F489048

General Info

Members Datasets Scaffolds Average Seq Length
1050 462 1023 122

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10002406|Ga0075432_100024066
Length 142
Sequence MAAKWVETLTGSLEQKKQYKQYKARIGALPEPYGSVAKALQRYFLYYGGVTDGETALTMLGDFADLWERAAADGTPVREIVGDDPVEFAETFAQAYTGTQWIDKERARLTKAIEDAERGHRNDSGDTDPGAGPGEAYKELNV

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221575 Microbacterium sp. Root61 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
6 2643221649 Leifsonia sp. Root4 Isolate Unclassified
7 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
8 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
9 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
10 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
11 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
12 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
13 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
14 2808606372 Agromyces sp. 23-23 Isolate Unclassified
15 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
16 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
17 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
18 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
19 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
20 2928153084 Leifsonia sp. 563 Isolate Unclassified
21 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
22 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
28 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
139 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
140 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
141 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
142 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
143 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
144 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
145 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
146 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
147 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
148 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
149 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
150 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
151 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
180 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
262 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
263 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
264 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
265 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
269 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
270 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
271 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
272 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
273 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
274 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
279 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
280 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
293 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
294 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
295 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
296 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
297 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
298 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
299 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
300 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
301 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
302 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
303 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
304 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
305 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
306 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
307 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
308 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
309 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
310 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
311 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
312 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
313 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
314 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
315 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
316 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
317 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
320 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
321 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
322 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
323 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
324 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
325 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
332 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
336 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
342 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
343 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
348 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
349 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
356 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
357 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
358 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
361 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
362 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
363 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
368 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
369 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
370 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
371 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
372 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
373 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
374 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
378 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
379 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
380 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
381 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
382 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
383 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
384 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
385 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
386 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
387 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
388 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
389 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
390 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
391 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
394 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
395 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
398 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
399 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
400 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
405 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
406 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
407 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
428 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
429 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
431 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
432 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
433 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
434 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
437 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
438 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
439 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
440 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
441 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
442 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
443 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
444 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
447 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
448 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
449 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
450 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
451 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
452 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
453 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
456 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
459 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
460 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
461 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
462 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 1.05
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.81
Nodule 0
Rhizoplane 12.86
Rhizosphere 77.14
Stem 0
Stem Tuber 0.1
Unclassified 6.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001702 3300001979 Bacteria 10095
2 JGI24740J21852_10049945 3300001979 Bacteria 1205
3 JGI24739J22299_10030520 3300001989 Bacteria 1868
4 JGI24739J22299_10241777 3300001989 Bacteria 529
5 JGI25165J46597_1000005 3300003214 Bacteria 623702
6 JGI25407J50210_10067815 3300003373 Bacteria 892
7 Ga0006562J51391_1096029 3300003578 Bacteria 10820
8 JGI25405J52794_10167215 3300003911 Bacteria 504
9 Ga0070658_10007993 3300005327 Bacteria 8508
10 Ga0070658_10056365 3300005327 Bacteria 3193
11 Ga0070658_10118563 3300005327 Bacteria 2197
12 Ga0070658_10135184 3300005327 Bacteria 2056
13 Ga0070658_10138813 3300005327 Bacteria 2030
14 Ga0070676_10348733 3300005328 Bacteria 1017
15 Ga0070683_100263723 3300005329 Bacteria 1639
16 Ga0070683_100307129 3300005329 Bacteria 1509
17 Ga0070683_100508465 3300005329 Bacteria 1151
18 Ga0070683_101123266 3300005329 Bacteria 755
19 Ga0070690_100166208 3300005330 Bacteria 1515
20 Ga0070690_100556914 3300005330 Bacteria 865
21 Ga0070670_100403612 3300005331 Bacteria 1207
22 Ga0068869_100324390 3300005334 Bacteria 1249
23 Ga0068869_100500207 3300005334 Bacteria 1015
24 Ga0068869_101787756 3300005334 Bacteria 549
25 Ga0070666_10196361 3300005335 Bacteria 1419
26 Ga0070666_11037913 3300005335 Bacteria 608
27 Ga0070680_100298706 3300005336 Bacteria 1365
28 Ga0070680_101248772 3300005336 Bacteria 643
29 Ga0070682_100009835 3300005337 Bacteria 5416
30 Ga0070682_100062986 3300005337 Bacteria 2350
31 Ga0070682_100105294 3300005337 Bacteria 1870
32 Ga0070682_100469656 3300005337 Bacteria 968
33 Ga0070682_100637344 3300005337 Bacteria 847
34 Ga0070682_100991648 3300005337 Bacteria 696
35 Ga0070682_101639315 3300005337 Bacteria 557
36 Ga0068868_100528702 3300005338 Bacteria 1036
37 Ga0068868_100802076 3300005338 Bacteria 849
38 Ga0070660_100018494 3300005339 Bacteria 5092
39 Ga0070660_100060151 3300005339 Bacteria 2948
40 Ga0070660_100178014 3300005339 Bacteria 1720
41 Ga0070660_101072463 3300005339 Bacteria 681
42 Ga0070689_100112351 3300005340 Bacteria 2168
43 Ga0070691_10015980 3300005341 Bacteria 3448
44 Ga0070691_10222633 3300005341 Bacteria 1001
45 Ga0070691_10467729 3300005341 Bacteria 723
46 Ga0070687_100249766 3300005343 Bacteria 1101
47 Ga0070687_100876685 3300005343 Bacteria 642
48 Ga0070661_100012837 3300005344 Bacteria 5867
49 Ga0070661_100489515 3300005344 Bacteria 983
50 Ga0070661_100620410 3300005344 Bacteria 876
51 Ga0070692_10158006 3300005345 Bacteria 1296
52 Ga0070692_10185682 3300005345 Bacteria 1208
53 Ga0070668_100385965 3300005347 Bacteria 1193
54 Ga0070668_100437081 3300005347 Bacteria 1123
55 Ga0070668_100499652 3300005347 Bacteria 1053
56 Ga0070669_100274260 3300005353 Bacteria 1350
57 Ga0070669_100721500 3300005353 Bacteria 843
58 Ga0070675_100387727 3300005354 Bacteria 1244
59 Ga0070675_100707147 3300005354 Bacteria 918
60 Ga0070671_100066508 3300005355 Bacteria 3004
61 Ga0070674_100088680 3300005356 Bacteria 2227
62 Ga0070674_100174023 3300005356 Bacteria 1644
63 Ga0070674_100477392 3300005356 Bacteria 1034
64 Ga0070674_101023314 3300005356 Bacteria 726
65 Ga0070673_100076293 3300005364 Bacteria 2706
66 Ga0070673_101354834 3300005364 Bacteria 669
67 Ga0070688_100479389 3300005365 Bacteria 935
68 Ga0070688_101400926 3300005365 Bacteria 567
69 Ga0070659_100000863 3300005366 Bacteria 22157
70 Ga0070659_100151219 3300005366 Bacteria 1894
71 Ga0070659_100855779 3300005366 Bacteria 793
72 Ga0070659_101694997 3300005366 Bacteria 565
73 Ga0070667_100030955 3300005367 Bacteria 4462
74 Ga0070709_10609271 3300005434 Bacteria 841
75 Ga0070709_11225659 3300005434 Bacteria 603
76 Ga0070714_100033819 3300005435 Bacteria 4277
77 Ga0070714_100466811 3300005435 Bacteria 1200
78 Ga0070714_100473939 3300005435 Bacteria 1191
79 Ga0070714_101831436 3300005435 Bacteria 592
80 Ga0070713_100032549 3300005436 Bacteria 4165
81 Ga0070710_10628048 3300005437 Bacteria 750
82 Ga0070710_11220522 3300005437 Bacteria 556
83 Ga0070701_10029301 3300005438 Bacteria 2713
84 Ga0070711_100004587 3300005439 Bacteria 8176
85 Ga0070711_101055046 3300005439 Bacteria 699
86 Ga0070711_101759420 3300005439 Bacteria 543
87 Ga0070705_100606615 3300005440 Bacteria 847
88 Ga0070700_100197780 3300005441 Bacteria 1410
89 Ga0070700_100370534 3300005441 Bacteria 1068
90 Ga0070700_100417604 3300005441 Bacteria 1013
91 Ga0070700_100637639 3300005441 Bacteria 840
92 Ga0070694_100015894 3300005444 Bacteria 4736
93 Ga0070694_100535408 3300005444 Bacteria 936
94 Ga0070708_100175445 3300005445 Bacteria 2002
95 Ga0070663_100157623 3300005455 Bacteria 1745
96 Ga0070663_101387941 3300005455 Bacteria 622
97 Ga0070678_100311470 3300005456 Bacteria 1341
98 Ga0070678_102400080 3300005456 Bacteria 501
99 Ga0070662_100037264 3300005457 Bacteria 3447
100 Ga0070662_100510230 3300005457 Bacteria 1004
101 Ga0070662_100898434 3300005457 Bacteria 756
102 Ga0070681_11144103 3300005458 Bacteria 700
103 Ga0068867_100114089 3300005459 Bacteria 2080
104 Ga0068867_100421220 3300005459 Bacteria 1131
105 Ga0070685_10058281 3300005466 Bacteria 2251
106 Ga0070685_10066899 3300005466 Bacteria 2119
107 Ga0070685_10564111 3300005466 Bacteria 814
108 Ga0070685_11040744 3300005466 Bacteria 616
109 Ga0070706_100435330 3300005467 Bacteria 1220
110 Ga0070699_100296728 3300005518 Bacteria 1450
111 Ga0070679_100547796 3300005530 Bacteria 1100
112 Ga0070679_100729066 3300005530 Bacteria 934
113 Ga0070684_100001103 3300005535 Bacteria 19349
114 Ga0070684_100002388 3300005535 Bacteria 13835
115 Ga0068853_100006583 3300005539 Bacteria 9251
116 Ga0068853_100059888 3300005539 Bacteria 3289
117 Ga0068853_100216380 3300005539 Bacteria 1748
118 Ga0068853_100666422 3300005539 Bacteria 991
119 Ga0070672_100189874 3300005543 Bacteria 1715
120 Ga0070672_100456964 3300005543 Bacteria 1100
121 Ga0070672_100496916 3300005543 Bacteria 1055
122 Ga0070686_100433319 3300005544 Bacteria 1007
123 Ga0070695_100598073 3300005545 Bacteria 865
124 Ga0070696_100104735 3300005546 Bacteria 2031
125 Ga0070696_100311037 3300005546 Bacteria 1209
126 Ga0070696_101349092 3300005546 Bacteria 607
127 Ga0070693_100074539 3300005547 Bacteria 2008
128 Ga0070693_100114455 3300005547 Bacteria 1664
129 Ga0070665_100253572 3300005548 Bacteria 1760
130 Ga0070665_100577842 3300005548 Bacteria 1137
131 Ga0070665_101257530 3300005548 Bacteria 750
132 Ga0070704_100164776 3300005549 Bacteria 1756
133 Ga0070704_101858764 3300005549 Bacteria 558
134 Ga0070704_101873800 3300005549 Bacteria 555
135 Ga0068855_100258065 3300005563 Bacteria 1942
136 Ga0068855_101814449 3300005563 Bacteria 619
137 Ga0070664_100136572 3300005564 Bacteria 2157
138 Ga0068857_100001573 3300005577 Bacteria 18293
139 Ga0068857_100014391 3300005577 Bacteria 6897
140 Ga0068857_100091617 3300005577 Bacteria 2721
141 Ga0068854_100014310 3300005578 Bacteria 5228
142 Ga0068854_100655850 3300005578 Bacteria 901
143 Ga0068856_100036544 3300005614 Bacteria 4815
144 Ga0068856_100036931 3300005614 Bacteria 4791
145 Ga0068856_100178550 3300005614 Bacteria 2136
146 Ga0068856_100349140 3300005614 Bacteria 1498
147 Ga0068856_100623165 3300005614 Bacteria 1100
148 Ga0070702_100125631 3300005615 Bacteria 1612
149 Ga0070702_100187117 3300005615 Bacteria 1359
150 Ga0068852_100000597 3300005616 Bacteria 23714
151 Ga0068852_100048864 3300005616 Bacteria 3617
152 Ga0068852_100079677 3300005616 Bacteria 2902
153 Ga0068852_100251785 3300005616 Bacteria 1692
154 Ga0068852_101247754 3300005616 Bacteria 765
155 Ga0068852_102341947 3300005616 Bacteria 555
156 Ga0068859_100131751 3300005617 Bacteria 2572
157 Ga0068864_100008378 3300005618 Bacteria 8529
158 Ga0068864_100105778 3300005618 Bacteria 2501
159 Ga0068866_10035542 3300005718 Bacteria 2435
160 Ga0068866_10156972 3300005718 Bacteria 1323
161 Ga0068866_10325107 3300005718 Bacteria 969
162 Ga0068861_100227597 3300005719 Bacteria 1580
163 Ga0068861_100493125 3300005719 Bacteria 1106
164 Ga0068861_101210994 3300005719 Bacteria 731
165 Ga0068851_10000020 3300005834 Bacteria 133551
166 Ga0068851_10482748 3300005834 Bacteria 741
167 Ga0068870_10148610 3300005840 Bacteria 1378
168 Ga0068863_100309046 3300005841 Bacteria 1534
169 Ga0068863_101396625 3300005841 Bacteria 708
170 Ga0068858_100000233 3300005842 Bacteria 60097
171 Ga0068858_100587726 3300005842 Bacteria 1079
172 Ga0068858_101660799 3300005842 Bacteria 631
173 Ga0068862_100354671 3300005844 Bacteria 1362
174 Ga0081455_10001475 3300005937 Bacteria 29104
175 Ga0081455_10005778 3300005937 Bacteria 13485
176 Ga0081455_10009290 3300005937 Bacteria 10125
177 Ga0081455_10111098 3300005937 Bacteria 2178
178 Ga0081538_10004076 3300005981 Bacteria 13588
179 Ga0081538_10013765 3300005981 Bacteria 6389
180 Ga0081540_1000051 3300005983 Bacteria 126311
181 Ga0070717_10159243 3300006028 Bacteria 1958
182 Ga0075365_10318441 3300006038 Bacteria 1095
183 Ga0075368_10036445 3300006042 Bacteria 1921
184 Ga0075363_100730336 3300006048 Bacteria 599
185 Ga0075363_101042222 3300006048 Bacteria 505
186 Ga0075364_10045196 3300006051 Bacteria 2866
187 Ga0075364_10421120 3300006051 Bacteria 912
188 Ga0075432_10000136 3300006058 Bacteria 17018
189 Ga0075432_10002406 3300006058 Bacteria 6231
190 Ga0070716_100029558 3300006173 Bacteria 2964
191 Ga0070716_100106037 3300006173 Bacteria 1732
192 Ga0070712_100008557 3300006175 Bacteria 6438
193 Ga0070712_100025252 3300006175 Bacteria 3947
194 Ga0070712_100682729 3300006175 Bacteria 874
195 Ga0070712_101717600 3300006175 Bacteria 549
196 Ga0075367_10082328 3300006178 Bacteria 1948
197 Ga0075369_10075257 3300006186 Bacteria 1491
198 Ga0075369_10129325 3300006186 Bacteria 1147
199 Ga0097621_100518667 3300006237 Bacteria 1081
200 Ga0097621_100561538 3300006237 Bacteria 1040
201 Ga0097621_101426630 3300006237 Bacteria 656
202 Ga0075370_10028796 3300006353 Bacteria 3090
203 Ga0068871_101005833 3300006358 Bacteria 776
204 Ga0068871_101580778 3300006358 Bacteria 620
205 Ga0075428_100028282 3300006844 Bacteria 6201
206 Ga0075428_100075810 3300006844 Bacteria 3672
207 Ga0075428_100922769 3300006844 Bacteria 926
208 Ga0075430_100341679 3300006846 Bacteria 1236
209 Ga0075431_100984329 3300006847 Bacteria 811
210 Ga0075433_10005449 3300006852 Bacteria 9997
211 Ga0075433_10007152 3300006852 Bacteria 8838
212 Ga0075433_11035133 3300006852 Bacteria 715
213 Ga0075434_100004021 3300006871 Bacteria 13177
214 Ga0075434_100015459 3300006871 Bacteria 7319
215 Ga0075434_100162022 3300006871 Bacteria 2256
216 Ga0075434_101498932 3300006871 Bacteria 684
217 Ga0075429_100099381 3300006880 Bacteria 2539
218 Ga0068865_100029131 3300006881 Bacteria 3660
219 Ga0068865_100075309 3300006881 Bacteria 2406
220 Ga0068865_100110050 3300006881 Bacteria 2031
221 Ga0075436_100001576 3300006914 Bacteria 15562
222 Ga0075436_100302031 3300006914 Bacteria 1147
223 Ga0097620_100131762 3300006931 Bacteria 2572
224 Ga0075435_100010337 3300007076 Bacteria 6822
225 Ga0075435_100044819 3300007076 Bacteria 3544
226 Ga0075435_100185626 3300007076 Bacteria 1758
227 Ga0105240_10186255 3300009093 Bacteria 2445
228 Ga0105240_10239816 3300009093 Bacteria 2102
229 Ga0105240_10450382 3300009093 Bacteria 1440
230 Ga0105240_10813681 3300009093 Bacteria 1011
231 Ga0111539_10001727 3300009094 Bacteria 29086
232 Ga0111539_10049845 3300009094 Bacteria 4990
233 Ga0111539_12044160 3300009094 Bacteria 664
234 Ga0105245_10003836 3300009098 Bacteria 13372
235 Ga0105245_10117363 3300009098 Bacteria 2482
236 Ga0105245_10210002 3300009098 Bacteria 1873
237 Ga0105245_10333868 3300009098 Bacteria 1497
238 Ga0105245_10726273 3300009098 Bacteria 1028
239 Ga0105245_11201862 3300009098 Bacteria 806
240 Ga0105247_10106159 3300009101 Bacteria 1801
241 Ga0105247_10349118 3300009101 Bacteria 1040
242 Ga0105247_10406399 3300009101 Bacteria 971
243 Ga0105247_10654935 3300009101 Bacteria 785
244 Ga0114129_10018326 3300009147 Bacteria 9973
245 Ga0114129_11904435 3300009147 Bacteria 721
246 Ga0105243_10038474 3300009148 Bacteria 3725
247 Ga0105243_10060820 3300009148 Bacteria 3018
248 Ga0105243_10068606 3300009148 Bacteria 2858
249 Ga0105243_10251316 3300009148 Bacteria 1579
250 Ga0105243_10514474 3300009148 Bacteria 1137
251 Ga0105243_11329718 3300009148 Bacteria 737
252 Ga0105243_11578757 3300009148 Bacteria 682
253 Ga0105241_10689295 3300009174 Bacteria 931
254 Ga0105242_10719661 3300009176 Bacteria 979
255 Ga0105242_10840842 3300009176 Bacteria 912
256 Ga0105242_10959733 3300009176 Bacteria 860
257 Ga0105242_10974875 3300009176 Bacteria 854
258 Ga0105242_11326578 3300009176 Bacteria 744
259 Ga0105242_11485796 3300009176 Bacteria 708
260 Ga0105242_12139855 3300009176 Bacteria 604
261 Ga0105248_10000714 3300009177 Bacteria 37567
262 Ga0105248_10124344 3300009177 Bacteria 2910
263 Ga0105248_10779460 3300009177 Bacteria 1079
264 Ga0105248_11173624 3300009177 Bacteria 868
265 Ga0105248_12473920 3300009177 Bacteria 592
266 Ga0105237_10004850 3300009545 Bacteria 15451
267 Ga0105237_10017606 3300009545 Bacteria 7404
268 Ga0105237_10275379 3300009545 Bacteria 1686
269 Ga0105237_10342803 3300009545 Bacteria 1498
270 Ga0105237_11637515 3300009545 Bacteria 651
271 Ga0105237_12213485 3300009545 Bacteria 559
272 Ga0105238_10025081 3300009551 Bacteria 6077
273 Ga0105238_10671091 3300009551 Bacteria 1047
274 Ga0105238_10798224 3300009551 Bacteria 959
275 Ga0105238_10802593 3300009551 Bacteria 957
276 Ga0105238_11973357 3300009551 Bacteria 617
277 Ga0105249_10062245 3300009553 Bacteria 3426
278 Ga0105249_11116102 3300009553 Bacteria 859
279 Ga0105249_11792198 3300009553 Bacteria 686
280 Ga0105239_10025612 3300010375 Bacteria 6495
281 Ga0105239_10085922 3300010375 Bacteria 3468
282 Ga0105239_10199323 3300010375 Bacteria 2242
283 Ga0105239_11720509 3300010375 Bacteria 726
284 Ga0105246_10003686 3300011119 Bacteria 9277
285 Ga0105246_10015493 3300011119 Bacteria 4819
286 Ga0105246_11984245 3300011119 Bacteria 561
287 Ga0157340_1001221 3300012473 Bacteria 1143
288 Ga0157320_1005023 3300012481 Bacteria 866
289 Ga0157318_1016339 3300012482 Bacteria 616
290 Ga0157337_1006937 3300012483 Bacteria 797
291 Ga0157343_1013878 3300012488 Bacteria 655
292 Ga0157322_1005288 3300012490 Bacteria 881
293 Ga0157329_1008807 3300012491 Bacteria 761
294 Ga0157319_1017147 3300012497 Bacteria 666
295 Ga0157345_1013134 3300012498 Bacteria 757
296 Ga0157314_1003428 3300012500 Bacteria 1126
297 Ga0157342_1007024 3300012507 Bacteria 1083
298 Ga0157315_1005632 3300012508 Bacteria 948
299 Ga0157315_1006045 3300012508 Bacteria 932
300 Ga0157316_1000680 3300012510 Bacteria 1867
301 Ga0157338_1019928 3300012515 Bacteria 772
302 Ga0157373_10044700 3300013100 Bacteria 3162
303 Ga0157371_10003246 3300013102 Bacteria 14919
304 Ga0157371_10056380 3300013102 Bacteria 2787
305 Ga0157371_10420247 3300013102 Bacteria 980
306 Ga0157371_10575141 3300013102 Bacteria 836
307 Ga0157370_10210527 3300013104 Bacteria 1802
308 Ga0157370_11638624 3300013104 Bacteria 578
309 Ga0157369_10000356 3300013105 Bacteria 60939
310 Ga0157369_10249574 3300013105 Bacteria 1852
311 Ga0157369_10532775 3300013105 Bacteria 1214
312 Ga0157369_10826210 3300013105 Bacteria 951
313 Ga0157369_11057607 3300013105 Bacteria 830
314 Ga0157369_11258305 3300013105 Bacteria 755
315 Ga0157369_11825763 3300013105 Bacteria 617
316 Ga0157374_10211363 3300013296 Bacteria 1902
317 Ga0157374_10574927 3300013296 Bacteria 1136
318 Ga0157378_10649626 3300013297 Bacteria 1070
319 Ga0157378_10790561 3300013297 Bacteria 974
320 Ga0157378_12182629 3300013297 Bacteria 605
321 Ga0163162_10019044 3300013306 Bacteria 6732
322 Ga0163162_10104782 3300013306 Bacteria 2923
323 Ga0163162_10138023 3300013306 Bacteria 2550
324 Ga0163162_10335330 3300013306 Bacteria 1645
325 Ga0163162_10405006 3300013306 Bacteria 1497
326 Ga0163162_10809828 3300013306 Bacteria 1054
327 Ga0163162_11501573 3300013306 Bacteria 768
328 Ga0157372_10004567 3300013307 Bacteria 14738
329 Ga0157372_10077075 3300013307 Bacteria 3764
330 Ga0157372_10095359 3300013307 Bacteria 3390
331 Ga0157372_10221925 3300013307 Bacteria 2191
332 Ga0157372_10449594 3300013307 Bacteria 1501
333 Ga0157372_12374444 3300013307 Bacteria 609
334 Ga0157372_12432769 3300013307 Bacteria 601
335 Ga0157372_12512721 3300013307 Bacteria 591
336 Ga0157372_12679278 3300013307 Bacteria 572
337 Ga0157375_10004900 3300013308 Bacteria 11635
338 Ga0157375_10276183 3300013308 Bacteria 1843
339 Ga0157375_10378896 3300013308 Bacteria 1581
340 Ga0157375_10714588 3300013308 Bacteria 1155
341 Ga0157375_10789082 3300013308 Bacteria 1099
342 Ga0157375_11219451 3300013308 Bacteria 883
343 Ga0157375_12870329 3300013308 Bacteria 576
344 Ga0163163_10098983 3300014325 Bacteria 2937
345 Ga0163163_10234479 3300014325 Bacteria 1884
346 Ga0163163_10327849 3300014325 Bacteria 1585
347 Ga0163163_10400000 3300014325 Bacteria 1432
348 Ga0163163_13020501 3300014325 Bacteria 525
349 Ga0157380_10185669 3300014326 Bacteria 1831
350 Ga0157380_10397255 3300014326 Bacteria 1307
351 Ga0157380_10920471 3300014326 Bacteria 902
352 Ga0157380_11026023 3300014326 Bacteria 860
353 Ga0157380_11431003 3300014326 Bacteria 742
354 Ga0157380_11727725 3300014326 Bacteria 684
355 Ga0157380_12014725 3300014326 Bacteria 639
356 Ga0157377_10296253 3300014745 Bacteria 1066
357 Ga0157377_10361854 3300014745 Bacteria 977
358 Ga0157379_10003043 3300014968 Bacteria 14169
359 Ga0157379_10005293 3300014968 Bacteria 11087
360 Ga0157379_10017466 3300014968 Bacteria 6317
361 Ga0157379_10240080 3300014968 Bacteria 1644
362 Ga0157379_10787179 3300014968 Bacteria 897
363 Ga0157376_10334593 3300014969 Bacteria 1444
364 Ga0157376_10838136 3300014969 Bacteria 934
365 Ga0157376_11259618 3300014969 Bacteria 769
366 Ga0163161_10098660 3300017792 Bacteria 2172
367 Ga0163161_10185510 3300017792 Bacteria 1597
368 Ga0163161_10221502 3300017792 Bacteria 1465
369 Ga0163161_10396224 3300017792 Bacteria 1106
370 Ga0163161_10621271 3300017792 Bacteria 893
371 Ga0197907_10557023 3300020069 Bacteria 1350
372 Ga0197907_10825227 3300020069 Bacteria 771
373 Ga0206356_10605762 3300020070 Bacteria 1731
374 Ga0206351_10698115 3300020077 Bacteria 797
375 Ga0206350_10376196 3300020080 Bacteria 2563
376 Ga0206354_10711242 3300020081 Bacteria 1673
377 Ga0206354_11605514 3300020081 Bacteria 874
378 Ga0206353_11910771 3300020082 Bacteria 4430
379 Ga0206353_11952588 3300020082 Bacteria 927
380 Ga0224712_10079355 3300022467 Bacteria 1351
381 Ga0209674_116786 3300025226 Bacteria 605
382 Ga0207427_100028 3300025231 Bacteria 388949
383 Ga0209437_100211 3300025233 Bacteria 108544
384 Ga0207425_1019162 3300025245 Bacteria 1477
385 Ga0209677_101239 3300025253 Bacteria 11548
386 Ga0209129_1000047 3300025258 Bacteria 270566
387 Ga0209233_1000001 3300025261 Bacteria 2992747
388 Ga0209025_1005871 3300025294 Bacteria 9814
389 Ga0207656_10000012 3300025321 Bacteria 190545
390 Ga0207656_10332594 3300025321 Bacteria 756
391 Ga0207653_10011989 3300025885 Bacteria 2703
392 Ga0207692_10013072 3300025898 Bacteria 3590
393 Ga0207692_10018048 3300025898 Bacteria 3159
394 Ga0207692_10044198 3300025898 Bacteria 2221
395 Ga0207642_10031172 3300025899 Bacteria 2230
396 Ga0207642_10051070 3300025899 Bacteria 1869
397 Ga0207642_10597308 3300025899 Bacteria 686
398 Ga0207710_10027788 3300025900 Bacteria 2453
399 Ga0207710_10041006 3300025900 Bacteria 2052
400 Ga0207710_10285023 3300025900 Bacteria 832
401 Ga0207710_10419779 3300025900 Bacteria 688
402 Ga0207710_10578528 3300025900 Bacteria 586
403 Ga0207688_10018593 3300025901 Bacteria 3780
404 Ga0207688_10094911 3300025901 Bacteria 1716
405 Ga0207688_10162278 3300025901 Bacteria 1325
406 Ga0207688_10762337 3300025901 Bacteria 613
407 Ga0207680_10400175 3300025903 Bacteria 970
408 Ga0207680_10519559 3300025903 Bacteria 849
409 Ga0207647_10088566 3300025904 Bacteria 1848
410 Ga0207685_10011766 3300025905 Bacteria 2645
411 Ga0207699_10003399 3300025906 Bacteria 7591
412 Ga0207699_10164054 3300025906 Bacteria 1481
413 Ga0207643_10082713 3300025908 Bacteria 1862
414 Ga0207705_10013430 3300025909 Bacteria 5908
415 Ga0207705_10039084 3300025909 Bacteria 3400
416 Ga0207705_10048348 3300025909 Bacteria 3060
417 Ga0207705_10068281 3300025909 Bacteria 2574
418 Ga0207705_10077282 3300025909 Bacteria 2421
419 Ga0207705_10101254 3300025909 Bacteria 2119
420 Ga0207707_10183231 3300025912 Bacteria 1828
421 Ga0207695_10008321 3300025913 Bacteria 13000
422 Ga0207695_10525711 3300025913 Bacteria 1065
423 Ga0207695_11020018 3300025913 Bacteria 707
424 Ga0207671_10000002 3300025914 Bacteria 1144816
425 Ga0207671_10056397 3300025914 Bacteria 2911
426 Ga0207671_10350979 3300025914 Bacteria 1170
427 Ga0207693_10006333 3300025915 Bacteria 9811
428 Ga0207663_10021359 3300025916 Bacteria 3684
429 Ga0207662_10061831 3300025918 Bacteria 2249
430 Ga0207662_10693281 3300025918 Bacteria 713
431 Ga0207662_11052102 3300025918 Bacteria 578
432 Ga0207657_10004024 3300025919 Bacteria 15609
433 Ga0207657_10025831 3300025919 Bacteria 5408
434 Ga0207657_10067466 3300025919 Bacteria 3042
435 Ga0207657_10911982 3300025919 Bacteria 677
436 Ga0207649_10038640 3300025920 Bacteria 2891
437 Ga0207649_10128504 3300025920 Bacteria 1718
438 Ga0207649_10202859 3300025920 Bacteria 1402
439 Ga0207652_10531999 3300025921 Bacteria 1057
440 Ga0207652_10757483 3300025921 Bacteria 864
441 Ga0207681_10321877 3300025923 Bacteria 1230
442 Ga0207694_10000433 3300025924 Bacteria 38856
443 Ga0207694_10690380 3300025924 Bacteria 861
444 Ga0207694_11017336 3300025924 Bacteria 701
445 Ga0207659_10179001 3300025926 Bacteria 1678
446 Ga0207687_10015948 3300025927 Bacteria 4930
447 Ga0207687_10239696 3300025927 Bacteria 1437
448 Ga0207687_10349185 3300025927 Bacteria 1205
449 Ga0207687_10374773 3300025927 Bacteria 1165
450 Ga0207687_10977145 3300025927 Bacteria 726
451 Ga0207700_10004680 3300025928 Bacteria 8106
452 Ga0207700_10012617 3300025928 Bacteria 5458
453 Ga0207700_10327400 3300025928 Bacteria 1329
454 Ga0207664_10012310 3300025929 Bacteria 6110
455 Ga0207664_10016720 3300025929 Bacteria 5358
456 Ga0207664_11754587 3300025929 Bacteria 543
457 Ga0207644_10126877 3300025931 Bacteria 1948
458 Ga0207690_10000690 3300025932 Bacteria 21704
459 Ga0207690_10059613 3300025932 Bacteria 2586
460 Ga0207690_11572467 3300025932 Bacteria 550
461 Ga0207706_10067163 3300025933 Bacteria 3155
462 Ga0207706_10182308 3300025933 Bacteria 1844
463 Ga0207706_11098540 3300025933 Bacteria 665
464 Ga0207686_10138383 3300025934 Bacteria 1679
465 Ga0207686_11650509 3300025934 Bacteria 530
466 Ga0207709_10123794 3300025935 Bacteria 1750
467 Ga0207709_10230553 3300025935 Bacteria 1341
468 Ga0207709_10352947 3300025935 Bacteria 1111
469 Ga0207709_11674224 3300025935 Bacteria 529
470 Ga0207670_10132602 3300025936 Bacteria 1827
471 Ga0207669_10502704 3300025937 Bacteria 970
472 Ga0207669_11761622 3300025937 Bacteria 529
473 Ga0207704_10200751 3300025938 Bacteria 1459
474 Ga0207704_11259609 3300025938 Bacteria 631
475 Ga0207665_10010148 3300025939 Bacteria 6182
476 Ga0207665_10078675 3300025939 Bacteria 2265
477 Ga0207665_11345684 3300025939 Bacteria 569
478 Ga0207691_10073900 3300025940 Bacteria 3075
479 Ga0207691_10221732 3300025940 Bacteria 1639
480 Ga0207691_10371589 3300025940 Bacteria 1221
481 Ga0207691_11196157 3300025940 Bacteria 630
482 Ga0207711_10001344 3300025941 Bacteria 23198
483 Ga0207711_10150846 3300025941 Bacteria 2097
484 Ga0207711_11048847 3300025941 Bacteria 755
485 Ga0207689_10017378 3300025942 Bacteria 6087
486 Ga0207689_10934128 3300025942 Bacteria 732
487 Ga0207661_10122938 3300025944 Bacteria 2212
488 Ga0207661_11385065 3300025944 Bacteria 645
489 Ga0207661_11803525 3300025944 Bacteria 557
490 Ga0207661_12168249 3300025944 Bacteria 502
491 Ga0207679_10139893 3300025945 Bacteria 1955
492 Ga0207667_10003648 3300025949 Bacteria 18980
493 Ga0207667_10142518 3300025949 Bacteria 2467
494 Ga0207667_11306193 3300025949 Bacteria 702
495 Ga0207712_10100114 3300025961 Bacteria 2153
496 Ga0207712_11638582 3300025961 Bacteria 577
497 Ga0207712_12005523 3300025961 Bacteria 518
498 Ga0207668_10082992 3300025972 Bacteria 2331
499 Ga0207668_10214236 3300025972 Bacteria 1542
500 Ga0207640_10069912 3300025981 Bacteria 2359
501 Ga0207658_10025692 3300025986 Bacteria 4124
502 Ga0207658_10139643 3300025986 Bacteria 1959
503 Ga0207658_11264201 3300025986 Bacteria 675
504 Ga0207677_10384459 3300026023 Bacteria 1185
505 Ga0207677_10712085 3300026023 Bacteria 892
506 Ga0207703_10000044 3300026035 Bacteria 158471
507 Ga0207703_10669170 3300026035 Bacteria 986
508 Ga0207639_10029843 3300026041 Bacteria 3996
509 Ga0207639_10081260 3300026041 Bacteria 2567
510 Ga0207639_10114593 3300026041 Bacteria 2203
511 Ga0207639_10373779 3300026041 Bacteria 1278
512 Ga0207639_10953785 3300026041 Bacteria 803
513 Ga0207639_11227981 3300026041 Bacteria 703
514 Ga0207678_10005013 3300026067 Bacteria 11879
515 Ga0207678_10264120 3300026067 Bacteria 1475
516 Ga0207678_10760526 3300026067 Bacteria 854
517 Ga0207678_11124316 3300026067 Bacteria 695
518 Ga0207708_10050227 3300026075 Bacteria 3175
519 Ga0207708_10058881 3300026075 Bacteria 2931
520 Ga0207708_10074252 3300026075 Bacteria 2606
521 Ga0207702_10013174 3300026078 Bacteria 6875
522 Ga0207702_10222140 3300026078 Bacteria 1761
523 Ga0207702_10548597 3300026078 Bacteria 1130
524 Ga0207702_10577580 3300026078 Bacteria 1101
525 Ga0207702_10774554 3300026078 Bacteria 948
526 Ga0207702_11067570 3300026078 Bacteria 801
527 Ga0207641_10001733 3300026088 Bacteria 21055
528 Ga0207641_10034591 3300026088 Bacteria 4205
529 Ga0207641_10367700 3300026088 Bacteria 1374
530 Ga0207641_11761506 3300026088 Bacteria 621
531 Ga0207648_10019076 3300026089 Bacteria 6193
532 Ga0207648_10544573 3300026089 Bacteria 1065
533 Ga0207648_10823358 3300026089 Bacteria 865
534 Ga0207676_10304754 3300026095 Bacteria 1456
535 Ga0207676_10350780 3300026095 Bacteria 1364
536 Ga0207676_12149845 3300026095 Bacteria 556
537 Ga0207674_10005505 3300026116 Bacteria 15034
538 Ga0207674_10013706 3300026116 Bacteria 8977
539 Ga0207674_10078956 3300026116 Bacteria 3296
540 Ga0207675_100109807 3300026118 Bacteria 2603
541 Ga0207675_100160490 3300026118 Bacteria 2144
542 Ga0207675_100251852 3300026118 Bacteria 1709
543 Ga0207675_100483873 3300026118 Bacteria 1230
544 Ga0207683_10002264 3300026121 Bacteria 16869
545 Ga0207683_10360498 3300026121 Bacteria 1335
546 Ga0207683_10765696 3300026121 Bacteria 896
547 Ga0207683_11036628 3300026121 Bacteria 761
548 Ga0207683_11746088 3300026121 Bacteria 571
549 Ga0207698_10000269 3300026142 Bacteria 31515
550 Ga0207698_10008328 3300026142 Bacteria 6551
551 Ga0207698_10124834 3300026142 Bacteria 2187
552 Ga0207698_10598033 3300026142 Bacteria 1087
553 Ga0207698_11602754 3300026142 Bacteria 666
554 Ga0209813_10202294 3300027866 Bacteria 736
555 Ga0207428_10001284 3300027907 Bacteria 26882
556 Ga0207428_10001525 3300027907 Bacteria 24188
557 Ga0207428_11040371 3300027907 Bacteria 574
558 Ga0268266_12135880 3300028379 Bacteria 532
559 Ga0268265_10563962 3300028380 Bacteria 1083
560 Ga0268264_10584575 3300028381 Bacteria 1099
561 Ga0268264_10708198 3300028381 Bacteria 1000
562 Ga0268264_10751506 3300028381 Bacteria 971
563 Ga0265320_10039832 3300031240 Bacteria 2347
564 Ga0265327_10238976 3300031251 Bacteria 812
565 Ga0307408_100015791 3300031548 Bacteria 5031
566 Ga0307408_100593880 3300031548 Bacteria 983
567 Ga0307408_100731909 3300031548 Bacteria 892
568 Ga0307514_10076490 3300031649 Bacteria 2493
569 Ga0307405_10117806 3300031731 Bacteria 1811
570 Ga0307405_10269253 3300031731 Bacteria 1276
571 Ga0307413_10006705 3300031824 Bacteria 5285
572 Ga0307413_10084939 3300031824 Bacteria 2042
573 Ga0307413_11077281 3300031824 Bacteria 693
574 Ga0307413_11461864 3300031824 Bacteria 603
575 Ga0307410_10007959 3300031852 Bacteria 5843
576 Ga0307410_10051292 3300031852 Bacteria 2780
577 Ga0307410_11083223 3300031852 Bacteria 694
578 Ga0307410_11642353 3300031852 Bacteria 568
579 Ga0307406_10002700 3300031901 Bacteria 9673
580 Ga0307406_10007635 3300031901 Bacteria 6005
581 Ga0307406_10033716 3300031901 Bacteria 3136
582 Ga0307406_10679537 3300031901 Bacteria 857
583 Ga0307406_10765884 3300031901 Bacteria 812
584 Ga0307407_10025529 3300031903 Bacteria 3115
585 Ga0307407_10041438 3300031903 Bacteria 2575
586 Ga0307407_10238290 3300031903 Bacteria 1240
587 Ga0307407_10270955 3300031903 Bacteria 1172
588 Ga0307407_10393425 3300031903 Bacteria 992
589 Ga0307412_10484887 3300031911 Bacteria 1026
590 Ga0307409_100012048 3300031995 Bacteria 5489
591 Ga0307409_100354787 3300031995 Bacteria 1385
592 Ga0307409_100375535 3300031995 Bacteria 1350
593 Ga0307409_100414271 3300031995 Bacteria 1291
594 Ga0307409_100753840 3300031995 Bacteria 977
595 Ga0307409_102648302 3300031995 Bacteria 530
596 Ga0307416_100053296 3300032002 Bacteria 3244
597 Ga0307416_100517581 3300032002 Bacteria 1261
598 Ga0307416_100575660 3300032002 Bacteria 1202
599 Ga0307416_100772248 3300032002 Bacteria 1055
600 Ga0307416_100798496 3300032002 Bacteria 1039
601 Ga0307416_101275772 3300032002 Bacteria 840
602 Ga0307416_102365648 3300032002 Bacteria 631
603 Ga0307414_10015974 3300032004 Bacteria 4549
604 Ga0307414_10446593 3300032004 Bacteria 1133
605 Ga0307414_10719458 3300032004 Bacteria 905
606 Ga0307414_10934712 3300032004 Bacteria 796
607 Ga0307414_11207095 3300032004 Bacteria 700
608 Ga0307414_11313065 3300032004 Bacteria 671
609 Ga0307411_10090170 3300032005 Bacteria 2138
610 Ga0307411_10231714 3300032005 Bacteria 1440
611 Ga0307411_10287120 3300032005 Bacteria 1313
612 Ga0307411_10329979 3300032005 Bacteria 1236
613 Ga0307411_10330455 3300032005 Bacteria 1235
614 Ga0307411_11582496 3300032005 Bacteria 604
615 Ga0307415_100139679 3300032126 Bacteria 1848
616 Ga0307415_100501717 3300032126 Bacteria 1061
617 Ga0307415_101694917 3300032126 Bacteria 609
618 Ga0373926_0010531 3300035083 Bacteria 3100
619 Ga0373934_0007671 3300035086 Bacteria 4008
620 Ga0373944_0001860 3300035089 Bacteria 5325
621 Ga0373949_0018196 3300035090 Bacteria 1591
622 Ga0373952_0116896 3300035092 Bacteria 719
623 Ga0373952_0211338 3300035092 Bacteria 572
624 Ga0373923_0000367 3300035111 Bacteria 10260
625 Ga0373936_0000674 3300035113 Bacteria 11861
626 Ga0373939_0046555 3300035114 Bacteria 1328
627 Ga0373941_0020839 3300035115 Bacteria 1843
628 Ga0373945_0000598 3300035116 Bacteria 10357
629 Ga0373953_0004098 3300035117 Bacteria 4617
630 Ga0373954_0006760 3300035118 Bacteria 5005
631 Ga0373956_0096518 3300035119 Bacteria 1367
632 Ga0373960_0021419 3300035121 Bacteria 1719
633 Ga0373960_0137873 3300035121 Bacteria 824
634 Ga0373943_0000724 3300035170 Bacteria 14450
635 Ga0373943_0610386 3300035170 Bacteria 643
636 Ga0373946_0086963 3300035171 Bacteria 1379
637 Ga0373955_0009172 3300035172 Bacteria 4625
638 Ga0373942_0040588 3300035207 Bacteria 1270
639 Ga0373961_0294062 3300035241 Bacteria 599
640 Ga0373924_0000394 3300035410 Bacteria 13412
641 Ga0373931_0035754 3300035691 Bacteria 2584
642 Ga0373931_1164342 3300035691 Bacteria 527
643 Ga0373935_0001407 3300035692 Bacteria 13333
644 Ga0373935_1485371 3300035692 Bacteria 507
645 Ga0373927_0001565 3300035695 Bacteria 17144
646 Ga0373927_0350619 3300035695 Bacteria 973
647 Ga0373927_0426119 3300035695 Bacteria 876
648 Ga0373933_0008451 3300035724 Bacteria 5615
649 Ga0373947_0001322 3300035725 Bacteria 15249
650 Ga0373947_0227788 3300035725 Bacteria 1227
651 Ga0373937_0016605 3300036401 Bacteria 6540
652 Ga0373925_0021520 3300037068 Bacteria 4699
653 Ga0395899_0018679 3300037312 Bacteria 5268
654 Ga0395900_0003464 3300037418 Bacteria 17036
655 Ga0395900_0619137 3300037418 Bacteria 1021
656 Ga0395900_1318181 3300037418 Bacteria 636
657 Ga0395898_0000015 3300037466 Bacteria 439819
658 Ga0395898_0392224 3300037466 Bacteria 1324
659 Ga0395898_1413127 3300037466 Bacteria 623
660 Ga0395901_0050789 3300038443 Bacteria 4307
661 Ga0395901_0284798 3300038443 Bacteria 1716
662 Ga0439465_0019640 3300041413 Bacteria 2113
663 Ga0451787_604139 3300041441 Bacteria 521
664 Ga0451787_605597 3300041441 Bacteria 884
665 Ga0451787_737160 3300041441 Bacteria 527
666 Ga0451789_0430189 3300041443 Bacteria 891
667 Ga0451789_1286349 3300041443 Bacteria 555
668 Ga0451793_1667579 3300041452 Bacteria 546
669 Ga0451797_0677432 3300041453 Bacteria 706
670 Ga0451835_0010124 3300041492 Bacteria 522
671 Ga0451837_0275620 3300041494 Bacteria 725
672 Ga0451841_0562518 3300041498 Bacteria 708
673 Ga0451847_0140216 3300041503 Bacteria 672
674 Ga0451843_0069868 3300041509 Bacteria 1048
675 Ga0451843_0448277 3300041509 Bacteria 668
676 Ga0451843_0669537 3300041509 Bacteria 605
677 Ga0451843_0797638 3300041509 Bacteria 630
678 Ga0451853_0890225 3300041512 Bacteria 640
679 Ga0451853_1028530 3300041512 Bacteria 1253
680 Ga0439442_006204 3300042002 Bacteria 2398
681 Ga0439442_006466 3300042002 Bacteria 2353
682 Ga0439445_0231550 3300042004 Bacteria 550
683 Ga0439448_0025669 3300042005 Bacteria 1849
684 Ga0439448_0071739 3300042005 Bacteria 1154
685 Ga0439449_0100329 3300042007 Bacteria 1070
686 Ga0439449_0312434 3300042007 Bacteria 594
687 Ga0439450_004633 3300042008 Bacteria 2362
688 Ga0439454_055028 3300042011 Bacteria 680
689 Ga0439455_0025634 3300042012 Bacteria 1434
690 Ga0439455_0133469 3300042012 Bacteria 701
691 Ga0439463_002010 3300042016 Bacteria 5284
692 Ga0439463_086646 3300042016 Bacteria 806
693 Ga0450920_035566 3300042122 Bacteria 986
694 Ga0450923_044497 3300042125 Bacteria 941
695 Ga0450890_042401 3300042127 Bacteria 677
696 Ga0450906_048511 3300042145 Bacteria 749
697 Ga0450908_108353 3300042184 Bacteria 512
698 Ga0439444_0016296 3300042437 Bacteria 1264
699 Ga0439464_0066057 3300042439 Bacteria 1065
700 Ga0439460_0198318 3300042461 Bacteria 683
701 Ga0450901_021754 3300042533 Bacteria 690
702 Ga0451577_0653749 3300042876 Bacteria 953
703 Ga0466972_0012105 3300044658 Bacteria 4334
704 Ga0466972_0127277 3300044658 Bacteria 1200
705 Ga0453683_0053958 3300044673 Bacteria 2516
706 Ga0466965_0000016 3300044683 Bacteria 81402
707 Ga0466965_0061263 3300044683 Bacteria 1881
708 Ga0466966_0035728 3300044684 Bacteria 3209
709 Ga0466961_0019240 3300044693 Bacteria 4395
710 Ga0466968_0003766 3300044735 Bacteria 5619
711 Ga0466970_0014509 3300044765 Bacteria 4046
712 Ga0466957_0013971 3300044842 Bacteria 4669
713 Ga0466960_0280481 3300044901 Bacteria 934
714 Ga0466959_0028311 3300045049 Bacteria 4155
715 Ga0451576_1584131 3300045051 Bacteria 680
716 Ga0495592_0028688 3300046454 Bacteria 4212
717 Ga0495603_0001187 3300046455 Bacteria 15195
718 Ga0495603_0355256 3300046455 Bacteria 841
719 Ga0495629_0001672 3300046459 Bacteria 17412
720 Ga0495638_0254418 3300046460 Bacteria 967
721 Ga0495641_0003984 3300046461 Bacteria 10713
722 Ga0495641_0067898 3300046461 Bacteria 1603
723 Ga0495651_0003789 3300046462 Bacteria 11566
724 Ga0495653_0041688 3300046463 Bacteria 3581
725 Ga0495653_0350770 3300046463 Bacteria 949
726 Ga0495580_0006947 3300046472 Bacteria 9131
727 Ga0495582_0002389 3300046473 Bacteria 10493
728 Ga0495582_0802875 3300046473 Bacteria 544
729 Ga0495639_0010448 3300046475 Bacteria 3999
730 Ga0495639_0222399 3300046475 Bacteria 928
731 Ga0495662_0008459 3300046476 Bacteria 5062
732 Ga0495664_0004030 3300046477 Bacteria 8014
733 Ga0495664_0060441 3300046477 Bacteria 2256
734 Ga0495594_0195282 3300046499 Bacteria 1153
735 Ga0495594_0383329 3300046499 Bacteria 800
736 Ga0495596_0191182 3300046500 Bacteria 796
737 Ga0495607_0327574 3300046501 Bacteria 713
738 Ga0495608_0040941 3300046511 Bacteria 3102
739 Ga0495616_0405294 3300046513 Bacteria 560
740 Ga0495618_0003119 3300046514 Bacteria 10437
741 Ga0495628_0025750 3300046516 Bacteria 4803
742 Ga0495630_0028520 3300046517 Bacteria 4147
743 Ga0495631_0091325 3300046518 Bacteria 1311
744 Ga0495637_0348268 3300046520 Bacteria 520
745 Ga0495643_0497387 3300046522 Bacteria 525
746 Ga0495644_0162405 3300046523 Bacteria 857
747 Ga0495666_0159731 3300046526 Bacteria 1045
748 Ga0495652_0008982 3300046529 Bacteria 9092
749 Ga0495665_0004883 3300046531 Bacteria 7227
750 Ga0495640_0023607 3300046533 Bacteria 4476
751 Ga0495586_0014085 3300046535 Bacteria 4248
752 Ga0495586_0173486 3300046535 Bacteria 1218
753 Ga0495587_0006125 3300046536 Bacteria 7851
754 Ga0495598_0384669 3300046537 Bacteria 546
755 Ga0495598_0416206 3300046537 Bacteria 527
756 Ga0495645_0012237 3300046543 Bacteria 6043
757 Ga0495645_0211264 3300046543 Bacteria 1310
758 Ga0495622_0288725 3300046557 Bacteria 716
759 Ga0495667_0014137 3300046559 Bacteria 5387
760 Ga0495634_0045885 3300046642 Bacteria 2951
761 Ga0495635_0016436 3300046663 Bacteria 5168
762 Ga0495588_0217201 3300046674 Bacteria 1009
763 Ga0495588_0548106 3300046674 Bacteria 606
764 Ga0495657_0015830 3300046675 Bacteria 5508
765 Ga0495599_0004443 3300046678 Bacteria 8300
766 Ga0495623_0006192 3300046679 Bacteria 7776
767 Ga0495646_0013069 3300046680 Bacteria 5276
768 Ga0495647_0181720 3300046681 Bacteria 915
769 Ga0495658_0003027 3300046683 Bacteria 8420
770 Ga0495658_0684990 3300046683 Bacteria 657
771 Ga0495658_0739174 3300046683 Bacteria 630
772 Ga0495613_0008109 3300046689 Bacteria 7809
773 Ga0495613_0238942 3300046689 Bacteria 1271
774 Ga0495624_0004181 3300046690 Bacteria 10611
775 Ga0495671_0401055 3300046692 Bacteria 657
776 Ga0495600_0004051 3300046809 Bacteria 8711
777 Ga0495600_0442402 3300046809 Bacteria 805
778 Ga0495581_0003256 3300047315 Bacteria 9309
779 Ga0495604_0004523 3300047317 Bacteria 11014
780 Ga0495674_0129631 3300047319 Bacteria 2125
781 Ga0495674_0334710 3300047319 Bacteria 1231
782 Ga0495672_0140544 3300047320 Bacteria 1261
783 Ga0495676_0003026 3300047321 Bacteria 15199
784 Ga0495676_0530742 3300047321 Bacteria 770
785 Ga0495677_0259950 3300047445 Bacteria 680
786 Ga0495684_0008710 3300047471 Bacteria 7845
787 Ga0495686_0067133 3300047472 Bacteria 2215
788 Ga0495686_0249070 3300047472 Bacteria 999
789 Ga0495593_0001731 3300047673 Bacteria 12927
790 Ga0495593_0050313 3300047673 Bacteria 2208
791 Ga0495602_0010671 3300048088 Bacteria 9530
792 Ga0495614_0051345 3300048089 Bacteria 1767
793 Ga0496100_0002276 3300048903 Bacteria 9702
794 Ga0496100_0060723 3300048903 Bacteria 2488
795 Ga0496100_0109283 3300048903 Bacteria 1918
796 Ga0496100_0510828 3300048903 Bacteria 927
797 Ga0496101_0003922 3300048904 Bacteria 9298
798 Ga0496101_0016066 3300048904 Bacteria 5053
799 Ga0496101_0064914 3300048904 Bacteria 2660
800 Ga0496101_0094865 3300048904 Bacteria 2224
801 Ga0496101_0103951 3300048904 Bacteria 2130
802 Ga0496101_0182095 3300048904 Bacteria 1618
803 Ga0496101_0575078 3300048904 Bacteria 891
804 Ga0496101_0589141 3300048904 Bacteria 879
805 Ga0496101_0725201 3300048904 Bacteria 785
806 Ga0496102_0000017 3300048905 Bacteria 284200
807 Ga0496102_0004090 3300048905 Bacteria 12362
808 Ga0496102_0017204 3300048905 Bacteria 6330
809 Ga0496102_0063643 3300048905 Bacteria 3378
810 Ga0496102_0160514 3300048905 Bacteria 2114
811 Ga0496102_0163030 3300048905 Bacteria 2097
812 Ga0496102_0407209 3300048905 Bacteria 1278
813 Ga0496102_0498331 3300048905 Bacteria 1140
814 Ga0496102_1591864 3300048905 Bacteria 572
815 Ga0496103_0000041 3300048906 Bacteria 169542
816 Ga0496103_0040842 3300048906 Bacteria 2851
817 Ga0496103_0049332 3300048906 Bacteria 2603
818 Ga0496103_0119576 3300048906 Bacteria 1677
819 Ga0496103_0324799 3300048906 Bacteria 990
820 Ga0496103_0494846 3300048906 Bacteria 783
821 Ga0496104_0001879 3300048907 Bacteria 18186
822 Ga0496104_0008855 3300048907 Bacteria 8945
823 Ga0496104_0068414 3300048907 Bacteria 3375
824 Ga0496104_0169506 3300048907 Bacteria 2093
825 Ga0496104_0388797 3300048907 Bacteria 1307
826 Ga0496104_0493559 3300048907 Bacteria 1136
827 Ga0496104_0725594 3300048907 Bacteria 901
828 Ga0496104_1201460 3300048907 Bacteria 661
829 Ga0496104_1373897 3300048907 Bacteria 609
830 Ga0496105_0001766 3300048908 Bacteria 15463
831 Ga0496105_0009627 3300048908 Bacteria 7563
832 Ga0496105_0011284 3300048908 Bacteria 7052
833 Ga0496105_0037487 3300048908 Bacteria 3992
834 Ga0496105_0067927 3300048908 Bacteria 2944
835 Ga0496105_0089820 3300048908 Bacteria 2538
836 Ga0496105_0133549 3300048908 Bacteria 2045
837 Ga0496105_0134802 3300048908 Bacteria 2034
838 Ga0496105_0266567 3300048908 Bacteria 1384
839 Ga0496106_0006289 3300048909 Bacteria 8792
840 Ga0496106_1039035 3300048909 Bacteria 643
841 Ga0496107_0011513 3300048910 Bacteria 6162
842 Ga0496107_0018120 3300048910 Bacteria 4954
843 Ga0496107_0046146 3300048910 Bacteria 3135
844 Ga0496107_0069628 3300048910 Bacteria 2554
845 Ga0496107_0071209 3300048910 Bacteria 2526
846 Ga0496107_0327491 3300048910 Bacteria 1140
847 Ga0496108_0002013 3300048911 Bacteria 16278
848 Ga0496108_0002520 3300048911 Bacteria 14655
849 Ga0496108_0023704 3300048911 Bacteria 5050
850 Ga0496108_0119728 3300048911 Bacteria 2257
851 Ga0496108_0202211 3300048911 Bacteria 1724
852 Ga0496108_0293672 3300048911 Bacteria 1415
853 Ga0496108_0442988 3300048911 Bacteria 1135
854 Ga0496108_0517783 3300048911 Bacteria 1041
855 Ga0496108_0633775 3300048911 Bacteria 930
856 Ga0496108_0936314 3300048911 Bacteria 742
857 Ga0496108_1064257 3300048911 Bacteria 689
858 Ga0496108_1613647 3300048911 Bacteria 536
859 Ga0496109_0036204 3300048912 Bacteria 4454
860 Ga0496109_0066031 3300048912 Bacteria 3312
861 Ga0496109_0110390 3300048912 Bacteria 2557
862 Ga0496109_0141753 3300048912 Bacteria 2247
863 Ga0496109_0178250 3300048912 Bacteria 1995
864 Ga0496109_0346851 3300048912 Bacteria 1402
865 Ga0496109_0372903 3300048912 Bacteria 1348
866 Ga0496109_0483898 3300048912 Bacteria 1168
867 Ga0496109_1470597 3300048912 Bacteria 616
868 Ga0496109_1971554 3300048912 Bacteria 516
869 Ga0496110_0002211 3300048913 Bacteria 14540
870 Ga0496110_0006460 3300048913 Bacteria 9289
871 Ga0496110_0010855 3300048913 Bacteria 7428
872 Ga0496110_0097958 3300048913 Bacteria 2627
873 Ga0496110_0109033 3300048913 Bacteria 2486
874 Ga0496110_0185434 3300048913 Bacteria 1889
875 Ga0496110_0983943 3300048913 Bacteria 751
876 Ga0496111_0000481 3300048914 Bacteria 20447
877 Ga0496111_0064765 3300048914 Bacteria 2652
878 Ga0496111_0122802 3300048914 Bacteria 1918
879 Ga0496111_0170158 3300048914 Bacteria 1619
880 Ga0496111_0312240 3300048914 Bacteria 1165
881 Ga0496111_0397223 3300048914 Bacteria 1019
882 Ga0496111_0430079 3300048914 Bacteria 975
883 Ga0496111_0736629 3300048914 Bacteria 716
884 Ga0496111_1111893 3300048914 Bacteria 563
885 Ga0496112_0007896 3300048915 Bacteria 9479
886 Ga0496112_0091055 3300048915 Bacteria 3019
887 Ga0496112_0185216 3300048915 Bacteria 2045
888 Ga0496112_0347519 3300048915 Bacteria 1426
889 Ga0496113_0065170 3300048916 Bacteria 2756
890 Ga0496113_0124461 3300048916 Bacteria 2018
891 Ga0496113_0162548 3300048916 Bacteria 1766
892 Ga0496113_0375339 3300048916 Bacteria 1141
893 Ga0496114_0004969 3300048917 Bacteria 10371
894 Ga0496114_0009643 3300048917 Bacteria 7668
895 Ga0496114_0038495 3300048917 Bacteria 3957
896 Ga0496114_0058447 3300048917 Bacteria 3220
897 Ga0496114_0105577 3300048917 Bacteria 2409
898 Ga0496114_0135406 3300048917 Bacteria 2130
899 Ga0496114_0148871 3300048917 Bacteria 2030
900 Ga0496114_0267808 3300048917 Bacteria 1505
901 Ga0496114_0275019 3300048917 Bacteria 1484
902 Ga0496114_0319135 3300048917 Bacteria 1372
903 Ga0496114_0342852 3300048917 Bacteria 1321
904 Ga0496114_0362624 3300048917 Bacteria 1282
905 Ga0496114_0389006 3300048917 Bacteria 1235
906 Ga0496114_0394639 3300048917 Bacteria 1225
907 Ga0496114_0400609 3300048917 Bacteria 1215
908 Ga0496114_0453716 3300048917 Bacteria 1135
909 Ga0496114_0500835 3300048917 Bacteria 1074
910 Ga0496114_0852297 3300048917 Bacteria 791
911 Ga0496114_1136690 3300048917 Bacteria 666
912 Ga0496115_0021354 3300048918 Bacteria 5001
913 Ga0496115_0036198 3300048918 Bacteria 3907
914 Ga0496115_0051666 3300048918 Bacteria 3295
915 Ga0496115_0071864 3300048918 Bacteria 2806
916 Ga0496115_0091204 3300048918 Bacteria 2490
917 Ga0496115_0175562 3300048918 Bacteria 1771
918 Ga0496115_0264995 3300048918 Bacteria 1412
919 Ga0496115_0470497 3300048918 Bacteria 1013
920 Ga0496115_0827928 3300048918 Bacteria 718
921 Ga0496116_0000121 3300048919 Bacteria 166606
922 Ga0496117_0000084 3300048920 Bacteria 214308
923 Ga0496117_0000163 3300048920 Bacteria 140644
924 Ga0496117_0006658 3300048920 Bacteria 11578
925 Ga0496117_0107087 3300048920 Bacteria 1752
926 Ga0496117_0119388 3300048920 Bacteria 1623
927 Ga0496117_0510275 3300048920 Bacteria 581
928 Ga0496118_0000057 3300048921 Bacteria 228315
929 Ga0496118_0039278 3300048921 Bacteria 3779
930 Ga0496118_0055293 3300048921 Bacteria 2997
931 Ga0496118_0247370 3300048921 Bacteria 1016
932 Ga0496119_0005258 3300048922 Bacteria 12479
933 Ga0496119_0236784 3300048922 Bacteria 926
934 Ga0496120_0001463 3300048923 Bacteria 28189
935 Ga0496120_0012737 3300048923 Bacteria 5703
936 Ga0496120_0061739 3300048923 Bacteria 2090
937 Ga0496121_0003923 3300048924 Bacteria 20623
938 Ga0496121_0007250 3300048924 Bacteria 13422
939 Ga0496122_0009222 3300048925 Bacteria 10443
940 Ga0496122_0054789 3300048925 Bacteria 2991
941 Ga0496122_0119691 3300048925 Bacteria 1702
942 Ga0496122_0156462 3300048925 Bacteria 1398
943 Ga0496123_0009772 3300048926 Bacteria 8573
944 Ga0496123_0010117 3300048926 Bacteria 8386
945 Ga0496123_0509208 3300048926 Bacteria 524
946 Ga0496124_0113217 3300048927 Bacteria 2180
947 Ga0496124_0153440 3300048927 Bacteria 1804
948 Ga0496124_0298588 3300048927 Bacteria 1165
949 Ga0496124_0349403 3300048927 Bacteria 1047
950 Ga0496125_0061576 3300048928 Bacteria 3008
951 Ga0496125_0256621 3300048928 Bacteria 1099
952 Ga0496125_0586879 3300048928 Bacteria 611
953 Ga0496126_0000135 3300048929 Bacteria 169551
954 Ga0496126_0001669 3300048929 Bacteria 33303
955 Ga0496126_0027360 3300048929 Bacteria 5448
956 Ga0496126_0198808 3300048929 Bacteria 1694
957 Ga0496126_0208866 3300048929 Bacteria 1645
958 Ga0496126_0223397 3300048929 Bacteria 1581
959 Ga0496126_0511642 3300048929 Bacteria 958
960 Ga0501031_0540692 3300049568 Bacteria 751
961 Ga0501032_0040496 3300049569 Bacteria 3167
962 Ga0501032_0757167 3300049569 Bacteria 614
963 Ga0501033_0161417 3300049570 Bacteria 1613
964 Ga0501034_0001761 3300049571 Bacteria 27727
965 Ga0501034_0827167 3300049571 Bacteria 817
966 Ga0501037_0535650 3300049573 Bacteria 791
967 Ga0501038_0172701 3300049574 Bacteria 1748
968 Ga0501039_0062359 3300049575 Bacteria 2888
969 Ga0501039_0364228 3300049575 Bacteria 1136
970 Ga0501043_0294241 3300049579 Bacteria 1242
971 Ga0501046_0088447 3300049580 Bacteria 2385
972 Ga0501047_0270821 3300049581 Bacteria 1544
973 Ga0501070_0001101 3300049586 Bacteria 24235
974 Ga0501070_0049085 3300049586 Bacteria 3505
975 Ga0501282_030085 3300049778 Bacteria 620
976 Ga0501035_0120750 3300049822 Bacteria 2291
977 Ga0501035_0420223 3300049822 Bacteria 1110
978 Ga0501044_0138867 3300049823 Bacteria 2419
979 Ga0501044_0380440 3300049823 Bacteria 1327
980 nmdc:mga03683_417542_c1 3300050489 Bacteria 642
981 nmdc:mga03n38_116147_c1 3300050490 Bacteria 1309
982 nmdc:mga00v17_196980_c1 3300050491 Bacteria 1302
983 nmdc:mga0yw44_196464_c1 3300050492 Bacteria 1331
984 nmdc:mga0yw44_319336_c1 3300050492 Bacteria 1043
985 nmdc:mga0yw44_341161_c1 3300050492 Bacteria 1008
986 nmdc:mga06z11_240180_c1 3300050494 Bacteria 1064
987 nmdc:mga04h51_71376_c1 3300050495 Bacteria 1213
988 nmdc:mga07m45_31881_c1 3300050496 Bacteria 2921
989 nmdc:mga07m45_492315_c1 3300050496 Bacteria 710
990 nmdc:mga05p37_23752_c1 3300050507 Bacteria 7445
991 nmdc:mga09592_1620630_c1 3300050508 Bacteria 524
992 nmdc:mga08y16_1901977_c1 3300050511 Bacteria 546
993 nmdc:mga08y16_33806_c1 3300050511 Bacteria 5371
994 nmdc:mga08y16_827806_c1 3300050511 Bacteria 916
995 nmdc:mga0n895_160103_c1 3300050512 Bacteria 2283
996 nmdc:mga0n895_19256_c1 3300050512 Bacteria 6340
997 nmdc:mga0n895_415041_c1 3300050512 Bacteria 1361
998 nmdc:mga0rr50_53114_c1 3300050513 Bacteria 3014
999 nmdc:mga0rr50_60982_c1 3300050513 Bacteria 2840
1000 nmdc:mga08x19_114880_c1 3300050514 Bacteria 1799
1001 nmdc:mga08x19_116411_c1 3300050514 Bacteria 1787
1002 nmdc:mga08x19_13651_c1 3300050514 Bacteria 4915
1003 nmdc:mga0a205_5837_c1 3300050515 Bacteria 11092
1004 nmdc:mga0a205_7200_c1 3300050515 Bacteria 10059
1005 nmdc:mga0a205_750712_c1 3300050515 Bacteria 824
1006 nmdc:mga0sz30_463020_c1 3300050516 Bacteria 569
1007 nmdc:mga0sz30_70580_c1 3300050516 Bacteria 1503
1008 Ga0495601_0048053 3300053077 Bacteria 2687
1009 Ga0495601_0359617 3300053077 Bacteria 946
1010 Ga0495612_0010119 3300053078 Bacteria 3815
1011 Ga0495595_0474361 3300053084 Bacteria 637
1012 Ga0495619_0006190 3300053085 Bacteria 7583
1013 Ga0500556_0000768 3300053104 Bacteria 19015
1014 Ga0500562_000448 3300053108 Bacteria 10042
1015 Ga0500568_0000327 3300053139 Bacteria 37336
1016 Ga0500568_0219679 3300053139 Bacteria 694
1017 Ga0500573_0394685 3300053140 Bacteria 657
1018 Ga0500616_0000071 3300053153 Bacteria 232527
1019 Ga0500620_104173 3300053155 Bacteria 993
1020 Ga0500645_038792 3300053730 Bacteria 1412
1021 Ga0501084_0435010 3300054114 Bacteria 1109
1022 Ga0530510_1476878 3300061734 Bacteria 522
1023 Ga0530510_1518701 3300061734 Bacteria 514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0610386 Ga0373943_0610386_102_452 109
2 3300035692 Ga0373935_1485371 Ga0373935_1485371_75_425 109
3 3300035695 Ga0373927_0350619 Ga0373927_0350619_478_828 109
4 3300035725 Ga0373947_0227788 Ga0373947_0227788_21_371 109
5 3300046461 Ga0495641_0067898 Ga0495641_0067898_1101_1451 109
6 3300046499 Ga0495594_0383329 Ga0495594_0383329_393_743 109
7 3300046689 Ga0495613_0238942 Ga0495613_0238942_424_774 109
8 3300047321 Ga0495676_0530742 Ga0495676_0530742_61_411 109
9 3300005356 Ga0070674_101023314 Ga0070674_1010233141 114
10 3300006852 Ga0075433_11035133 Ga0075433_110351332 114
11 3300009148 Ga0105243_11578757 Ga0105243_115787571 114
12 3300041441 Ga0451787_737160 Ga0451787_737160_35_400 114
13 3300053108 Ga0500562_000448 Ga0500562_000448_1716_2081 114
14 3300017792 Ga0163161_10621271 Ga0163161_106212712 116
15 3300046543 Ga0495645_0211264 Ga0495645_0211264_233_583 116
16 3300048908 Ga0496105_0067927 Ga0496105_0067927_1891_2241 116
17 3300048917 Ga0496114_0453716 Ga0496114_0453716_656_1006 116
18 iso_pu_bacteria 2643221616 2644097763 116
19 iso_pu_bacteria 2808606368 2808883450 116
20 iso_pu_bacteria 2852677369 2852677597 116
21 iso_pu_bacteria 2884763398 2884766983 116
22 3300013105 Ga0157369_11258305 Ga0157369_112583052 117
23 3300013308 Ga0157375_11219451 Ga0157375_112194512 117
24 3300017792 Ga0163161_10396224 Ga0163161_103962242 117
25 3300026118 Ga0207675_100483873 Ga0207675_1004838733 117
26 3300031649 Ga0307514_10076490 Ga0307514_100764901 117
27 3300050492 nmdc:mga0yw44_196464_c1 nmdc:mga0yw44_196464_c1_864_1232 117
28 3300053104 Ga0500556_0000768 Ga0500556_0000768_9908_10276 117
29 3300053139 Ga0500568_0219679 Ga0500568_0219679_35_403 117
30 iso_pu_bacteria 2585428094 2587861828 117
31 iso_pu_bacteria 2585428157 2588107165 117
32 iso_pu_bacteria 2643221575 2643886697 117
33 iso_pu_bacteria 2643221632 2644183769 117
34 iso_pu_bacteria 2643221649 2644280253 117
35 iso_pu_bacteria 2643221724 2644678536 117
36 iso_pu_bacteria 2721755702 2723643466 117
37 iso_pu_bacteria 2728369380 2730228037 117
38 iso_pu_bacteria 2747842429 2747955180 117
39 iso_pu_bacteria 2773857763 2774399659 117
40 iso_pu_bacteria 2808606360 2808851504 117
41 iso_pu_bacteria 2808606372 2808899979 117
42 iso_pu_bacteria 2811994872 2812324385 117
43 iso_pu_bacteria 2844841374 2844843109 117
44 iso_pu_bacteria 2919055335 2919058621 117
45 iso_pu_bacteria 2928153084 2928153271 117
46 iso_pu_bacteria 2945941187 2945943430 117
47 iso_pu_bacteria 2945941187 2945944143 117
48 iso_pu_bacteria 2946024296 2946025781 117
49 iso_pu_bacteria 8004182704 8004182911 117
50 iso_pu_bacteria 8054107350 8054108866 117
51 iso_pu_bacteria 8055034563 8055037024 117
52 iso_pu_bacteria 8057345674 8057349564 117
53 3300003373 JGI25407J50210_10067815 JGI25407J50210_100678152 118
54 3300005981 Ga0081538_10013765 Ga0081538_100137652 118
55 3300006844 Ga0075428_100028282 Ga0075428_1000282821 118
56 3300048914 Ga0496111_0736629 Ga0496111_0736629_40_405 119
57 3300053077 Ga0495601_0359617 Ga0495601_0359617_109_477 119
58 3300003214 JGI25165J46597_1000005 JGI25165J46597_100000575 120
59 3300005337 Ga0070682_101639315 Ga0070682_1016393151 120
60 3300005341 Ga0070691_10222633 Ga0070691_102226332 120
61 3300005466 Ga0070685_11040744 Ga0070685_110407442 120
62 3300005616 Ga0068852_102341947 Ga0068852_1023419472 120
63 3300005981 Ga0081538_10004076 Ga0081538_100040763 120
64 3300006353 Ga0075370_10028796 Ga0075370_100287963 120
65 3300007076 Ga0075435_100185626 Ga0075435_1001856264 120
66 3300009177 Ga0105248_12473920 Ga0105248_124739202 120
67 3300009545 Ga0105237_10275379 Ga0105237_102753793 120
68 3300010375 Ga0105239_10085922 Ga0105239_100859227 120
69 3300012508 Ga0157315_1005632 Ga0157315_10056321 120
70 3300013105 Ga0157369_10826210 Ga0157369_108262102 120
71 3300013306 Ga0163162_10019044 Ga0163162_100190447 120
72 3300013307 Ga0157372_10095359 Ga0157372_100953596 120
73 3300013307 Ga0157372_12679278 Ga0157372_126792782 120
74 3300025231 Ga0207427_100028 Ga0207427_10002877 120
75 3300025233 Ga0209437_100211 Ga0209437_10021161 120
76 3300025261 Ga0209233_1000001 Ga0209233_1000001575 120
77 3300025914 Ga0207671_10350979 Ga0207671_103509792 120
78 3300027907 Ga0207428_11040371 Ga0207428_110403711 120
79 3300031548 Ga0307408_100015791 Ga0307408_1000157914 120
80 3300031731 Ga0307405_10117806 Ga0307405_101178062 120
81 3300031824 Ga0307413_10084939 Ga0307413_100849393 120
82 3300031852 Ga0307410_11083223 Ga0307410_110832232 120
83 3300031901 Ga0307406_10679537 Ga0307406_106795371 120
84 3300031903 Ga0307407_10041438 Ga0307407_100414384 120
85 3300032002 Ga0307416_100517581 Ga0307416_1005175813 120
86 3300032004 Ga0307414_10446593 Ga0307414_104465931 120
87 3300032005 Ga0307411_10090170 Ga0307411_100901703 120
88 3300032005 Ga0307411_11582496 Ga0307411_115824961 120
89 3300041443 Ga0451789_1286349 Ga0451789_1286349_66_434 120
90 3300041494 Ga0451837_0275620 Ga0451837_0275620_268_633 120
91 3300041498 Ga0451841_0562518 Ga0451841_0562518_206_574 120
92 3300041503 Ga0451847_0140216 Ga0451847_0140216_100_468 120
93 3300041509 Ga0451843_0797638 Ga0451843_0797638_173_541 120
94 3300042145 Ga0450906_048511 Ga0450906_048511_169_543 120
95 3300042876 Ga0451577_0653749 Ga0451577_0653749_465_830 120
96 3300044673 Ga0453683_0053958 Ga0453683_0053958_483_848 120
97 3300044683 Ga0466965_0000016 Ga0466965_0000016_34703_35068 120
98 3300046455 Ga0495603_0355256 Ga0495603_0355256_109_474 120
99 3300046473 Ga0495582_0802875 Ga0495582_0802875_75_440 120
100 3300046537 Ga0495598_0416206 Ga0495598_0416206_33_401 120
101 3300046683 Ga0495658_0684990 Ga0495658_0684990_24_389 120
102 3300048903 Ga0496100_0060723 Ga0496100_0060723_20_385 120
103 3300048904 Ga0496101_0064914 Ga0496101_0064914_1607_1972 120
104 3300048905 Ga0496102_0163030 Ga0496102_0163030_1340_1705 120
105 3300048906 Ga0496103_0049332 Ga0496103_0049332_1576_1941 120
106 3300048908 Ga0496105_0134802 Ga0496105_0134802_412_777 120
107 3300048910 Ga0496107_0011513 Ga0496107_0011513_1760_2125 120
108 3300048911 Ga0496108_0202211 Ga0496108_0202211_817_1182 120
109 3300048912 Ga0496109_0110390 Ga0496109_0110390_1896_2261 120
110 3300048912 Ga0496109_1971554 Ga0496109_1971554_17_385 120
111 3300048913 Ga0496110_0109033 Ga0496110_0109033_366_731 120
112 3300048913 Ga0496110_0983943 Ga0496110_0983943_112_480 120
113 3300048914 Ga0496111_0064765 Ga0496111_0064765_1585_1950 120
114 3300048915 Ga0496112_0091055 Ga0496112_0091055_208_573 120
115 3300048916 Ga0496113_0065170 Ga0496113_0065170_2365_2730 120
116 3300048917 Ga0496114_0105577 Ga0496114_0105577_1610_1975 120
117 3300048917 Ga0496114_0267808 Ga0496114_0267808_898_1266 120
118 3300048917 Ga0496114_0394639 Ga0496114_0394639_152_520 120
119 3300048918 Ga0496115_0051666 Ga0496115_0051666_2598_2963 120
120 3300048920 Ga0496117_0107087 Ga0496117_0107087_944_1318 120
121 3300048921 Ga0496118_0055293 Ga0496118_0055293_1057_1431 120
122 3300048923 Ga0496120_0061739 Ga0496120_0061739_1038_1403 120
123 3300048924 Ga0496121_0003923 Ga0496121_0003923_9615_9977 120
124 3300048925 Ga0496122_0054789 Ga0496122_0054789_1746_2120 120
125 3300048926 Ga0496123_0009772 Ga0496123_0009772_1217_1591 120
126 3300048927 Ga0496124_0298588 Ga0496124_0298588_87_461 120
127 3300048929 Ga0496126_0027360 Ga0496126_0027360_1269_1631 120
128 3300048929 Ga0496126_0223397 Ga0496126_0223397_127_501 120
129 3300049568 Ga0501031_0540692 Ga0501031_0540692_140_505 120
130 3300049569 Ga0501032_0040496 Ga0501032_0040496_2263_2628 120
131 3300049569 Ga0501032_0757167 Ga0501032_0757167_145_513 120
132 3300049570 Ga0501033_0161417 Ga0501033_0161417_477_845 120
133 3300049571 Ga0501034_0827167 Ga0501034_0827167_151_516 120
134 3300049573 Ga0501037_0535650 Ga0501037_0535650_29_394 120
135 3300049574 Ga0501038_0172701 Ga0501038_0172701_1297_1662 120
136 3300049575 Ga0501039_0062359 Ga0501039_0062359_1086_1451 120
137 3300049579 Ga0501043_0294241 Ga0501043_0294241_213_578 120
138 3300049580 Ga0501046_0088447 Ga0501046_0088447_57_425 120
139 3300049581 Ga0501047_0270821 Ga0501047_0270821_783_1151 120
140 3300049586 Ga0501070_0049085 Ga0501070_0049085_1793_2161 120
141 3300049822 Ga0501035_0420223 Ga0501035_0420223_199_564 120
142 3300049823 Ga0501044_0138867 Ga0501044_0138867_1135_1503 120
143 3300049823 Ga0501044_0380440 Ga0501044_0380440_397_762 120
144 3300050496 nmdc:mga07m45_31881_c1 nmdc:mga07m45_31881_c1_1263_1625 120
145 3300050511 nmdc:mga08y16_827806_c1 nmdc:mga08y16_827806_c1_228_593 120
146 3300054114 Ga0501084_0435010 Ga0501084_0435010_698_1063 120
147 3300001979 JGI24740J21852_10001702 JGI24740J21852_1000170210 121
148 3300001979 JGI24740J21852_10049945 JGI24740J21852_100499452 121
149 3300001989 JGI24739J22299_10030520 JGI24739J22299_100305203 121
150 3300001989 JGI24739J22299_10241777 JGI24739J22299_102417772 121
151 3300003578 Ga0006562J51391_1096029 Ga0006562J51391_10960295 121
152 3300003911 JGI25405J52794_10167215 JGI25405J52794_101672152 121
153 3300005327 Ga0070658_10007993 Ga0070658_1000799310 121
154 3300005327 Ga0070658_10056365 Ga0070658_100563652 121
155 3300005327 Ga0070658_10118563 Ga0070658_101185632 121
156 3300005327 Ga0070658_10135184 Ga0070658_101351842 121
157 3300005327 Ga0070658_10138813 Ga0070658_101388132 121
158 3300005328 Ga0070676_10348733 Ga0070676_103487332 121
159 3300005329 Ga0070683_100263723 Ga0070683_1002637232 121
160 3300005329 Ga0070683_100307129 Ga0070683_1003071291 121
161 3300005329 Ga0070683_100508465 Ga0070683_1005084653 121
162 3300005329 Ga0070683_101123266 Ga0070683_1011232662 121
163 3300005330 Ga0070690_100166208 Ga0070690_1001662082 121
164 3300005330 Ga0070690_100556914 Ga0070690_1005569141 121
165 3300005331 Ga0070670_100403612 Ga0070670_1004036121 121
166 3300005334 Ga0068869_100324390 Ga0068869_1003243902 121
167 3300005334 Ga0068869_100500207 Ga0068869_1005002072 121
168 3300005334 Ga0068869_101787756 Ga0068869_1017877561 121
169 3300005335 Ga0070666_10196361 Ga0070666_101963612 121
170 3300005335 Ga0070666_11037913 Ga0070666_110379131 121
171 3300005336 Ga0070680_100298706 Ga0070680_1002987062 121
172 3300005336 Ga0070680_101248772 Ga0070680_1012487722 121
173 3300005337 Ga0070682_100009835 Ga0070682_1000098355 121
174 3300005337 Ga0070682_100062986 Ga0070682_1000629863 121
175 3300005337 Ga0070682_100105294 Ga0070682_1001052942 121
176 3300005337 Ga0070682_100469656 Ga0070682_1004696562 121
177 3300005337 Ga0070682_100637344 Ga0070682_1006373442 121
178 3300005337 Ga0070682_100991648 Ga0070682_1009916482 121
179 3300005338 Ga0068868_100528702 Ga0068868_1005287022 121
180 3300005338 Ga0068868_100802076 Ga0068868_1008020762 121
181 3300005339 Ga0070660_100018494 Ga0070660_1000184947 121
182 3300005339 Ga0070660_100060151 Ga0070660_1000601514 121
183 3300005339 Ga0070660_100178014 Ga0070660_1001780142 121
184 3300005339 Ga0070660_101072463 Ga0070660_1010724631 121
185 3300005340 Ga0070689_100112351 Ga0070689_1001123513 121
186 3300005341 Ga0070691_10015980 Ga0070691_100159804 121
187 3300005341 Ga0070691_10467729 Ga0070691_104677292 121
188 3300005343 Ga0070687_100249766 Ga0070687_1002497661 121
189 3300005343 Ga0070687_100876685 Ga0070687_1008766852 121
190 3300005344 Ga0070661_100012837 Ga0070661_1000128375 121
191 3300005344 Ga0070661_100489515 Ga0070661_1004895152 121
192 3300005344 Ga0070661_100620410 Ga0070661_1006204102 121
193 3300005345 Ga0070692_10158006 Ga0070692_101580063 121
194 3300005345 Ga0070692_10185682 Ga0070692_101856822 121
195 3300005347 Ga0070668_100385965 Ga0070668_1003859652 121
196 3300005347 Ga0070668_100437081 Ga0070668_1004370812 121
197 3300005347 Ga0070668_100499652 Ga0070668_1004996523 121
198 3300005353 Ga0070669_100274260 Ga0070669_1002742602 121
199 3300005353 Ga0070669_100721500 Ga0070669_1007215002 121
200 3300005354 Ga0070675_100387727 Ga0070675_1003877272 121
201 3300005354 Ga0070675_100707147 Ga0070675_1007071472 121
202 3300005355 Ga0070671_100066508 Ga0070671_1000665084 121
203 3300005356 Ga0070674_100088680 Ga0070674_1000886804 121
204 3300005356 Ga0070674_100174023 Ga0070674_1001740232 121
205 3300005356 Ga0070674_100477392 Ga0070674_1004773922 121
206 3300005364 Ga0070673_100076293 Ga0070673_1000762932 121
207 3300005364 Ga0070673_101354834 Ga0070673_1013548342 121
208 3300005365 Ga0070688_100479389 Ga0070688_1004793892 121
209 3300005365 Ga0070688_101400926 Ga0070688_1014009262 121
210 3300005366 Ga0070659_100000863 Ga0070659_10000086326 121
211 3300005366 Ga0070659_100151219 Ga0070659_1001512192 121
212 3300005366 Ga0070659_100855779 Ga0070659_1008557792 121
213 3300005366 Ga0070659_101694997 Ga0070659_1016949971 121
214 3300005367 Ga0070667_100030955 Ga0070667_1000309554 121
215 3300005434 Ga0070709_10609271 Ga0070709_106092712 121
216 3300005434 Ga0070709_11225659 Ga0070709_112256591 121
217 3300005435 Ga0070714_100033819 Ga0070714_1000338194 121
218 3300005435 Ga0070714_100466811 Ga0070714_1004668112 121
219 3300005435 Ga0070714_100473939 Ga0070714_1004739392 121
220 3300005435 Ga0070714_101831436 Ga0070714_1018314361 121
221 3300005436 Ga0070713_100032549 Ga0070713_1000325491 121
222 3300005437 Ga0070710_10628048 Ga0070710_106280482 121
223 3300005437 Ga0070710_11220522 Ga0070710_112205221 121
224 3300005438 Ga0070701_10029301 Ga0070701_100293012 121
225 3300005439 Ga0070711_100004587 Ga0070711_1000045873 121
226 3300005439 Ga0070711_101055046 Ga0070711_1010550462 121
227 3300005439 Ga0070711_101759420 Ga0070711_1017594201 121
228 3300005440 Ga0070705_100606615 Ga0070705_1006066152 121
229 3300005441 Ga0070700_100197780 Ga0070700_1001977801 121
230 3300005441 Ga0070700_100370534 Ga0070700_1003705342 121
231 3300005441 Ga0070700_100417604 Ga0070700_1004176042 121
232 3300005441 Ga0070700_100637639 Ga0070700_1006376391 121
233 3300005444 Ga0070694_100015894 Ga0070694_1000158942 121
234 3300005444 Ga0070694_100535408 Ga0070694_1005354081 121
235 3300005445 Ga0070708_100175445 Ga0070708_1001754452 121
236 3300005455 Ga0070663_100157623 Ga0070663_1001576234 121
237 3300005455 Ga0070663_101387941 Ga0070663_1013879411 121
238 3300005456 Ga0070678_100311470 Ga0070678_1003114702 121
239 3300005456 Ga0070678_102400080 Ga0070678_1024000801 121
240 3300005457 Ga0070662_100037264 Ga0070662_1000372643 121
241 3300005457 Ga0070662_100510230 Ga0070662_1005102302 121
242 3300005457 Ga0070662_100898434 Ga0070662_1008984342 121
243 3300005458 Ga0070681_11144103 Ga0070681_111441031 121
244 3300005459 Ga0068867_100114089 Ga0068867_1001140893 121
245 3300005459 Ga0068867_100421220 Ga0068867_1004212202 121
246 3300005466 Ga0070685_10058281 Ga0070685_100582812 121
247 3300005466 Ga0070685_10066899 Ga0070685_100668991 121
248 3300005466 Ga0070685_10564111 Ga0070685_105641112 121
249 3300005467 Ga0070706_100435330 Ga0070706_1004353302 121
250 3300005518 Ga0070699_100296728 Ga0070699_1002967282 121
251 3300005530 Ga0070679_100547796 Ga0070679_1005477962 121
252 3300005530 Ga0070679_100729066 Ga0070679_1007290662 121
253 3300005535 Ga0070684_100001103 Ga0070684_10000110310 121
254 3300005535 Ga0070684_100002388 Ga0070684_1000023882 121
255 3300005539 Ga0068853_100006583 Ga0068853_1000065839 121
256 3300005539 Ga0068853_100059888 Ga0068853_1000598882 121
257 3300005539 Ga0068853_100216380 Ga0068853_1002163803 121
258 3300005539 Ga0068853_100666422 Ga0068853_1006664222 121
259 3300005543 Ga0070672_100189874 Ga0070672_1001898743 121
260 3300005543 Ga0070672_100456964 Ga0070672_1004569642 121
261 3300005543 Ga0070672_100496916 Ga0070672_1004969163 121
262 3300005544 Ga0070686_100433319 Ga0070686_1004333192 121
263 3300005545 Ga0070695_100598073 Ga0070695_1005980732 121
264 3300005546 Ga0070696_100104735 Ga0070696_1001047352 121
265 3300005546 Ga0070696_100311037 Ga0070696_1003110372 121
266 3300005546 Ga0070696_101349092 Ga0070696_1013490921 121
267 3300005547 Ga0070693_100074539 Ga0070693_1000745392 121
268 3300005547 Ga0070693_100114455 Ga0070693_1001144552 121
269 3300005548 Ga0070665_100253572 Ga0070665_1002535723 121
270 3300005548 Ga0070665_100577842 Ga0070665_1005778423 121
271 3300005548 Ga0070665_101257530 Ga0070665_1012575302 121
272 3300005549 Ga0070704_100164776 Ga0070704_1001647762 121
273 3300005549 Ga0070704_101858764 Ga0070704_1018587642 121
274 3300005549 Ga0070704_101873800 Ga0070704_1018738001 121
275 3300005563 Ga0068855_100258065 Ga0068855_1002580652 121
276 3300005563 Ga0068855_101814449 Ga0068855_1018144492 121
277 3300005564 Ga0070664_100136572 Ga0070664_1001365723 121
278 3300005577 Ga0068857_100001573 Ga0068857_10000157320 121
279 3300005577 Ga0068857_100014391 Ga0068857_1000143915 121
280 3300005577 Ga0068857_100091617 Ga0068857_1000916174 121
281 3300005578 Ga0068854_100014310 Ga0068854_1000143104 121
282 3300005578 Ga0068854_100655850 Ga0068854_1006558502 121
283 3300005614 Ga0068856_100036544 Ga0068856_1000365445 121
284 3300005614 Ga0068856_100036931 Ga0068856_1000369316 121
285 3300005614 Ga0068856_100178550 Ga0068856_1001785505 121
286 3300005614 Ga0068856_100349140 Ga0068856_1003491403 121
287 3300005614 Ga0068856_100623165 Ga0068856_1006231652 121
288 3300005615 Ga0070702_100125631 Ga0070702_1001256312 121
289 3300005615 Ga0070702_100187117 Ga0070702_1001871172 121
290 3300005616 Ga0068852_100000597 Ga0068852_10000059711 121
291 3300005616 Ga0068852_100048864 Ga0068852_1000488642 121
292 3300005616 Ga0068852_100079677 Ga0068852_1000796774 121
293 3300005616 Ga0068852_100251785 Ga0068852_1002517852 121
294 3300005616 Ga0068852_101247754 Ga0068852_1012477542 121
295 3300005617 Ga0068859_100131751 Ga0068859_1001317512 121
296 3300005618 Ga0068864_100008378 Ga0068864_1000083785 121
297 3300005618 Ga0068864_100105778 Ga0068864_1001057785 121
298 3300005718 Ga0068866_10035542 Ga0068866_100355423 121
299 3300005718 Ga0068866_10156972 Ga0068866_101569722 121
300 3300005718 Ga0068866_10325107 Ga0068866_103251072 121
301 3300005719 Ga0068861_100227597 Ga0068861_1002275972 121
302 3300005719 Ga0068861_100493125 Ga0068861_1004931253 121
303 3300005719 Ga0068861_101210994 Ga0068861_1012109942 121
304 3300005834 Ga0068851_10000020 Ga0068851_1000002052 121
305 3300005834 Ga0068851_10482748 Ga0068851_104827482 121
306 3300005840 Ga0068870_10148610 Ga0068870_101486102 121
307 3300005841 Ga0068863_100309046 Ga0068863_1003090462 121
308 3300005841 Ga0068863_101396625 Ga0068863_1013966252 121
309 3300005842 Ga0068858_100000233 Ga0068858_10000023330 121
310 3300005842 Ga0068858_100587726 Ga0068858_1005877262 121
311 3300005842 Ga0068858_101660799 Ga0068858_1016607992 121
312 3300005844 Ga0068862_100354671 Ga0068862_1003546713 121
313 3300005937 Ga0081455_10001475 Ga0081455_1000147530 121
314 3300005937 Ga0081455_10005778 Ga0081455_100057786 121
315 3300005937 Ga0081455_10009290 Ga0081455_100092902 121
316 3300005937 Ga0081455_10111098 Ga0081455_101110982 121
317 3300005983 Ga0081540_1000051 Ga0081540_1000051125 121
318 3300006028 Ga0070717_10159243 Ga0070717_101592432 121
319 3300006038 Ga0075365_10318441 Ga0075365_103184412 121
320 3300006042 Ga0075368_10036445 Ga0075368_100364453 121
321 3300006048 Ga0075363_100730336 Ga0075363_1007303362 121
322 3300006048 Ga0075363_101042222 Ga0075363_1010422222 121
323 3300006051 Ga0075364_10045196 Ga0075364_100451962 121
324 3300006051 Ga0075364_10421120 Ga0075364_104211202 121
325 3300006058 Ga0075432_10000136 Ga0075432_1000013618 121
326 3300006058 Ga0075432_10002406 Ga0075432_100024066 121
327 3300006173 Ga0070716_100029558 Ga0070716_1000295582 121
328 3300006173 Ga0070716_100106037 Ga0070716_1001060375 121
329 3300006175 Ga0070712_100008557 Ga0070712_1000085572 121
330 3300006175 Ga0070712_100025252 Ga0070712_1000252524 121
331 3300006175 Ga0070712_100682729 Ga0070712_1006827292 121
332 3300006175 Ga0070712_101717600 Ga0070712_1017176002 121
333 3300006178 Ga0075367_10082328 Ga0075367_100823282 121
334 3300006186 Ga0075369_10075257 Ga0075369_100752572 121
335 3300006186 Ga0075369_10129325 Ga0075369_101293253 121
336 3300006237 Ga0097621_100518667 Ga0097621_1005186672 121
337 3300006237 Ga0097621_100561538 Ga0097621_1005615382 121
338 3300006237 Ga0097621_101426630 Ga0097621_1014266302 121
339 3300006358 Ga0068871_101005833 Ga0068871_1010058332 121
340 3300006358 Ga0068871_101580778 Ga0068871_1015807782 121
341 3300006844 Ga0075428_100075810 Ga0075428_1000758101 121
342 3300006844 Ga0075428_100922769 Ga0075428_1009227692 121
343 3300006846 Ga0075430_100341679 Ga0075430_1003416792 121
344 3300006847 Ga0075431_100984329 Ga0075431_1009843292 121
345 3300006852 Ga0075433_10005449 Ga0075433_100054498 121
346 3300006852 Ga0075433_10007152 Ga0075433_100071527 121
347 3300006871 Ga0075434_100004021 Ga0075434_10000402114 121
348 3300006871 Ga0075434_100015459 Ga0075434_1000154596 121
349 3300006871 Ga0075434_100162022 Ga0075434_1001620222 121
350 3300006871 Ga0075434_101498932 Ga0075434_1014989322 121
351 3300006880 Ga0075429_100099381 Ga0075429_1000993815 121
352 3300006881 Ga0068865_100029131 Ga0068865_1000291313 121
353 3300006881 Ga0068865_100075309 Ga0068865_1000753093 121
354 3300006881 Ga0068865_100110050 Ga0068865_1001100503 121
355 3300006914 Ga0075436_100001576 Ga0075436_10000157614 121
356 3300006914 Ga0075436_100302031 Ga0075436_1003020312 121
357 3300006931 Ga0097620_100131762 Ga0097620_1001317622 121
358 3300007076 Ga0075435_100010337 Ga0075435_1000103376 121
359 3300007076 Ga0075435_100044819 Ga0075435_1000448193 121
360 3300009093 Ga0105240_10186255 Ga0105240_101862553 121
361 3300009093 Ga0105240_10239816 Ga0105240_102398163 121
362 3300009093 Ga0105240_10450382 Ga0105240_104503822 121
363 3300009093 Ga0105240_10813681 Ga0105240_108136812 121
364 3300009094 Ga0111539_10001727 Ga0111539_1000172740 121
365 3300009094 Ga0111539_10049845 Ga0111539_100498458 121
366 3300009094 Ga0111539_12044160 Ga0111539_120441602 121
367 3300009098 Ga0105245_10003836 Ga0105245_100038368 121
368 3300009098 Ga0105245_10117363 Ga0105245_101173633 121
369 3300009098 Ga0105245_10210002 Ga0105245_102100022 121
370 3300009098 Ga0105245_10333868 Ga0105245_103338681 121
371 3300009098 Ga0105245_10726273 Ga0105245_107262732 121
372 3300009098 Ga0105245_11201862 Ga0105245_112018622 121
373 3300009101 Ga0105247_10106159 Ga0105247_101061593 121
374 3300009101 Ga0105247_10349118 Ga0105247_103491182 121
375 3300009101 Ga0105247_10406399 Ga0105247_104063992 121
376 3300009101 Ga0105247_10654935 Ga0105247_106549352 121
377 3300009147 Ga0114129_10018326 Ga0114129_1001832613 121
378 3300009147 Ga0114129_11904435 Ga0114129_119044352 121
379 3300009148 Ga0105243_10038474 Ga0105243_100384742 121
380 3300009148 Ga0105243_10060820 Ga0105243_100608203 121
381 3300009148 Ga0105243_10068606 Ga0105243_100686063 121
382 3300009148 Ga0105243_10251316 Ga0105243_102513161 121
383 3300009148 Ga0105243_10514474 Ga0105243_105144742 121
384 3300009148 Ga0105243_11329718 Ga0105243_113297182 121
385 3300009174 Ga0105241_10689295 Ga0105241_106892952 121
386 3300009176 Ga0105242_10719661 Ga0105242_107196612 121
387 3300009176 Ga0105242_10840842 Ga0105242_108408422 121
388 3300009176 Ga0105242_10959733 Ga0105242_109597332 121
389 3300009176 Ga0105242_10974875 Ga0105242_109748752 121
390 3300009176 Ga0105242_11326578 Ga0105242_113265782 121
391 3300009176 Ga0105242_11485796 Ga0105242_114857962 121
392 3300009176 Ga0105242_12139855 Ga0105242_121398552 121
393 3300009177 Ga0105248_10000714 Ga0105248_100007148 121
394 3300009177 Ga0105248_10124344 Ga0105248_101243442 121
395 3300009177 Ga0105248_10779460 Ga0105248_107794602 121
396 3300009177 Ga0105248_11173624 Ga0105248_111736242 121
397 3300009545 Ga0105237_10004850 Ga0105237_100048506 121
398 3300009545 Ga0105237_10017606 Ga0105237_100176063 121
399 3300009545 Ga0105237_10342803 Ga0105237_103428031 121
400 3300009545 Ga0105237_11637515 Ga0105237_116375151 121
401 3300009545 Ga0105237_12213485 Ga0105237_122134852 121
402 3300009551 Ga0105238_10025081 Ga0105238_100250814 121
403 3300009551 Ga0105238_10671091 Ga0105238_106710913 121
404 3300009551 Ga0105238_10798224 Ga0105238_107982242 121
405 3300009551 Ga0105238_10802593 Ga0105238_108025932 121
406 3300009551 Ga0105238_11973357 Ga0105238_119733572 121
407 3300009553 Ga0105249_10062245 Ga0105249_100622455 121
408 3300009553 Ga0105249_11116102 Ga0105249_111161022 121
409 3300009553 Ga0105249_11792198 Ga0105249_117921982 121
410 3300010375 Ga0105239_10025612 Ga0105239_100256125 121
411 3300010375 Ga0105239_10199323 Ga0105239_101993234 121
412 3300010375 Ga0105239_11720509 Ga0105239_117205092 121
413 3300011119 Ga0105246_10003686 Ga0105246_100036866 121
414 3300011119 Ga0105246_10015493 Ga0105246_100154935 121
415 3300011119 Ga0105246_11984245 Ga0105246_119842452 121
416 3300012473 Ga0157340_1001221 Ga0157340_10012212 121
417 3300012481 Ga0157320_1005023 Ga0157320_10050232 121
418 3300012482 Ga0157318_1016339 Ga0157318_10163392 121
419 3300012483 Ga0157337_1006937 Ga0157337_10069372 121
420 3300012488 Ga0157343_1013878 Ga0157343_10138782 121
421 3300012490 Ga0157322_1005288 Ga0157322_10052882 121
422 3300012491 Ga0157329_1008807 Ga0157329_10088072 121
423 3300012497 Ga0157319_1017147 Ga0157319_10171472 121
424 3300012498 Ga0157345_1013134 Ga0157345_10131342 121
425 3300012500 Ga0157314_1003428 Ga0157314_10034282 121
426 3300012507 Ga0157342_1007024 Ga0157342_10070243 121
427 3300012508 Ga0157315_1006045 Ga0157315_10060452 121
428 3300012510 Ga0157316_1000680 Ga0157316_10006803 121
429 3300012515 Ga0157338_1019928 Ga0157338_10199282 121
430 3300013100 Ga0157373_10044700 Ga0157373_100447002 121
431 3300013102 Ga0157371_10003246 Ga0157371_1000324613 121
432 3300013102 Ga0157371_10056380 Ga0157371_100563802 121
433 3300013102 Ga0157371_10420247 Ga0157371_104202472 121
434 3300013102 Ga0157371_10575141 Ga0157371_105751412 121
435 3300013104 Ga0157370_10210527 Ga0157370_102105273 121
436 3300013104 Ga0157370_11638624 Ga0157370_116386241 121
437 3300013105 Ga0157369_10000356 Ga0157369_100003562 121
438 3300013105 Ga0157369_10249574 Ga0157369_102495742 121
439 3300013105 Ga0157369_10532775 Ga0157369_105327752 121
440 3300013105 Ga0157369_11057607 Ga0157369_110576072 121
441 3300013105 Ga0157369_11825763 Ga0157369_118257631 121
442 3300013296 Ga0157374_10211363 Ga0157374_102113633 121
443 3300013296 Ga0157374_10574927 Ga0157374_105749271 121
444 3300013297 Ga0157378_10649626 Ga0157378_106496262 121
445 3300013297 Ga0157378_10790561 Ga0157378_107905612 121
446 3300013297 Ga0157378_12182629 Ga0157378_121826292 121
447 3300013306 Ga0163162_10104782 Ga0163162_101047825 121
448 3300013306 Ga0163162_10138023 Ga0163162_101380232 121
449 3300013306 Ga0163162_10335330 Ga0163162_103353302 121
450 3300013306 Ga0163162_10405006 Ga0163162_104050063 121
451 3300013306 Ga0163162_10809828 Ga0163162_108098283 121
452 3300013306 Ga0163162_11501573 Ga0163162_115015732 121
453 3300013307 Ga0157372_10004567 Ga0157372_100045675 121
454 3300013307 Ga0157372_10077075 Ga0157372_100770754 121
455 3300013307 Ga0157372_10221925 Ga0157372_102219253 121
456 3300013307 Ga0157372_10449594 Ga0157372_104495942 121
457 3300013307 Ga0157372_12374444 Ga0157372_123744442 121
458 3300013307 Ga0157372_12432769 Ga0157372_124327691 121
459 3300013307 Ga0157372_12512721 Ga0157372_125127211 121
460 3300013308 Ga0157375_10004900 Ga0157375_100049005 121
461 3300013308 Ga0157375_10276183 Ga0157375_102761833 121
462 3300013308 Ga0157375_10378896 Ga0157375_103788962 121
463 3300013308 Ga0157375_10714588 Ga0157375_107145883 121
464 3300013308 Ga0157375_10789082 Ga0157375_107890823 121
465 3300013308 Ga0157375_12870329 Ga0157375_128703291 121
466 3300014325 Ga0163163_10098983 Ga0163163_100989834 121
467 3300014325 Ga0163163_10234479 Ga0163163_102344792 121
468 3300014325 Ga0163163_10327849 Ga0163163_103278493 121
469 3300014325 Ga0163163_10400000 Ga0163163_104000003 121
470 3300014325 Ga0163163_13020501 Ga0163163_130205011 121
471 3300014326 Ga0157380_10185669 Ga0157380_101856692 121
472 3300014326 Ga0157380_10397255 Ga0157380_103972552 121
473 3300014326 Ga0157380_10920471 Ga0157380_109204712 121
474 3300014326 Ga0157380_11026023 Ga0157380_110260232 121
475 3300014326 Ga0157380_11431003 Ga0157380_114310032 121
476 3300014326 Ga0157380_11727725 Ga0157380_117277251 121
477 3300014326 Ga0157380_12014725 Ga0157380_120147251 121
478 3300014745 Ga0157377_10296253 Ga0157377_102962532 121
479 3300014745 Ga0157377_10361854 Ga0157377_103618542 121
480 3300014968 Ga0157379_10003043 Ga0157379_100030434 121
481 3300014968 Ga0157379_10005293 Ga0157379_1000529310 121
482 3300014968 Ga0157379_10017466 Ga0157379_100174665 121
483 3300014968 Ga0157379_10240080 Ga0157379_102400802 121
484 3300014968 Ga0157379_10787179 Ga0157379_107871792 121
485 3300014969 Ga0157376_10334593 Ga0157376_103345932 121
486 3300014969 Ga0157376_10838136 Ga0157376_108381362 121
487 3300014969 Ga0157376_11259618 Ga0157376_112596181 121
488 3300017792 Ga0163161_10098660 Ga0163161_100986604 121
489 3300017792 Ga0163161_10185510 Ga0163161_101855102 121
490 3300017792 Ga0163161_10221502 Ga0163161_102215022 121
491 3300020069 Ga0197907_10557023 Ga0197907_105570232 121
492 3300020069 Ga0197907_10825227 Ga0197907_108252272 121
493 3300020070 Ga0206356_10605762 Ga0206356_106057622 121
494 3300020077 Ga0206351_10698115 Ga0206351_106981152 121
495 3300020080 Ga0206350_10376196 Ga0206350_103761963 121
496 3300020081 Ga0206354_10711242 Ga0206354_107112422 121
497 3300020081 Ga0206354_11605514 Ga0206354_116055141 121
498 3300020082 Ga0206353_11910771 Ga0206353_119107715 121
499 3300020082 Ga0206353_11952588 Ga0206353_119525882 121
500 3300022467 Ga0224712_10079355 Ga0224712_100793552 121
501 3300025226 Ga0209674_116786 Ga0209674_1167862 121
502 3300025245 Ga0207425_1019162 Ga0207425_10191621 121
503 3300025253 Ga0209677_101239 Ga0209677_10123911 121
504 3300025258 Ga0209129_1000047 Ga0209129_100004788 121
505 3300025294 Ga0209025_1005871 Ga0209025_10058714 121
506 3300025321 Ga0207656_10000012 Ga0207656_1000001227 121
507 3300025321 Ga0207656_10332594 Ga0207656_103325942 121
508 3300025885 Ga0207653_10011989 Ga0207653_100119893 121
509 3300025898 Ga0207692_10013072 Ga0207692_100130724 121
510 3300025898 Ga0207692_10018048 Ga0207692_100180483 121
511 3300025898 Ga0207692_10044198 Ga0207692_100441983 121
512 3300025899 Ga0207642_10031172 Ga0207642_100311722 121
513 3300025899 Ga0207642_10051070 Ga0207642_100510702 121
514 3300025899 Ga0207642_10597308 Ga0207642_105973082 121
515 3300025900 Ga0207710_10027788 Ga0207710_100277882 121
516 3300025900 Ga0207710_10041006 Ga0207710_100410063 121
517 3300025900 Ga0207710_10285023 Ga0207710_102850232 121
518 3300025900 Ga0207710_10419779 Ga0207710_104197792 121
519 3300025900 Ga0207710_10578528 Ga0207710_105785282 121
520 3300025901 Ga0207688_10018593 Ga0207688_100185934 121
521 3300025901 Ga0207688_10094911 Ga0207688_100949112 121
522 3300025901 Ga0207688_10162278 Ga0207688_101622782 121
523 3300025901 Ga0207688_10762337 Ga0207688_107623371 121
524 3300025903 Ga0207680_10400175 Ga0207680_104001752 121
525 3300025903 Ga0207680_10519559 Ga0207680_105195592 121
526 3300025904 Ga0207647_10088566 Ga0207647_100885664 121
527 3300025905 Ga0207685_10011766 Ga0207685_100117663 121
528 3300025906 Ga0207699_10003399 Ga0207699_100033995 121
529 3300025906 Ga0207699_10164054 Ga0207699_101640542 121
530 3300025908 Ga0207643_10082713 Ga0207643_100827132 121
531 3300025909 Ga0207705_10013430 Ga0207705_100134308 121
532 3300025909 Ga0207705_10039084 Ga0207705_100390844 121
533 3300025909 Ga0207705_10048348 Ga0207705_100483481 121
534 3300025909 Ga0207705_10068281 Ga0207705_100682811 121
535 3300025909 Ga0207705_10077282 Ga0207705_100772822 121
536 3300025909 Ga0207705_10101254 Ga0207705_101012542 121
537 3300025912 Ga0207707_10183231 Ga0207707_101832312 121
538 3300025913 Ga0207695_10008321 Ga0207695_100083215 121
539 3300025913 Ga0207695_10525711 Ga0207695_105257111 121
540 3300025913 Ga0207695_11020018 Ga0207695_110200182 121
541 3300025914 Ga0207671_10000002 Ga0207671_10000002135 121
542 3300025914 Ga0207671_10056397 Ga0207671_100563974 121
543 3300025915 Ga0207693_10006333 Ga0207693_100063337 121
544 3300025916 Ga0207663_10021359 Ga0207663_100213594 121
545 3300025918 Ga0207662_10061831 Ga0207662_100618312 121
546 3300025918 Ga0207662_10693281 Ga0207662_106932812 121
547 3300025918 Ga0207662_11052102 Ga0207662_110521021 121
548 3300025919 Ga0207657_10004024 Ga0207657_1000402415 121
549 3300025919 Ga0207657_10025831 Ga0207657_100258312 121
550 3300025919 Ga0207657_10067466 Ga0207657_100674664 121
551 3300025919 Ga0207657_10911982 Ga0207657_109119822 121
552 3300025920 Ga0207649_10038640 Ga0207649_100386407 121
553 3300025920 Ga0207649_10128504 Ga0207649_101285042 121
554 3300025920 Ga0207649_10202859 Ga0207649_102028592 121
555 3300025921 Ga0207652_10531999 Ga0207652_105319992 121
556 3300025921 Ga0207652_10757483 Ga0207652_107574831 121
557 3300025923 Ga0207681_10321877 Ga0207681_103218772 121
558 3300025924 Ga0207694_10000433 Ga0207694_1000043313 121
559 3300025924 Ga0207694_10690380 Ga0207694_106903802 121
560 3300025924 Ga0207694_11017336 Ga0207694_110173362 121
561 3300025926 Ga0207659_10179001 Ga0207659_101790013 121
562 3300025927 Ga0207687_10015948 Ga0207687_100159485 121
563 3300025927 Ga0207687_10239696 Ga0207687_102396963 121
564 3300025927 Ga0207687_10349185 Ga0207687_103491852 121
565 3300025927 Ga0207687_10374773 Ga0207687_103747731 121
566 3300025927 Ga0207687_10977145 Ga0207687_109771452 121
567 3300025928 Ga0207700_10004680 Ga0207700_100046806 121
568 3300025928 Ga0207700_10012617 Ga0207700_100126174 121
569 3300025928 Ga0207700_10327400 Ga0207700_103274002 121
570 3300025929 Ga0207664_10012310 Ga0207664_100123104 121
571 3300025929 Ga0207664_10016720 Ga0207664_100167205 121
572 3300025929 Ga0207664_11754587 Ga0207664_117545871 121
573 3300025931 Ga0207644_10126877 Ga0207644_101268772 121
574 3300025932 Ga0207690_10000690 Ga0207690_100006902 121
575 3300025932 Ga0207690_10059613 Ga0207690_100596132 121
576 3300025932 Ga0207690_11572467 Ga0207690_115724672 121
577 3300025933 Ga0207706_10067163 Ga0207706_100671632 121
578 3300025933 Ga0207706_10182308 Ga0207706_101823082 121
579 3300025933 Ga0207706_11098540 Ga0207706_110985402 121
580 3300025934 Ga0207686_10138383 Ga0207686_101383832 121
581 3300025934 Ga0207686_11650509 Ga0207686_116505092 121
582 3300025935 Ga0207709_10123794 Ga0207709_101237943 121
583 3300025935 Ga0207709_10230553 Ga0207709_102305532 121
584 3300025935 Ga0207709_10352947 Ga0207709_103529472 121
585 3300025935 Ga0207709_11674224 Ga0207709_116742241 121
586 3300025936 Ga0207670_10132602 Ga0207670_101326023 121
587 3300025937 Ga0207669_10502704 Ga0207669_105027042 121
588 3300025937 Ga0207669_11761622 Ga0207669_117616222 121
589 3300025938 Ga0207704_10200751 Ga0207704_102007512 121
590 3300025938 Ga0207704_11259609 Ga0207704_112596092 121
591 3300025939 Ga0207665_10010148 Ga0207665_100101483 121
592 3300025939 Ga0207665_10078675 Ga0207665_100786752 121
593 3300025939 Ga0207665_11345684 Ga0207665_113456841 121
594 3300025940 Ga0207691_10073900 Ga0207691_100739003 121
595 3300025940 Ga0207691_10221732 Ga0207691_102217322 121
596 3300025940 Ga0207691_10371589 Ga0207691_103715892 121
597 3300025940 Ga0207691_11196157 Ga0207691_111961572 121
598 3300025941 Ga0207711_10001344 Ga0207711_1000134422 121
599 3300025941 Ga0207711_10150846 Ga0207711_101508463 121
600 3300025941 Ga0207711_11048847 Ga0207711_110488472 121
601 3300025942 Ga0207689_10017378 Ga0207689_100173784 121
602 3300025942 Ga0207689_10934128 Ga0207689_109341282 121
603 3300025944 Ga0207661_10122938 Ga0207661_101229383 121
604 3300025944 Ga0207661_11385065 Ga0207661_113850652 121
605 3300025944 Ga0207661_11803525 Ga0207661_118035251 121
606 3300025944 Ga0207661_12168249 Ga0207661_121682492 121
607 3300025945 Ga0207679_10139893 Ga0207679_101398932 121
608 3300025949 Ga0207667_10003648 Ga0207667_1000364812 121
609 3300025949 Ga0207667_10142518 Ga0207667_101425184 121
610 3300025949 Ga0207667_11306193 Ga0207667_113061932 121
611 3300025961 Ga0207712_10100114 Ga0207712_101001141 121
612 3300025961 Ga0207712_11638582 Ga0207712_116385822 121
613 3300025961 Ga0207712_12005523 Ga0207712_120055232 121
614 3300025972 Ga0207668_10082992 Ga0207668_100829923 121
615 3300025972 Ga0207668_10214236 Ga0207668_102142363 121
616 3300025981 Ga0207640_10069912 Ga0207640_100699122 121
617 3300025986 Ga0207658_10025692 Ga0207658_100256927 121
618 3300025986 Ga0207658_10139643 Ga0207658_101396432 121
619 3300025986 Ga0207658_11264201 Ga0207658_112642012 121
620 3300026023 Ga0207677_10384459 Ga0207677_103844592 121
621 3300026023 Ga0207677_10712085 Ga0207677_107120851 121
622 3300026035 Ga0207703_10000044 Ga0207703_1000004444 121
623 3300026035 Ga0207703_10669170 Ga0207703_106691702 121
624 3300026041 Ga0207639_10029843 Ga0207639_100298435 121
625 3300026041 Ga0207639_10081260 Ga0207639_100812602 121
626 3300026041 Ga0207639_10114593 Ga0207639_101145932 121
627 3300026041 Ga0207639_10373779 Ga0207639_103737792 121
628 3300026041 Ga0207639_10953785 Ga0207639_109537852 121
629 3300026041 Ga0207639_11227981 Ga0207639_112279812 121
630 3300026067 Ga0207678_10005013 Ga0207678_100050136 121
631 3300026067 Ga0207678_10264120 Ga0207678_102641202 121
632 3300026067 Ga0207678_10760526 Ga0207678_107605262 121
633 3300026067 Ga0207678_11124316 Ga0207678_111243161 121
634 3300026075 Ga0207708_10050227 Ga0207708_100502273 121
635 3300026075 Ga0207708_10058881 Ga0207708_100588813 121
636 3300026075 Ga0207708_10074252 Ga0207708_100742523 121
637 3300026078 Ga0207702_10013174 Ga0207702_100131743 121
638 3300026078 Ga0207702_10222140 Ga0207702_102221402 121
639 3300026078 Ga0207702_10548597 Ga0207702_105485972 121
640 3300026078 Ga0207702_10577580 Ga0207702_105775802 121
641 3300026078 Ga0207702_10774554 Ga0207702_107745542 121
642 3300026078 Ga0207702_11067570 Ga0207702_110675702 121
643 3300026088 Ga0207641_10001733 Ga0207641_1000173313 121
644 3300026088 Ga0207641_10034591 Ga0207641_100345913 121
645 3300026088 Ga0207641_10367700 Ga0207641_103677003 121
646 3300026088 Ga0207641_11761506 Ga0207641_117615062 121
647 3300026089 Ga0207648_10019076 Ga0207648_100190766 121
648 3300026089 Ga0207648_10544573 Ga0207648_105445732 121
649 3300026089 Ga0207648_10823358 Ga0207648_108233582 121
650 3300026095 Ga0207676_10304754 Ga0207676_103047542 121
651 3300026095 Ga0207676_10350780 Ga0207676_103507803 121
652 3300026095 Ga0207676_12149845 Ga0207676_121498452 121
653 3300026116 Ga0207674_10005505 Ga0207674_100055055 121
654 3300026116 Ga0207674_10013706 Ga0207674_100137062 121
655 3300026116 Ga0207674_10078956 Ga0207674_100789562 121
656 3300026118 Ga0207675_100109807 Ga0207675_1001098072 121
657 3300026118 Ga0207675_100160490 Ga0207675_1001604903 121
658 3300026118 Ga0207675_100251852 Ga0207675_1002518523 121
659 3300026121 Ga0207683_10002264 Ga0207683_100022645 121
660 3300026121 Ga0207683_10360498 Ga0207683_103604982 121
661 3300026121 Ga0207683_10765696 Ga0207683_107656962 121
662 3300026121 Ga0207683_11036628 Ga0207683_110366282 121
663 3300026121 Ga0207683_11746088 Ga0207683_117460881 121
664 3300026142 Ga0207698_10000269 Ga0207698_1000026922 121
665 3300026142 Ga0207698_10008328 Ga0207698_1000832810 121
666 3300026142 Ga0207698_10124834 Ga0207698_101248344 121
667 3300026142 Ga0207698_10598033 Ga0207698_105980332 121
668 3300026142 Ga0207698_11602754 Ga0207698_116027542 121
669 3300027866 Ga0209813_10202294 Ga0209813_102022942 121
670 3300027907 Ga0207428_10001284 Ga0207428_1000128422 121
671 3300027907 Ga0207428_10001525 Ga0207428_100015256 121
672 3300028379 Ga0268266_12135880 Ga0268266_121358801 121
673 3300028380 Ga0268265_10563962 Ga0268265_105639621 121
674 3300028381 Ga0268264_10584575 Ga0268264_105845752 121
675 3300028381 Ga0268264_10708198 Ga0268264_107081982 121
676 3300028381 Ga0268264_10751506 Ga0268264_107515062 121
677 3300031240 Ga0265320_10039832 Ga0265320_100398324 121
678 3300031251 Ga0265327_10238976 Ga0265327_102389762 121
679 3300031548 Ga0307408_100593880 Ga0307408_1005938802 121
680 3300031548 Ga0307408_100731909 Ga0307408_1007319092 121
681 3300031731 Ga0307405_10269253 Ga0307405_102692532 121
682 3300031824 Ga0307413_10006705 Ga0307413_100067055 121
683 3300031824 Ga0307413_11077281 Ga0307413_110772812 121
684 3300031824 Ga0307413_11461864 Ga0307413_114618641 121
685 3300031852 Ga0307410_10007959 Ga0307410_1000795910 121
686 3300031852 Ga0307410_10051292 Ga0307410_100512925 121
687 3300031852 Ga0307410_11642353 Ga0307410_116423531 121
688 3300031901 Ga0307406_10002700 Ga0307406_100027006 121
689 3300031901 Ga0307406_10007635 Ga0307406_100076355 121
690 3300031901 Ga0307406_10033716 Ga0307406_100337162 121
691 3300031901 Ga0307406_10765884 Ga0307406_107658842 121
692 3300031903 Ga0307407_10025529 Ga0307407_100255296 121
693 3300031903 Ga0307407_10238290 Ga0307407_102382902 121
694 3300031903 Ga0307407_10270955 Ga0307407_102709552 121
695 3300031903 Ga0307407_10393425 Ga0307407_103934252 121
696 3300031911 Ga0307412_10484887 Ga0307412_104848871 121
697 3300031995 Ga0307409_100012048 Ga0307409_10001204810 121
698 3300031995 Ga0307409_100354787 Ga0307409_1003547874 121
699 3300031995 Ga0307409_100375535 Ga0307409_1003755352 121
700 3300031995 Ga0307409_100414271 Ga0307409_1004142712 121
701 3300031995 Ga0307409_100753840 Ga0307409_1007538402 121
702 3300031995 Ga0307409_102648302 Ga0307409_1026483021 121
703 3300032002 Ga0307416_100053296 Ga0307416_1000532966 121
704 3300032002 Ga0307416_100575660 Ga0307416_1005756602 121
705 3300032002 Ga0307416_100772248 Ga0307416_1007722481 121
706 3300032002 Ga0307416_100798496 Ga0307416_1007984963 121
707 3300032002 Ga0307416_101275772 Ga0307416_1012757722 121
708 3300032002 Ga0307416_102365648 Ga0307416_1023656482 121
709 3300032004 Ga0307414_10015974 Ga0307414_100159744 121
710 3300032004 Ga0307414_10719458 Ga0307414_107194582 121
711 3300032004 Ga0307414_10934712 Ga0307414_109347122 121
712 3300032004 Ga0307414_11207095 Ga0307414_112070951 121
713 3300032004 Ga0307414_11313065 Ga0307414_113130652 121
714 3300032005 Ga0307411_10231714 Ga0307411_102317143 121
715 3300032005 Ga0307411_10287120 Ga0307411_102871202 121
716 3300032005 Ga0307411_10329979 Ga0307411_103299792 121
717 3300032005 Ga0307411_10330455 Ga0307411_103304552 121
718 3300032126 Ga0307415_100139679 Ga0307415_1001396792 121
719 3300032126 Ga0307415_100501717 Ga0307415_1005017172 121
720 3300032126 Ga0307415_101694917 Ga0307415_1016949172 121
721 3300035083 Ga0373926_0010531 Ga0373926_0010531_342_710 121
722 3300035086 Ga0373934_0007671 Ga0373934_0007671_2896_3264 121
723 3300035089 Ga0373944_0001860 Ga0373944_0001860_216_584 121
724 3300035090 Ga0373949_0018196 Ga0373949_0018196_259_627 121
725 3300035092 Ga0373952_0116896 Ga0373952_0116896_119_487 121
726 3300035092 Ga0373952_0211338 Ga0373952_0211338_188_556 121
727 3300035111 Ga0373923_0000367 Ga0373923_0000367_1722_2090 121
728 3300035113 Ga0373936_0000674 Ga0373936_0000674_2648_3016 121
729 3300035114 Ga0373939_0046555 Ga0373939_0046555_347_715 121
730 3300035115 Ga0373941_0020839 Ga0373941_0020839_997_1365 121
731 3300035116 Ga0373945_0000598 Ga0373945_0000598_7326_7694 121
732 3300035117 Ga0373953_0004098 Ga0373953_0004098_423_791 121
733 3300035118 Ga0373954_0006760 Ga0373954_0006760_1657_2025 121
734 3300035119 Ga0373956_0096518 Ga0373956_0096518_89_457 121
735 3300035121 Ga0373960_0021419 Ga0373960_0021419_318_686 121
736 3300035121 Ga0373960_0137873 Ga0373960_0137873_277_645 121
737 3300035170 Ga0373943_0000724 Ga0373943_0000724_6539_6907 121
738 3300035171 Ga0373946_0086963 Ga0373946_0086963_130_498 121
739 3300035172 Ga0373955_0009172 Ga0373955_0009172_2535_2903 121
740 3300035207 Ga0373942_0040588 Ga0373942_0040588_566_934 121
741 3300035241 Ga0373961_0294062 Ga0373961_0294062_28_396 121
742 3300035410 Ga0373924_0000394 Ga0373924_0000394_7185_7553 121
743 3300035691 Ga0373931_0035754 Ga0373931_0035754_2144_2512 121
744 3300035691 Ga0373931_1164342 Ga0373931_1164342_25_393 121
745 3300035692 Ga0373935_0001407 Ga0373935_0001407_5561_5929 121
746 3300035695 Ga0373927_0001565 Ga0373927_0001565_8948_9316 121
747 3300035695 Ga0373927_0426119 Ga0373927_0426119_30_398 121
748 3300035724 Ga0373933_0008451 Ga0373933_0008451_1589_1957 121
749 3300035725 Ga0373947_0001322 Ga0373947_0001322_6046_6414 121
750 3300036401 Ga0373937_0016605 Ga0373937_0016605_3193_3561 121
751 3300037068 Ga0373925_0021520 Ga0373925_0021520_446_814 121
752 3300037312 Ga0395899_0018679 Ga0395899_0018679_1493_1861 121
753 3300037418 Ga0395900_0003464 Ga0395900_0003464_12270_12659 121
754 3300037418 Ga0395900_0619137 Ga0395900_0619137_54_422 121
755 3300037418 Ga0395900_1318181 Ga0395900_1318181_79_447 121
756 3300037466 Ga0395898_0000015 Ga0395898_0000015_314067_314456 121
757 3300037466 Ga0395898_0392224 Ga0395898_0392224_524_901 121
758 3300037466 Ga0395898_1413127 Ga0395898_1413127_168_536 121
759 3300038443 Ga0395901_0050789 Ga0395901_0050789_2720_3097 121
760 3300038443 Ga0395901_0284798 Ga0395901_0284798_575_943 121
761 3300041413 Ga0439465_0019640 Ga0439465_0019640_1012_1392 121
762 3300041441 Ga0451787_604139 Ga0451787_604139_140_508 121
763 3300041441 Ga0451787_605597 Ga0451787_605597_100_468 121
764 3300041443 Ga0451789_0430189 Ga0451789_0430189_465_839 121
765 3300041452 Ga0451793_1667579 Ga0451793_1667579_141_509 121
766 3300041453 Ga0451797_0677432 Ga0451797_0677432_135_506 121
767 3300041492 Ga0451835_0010124 Ga0451835_0010124_88_456 121
768 3300041509 Ga0451843_0069868 Ga0451843_0069868_128_526 121
769 3300041509 Ga0451843_0448277 Ga0451843_0448277_36_407 121
770 3300041509 Ga0451843_0669537 Ga0451843_0669537_96_464 121
771 3300041512 Ga0451853_0890225 Ga0451853_0890225_48_416 121
772 3300041512 Ga0451853_1028530 Ga0451853_1028530_260_628 121
773 3300042002 Ga0439442_006204 Ga0439442_006204_1095_1469 121
774 3300042002 Ga0439442_006466 Ga0439442_006466_889_1269 121
775 3300042004 Ga0439445_0231550 Ga0439445_0231550_17_391 121
776 3300042005 Ga0439448_0025669 Ga0439448_0025669_555_923 121
777 3300042005 Ga0439448_0071739 Ga0439448_0071739_286_654 121
778 3300042007 Ga0439449_0100329 Ga0439449_0100329_203_571 121
779 3300042007 Ga0439449_0312434 Ga0439449_0312434_36_404 121
780 3300042008 Ga0439450_004633 Ga0439450_004633_619_987 121
781 3300042011 Ga0439454_055028 Ga0439454_055028_232_600 121
782 3300042012 Ga0439455_0025634 Ga0439455_0025634_853_1221 121
783 3300042012 Ga0439455_0133469 Ga0439455_0133469_245_613 121
784 3300042016 Ga0439463_002010 Ga0439463_002010_3148_3516 121
785 3300042016 Ga0439463_086646 Ga0439463_086646_201_569 121
786 3300042122 Ga0450920_035566 Ga0450920_035566_214_588 121
787 3300042125 Ga0450923_044497 Ga0450923_044497_143_517 121
788 3300042127 Ga0450890_042401 Ga0450890_042401_251_619 121
789 3300042184 Ga0450908_108353 Ga0450908_108353_74_442 121
790 3300042437 Ga0439444_0016296 Ga0439444_0016296_723_1091 121
791 3300042439 Ga0439464_0066057 Ga0439464_0066057_249_617 121
792 3300042461 Ga0439460_0198318 Ga0439460_0198318_256_624 121
793 3300042533 Ga0450901_021754 Ga0450901_021754_312_680 121
794 3300044658 Ga0466972_0012105 Ga0466972_0012105_1725_2096 121
795 3300044658 Ga0466972_0127277 Ga0466972_0127277_610_975 121
796 3300044683 Ga0466965_0061263 Ga0466965_0061263_1445_1816 121
797 3300044684 Ga0466966_0035728 Ga0466966_0035728_987_1358 121
798 3300044693 Ga0466961_0019240 Ga0466961_0019240_2054_2425 121
799 3300044735 Ga0466968_0003766 Ga0466968_0003766_101_472 121
800 3300044765 Ga0466970_0014509 Ga0466970_0014509_1778_2149 121
801 3300044842 Ga0466957_0013971 Ga0466957_0013971_1819_2190 121
802 3300044901 Ga0466960_0280481 Ga0466960_0280481_287_655 121
803 3300045049 Ga0466959_0028311 Ga0466959_0028311_274_645 121
804 3300045051 Ga0451576_1584131 Ga0451576_1584131_154_519 121
805 3300046454 Ga0495592_0028688 Ga0495592_0028688_881_1249 121
806 3300046455 Ga0495603_0001187 Ga0495603_0001187_7613_7981 121
807 3300046459 Ga0495629_0001672 Ga0495629_0001672_11392_11760 121
808 3300046460 Ga0495638_0254418 Ga0495638_0254418_285_656 121
809 3300046461 Ga0495641_0003984 Ga0495641_0003984_7391_7759 121
810 3300046462 Ga0495651_0003789 Ga0495651_0003789_3001_3369 121
811 3300046463 Ga0495653_0041688 Ga0495653_0041688_2896_3264 121
812 3300046463 Ga0495653_0350770 Ga0495653_0350770_546_914 121
813 3300046472 Ga0495580_0006947 Ga0495580_0006947_2690_3058 121
814 3300046473 Ga0495582_0002389 Ga0495582_0002389_7462_7830 121
815 3300046475 Ga0495639_0010448 Ga0495639_0010448_920_1288 121
816 3300046475 Ga0495639_0222399 Ga0495639_0222399_241_609 121
817 3300046476 Ga0495662_0008459 Ga0495662_0008459_3323_3691 121
818 3300046477 Ga0495664_0004030 Ga0495664_0004030_4545_4913 121
819 3300046477 Ga0495664_0060441 Ga0495664_0060441_752_1120 121
820 3300046499 Ga0495594_0195282 Ga0495594_0195282_628_996 121
821 3300046500 Ga0495596_0191182 Ga0495596_0191182_261_629 121
822 3300046501 Ga0495607_0327574 Ga0495607_0327574_283_663 121
823 3300046511 Ga0495608_0040941 Ga0495608_0040941_446_814 121
824 3300046513 Ga0495616_0405294 Ga0495616_0405294_22_405 121
825 3300046514 Ga0495618_0003119 Ga0495618_0003119_2397_2765 121
826 3300046516 Ga0495628_0025750 Ga0495628_0025750_1328_1696 121
827 3300046517 Ga0495630_0028520 Ga0495630_0028520_3056_3424 121
828 3300046518 Ga0495631_0091325 Ga0495631_0091325_100_483 121
829 3300046520 Ga0495637_0348268 Ga0495637_0348268_78_461 121
830 3300046522 Ga0495643_0497387 Ga0495643_0497387_138_506 121
831 3300046523 Ga0495644_0162405 Ga0495644_0162405_219_587 121
832 3300046526 Ga0495666_0159731 Ga0495666_0159731_328_696 121
833 3300046529 Ga0495652_0008982 Ga0495652_0008982_2561_2929 121
834 3300046531 Ga0495665_0004883 Ga0495665_0004883_3890_4258 121
835 3300046533 Ga0495640_0023607 Ga0495640_0023607_1025_1393 121
836 3300046535 Ga0495586_0014085 Ga0495586_0014085_1333_1701 121
837 3300046535 Ga0495586_0173486 Ga0495586_0173486_265_633 121
838 3300046536 Ga0495587_0006125 Ga0495587_0006125_3973_4341 121
839 3300046537 Ga0495598_0384669 Ga0495598_0384669_123_506 121
840 3300046543 Ga0495645_0012237 Ga0495645_0012237_2889_3257 121
841 3300046557 Ga0495622_0288725 Ga0495622_0288725_16_384 121
842 3300046559 Ga0495667_0014137 Ga0495667_0014137_4702_5070 121
843 3300046642 Ga0495634_0045885 Ga0495634_0045885_577_945 121
844 3300046663 Ga0495635_0016436 Ga0495635_0016436_3487_3855 121
845 3300046674 Ga0495588_0217201 Ga0495588_0217201_205_573 121
846 3300046674 Ga0495588_0548106 Ga0495588_0548106_225_593 121
847 3300046675 Ga0495657_0015830 Ga0495657_0015830_2980_3348 121
848 3300046678 Ga0495599_0004443 Ga0495599_0004443_4757_5125 121
849 3300046679 Ga0495623_0006192 Ga0495623_0006192_5973_6341 121
850 3300046680 Ga0495646_0013069 Ga0495646_0013069_3469_3837 121
851 3300046681 Ga0495647_0181720 Ga0495647_0181720_515_883 121
852 3300046683 Ga0495658_0003027 Ga0495658_0003027_2194_2562 121
853 3300046683 Ga0495658_0739174 Ga0495658_0739174_223_597 121
854 3300046689 Ga0495613_0008109 Ga0495613_0008109_3929_4297 121
855 3300046690 Ga0495624_0004181 Ga0495624_0004181_2980_3348 121
856 3300046692 Ga0495671_0401055 Ga0495671_0401055_271_639 121
857 3300046809 Ga0495600_0004051 Ga0495600_0004051_6905_7273 121
858 3300046809 Ga0495600_0442402 Ga0495600_0442402_22_390 121
859 3300047315 Ga0495581_0003256 Ga0495581_0003256_6046_6414 121
860 3300047317 Ga0495604_0004523 Ga0495604_0004523_7361_7729 121
861 3300047319 Ga0495674_0129631 Ga0495674_0129631_318_686 121
862 3300047319 Ga0495674_0334710 Ga0495674_0334710_418_786 121
863 3300047320 Ga0495672_0140544 Ga0495672_0140544_183_554 121
864 3300047321 Ga0495676_0003026 Ga0495676_0003026_11935_12303 121
865 3300047445 Ga0495677_0259950 Ga0495677_0259950_121_504 121
866 3300047471 Ga0495684_0008710 Ga0495684_0008710_1314_1682 121
867 3300047472 Ga0495686_0067133 Ga0495686_0067133_411_785 121
868 3300047472 Ga0495686_0249070 Ga0495686_0249070_109_480 121
869 3300047673 Ga0495593_0001731 Ga0495593_0001731_6537_6905 121
870 3300047673 Ga0495593_0050313 Ga0495593_0050313_603_971 121
871 3300048088 Ga0495602_0010671 Ga0495602_0010671_2624_2992 121
872 3300048089 Ga0495614_0051345 Ga0495614_0051345_309_677 121
873 3300048903 Ga0496100_0002276 Ga0496100_0002276_6178_6546 121
874 3300048903 Ga0496100_0109283 Ga0496100_0109283_351_719 121
875 3300048903 Ga0496100_0510828 Ga0496100_0510828_511_879 121
876 3300048904 Ga0496101_0003922 Ga0496101_0003922_7465_7833 121
877 3300048904 Ga0496101_0016066 Ga0496101_0016066_4110_4481 121
878 3300048904 Ga0496101_0094865 Ga0496101_0094865_1469_1837 121
879 3300048904 Ga0496101_0103951 Ga0496101_0103951_1489_1857 121
880 3300048904 Ga0496101_0182095 Ga0496101_0182095_451_822 121
881 3300048904 Ga0496101_0575078 Ga0496101_0575078_12_380 121
882 3300048904 Ga0496101_0589141 Ga0496101_0589141_386_751 121
883 3300048904 Ga0496101_0725201 Ga0496101_0725201_286_654 121
884 3300048905 Ga0496102_0000017 Ga0496102_0000017_104360_104728 121
885 3300048905 Ga0496102_0004090 Ga0496102_0004090_3604_3969 121
886 3300048905 Ga0496102_0017204 Ga0496102_0017204_5410_5778 121
887 3300048905 Ga0496102_0063643 Ga0496102_0063643_309_677 121
888 3300048905 Ga0496102_0160514 Ga0496102_0160514_1085_1453 121
889 3300048905 Ga0496102_0407209 Ga0496102_0407209_405_776 121
890 3300048905 Ga0496102_0498331 Ga0496102_0498331_202_576 121
891 3300048905 Ga0496102_1591864 Ga0496102_1591864_74_439 121
892 3300048906 Ga0496103_0000041 Ga0496103_0000041_29984_30352 121
893 3300048906 Ga0496103_0040842 Ga0496103_0040842_492_857 121
894 3300048906 Ga0496103_0119576 Ga0496103_0119576_948_1316 121
895 3300048906 Ga0496103_0324799 Ga0496103_0324799_305_673 121
896 3300048906 Ga0496103_0494846 Ga0496103_0494846_21_392 121
897 3300048907 Ga0496104_0001879 Ga0496104_0001879_7433_7801 121
898 3300048907 Ga0496104_0008855 Ga0496104_0008855_207_575 121
899 3300048907 Ga0496104_0068414 Ga0496104_0068414_737_1108 121
900 3300048907 Ga0496104_0169506 Ga0496104_0169506_1124_1492 121
901 3300048907 Ga0496104_0388797 Ga0496104_0388797_580_948 121
902 3300048907 Ga0496104_0493559 Ga0496104_0493559_547_915 121
903 3300048907 Ga0496104_0725594 Ga0496104_0725594_427_795 121
904 3300048907 Ga0496104_1201460 Ga0496104_1201460_230_598 121
905 3300048907 Ga0496104_1373897 Ga0496104_1373897_76_444 121
906 3300048908 Ga0496105_0001766 Ga0496105_0001766_3071_3439 121
907 3300048908 Ga0496105_0009627 Ga0496105_0009627_5469_5837 121
908 3300048908 Ga0496105_0011284 Ga0496105_0011284_748_1116 121
909 3300048908 Ga0496105_0037487 Ga0496105_0037487_284_655 121
910 3300048908 Ga0496105_0089820 Ga0496105_0089820_1365_1733 121
911 3300048908 Ga0496105_0133549 Ga0496105_0133549_756_1124 121
912 3300048908 Ga0496105_0266567 Ga0496105_0266567_360_728 121
913 3300048909 Ga0496106_0006289 Ga0496106_0006289_5570_5941 121
914 3300048909 Ga0496106_1039035 Ga0496106_1039035_211_579 121
915 3300048910 Ga0496107_0018120 Ga0496107_0018120_4010_4381 121
916 3300048910 Ga0496107_0046146 Ga0496107_0046146_828_1196 121
917 3300048910 Ga0496107_0069628 Ga0496107_0069628_1058_1426 121
918 3300048910 Ga0496107_0071209 Ga0496107_0071209_1383_1748 121
919 3300048910 Ga0496107_0327491 Ga0496107_0327491_359_730 121
920 3300048911 Ga0496108_0002013 Ga0496108_0002013_13165_13533 121
921 3300048911 Ga0496108_0002520 Ga0496108_0002520_10657_11025 121
922 3300048911 Ga0496108_0023704 Ga0496108_0023704_279_647 121
923 3300048911 Ga0496108_0119728 Ga0496108_0119728_958_1323 121
924 3300048911 Ga0496108_0293672 Ga0496108_0293672_724_1092 121
925 3300048911 Ga0496108_0442988 Ga0496108_0442988_336_704 121
926 3300048911 Ga0496108_0517783 Ga0496108_0517783_576_944 121
927 3300048911 Ga0496108_0633775 Ga0496108_0633775_263_631 121
928 3300048911 Ga0496108_0936314 Ga0496108_0936314_39_407 121
929 3300048911 Ga0496108_1064257 Ga0496108_1064257_34_402 121
930 3300048911 Ga0496108_1613647 Ga0496108_1613647_149_517 121
931 3300048912 Ga0496109_0036204 Ga0496109_0036204_4055_4423 121
932 3300048912 Ga0496109_0066031 Ga0496109_0066031_657_1025 121
933 3300048912 Ga0496109_0141753 Ga0496109_0141753_897_1265 121
934 3300048912 Ga0496109_0178250 Ga0496109_0178250_966_1331 121
935 3300048912 Ga0496109_0346851 Ga0496109_0346851_408_776 121
936 3300048912 Ga0496109_0372903 Ga0496109_0372903_143_511 121
937 3300048912 Ga0496109_0483898 Ga0496109_0483898_654_1022 121
938 3300048912 Ga0496109_1470597 Ga0496109_1470597_90_458 121
939 3300048913 Ga0496110_0002211 Ga0496110_0002211_12242_12610 121
940 3300048913 Ga0496110_0006460 Ga0496110_0006460_5336_5704 121
941 3300048913 Ga0496110_0010855 Ga0496110_0010855_6141_6506 121
942 3300048913 Ga0496110_0097958 Ga0496110_0097958_966_1334 121
943 3300048913 Ga0496110_0185434 Ga0496110_0185434_1417_1785 121
944 3300048914 Ga0496111_0000481 Ga0496111_0000481_10118_10483 121
945 3300048914 Ga0496111_0122802 Ga0496111_0122802_1200_1568 121
946 3300048914 Ga0496111_0170158 Ga0496111_0170158_765_1133 121
947 3300048914 Ga0496111_0312240 Ga0496111_0312240_190_558 121
948 3300048914 Ga0496111_0397223 Ga0496111_0397223_384_752 121
949 3300048914 Ga0496111_0430079 Ga0496111_0430079_226_594 121
950 3300048914 Ga0496111_1111893 Ga0496111_1111893_137_505 121
951 3300048915 Ga0496112_0007896 Ga0496112_0007896_8829_9197 121
952 3300048915 Ga0496112_0185216 Ga0496112_0185216_1133_1501 121
953 3300048915 Ga0496112_0347519 Ga0496112_0347519_783_1151 121
954 3300048916 Ga0496113_0124461 Ga0496113_0124461_1029_1397 121
955 3300048916 Ga0496113_0162548 Ga0496113_0162548_601_969 121
956 3300048916 Ga0496113_0375339 Ga0496113_0375339_297_662 121
957 3300048917 Ga0496114_0004969 Ga0496114_0004969_3696_4064 121
958 3300048917 Ga0496114_0009643 Ga0496114_0009643_4088_4456 121
959 3300048917 Ga0496114_0038495 Ga0496114_0038495_3255_3620 121
960 3300048917 Ga0496114_0058447 Ga0496114_0058447_1822_2190 121
961 3300048917 Ga0496114_0135406 Ga0496114_0135406_1552_1920 121
962 3300048917 Ga0496114_0148871 Ga0496114_0148871_1015_1383 121
963 3300048917 Ga0496114_0275019 Ga0496114_0275019_838_1206 121
964 3300048917 Ga0496114_0319135 Ga0496114_0319135_745_1116 121
965 3300048917 Ga0496114_0342852 Ga0496114_0342852_169_534 121
966 3300048917 Ga0496114_0362624 Ga0496114_0362624_592_960 121
967 3300048917 Ga0496114_0389006 Ga0496114_0389006_427_795 121
968 3300048917 Ga0496114_0400609 Ga0496114_0400609_221_589 121
969 3300048917 Ga0496114_0500835 Ga0496114_0500835_294_662 121
970 3300048917 Ga0496114_0852297 Ga0496114_0852297_165_536 121
971 3300048917 Ga0496114_1136690 Ga0496114_1136690_156_524 121
972 3300048918 Ga0496115_0021354 Ga0496115_0021354_839_1207 121
973 3300048918 Ga0496115_0036198 Ga0496115_0036198_1768_2139 121
974 3300048918 Ga0496115_0071864 Ga0496115_0071864_2152_2520 121
975 3300048918 Ga0496115_0091204 Ga0496115_0091204_187_555 121
976 3300048918 Ga0496115_0175562 Ga0496115_0175562_20_391 121
977 3300048918 Ga0496115_0264995 Ga0496115_0264995_39_407 121
978 3300048918 Ga0496115_0470497 Ga0496115_0470497_321_689 121
979 3300048918 Ga0496115_0827928 Ga0496115_0827928_100_468 121
980 3300048919 Ga0496116_0000121 Ga0496116_0000121_155475_155843 121
981 3300048920 Ga0496117_0000084 Ga0496117_0000084_30252_30620 121
982 3300048920 Ga0496117_0000163 Ga0496117_0000163_72424_72792 121
983 3300048920 Ga0496117_0006658 Ga0496117_0006658_11176_11544 121
984 3300048920 Ga0496117_0119388 Ga0496117_0119388_337_711 121
985 3300048920 Ga0496117_0510275 Ga0496117_0510275_183_551 121
986 3300048921 Ga0496118_0000057 Ga0496118_0000057_155492_155860 121
987 3300048921 Ga0496118_0039278 Ga0496118_0039278_3338_3718 121
988 3300048921 Ga0496118_0247370 Ga0496118_0247370_453_821 121
989 3300048922 Ga0496119_0005258 Ga0496119_0005258_10713_11081 121
990 3300048922 Ga0496119_0236784 Ga0496119_0236784_223_591 121
991 3300048923 Ga0496120_0001463 Ga0496120_0001463_1757_2125 121
992 3300048923 Ga0496120_0012737 Ga0496120_0012737_3818_4186 121
993 3300048924 Ga0496121_0007250 Ga0496121_0007250_7013_7381 121
994 3300048925 Ga0496122_0009222 Ga0496122_0009222_6109_6480 121
995 3300048925 Ga0496122_0119691 Ga0496122_0119691_780_1148 121
996 3300048925 Ga0496122_0156462 Ga0496122_0156462_216_587 121
997 3300048926 Ga0496123_0010117 Ga0496123_0010117_4440_4811 121
998 3300048926 Ga0496123_0509208 Ga0496123_0509208_107_475 121
999 3300048927 Ga0496124_0113217 Ga0496124_0113217_420_788 121
1000 3300048927 Ga0496124_0153440 Ga0496124_0153440_1110_1478 121
1001 3300048927 Ga0496124_0349403 Ga0496124_0349403_166_534 121
1002 3300048928 Ga0496125_0061576 Ga0496125_0061576_2431_2799 121
1003 3300048928 Ga0496125_0256621 Ga0496125_0256621_459_827 121
1004 3300048928 Ga0496125_0586879 Ga0496125_0586879_215_586 121
1005 3300048929 Ga0496126_0000135 Ga0496126_0000135_139182_139550 121
1006 3300048929 Ga0496126_0001669 Ga0496126_0001669_3436_3804 121
1007 3300048929 Ga0496126_0198808 Ga0496126_0198808_1291_1662 121
1008 3300048929 Ga0496126_0208866 Ga0496126_0208866_106_474 121
1009 3300048929 Ga0496126_0511642 Ga0496126_0511642_545_916 121
1010 3300049571 Ga0501034_0001761 Ga0501034_0001761_20443_20814 121
1011 3300049575 Ga0501039_0364228 Ga0501039_0364228_636_1007 121
1012 3300049586 Ga0501070_0001101 Ga0501070_0001101_6182_6556 121
1013 3300049778 Ga0501282_030085 Ga0501282_030085_163_531 121
1014 3300049822 Ga0501035_0120750 Ga0501035_0120750_527_916 121
1015 3300050489 nmdc:mga03683_417542_c1 nmdc:mga03683_417542_c1_120_485 121
1016 3300050490 nmdc:mga03n38_116147_c1 nmdc:mga03n38_116147_c1_609_974 121
1017 3300050491 nmdc:mga00v17_196980_c1 nmdc:mga00v17_196980_c1_28_396 121
1018 3300050492 nmdc:mga0yw44_319336_c1 nmdc:mga0yw44_319336_c1_433_801 121
1019 3300050492 nmdc:mga0yw44_341161_c1 nmdc:mga0yw44_341161_c1_515_880 121
1020 3300050494 nmdc:mga06z11_240180_c1 nmdc:mga06z11_240180_c1_317_682 121
1021 3300050495 nmdc:mga04h51_71376_c1 nmdc:mga04h51_71376_c1_740_1105 121
1022 3300050496 nmdc:mga07m45_492315_c1 nmdc:mga07m45_492315_c1_328_696 121
1023 3300050507 nmdc:mga05p37_23752_c1 nmdc:mga05p37_23752_c1_813_1181 121
1024 3300050508 nmdc:mga09592_1620630_c1 nmdc:mga09592_1620630_c1_104_472 121
1025 3300050511 nmdc:mga08y16_1901977_c1 nmdc:mga08y16_1901977_c1_27_398 121
1026 3300050511 nmdc:mga08y16_33806_c1 nmdc:mga08y16_33806_c1_432_860 121
1027 3300050512 nmdc:mga0n895_160103_c1 nmdc:mga0n895_160103_c1_662_1090 121
1028 3300050512 nmdc:mga0n895_19256_c1 nmdc:mga0n895_19256_c1_2885_3253 121
1029 3300050512 nmdc:mga0n895_415041_c1 nmdc:mga0n895_415041_c1_789_1157 121
1030 3300050513 nmdc:mga0rr50_53114_c1 nmdc:mga0rr50_53114_c1_841_1209 121
1031 3300050513 nmdc:mga0rr50_60982_c1 nmdc:mga0rr50_60982_c1_2309_2737 121
1032 3300050514 nmdc:mga08x19_114880_c1 nmdc:mga08x19_114880_c1_1199_1567 121
1033 3300050514 nmdc:mga08x19_116411_c1 nmdc:mga08x19_116411_c1_1088_1456 121
1034 3300050514 nmdc:mga08x19_13651_c1 nmdc:mga08x19_13651_c1_4214_4642 121
1035 3300050515 nmdc:mga0a205_5837_c1 nmdc:mga0a205_5837_c1_509_937 121
1036 3300050515 nmdc:mga0a205_7200_c1 nmdc:mga0a205_7200_c1_6555_6923 121
1037 3300050515 nmdc:mga0a205_750712_c1 nmdc:mga0a205_750712_c1_264_632 121
1038 3300050516 nmdc:mga0sz30_463020_c1 nmdc:mga0sz30_463020_c1_41_409 121
1039 3300050516 nmdc:mga0sz30_70580_c1 nmdc:mga0sz30_70580_c1_744_1112 121
1040 3300053077 Ga0495601_0048053 Ga0495601_0048053_881_1249 121
1041 3300053078 Ga0495612_0010119 Ga0495612_0010119_851_1219 121
1042 3300053084 Ga0495595_0474361 Ga0495595_0474361_48_416 121
1043 3300053085 Ga0495619_0006190 Ga0495619_0006190_4545_4913 121
1044 3300053139 Ga0500568_0000327 Ga0500568_0000327_2599_2967 121
1045 3300053140 Ga0500573_0394685 Ga0500573_0394685_165_542 121
1046 3300053153 Ga0500616_0000071 Ga0500616_0000071_86239_86607 121
1047 3300053155 Ga0500620_104173 Ga0500620_104173_26_394 121
1048 3300053730 Ga0500645_038792 Ga0500645_038792_490_870 121
1049 3300061734 Ga0530510_1476878 Ga0530510_1476878_24_392 121
1050 3300061734 Ga0530510_1518701 Ga0530510_1518701_115_483 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06304

DUF1048

Protein of unknown function (DUF1048)

10

114

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o3l-assembly2.cif.gz_B crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution 0.8678 22 97
2o3l-assembly2.cif.gz_B crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution 0.8025 22 97
2o4t-assembly1.cif.gz_A-2 crystal structure of a protein of the duf1048 family with a left-handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution 0.7405 25 113
2o4t-assembly1.cif.gz_A-2 crystal structure of a protein of the duf1048 family with a left-handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution 0.7043 25 113
2hh6-assembly1.cif.gz_A-2 crystal structure of bh3980 (10176605) from bacillus halodurans at 2.04 a resolution 0.6986 5 113
ID Description Score Start End Superfamily
2o3lB00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.8349 24 97 1.10.1900.10
2o3lB00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.7777 24 97 1.10.1900.10
2o4tA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.7405 25 113 1.10.1900.10
2o4tA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.7043 25 113 1.10.1900.10
2hh6A00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.6987 5 113 1.10.1900.10
ID Description Score Start End GO Terms
AF-A0A6I6MUK6-F1-model_v4 DUF1048 domain-containing protein 0.9489 16 96
AF-A0A6L8N6Z2-F1-model_v4 DUF1048 domain-containing protein 0.9429 16 95
AF-A0A7X6YKE7-F1-model_v4 Uncharacterized protein 0.9216 22 93 GO:0016020
AF-A0A6I2F7X0-F1-model_v4 DUF1048 domain-containing protein 0.8826 1 117
AF-A0A359FE50-F1-model_v4 deleted 0.8676 1 85

Feature Viewer

pLDDT pTM Quality
85.92 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map