041 | Ga0496103_0000041_29984_30352 | 121 |
| 893 | 3300048906 | Ga0496103_0040842 | Ga0496103_0040842_492_857 | 121 |
| 894 | 3300048906 | Ga0496103_0119576 | Ga0496103_0119576_948_1316 | 121 |
| 895 | 3300048906 | Ga0496103_0324799 | Ga0496103_0324799_305_673 | 121 |
| 896 | 3300048906 | Ga0496103_0494846 | Ga0496103_0494846_21_392 | 121 |
| 897 | 3300048907 | Ga0496104_0001879 | Ga0496104_0001879_7433_7801 | 121 |
| 898 | 3300048907 | Ga0496104_0008855 | Ga0496104_0008855_207_575 | 121 |
| 899 | 3300048907 | Ga0496104_0068414 | Ga0496104_0068414_737_1108 | 121 |
| 900 | 3300048907 | Ga0496104_0169506 | Ga0496104_0169506_1124_1492 | 121 |
| 901 | 3300048907 | Ga0496104_0388797 | Ga0496104_0388797_580_948 | 121 |
| 902 | 3300048907 | Ga0496104_0493559 | Ga0496104_0493559_547_915 | 121 |
| 903 | 3300048907 | Ga0496104_0725594 | Ga0496104_0725594_427_795 | 121 |
| 904 | 3300048907 | Ga0496104_1201460 | Ga0496104_1201460_230_598 | 121 |
| 905 | 3300048907 | Ga0496104_1373897 | Ga0496104_1373897_76_444 | 121 |
| 906 | 3300048908 | Ga0496105_0001766 | Ga0496105_0001766_3071_3439 | 121 |
| 907 | 3300048908 | Ga0496105_0009627 | Ga0496105_0009627_5469_5837 | 121 |
| 908 | 3300048908 | Ga0496105_0011284 | Ga0496105_0011284_748_1116 | 121 |
| 909 | 3300048908 | Ga0496105_0037487 | Ga0496105_0037487_284_655 | 121 |
| 910 | 3300048908 | Ga0496105_0089820 | Ga0496105_0089820_1365_1733 | 121 |
| 911 | 3300048908 | Ga0496105_0133549 | Ga0496105_0133549_756_1124 | 121 |
| 912 | 3300048908 | Ga0496105_0266567 | Ga0496105_0266567_360_728 | 121 |
| 913 | 3300048909 | Ga0496106_0006289 | Ga0496106_0006289_5570_5941 | 121 |
| 914 | 3300048909 | Ga0496106_1039035 | Ga0496106_1039035_211_579 | 121 |
| 915 | 3300048910 | Ga0496107_0018120 | Ga0496107_0018120_4010_4381 | 121 |
| 916 | 3300048910 | Ga0496107_0046146 | Ga0496107_0046146_828_1196 | 121 |
| 917 | 3300048910 | Ga0496107_0069628 | Ga0496107_0069628_1058_1426 | 121 |
| 918 | 3300048910 | Ga0496107_0071209 | Ga0496107_0071209_1383_1748 | 121 |
| 919 | 3300048910 | Ga0496107_0327491 | Ga0496107_0327491_359_730 | 121 |
| 920 | 3300048911 | Ga0496108_0002013 | Ga0496108_0002013_13165_13533 | 121 |
| 921 | 3300048911 | Ga0496108_0002520 | Ga0496108_0002520_10657_11025 | 121 |
| 922 | 3300048911 | Ga0496108_0023704 | Ga0496108_0023704_279_647 | 121 |
| 923 | 3300048911 | Ga0496108_0119728 | Ga0496108_0119728_958_1323 | 121 |
| 924 | 3300048911 | Ga0496108_0293672 | Ga0496108_0293672_724_1092 | 121 |
| 925 | 3300048911 | Ga0496108_0442988 | Ga0496108_0442988_336_704 | 121 |
| 926 | 3300048911 | Ga0496108_0517783 | Ga0496108_0517783_576_944 | 121 |
| 927 | 3300048911 | Ga0496108_0633775 | Ga0496108_0633775_263_631 | 121 |
| 928 | 3300048911 | Ga0496108_0936314 | Ga0496108_0936314_39_407 | 121 |
| 929 | 3300048911 | Ga0496108_1064257 | Ga0496108_1064257_34_402 | 121 |
| 930 | 3300048911 | Ga0496108_1613647 | Ga0496108_1613647_149_517 | 121 |
| 931 | 3300048912 | Ga0496109_0036204 | Ga0496109_0036204_4055_4423 | 121 |
| 932 | 3300048912 | Ga0496109_0066031 | Ga0496109_0066031_657_1025 | 121 |
| 933 | 3300048912 | Ga0496109_0141753 | Ga0496109_0141753_897_1265 | 121 |
| 934 | 3300048912 | Ga0496109_0178250 | Ga0496109_0178250_966_1331 | 121 |
| 935 | 3300048912 | Ga0496109_0346851 | Ga0496109_0346851_408_776 | 121 |
| 936 | 3300048912 | Ga0496109_0372903 | Ga0496109_0372903_143_511 | 121 |
| 937 | 3300048912 | Ga0496109_0483898 | Ga0496109_0483898_654_1022 | 121 |
| 938 | 3300048912 | Ga0496109_1470597 | Ga0496109_1470597_90_458 | 121 |
| 939 | 3300048913 | Ga0496110_0002211 | Ga0496110_0002211_12242_12610 | 121 |
| 940 | 3300048913 | Ga0496110_0006460 | Ga0496110_0006460_5336_5704 | 121 |
| 941 | 3300048913 | Ga0496110_0010855 | Ga0496110_0010855_6141_6506 | 121 |
| 942 | 3300048913 | Ga0496110_0097958 | Ga0496110_0097958_966_1334 | 121 |
| 943 | 3300048913 | Ga0496110_0185434 | Ga0496110_0185434_1417_1785 | 121 |
| 944 | 3300048914 | Ga0496111_0000481 | Ga0496111_0000481_10118_10483 | 121 |
| 945 | 3300048914 | Ga0496111_0122802 | Ga0496111_0122802_1200_1568 | 121 |
| 946 | 3300048914 | Ga0496111_0170158 | Ga0496111_0170158_765_1133 | 121 |
| 947 | 3300048914 | Ga0496111_0312240 | Ga0496111_0312240_190_558 | 121 |
| 948 | 3300048914 | Ga0496111_0397223 | Ga0496111_0397223_384_752 | 121 |
| 949 | 3300048914 | Ga0496111_0430079 | Ga0496111_0430079_226_594 | 121 |
| 950 | 3300048914 | Ga0496111_1111893 | Ga0496111_1111893_137_505 | 121 |
| 951 | 3300048915 | Ga0496112_0007896 | Ga0496112_0007896_8829_9197 | 121 |
| 952 | 3300048915 | Ga0496112_0185216 | Ga0496112_0185216_1133_1501 | 121 |
| 953 | 3300048915 | Ga0496112_0347519 | Ga0496112_0347519_783_1151 | 121 |
| 954 | 3300048916 | Ga0496113_0124461 | Ga0496113_0124461_1029_1397 | 121 |
| 955 | 3300048916 | Ga0496113_0162548 | Ga0496113_0162548_601_969 | 121 |
| 956 | 3300048916 | Ga0496113_0375339 | Ga0496113_0375339_297_662 | 121 |
| 957 | 3300048917 | Ga0496114_0004969 | Ga0496114_0004969_3696_4064 | 121 |
| 958 | 3300048917 | Ga0496114_0009643 | Ga0496114_0009643_4088_4456 | 121 |
| 959 | 3300048917 | Ga0496114_0038495 | Ga0496114_0038495_3255_3620 | 121 |
| 960 | 3300048917 | Ga0496114_0058447 | Ga0496114_0058447_1822_2190 | 121 |
| 961 | 3300048917 | Ga0496114_0135406 | Ga0496114_0135406_1552_1920 | 121 |
| 962 | 3300048917 | Ga0496114_0148871 | Ga0496114_0148871_1015_1383 | 121 |
| 963 | 3300048917 | Ga0496114_0275019 | Ga0496114_0275019_838_1206 | 121 |
| 964 | 3300048917 | Ga0496114_0319135 | Ga0496114_0319135_745_1116 | 121 |
| 965 | 3300048917 | Ga0496114_0342852 | Ga0496114_0342852_169_534 | 121 |
| 966 | 3300048917 | Ga0496114_0362624 | Ga0496114_0362624_592_960 | 121 |
| 967 | 3300048917 | Ga0496114_0389006 | Ga0496114_0389006_427_795 | 121 |
| 968 | 3300048917 | Ga0496114_0400609 | Ga0496114_0400609_221_589 | 121 |
| 969 | 3300048917 | Ga0496114_0500835 | Ga0496114_0500835_294_662 | 121 |
| 970 | 3300048917 | Ga0496114_0852297 | Ga0496114_0852297_165_536 | 121 |
| 971 | 3300048917 | Ga0496114_1136690 | Ga0496114_1136690_156_524 | 121 |
| 972 | 3300048918 | Ga0496115_0021354 | Ga0496115_0021354_839_1207 | 121 |
| 973 | 3300048918 | Ga0496115_0036198 | Ga0496115_0036198_1768_2139 | 121 |
| 974 | 3300048918 | Ga0496115_0071864 | Ga0496115_0071864_2152_2520 | 121 |
| 975 | 3300048918 | Ga0496115_0091204 | Ga0496115_0091204_187_555 | 121 |
| 976 | 3300048918 | Ga0496115_0175562 | Ga0496115_0175562_20_391 | 121 |
| 977 | 3300048918 | Ga0496115_0264995 | Ga0496115_0264995_39_407 | 121 |
| 978 | 3300048918 | Ga0496115_0470497 | Ga0496115_0470497_321_689 | 121 |
| 979 | 3300048918 | Ga0496115_0827928 | Ga0496115_0827928_100_468 | 121 |
| 980 | 3300048919 | Ga0496116_0000121 | Ga0496116_0000121_155475_155843 | 121 |
| 981 | 3300048920 | Ga0496117_0000084 | Ga0496117_0000084_30252_30620 | 121 |
| 982 | 3300048920 | Ga0496117_0000163 | Ga0496117_0000163_72424_72792 | 121 |
| 983 | 3300048920 | Ga0496117_0006658 | Ga0496117_0006658_11176_11544 | 121 |
| 984 | 3300048920 | Ga0496117_0119388 | Ga0496117_0119388_337_711 | 121 |
| 985 | 3300048920 | Ga0496117_0510275 | Ga0496117_0510275_183_551 | 121 |
| 986 | 3300048921 | Ga0496118_0000057 | Ga0496118_0000057_155492_155860 | 121 |
| 987 | 3300048921 | Ga0496118_0039278 | Ga0496118_0039278_3338_3718 | 121 |
| 988 | 3300048921 | Ga0496118_0247370 | Ga0496118_0247370_453_821 | 121 |
| 989 | 3300048922 | Ga0496119_0005258 | Ga0496119_0005258_10713_11081 | 121 |
| 990 | 3300048922 | Ga0496119_0236784 | Ga0496119_0236784_223_591 | 121 |
| 991 | 3300048923 | Ga0496120_0001463 | Ga0496120_0001463_1757_2125 | 121 |
| 992 | 3300048923 | Ga0496120_0012737 | Ga0496120_0012737_3818_4186 | 121 |
| 993 | 3300048924 | Ga0496121_0007250 | Ga0496121_0007250_7013_7381 | 121 |
| 994 | 3300048925 | Ga0496122_0009222 | Ga0496122_0009222_6109_6480 | 121 |
| 995 | 3300048925 | Ga0496122_0119691 | Ga0496122_0119691_780_1148 | 121 |
| 996 | 3300048925 | Ga0496122_0156462 | Ga0496122_0156462_216_587 | 121 |
| 997 | 3300048926 | Ga0496123_0010117 | Ga0496123_0010117_4440_4811 | 121 |
| 998 | 3300048926 | Ga0496123_0509208 | Ga0496123_0509208_107_475 | 121 |
| 999 | 3300048927 | Ga0496124_0113217 | Ga0496124_0113217_420_788 | 121 |
| 1000 | 3300048927 | Ga0496124_0153440 | Ga0496124_0153440_1110_1478 | 121 |
| 1001 | 3300048927 | Ga0496124_0349403 | Ga0496124_0349403_166_534 | 121 |
| 1002 | 3300048928 | Ga0496125_0061576 | Ga0496125_0061576_2431_2799 | 121 |
| 1003 | 3300048928 | Ga0496125_0256621 | Ga0496125_0256621_459_827 | 121 |
| 1004 | 3300048928 | Ga0496125_0586879 | Ga0496125_0586879_215_586 | 121 |
| 1005 | 3300048929 | Ga0496126_0000135 | Ga0496126_0000135_139182_139550 | 121 |
| 1006 | 3300048929 | Ga0496126_0001669 | Ga0496126_0001669_3436_3804 | 121 |
| 1007 | 3300048929 | Ga0496126_0198808 | Ga0496126_0198808_1291_1662 | 121 |
| 1008 | 3300048929 | Ga0496126_0208866 | Ga0496126_0208866_106_474 | 121 |
| 1009 | 3300048929 | Ga0496126_0511642 | Ga0496126_0511642_545_916 | 121 |
| 1010 | 3300049571 | Ga0501034_0001761 | Ga0501034_0001761_20443_20814 | 121 |
| 1011 | 3300049575 | Ga0501039_0364228 | Ga0501039_0364228_636_1007 | 121 |
| 1012 | 3300049586 | Ga0501070_0001101 | Ga0501070_0001101_6182_6556 | 121 |
| 1013 | 3300049778 | Ga0501282_030085 | Ga0501282_030085_163_531 | 121 |
| 1014 | 3300049822 | Ga0501035_0120750 | Ga0501035_0120750_527_916 | 121 |
| 1015 | 3300050489 | nmdc:mga03683_417542_c1 | nmdc:mga03683_417542_c1_120_485 | 121 |
| 1016 | 3300050490 | nmdc:mga03n38_116147_c1 | nmdc:mga03n38_116147_c1_609_974 | 121 |
| 1017 | 3300050491 | nmdc:mga00v17_196980_c1 | nmdc:mga00v17_196980_c1_28_396 | 121 |
| 1018 | 3300050492 | nmdc:mga0yw44_319336_c1 | nmdc:mga0yw44_319336_c1_433_801 | 121 |
| 1019 | 3300050492 | nmdc:mga0yw44_341161_c1 | nmdc:mga0yw44_341161_c1_515_880 | 121 |
| 1020 | 3300050494 | nmdc:mga06z11_240180_c1 | nmdc:mga06z11_240180_c1_317_682 | 121 |
| 1021 | 3300050495 | nmdc:mga04h51_71376_c1 | nmdc:mga04h51_71376_c1_740_1105 | 121 |
| 1022 | 3300050496 | nmdc:mga07m45_492315_c1 | nmdc:mga07m45_492315_c1_328_696 | 121 |
| 1023 | 3300050507 | nmdc:mga05p37_23752_c1 | nmdc:mga05p37_23752_c1_813_1181 | 121 |
| 1024 | 3300050508 | nmdc:mga09592_1620630_c1 | nmdc:mga09592_1620630_c1_104_472 | 121 |
| 1025 | 3300050511 | nmdc:mga08y16_1901977_c1 | nmdc:mga08y16_1901977_c1_27_398 | 121 |
| 1026 | 3300050511 | nmdc:mga08y16_33806_c1 | nmdc:mga08y16_33806_c1_432_860 | 121 |
| 1027 | 3300050512 | nmdc:mga0n895_160103_c1 | nmdc:mga0n895_160103_c1_662_1090 | 121 |
| 1028 | 3300050512 | nmdc:mga0n895_19256_c1 | nmdc:mga0n895_19256_c1_2885_3253 | 121 |
| 1029 | 3300050512 | nmdc:mga0n895_415041_c1 | nmdc:mga0n895_415041_c1_789_1157 | 121 |
| 1030 | 3300050513 | nmdc:mga0rr50_53114_c1 | nmdc:mga0rr50_53114_c1_841_1209 | 121 |
| 1031 | 3300050513 | nmdc:mga0rr50_60982_c1 | nmdc:mga0rr50_60982_c1_2309_2737 | 121 |
| 1032 | 3300050514 | nmdc:mga08x19_114880_c1 | nmdc:mga08x19_114880_c1_1199_1567 | 121 |
| 1033 | 3300050514 | nmdc:mga08x19_116411_c1 | nmdc:mga08x19_116411_c1_1088_1456 | 121 |
| 1034 | 3300050514 | nmdc:mga08x19_13651_c1 | nmdc:mga08x19_13651_c1_4214_4642 | 121 |
| 1035 | 3300050515 | nmdc:mga0a205_5837_c1 | nmdc:mga0a205_5837_c1_509_937 | 121 |
| 1036 | 3300050515 | nmdc:mga0a205_7200_c1 | nmdc:mga0a205_7200_c1_6555_6923 | 121 |
| 1037 | 3300050515 | nmdc:mga0a205_750712_c1 | nmdc:mga0a205_750712_c1_264_632 | 121 |
| 1038 | 3300050516 | nmdc:mga0sz30_463020_c1 | nmdc:mga0sz30_463020_c1_41_409 | 121 |
| 1039 | 3300050516 | nmdc:mga0sz30_70580_c1 | nmdc:mga0sz30_70580_c1_744_1112 | 121 |
| 1040 | 3300053077 | Ga0495601_0048053 | Ga0495601_0048053_881_1249 | 121 |
| 1041 | 3300053078 | Ga0495612_0010119 | Ga0495612_0010119_851_1219 | 121 |
| 1042 | 3300053084 | Ga0495595_0474361 | Ga0495595_0474361_48_416 | 121 |
| 1043 | 3300053085 | Ga0495619_0006190 | Ga0495619_0006190_4545_4913 | 121 |
| 1044 | 3300053139 | Ga0500568_0000327 | Ga0500568_0000327_2599_2967 | 121 |
| 1045 | 3300053140 | Ga0500573_0394685 | Ga0500573_0394685_165_542 | 121 |
| 1046 | 3300053153 | Ga0500616_0000071 | Ga0500616_0000071_86239_86607 | 121 |
| 1047 | 3300053155 | Ga0500620_104173 | Ga0500620_104173_26_394 | 121 |
| 1048 | 3300053730 | Ga0500645_038792 | Ga0500645_038792_490_870 | 121 |
| 1049 | 3300061734 | Ga0530510_1476878 | Ga0530510_1476878_24_392 | 121 |
| 1050 | 3300061734 | Ga0530510_1518701 | Ga0530510_1518701_115_483 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o3l-assembly2.cif.gz_B | crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution | 0.8678 | 22 | 97 |
| 2o3l-assembly2.cif.gz_B | crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution | 0.8025 | 22 | 97 |
| 2o4t-assembly1.cif.gz_A-2 | crystal structure of a protein of the duf1048 family with a left-handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution | 0.7405 | 25 | 113 |
| 2o4t-assembly1.cif.gz_A-2 | crystal structure of a protein of the duf1048 family with a left-handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution | 0.7043 | 25 | 113 |
| 2hh6-assembly1.cif.gz_A-2 | crystal structure of bh3980 (10176605) from bacillus halodurans at 2.04 a resolution | 0.6986 | 5 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o3lB00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein | 0.8349 | 24 | 97 | 1.10.1900.10 |
| 2o3lB00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein | 0.7777 | 24 | 97 | 1.10.1900.10 |
| 2o4tA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein | 0.7405 | 25 | 113 | 1.10.1900.10 |
| 2o4tA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein | 0.7043 | 25 | 113 | 1.10.1900.10 |
| 2hh6A00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein | 0.6987 | 5 | 113 | 1.10.1900.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I6MUK6-F1-model_v4 | DUF1048 domain-containing protein | 0.9489 | 16 | 96 |
|
| AF-A0A6L8N6Z2-F1-model_v4 | DUF1048 domain-containing protein | 0.9429 | 16 | 95 |
|
| AF-A0A7X6YKE7-F1-model_v4 | Uncharacterized protein | 0.9216 | 22 | 93 |
GO:0016020
|
| AF-A0A6I2F7X0-F1-model_v4 | DUF1048 domain-containing protein | 0.8826 | 1 | 117 |
|
| AF-A0A359FE50-F1-model_v4 | deleted | 0.8676 | 1 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar