F489050

General Info

Members Datasets Scaffolds Average Seq Length
1050 304 1050 253

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10249147|Ga0157378_102491471
Length 273
Sequence LDEALFFDFFQQYLFQLWCPPHIVISYEFPLNERIRTLLRLEDLYRRTQHFASKTESGDHHVALTSLFELLDVGGRADLKSDIMQELERQKQHLEALQNNPAISQEALTTVLADIEKAVSDLFLSSGKTGQELRGNDWLMGIKQRSAIPGGVCEFDLPSYHYWLNQAAEVRRLDLDQWLSPFIPIRNGVRIILKLLRENGKTANQMAHQGVYQQTMAGRLAQMLRIRLDSTYDCVPEISANKYALNVRFTTAVGTQRRTSVEAIGFELTFCNL

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
238 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
239 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 3.05
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005003 3300001976 Bacteria 1733
2 JGI24743J22301_10004821 3300001991 Bacteria 2220
3 JGI24034J26672_10015764 3300002239 Bacteria 1159
4 Ga0065715_10127545 3300005293 Bacteria 2085
5 Ga0065715_10290220 3300005293 Bacteria 1065
6 Ga0070658_10125697 3300005327 Bacteria 2134
7 Ga0070658_10254008 3300005327 Bacteria 1492
8 Ga0070658_10291819 3300005327 Bacteria 1390
9 Ga0070676_10000862 3300005328 Bacteria 14943
10 Ga0070676_10030341 3300005328 Bacteria 3083
11 Ga0070676_10038891 3300005328 Bacteria 2749
12 Ga0070676_10072225 3300005328 Bacteria 2074
13 Ga0070676_10108269 3300005328 Bacteria 1727
14 Ga0070683_100001287 3300005329 Bacteria 19089
15 Ga0070683_100012440 3300005329 Bacteria 7396
16 Ga0070683_100031022 3300005329 Bacteria 4856
17 Ga0070683_100234752 3300005329 Bacteria 1744
18 Ga0070683_100377037 3300005329 Bacteria 1352
19 Ga0070690_100000076 3300005330 Bacteria 48076
20 Ga0070690_100007192 3300005330 Bacteria 6367
21 Ga0070690_100034185 3300005330 Bacteria 3185
22 Ga0070690_100115903 3300005330 Bacteria 1793
23 Ga0070690_100247875 3300005330 Bacteria 1259
24 Ga0070670_100002815 3300005331 Bacteria 14386
25 Ga0070670_100019908 3300005331 Bacteria 5761
26 Ga0070670_100134100 3300005331 Bacteria 2139
27 Ga0070670_100205058 3300005331 Bacteria 1714
28 Ga0070670_100361202 3300005331 Bacteria 1277
29 Ga0070677_10003277 3300005333 Bacteria 5215
30 Ga0070677_10008080 3300005333 Bacteria 3529
31 Ga0068869_100000088 3300005334 Bacteria 42016
32 Ga0068869_100000717 3300005334 Bacteria 18833
33 Ga0068869_100001183 3300005334 Bacteria 15316
34 Ga0068869_100028801 3300005334 Bacteria 3885
35 Ga0068869_100060879 3300005334 Bacteria 2768
36 Ga0068869_100156574 3300005334 Bacteria 1771
37 Ga0068869_100348418 3300005334 Bacteria 1207
38 Ga0070666_10019183 3300005335 Bacteria 4411
39 Ga0070666_10041096 3300005335 Bacteria 3089
40 Ga0070666_10076366 3300005335 Bacteria 2285
41 Ga0070666_10080253 3300005335 Bacteria 2229
42 Ga0070666_10383584 3300005335 Bacteria 1009
43 Ga0070680_100092124 3300005336 Bacteria 2509
44 Ga0070680_100247497 3300005336 Bacteria 1507
45 Ga0070680_100346249 3300005336 Bacteria 1263
46 Ga0070682_100057269 3300005337 Bacteria 2455
47 Ga0068868_100010467 3300005338 Bacteria 6718
48 Ga0068868_100025737 3300005338 Bacteria 4479
49 Ga0068868_100100558 3300005338 Bacteria 2339
50 Ga0068868_100124166 3300005338 Bacteria 2107
51 Ga0068868_100223011 3300005338 Bacteria 1579
52 Ga0068868_100305234 3300005338 Bacteria 1353
53 Ga0068868_100336109 3300005338 Bacteria 1290
54 Ga0070660_100001693 3300005339 Bacteria 15121
55 Ga0070660_100027181 3300005339 Bacteria 4268
56 Ga0070660_100068215 3300005339 Bacteria 2772
57 Ga0070660_100196004 3300005339 Bacteria 1637
58 Ga0070660_100220072 3300005339 Bacteria 1543
59 Ga0070689_100005432 3300005340 Bacteria 8699
60 Ga0070689_100005991 3300005340 Bacteria 8370
61 Ga0070689_100047955 3300005340 Bacteria 3294
62 Ga0070689_100063003 3300005340 Bacteria 2886
63 Ga0070689_100305314 3300005340 Bacteria 1325
64 Ga0070691_10003688 3300005341 Bacteria 6917
65 Ga0070691_10063733 3300005341 Bacteria 1777
66 Ga0070687_100009320 3300005343 Bacteria 4202
67 Ga0070661_100006074 3300005344 Bacteria 8312
68 Ga0070661_100010193 3300005344 Bacteria 6529
69 Ga0070661_100020639 3300005344 Bacteria 4699
70 Ga0070692_10096736 3300005345 Bacteria 1613
71 Ga0070692_10175038 3300005345 Bacteria 1240
72 Ga0070668_100002207 3300005347 Bacteria 14294
73 Ga0070668_100003003 3300005347 Bacteria 12469
74 Ga0070668_100015878 3300005347 Bacteria 5633
75 Ga0070668_100077656 3300005347 Bacteria 2596
76 Ga0070668_100088342 3300005347 Bacteria 2440
77 Ga0070668_100088391 3300005347 Bacteria 2439
78 Ga0070668_100105635 3300005347 Bacteria 2236
79 Ga0070668_100143510 3300005347 Bacteria 1926
80 Ga0070668_100159150 3300005347 Bacteria 1831
81 Ga0070668_100344462 3300005347 Bacteria 1260
82 Ga0070669_100001156 3300005353 Bacteria 19281
83 Ga0070669_100013323 3300005353 Bacteria 5846
84 Ga0070669_100025892 3300005353 Bacteria 4217
85 Ga0070669_100046555 3300005353 Bacteria 3163
86 Ga0070669_100085778 3300005353 Bacteria 2351
87 Ga0070669_100242557 3300005353 Bacteria 1432
88 Ga0070669_100258135 3300005353 Bacteria 1390
89 Ga0070675_100004311 3300005354 Bacteria 10844
90 Ga0070675_100017285 3300005354 Bacteria 5731
91 Ga0070675_100022702 3300005354 Bacteria 5013
92 Ga0070675_100046835 3300005354 Bacteria 3542
93 Ga0070675_100050884 3300005354 Bacteria 3402
94 Ga0070671_100002321 3300005355 Bacteria 14682
95 Ga0070671_100003085 3300005355 Bacteria 12964
96 Ga0070671_100015150 3300005355 Bacteria 6227
97 Ga0070671_100053520 3300005355 Bacteria 3355
98 Ga0070671_100060051 3300005355 Bacteria 3165
99 Ga0070671_100152688 3300005355 Bacteria 1950
100 Ga0070671_100198530 3300005355 Bacteria 1701
101 Ga0070674_100000201 3300005356 Bacteria 28830
102 Ga0070674_100006528 3300005356 Bacteria 6813
103 Ga0070674_100015303 3300005356 Bacteria 4787
104 Ga0070674_100028845 3300005356 Bacteria 3648
105 Ga0070674_100193571 3300005356 Bacteria 1566
106 Ga0070674_100232750 3300005356 Bacteria 1439
107 Ga0070674_100271511 3300005356 Bacteria 1340
108 Ga0070673_100001215 3300005364 Bacteria 14873
109 Ga0070673_100014731 3300005364 Bacteria 5462
110 Ga0070673_100014757 3300005364 Bacteria 5459
111 Ga0070673_100023959 3300005364 Bacteria 4467
112 Ga0070673_100084963 3300005364 Bacteria 2575
113 Ga0070688_100000896 3300005365 Bacteria 14860
114 Ga0070688_100003476 3300005365 Bacteria 8115
115 Ga0070688_100032259 3300005365 Bacteria 3157
116 Ga0070659_100005062 3300005366 Bacteria 9448
117 Ga0070659_100017470 3300005366 Bacteria 5402
118 Ga0070659_100060510 3300005366 Bacteria 2991
119 Ga0070659_100081795 3300005366 Bacteria 2579
120 Ga0070667_100003209 3300005367 Bacteria 14006
121 Ga0070667_100005512 3300005367 Bacteria 10571
122 Ga0070667_100006580 3300005367 Bacteria 9662
123 Ga0070667_100050405 3300005367 Bacteria 3508
124 Ga0070667_100051843 3300005367 Bacteria 3460
125 Ga0070667_100234265 3300005367 Bacteria 1638
126 Ga0070667_100262909 3300005367 Bacteria 1545
127 Ga0070667_100275423 3300005367 Bacteria 1510
128 Ga0070709_10004984 3300005434 Bacteria 7173
129 Ga0070709_10122109 3300005434 Bacteria 1767
130 Ga0070714_100005782 3300005435 Bacteria 9484
131 Ga0070714_100013363 3300005435 Bacteria 6580
132 Ga0070714_100121574 3300005435 Bacteria 2323
133 Ga0070713_100000039 3300005436 Bacteria 83384
134 Ga0070713_100004462 3300005436 Bacteria 9404
135 Ga0070713_100037161 3300005436 Bacteria 3936
136 Ga0070713_100080634 3300005436 Bacteria 2775
137 Ga0070701_10000399 3300005438 Bacteria 14648
138 Ga0070701_10075718 3300005438 Bacteria 1810
139 Ga0070701_10101812 3300005438 Bacteria 1592
140 Ga0070711_100010984 3300005439 Bacteria 5614
141 Ga0070711_100042986 3300005439 Bacteria 3058
142 Ga0070705_100074130 3300005440 Bacteria 2068
143 Ga0070705_100086692 3300005440 Bacteria 1939
144 Ga0070705_100104478 3300005440 Bacteria 1796
145 Ga0070705_100173360 3300005440 Bacteria 1454
146 Ga0070700_100000695 3300005441 Bacteria 16626
147 Ga0070700_100011858 3300005441 Bacteria 4841
148 Ga0070694_100017434 3300005444 Bacteria 4539
149 Ga0070694_100070645 3300005444 Bacteria 2404
150 Ga0070708_100001846 3300005445 Bacteria 16258
151 Ga0070663_100009903 3300005455 Bacteria 5921
152 Ga0070663_100031301 3300005455 Bacteria 3656
153 Ga0070663_100031697 3300005455 Bacteria 3635
154 Ga0070663_100164775 3300005455 Bacteria 1709
155 Ga0070663_100180459 3300005455 Bacteria 1637
156 Ga0070663_100241612 3300005455 Bacteria 1426
157 Ga0070678_100000169 3300005456 Bacteria 28018
158 Ga0070678_100002373 3300005456 Bacteria 10296
159 Ga0070678_100003566 3300005456 Bacteria 8681
160 Ga0070678_100005377 3300005456 Bacteria 7388
161 Ga0070678_100008313 3300005456 Bacteria 6214
162 Ga0070678_100043852 3300005456 Bacteria 3189
163 Ga0070678_100074831 3300005456 Bacteria 2546
164 Ga0070678_100485488 3300005456 Bacteria 1088
165 Ga0070678_100505638 3300005456 Bacteria 1067
166 Ga0070662_100000554 3300005457 Bacteria 22651
167 Ga0070662_100037635 3300005457 Bacteria 3431
168 Ga0070662_100040446 3300005457 Bacteria 3319
169 Ga0070662_100093697 3300005457 Bacteria 2260
170 Ga0070662_100269277 3300005457 Bacteria 1375
171 Ga0070681_10006907 3300005458 Bacteria 11050
172 Ga0070681_10021992 3300005458 Bacteria 6399
173 Ga0070681_10065344 3300005458 Bacteria 3607
174 Ga0070681_10378656 3300005458 Bacteria 1326
175 Ga0068867_100001455 3300005459 Bacteria 16409
176 Ga0068867_100002460 3300005459 Bacteria 13022
177 Ga0068867_100004404 3300005459 Bacteria 9905
178 Ga0068867_100046777 3300005459 Bacteria 3179
179 Ga0068867_100047495 3300005459 Bacteria 3156
180 Ga0068867_100076291 3300005459 Bacteria 2516
181 Ga0068867_100212268 3300005459 Bacteria 1555
182 Ga0068867_100234012 3300005459 Bacteria 1486
183 Ga0068867_100391734 3300005459 Bacteria 1169
184 Ga0070685_10002112 3300005466 Bacteria 10265
185 Ga0070685_10025251 3300005466 Bacteria 3270
186 Ga0070698_100396666 3300005471 Bacteria 1313
187 Ga0070699_100086564 3300005518 Bacteria 2735
188 Ga0070699_100087382 3300005518 Bacteria 2721
189 Ga0070679_100034376 3300005530 Bacteria 5024
190 Ga0070679_100098982 3300005530 Bacteria 2903
191 Ga0070679_100124868 3300005530 Bacteria 2557
192 Ga0070679_100407258 3300005530 Bacteria 1306
193 Ga0070684_100001168 3300005535 Bacteria 18835
194 Ga0070684_100014961 3300005535 Bacteria 6299
195 Ga0068853_100004198 3300005539 Bacteria 11111
196 Ga0068853_100013365 3300005539 Bacteria 6702
197 Ga0068853_100016992 3300005539 Bacteria 5999
198 Ga0068853_100047579 3300005539 Bacteria 3681
199 Ga0068853_100080012 3300005539 Bacteria 2858
200 Ga0068853_100083060 3300005539 Bacteria 2806
201 Ga0068853_100105281 3300005539 Bacteria 2499
202 Ga0068853_100384572 3300005539 Bacteria 1311
203 Ga0068853_100431284 3300005539 Bacteria 1237
204 Ga0068853_100533199 3300005539 Unclassified 1111
205 Ga0070672_100000440 3300005543 Bacteria 24267
206 Ga0070672_100005197 3300005543 Bacteria 8609
207 Ga0070672_100049300 3300005543 Bacteria 3275
208 Ga0070672_100050443 3300005543 Bacteria 3241
209 Ga0070672_100061572 3300005543 Bacteria 2959
210 Ga0070672_100086223 3300005543 Bacteria 2525
211 Ga0070672_100122859 3300005543 Bacteria 2127
212 Ga0070672_100125117 3300005543 Bacteria 2108
213 Ga0070672_100129992 3300005543 Bacteria 2069
214 Ga0070672_100307976 3300005543 Bacteria 1344
215 Ga0070686_100000265 3300005544 Bacteria 35750
216 Ga0070686_100296934 3300005544 Unclassified 1197
217 Ga0070686_100622145 3300005544 Bacteria 853
218 Ga0070695_100010977 3300005545 Bacteria 5415
219 Ga0070695_100032469 3300005545 Bacteria 3264
220 Ga0070695_100038044 3300005545 Bacteria 3034
221 Ga0070696_100027813 3300005546 Bacteria 3856
222 Ga0070696_100030558 3300005546 Bacteria 3689
223 Ga0070696_100057565 3300005546 Bacteria 2713
224 Ga0070696_100212328 3300005546 Bacteria 1449
225 Ga0070696_100440431 3300005546 Bacteria 1026
226 Ga0070693_100012997 3300005547 Bacteria 4228
227 Ga0070693_100123847 3300005547 Bacteria 1607
228 Ga0070693_100190158 3300005547 Bacteria 1327
229 Ga0070665_100001395 3300005548 Bacteria 28413
230 Ga0070665_100074886 3300005548 Bacteria 3391
231 Ga0070665_100185487 3300005548 Bacteria 2081
232 Ga0070665_100284673 3300005548 Bacteria 1655
233 Ga0070665_100347234 3300005548 Bacteria 1489
234 Ga0070704_100069699 3300005549 Bacteria 2549
235 Ga0068855_100007680 3300005563 Bacteria 13030
236 Ga0068855_100046728 3300005563 Bacteria 5116
237 Ga0068855_100066105 3300005563 Bacteria 4215
238 Ga0068855_100082939 3300005563 Bacteria 3715
239 Ga0068855_100324526 3300005563 Bacteria 1701
240 Ga0068855_100461052 3300005563 Bacteria 1386
241 Ga0070664_100004095 3300005564 Bacteria 11709
242 Ga0070664_100021991 3300005564 Bacteria 5259
243 Ga0070664_100029333 3300005564 Bacteria 4587
244 Ga0070664_100089347 3300005564 Bacteria 2665
245 Ga0070664_100116008 3300005564 Bacteria 2341
246 Ga0070664_100137742 3300005564 Bacteria 2147
247 Ga0070664_100159028 3300005564 Bacteria 1998
248 Ga0070664_100269714 3300005564 Bacteria 1533
249 Ga0070664_100358199 3300005564 Bacteria 1328
250 Ga0068857_100000465 3300005577 Bacteria 28816
251 Ga0068857_100012046 3300005577 Bacteria 7519
252 Ga0068857_100028444 3300005577 Bacteria 4933
253 Ga0068857_100059544 3300005577 Bacteria 3392
254 Ga0068857_100375812 3300005577 Bacteria 1319
255 Ga0068854_100008411 3300005578 Bacteria 6633
256 Ga0068854_100011787 3300005578 Bacteria 5707
257 Ga0068854_100016344 3300005578 Bacteria 4945
258 Ga0068854_100398130 3300005578 Bacteria 1139
259 Ga0068856_100000962 3300005614 Bacteria 30736
260 Ga0068856_100001205 3300005614 Bacteria 27150
261 Ga0068856_100053867 3300005614 Bacteria 3967
262 Ga0068856_100095061 3300005614 Bacteria 2968
263 Ga0068856_100334627 3300005614 Bacteria 1532
264 Ga0070702_100000169 3300005615 Bacteria 20800
265 Ga0070702_100036658 3300005615 Bacteria 2718
266 Ga0070702_100040204 3300005615 Bacteria 2615
267 Ga0070702_100055160 3300005615 Bacteria 2290
268 Ga0070702_100121365 3300005615 Bacteria 1637
269 Ga0068852_100020943 3300005616 Bacteria 5208
270 Ga0068852_100044998 3300005616 Bacteria 3752
271 Ga0068852_100060515 3300005616 Bacteria 3287
272 Ga0068852_100182963 3300005616 Bacteria 1972
273 Ga0068852_100219713 3300005616 Bacteria 1807
274 Ga0068852_100227600 3300005616 Bacteria 1776
275 Ga0068852_100287974 3300005616 Bacteria 1586
276 Ga0068859_100002809 3300005617 Bacteria 17641
277 Ga0068859_100003358 3300005617 Bacteria 16282
278 Ga0068859_100019571 3300005617 Bacteria 6800
279 Ga0068859_100066896 3300005617 Bacteria 3628
280 Ga0068859_100093881 3300005617 Bacteria 3052
281 Ga0068859_100104174 3300005617 Bacteria 2896
282 Ga0068859_100292570 3300005617 Bacteria 1722
283 Ga0068859_100426994 3300005617 Bacteria 1422
284 Ga0068864_100001769 3300005618 Bacteria 17759
285 Ga0068864_100003838 3300005618 Bacteria 12389
286 Ga0068864_100007835 3300005618 Bacteria 8802
287 Ga0068864_100014828 3300005618 Bacteria 6475
288 Ga0068864_100015696 3300005618 Bacteria 6299
289 Ga0068864_100017807 3300005618 Bacteria 5926
290 Ga0068864_100048679 3300005618 Bacteria 3645
291 Ga0068864_100241597 3300005618 Bacteria 1673
292 Ga0068864_100260814 3300005618 Bacteria 1612
293 Ga0068866_10000107 3300005718 Bacteria 35562
294 Ga0068866_10002377 3300005718 Bacteria 7804
295 Ga0068866_10055787 3300005718 Bacteria 2030
296 Ga0068861_100001908 3300005719 Bacteria 13422
297 Ga0068861_100002714 3300005719 Bacteria 11587
298 Ga0068861_100017867 3300005719 Bacteria 5040
299 Ga0068861_100036343 3300005719 Bacteria 3654
300 Ga0068861_100087450 3300005719 Bacteria 2452
301 Ga0068851_10001492 3300005834 Bacteria 10276
302 Ga0068851_10003124 3300005834 Bacteria 7338
303 Ga0068851_10003579 3300005834 Bacteria 6924
304 Ga0068851_10024911 3300005834 Bacteria 2932
305 Ga0068870_10008706 3300005840 Bacteria 4576
306 Ga0068870_10017986 3300005840 Bacteria 3405
307 Ga0068870_10025091 3300005840 Bacteria 2957
308 Ga0068870_10052619 3300005840 Bacteria 2160
309 Ga0068870_10176239 3300005840 Bacteria 1280
310 Ga0068863_100007665 3300005841 Bacteria 10561
311 Ga0068863_100007669 3300005841 Bacteria 10556
312 Ga0068863_100013004 3300005841 Bacteria 8026
313 Ga0068863_100053915 3300005841 Bacteria 3811
314 Ga0068863_100125651 3300005841 Bacteria 2447
315 Ga0068863_100127265 3300005841 Bacteria 2431
316 Ga0068863_100131432 3300005841 Bacteria 2390
317 Ga0068863_100149131 3300005841 Bacteria 2237
318 Ga0068863_100189917 3300005841 Bacteria 1974
319 Ga0068863_100247590 3300005841 Bacteria 1721
320 Ga0068863_100287822 3300005841 Bacteria 1593
321 Ga0068858_100002634 3300005842 Bacteria 18080
322 Ga0068858_100006556 3300005842 Bacteria 11322
323 Ga0068858_100012060 3300005842 Bacteria 8145
324 Ga0068858_100037867 3300005842 Bacteria 4472
325 Ga0068858_100065474 3300005842 Bacteria 3363
326 Ga0068858_100167891 3300005842 Bacteria 2068
327 Ga0068858_100404486 3300005842 Bacteria 1312
328 Ga0068858_100448955 3300005842 Bacteria 1242
329 Ga0068860_100008429 3300005843 Bacteria 10267
330 Ga0068860_100010005 3300005843 Bacteria 9401
331 Ga0068860_100023819 3300005843 Bacteria 5918
332 Ga0068860_100030005 3300005843 Bacteria 5229
333 Ga0068860_100032212 3300005843 Bacteria 5038
334 Ga0068860_100042964 3300005843 Bacteria 4313
335 Ga0068860_100053859 3300005843 Bacteria 3824
336 Ga0068860_100062653 3300005843 Bacteria 3533
337 Ga0068860_100145146 3300005843 Bacteria 2283
338 Ga0068860_100192197 3300005843 Bacteria 1975
339 Ga0068860_100233796 3300005843 Bacteria 1786
340 Ga0068860_100327203 3300005843 Bacteria 1505
341 Ga0068862_100005712 3300005844 Bacteria 10379
342 Ga0068862_100041412 3300005844 Bacteria 3918
343 Ga0068862_100048687 3300005844 Bacteria 3619
344 Ga0068862_100070328 3300005844 Bacteria 3021
345 Ga0068862_100086797 3300005844 Bacteria 2721
346 Ga0068862_100087654 3300005844 Bacteria 2707
347 Ga0068862_100093715 3300005844 Bacteria 2619
348 Ga0068862_100227551 3300005844 Bacteria 1691
349 Ga0068862_100388021 3300005844 Bacteria 1304
350 Ga0081539_10004036 3300005985 Bacteria 16839
351 Ga0070716_100110016 3300006173 Bacteria 1706
352 Ga0070712_100031277 3300006175 Bacteria 3584
353 Ga0070712_100238042 3300006175 Bacteria 1449
354 Ga0097621_100004128 3300006237 Bacteria 10071
355 Ga0097621_100015018 3300006237 Bacteria 5814
356 Ga0097621_100019995 3300006237 Bacteria 5153
357 Ga0097621_100082429 3300006237 Bacteria 2678
358 Ga0097621_100107011 3300006237 Bacteria 2359
359 Ga0097621_100152761 3300006237 Bacteria 1980
360 Ga0097621_100333176 3300006237 Bacteria 1346
361 Ga0097621_100378555 3300006237 Bacteria 1264
362 Ga0068871_100001255 3300006358 Bacteria 16960
363 Ga0068871_100003622 3300006358 Bacteria 10614
364 Ga0068871_100020253 3300006358 Bacteria 5093
365 Ga0068871_100020467 3300006358 Bacteria 5069
366 Ga0068871_100035781 3300006358 Bacteria 3948
367 Ga0068871_100061281 3300006358 Bacteria 3072
368 Ga0068871_100075397 3300006358 Bacteria 2784
369 Ga0068871_100090925 3300006358 Bacteria 2543
370 Ga0068871_100300808 3300006358 Bacteria 1408
371 Ga0068871_100591902 3300006358 Bacteria 1008
372 Ga0075428_100130851 3300006844 Bacteria 2730
373 Ga0075428_100729616 3300006844 Bacteria 1055
374 Ga0075430_100332586 3300006846 Bacteria 1255
375 Ga0075431_100404444 3300006847 Bacteria 1366
376 Ga0075434_100202202 3300006871 Bacteria 2007
377 Ga0075434_100510365 3300006871 Bacteria 1223
378 Ga0075429_100405365 3300006880 Bacteria 1194
379 Ga0068865_100000281 3300006881 Bacteria 28119
380 Ga0068865_100071695 3300006881 Bacteria 2458
381 Ga0068865_100101425 3300006881 Bacteria 2108
382 Ga0068865_100107727 3300006881 Bacteria 2050
383 Ga0068865_100125400 3300006881 Bacteria 1916
384 Ga0068865_100645659 3300006881 Bacteria 899
385 Ga0075436_100085811 3300006914 Bacteria 2186
386 Ga0075436_100197575 3300006914 Bacteria 1424
387 Ga0097620_100002809 3300006931 Bacteria 17641
388 Ga0097620_100003358 3300006931 Bacteria 16282
389 Ga0097620_100019569 3300006931 Bacteria 6800
390 Ga0097620_100066904 3300006931 Bacteria 3628
391 Ga0097620_100093880 3300006931 Bacteria 3052
392 Ga0097620_100104175 3300006931 Bacteria 2896
393 Ga0097620_100292562 3300006931 Bacteria 1722
394 Ga0097620_100427006 3300006931 Bacteria 1422
395 Ga0075435_100300789 3300007076 Bacteria 1372
396 Ga0105240_10010941 3300009093 Bacteria 12710
397 Ga0105240_10018465 3300009093 Bacteria 9364
398 Ga0105240_10061726 3300009093 Bacteria 4670
399 Ga0105240_10330625 3300009093 Bacteria 1734
400 Ga0111539_10053147 3300009094 Bacteria 4822
401 Ga0105245_10000511 3300009098 Bacteria 35566
402 Ga0105245_10034453 3300009098 Bacteria 4491
403 Ga0105245_10051712 3300009098 Bacteria 3683
404 Ga0105245_10097516 3300009098 Bacteria 2715
405 Ga0105247_10219055 3300009101 Bacteria 1287
406 Ga0105243_10001212 3300009148 Bacteria 23228
407 Ga0105243_10212867 3300009148 Bacteria 1703
408 Ga0105241_10012701 3300009174 Bacteria 6180
409 Ga0105241_10104896 3300009174 Bacteria 2253
410 Ga0105242_10002499 3300009176 Bacteria 14416
411 Ga0105242_10014168 3300009176 Bacteria 6174
412 Ga0105242_10038238 3300009176 Bacteria 3858
413 Ga0105242_10130741 3300009176 Bacteria 2167
414 Ga0105242_10164332 3300009176 Bacteria 1946
415 Ga0105242_10239056 3300009176 Bacteria 1632
416 Ga0105242_10324829 3300009176 Bacteria 1413
417 Ga0105248_10007610 3300009177 Bacteria 11898
418 Ga0105248_10019862 3300009177 Bacteria 7441
419 Ga0105248_10048080 3300009177 Bacteria 4785
420 Ga0105248_10161258 3300009177 Bacteria 2529
421 Ga0105248_10180308 3300009177 Bacteria 2380
422 Ga0105248_10247179 3300009177 Bacteria 2008
423 Ga0105248_10938239 3300009177 Bacteria 977
424 Ga0105237_10033884 3300009545 Bacteria 5174
425 Ga0105237_10050061 3300009545 Bacteria 4199
426 Ga0105237_10058469 3300009545 Bacteria 3859
427 Ga0105237_10393642 3300009545 Bacteria 1390
428 Ga0105238_10000817 3300009551 Bacteria 32236
429 Ga0105238_10007607 3300009551 Bacteria 10858
430 Ga0105238_10067792 3300009551 Bacteria 3568
431 Ga0105238_10076233 3300009551 Bacteria 3344
432 Ga0105249_10014809 3300009553 Bacteria 6894
433 Ga0105249_10046471 3300009553 Bacteria 3951
434 Ga0105249_10112822 3300009553 Bacteria 2571
435 Ga0105239_10143552 3300010375 Bacteria 2661
436 Ga0105239_10254400 3300010375 Bacteria 1973
437 Ga0105239_10491997 3300010375 Bacteria 1394
438 Ga0157373_10001602 3300013100 Bacteria 17274
439 Ga0157373_10017961 3300013100 Bacteria 5150
440 Ga0157373_10069308 3300013100 Bacteria 2494
441 Ga0157373_10437123 3300013100 Bacteria 940
442 Ga0157371_10010228 3300013102 Bacteria 7327
443 Ga0157371_10029894 3300013102 Bacteria 3934
444 Ga0157371_10047846 3300013102 Bacteria 3040
445 Ga0157371_10236011 3300013102 Bacteria 1315
446 Ga0157370_10008792 3300013104 Bacteria 10850
447 Ga0157370_10017286 3300013104 Bacteria 7279
448 Ga0157370_10050351 3300013104 Bacteria 3982
449 Ga0157370_10069275 3300013104 Bacteria 3332
450 Ga0157370_10160044 3300013104 Bacteria 2095
451 Ga0157370_10391572 3300013104 Bacteria 1279
452 Ga0157369_10064425 3300013105 Bacteria 3947
453 Ga0157369_10098306 3300013105 Bacteria 3122
454 Ga0157369_10150200 3300013105 Bacteria 2462
455 Ga0157374_10043219 3300013296 Bacteria 4161
456 Ga0157374_10093604 3300013296 Bacteria 2869
457 Ga0157374_10267005 3300013296 Bacteria 1687
458 Ga0157374_10283231 3300013296 Bacteria 1637
459 Ga0157374_10707758 3300013296 Bacteria 1020
460 Ga0157378_10010461 3300013297 Bacteria 8104
461 Ga0157378_10027168 3300013297 Bacteria 5050
462 Ga0157378_10057901 3300013297 Bacteria 3455
463 Ga0157378_10249147 3300013297 Bacteria 1700
464 Ga0157378_10256624 3300013297 Bacteria 1676
465 Ga0163162_10004211 3300013306 Bacteria 13826
466 Ga0163162_10015531 3300013306 Bacteria 7442
467 Ga0163162_10025286 3300013306 Bacteria 5867
468 Ga0163162_10047462 3300013306 Bacteria 4304
469 Ga0163162_10071918 3300013306 Bacteria 3513
470 Ga0157372_10007349 3300013307 Bacteria 11721
471 Ga0157372_10009688 3300013307 Bacteria 10241
472 Ga0157372_10015367 3300013307 Bacteria 8203
473 Ga0157372_10043059 3300013307 Bacteria 4997
474 Ga0157372_10686247 3300013307 Bacteria 1192
475 Ga0157375_10012219 3300013308 Bacteria 7613
476 Ga0157375_10015352 3300013308 Bacteria 6853
477 Ga0157375_10041117 3300013308 Bacteria 4461
478 Ga0157375_10068792 3300013308 Bacteria 3544
479 Ga0157375_10111297 3300013308 Bacteria 2837
480 Ga0157375_10114144 3300013308 Bacteria 2803
481 Ga0157375_10140113 3300013308 Bacteria 2545
482 Ga0157375_10156544 3300013308 Bacteria 2417
483 Ga0157375_10337562 3300013308 Bacteria 1672
484 Ga0163163_10019983 3300014325 Bacteria 6301
485 Ga0163163_10033099 3300014325 Bacteria 4998
486 Ga0163163_10033527 3300014325 Bacteria 4968
487 Ga0163163_10038819 3300014325 Bacteria 4643
488 Ga0163163_10222634 3300014325 Bacteria 1936
489 Ga0163163_10361973 3300014325 Unclassified 1507
490 Ga0163163_10539130 3300014325 Bacteria 1229
491 Ga0157380_10003477 3300014326 Bacteria 10815
492 Ga0157380_10011897 3300014326 Bacteria 6295
493 Ga0157380_10195321 3300014326 Bacteria 1790
494 Ga0157380_10560146 3300014326 Bacteria 1123
495 Ga0182008_10080964 3300014497 Bacteria 1598
496 Ga0157377_10002721 3300014745 Bacteria 7859
497 Ga0157379_10021513 3300014968 Bacteria 5710
498 Ga0157379_10024362 3300014968 Bacteria 5373
499 Ga0157379_10026641 3300014968 Bacteria 5146
500 Ga0157379_10061926 3300014968 Bacteria 3347
501 Ga0157379_10073753 3300014968 Bacteria 3055
502 Ga0157379_10130031 3300014968 Bacteria 2266
503 Ga0157379_10198580 3300014968 Bacteria 1813
504 Ga0157379_10214470 3300014968 Bacteria 1743
505 Ga0157376_10024082 3300014969 Bacteria 4775
506 Ga0157376_10062975 3300014969 Bacteria 3123
507 Ga0157376_10064154 3300014969 Bacteria 3097
508 Ga0157376_10080059 3300014969 Bacteria 2801
509 Ga0157376_10086054 3300014969 Bacteria 2710
510 Ga0157376_10122623 3300014969 Bacteria 2306
511 Ga0157376_10481526 3300014969 Bacteria 1216
512 Ga0157376_10491953 3300014969 Bacteria 1204
513 Ga0163161_10034950 3300017792 Bacteria 3596
514 Ga0163161_10161956 3300017792 Bacteria 1706
515 Ga0163161_10175493 3300017792 Bacteria 1640
516 Ga0163161_10236639 3300017792 Bacteria 1419
517 Ga0206353_11413114 3300020082 Bacteria 2307
518 Ga0207697_10000331 3300025315 Bacteria 26425
519 Ga0207697_10028371 3300025315 Bacteria 2289
520 Ga0207656_10023601 3300025321 Bacteria 2478
521 Ga0207656_10097702 3300025321 Bacteria 1342
522 Ga0207656_10111576 3300025321 Bacteria 1264
523 Ga0207682_10000010 3300025893 Bacteria 85697
524 Ga0207682_10004862 3300025893 Bacteria 5548
525 Ga0207682_10025216 3300025893 Bacteria 2358
526 Ga0207682_10071046 3300025893 Bacteria 1475
527 Ga0207642_10004760 3300025899 Bacteria 4384
528 Ga0207642_10005957 3300025899 Bacteria 4019
529 Ga0207642_10064870 3300025899 Bacteria 1714
530 Ga0207642_10297612 3300025899 Bacteria 934
531 Ga0207688_10016279 3300025901 Bacteria 4032
532 Ga0207688_10031894 3300025901 Bacteria 2910
533 Ga0207680_10030182 3300025903 Bacteria 3055
534 Ga0207680_10060062 3300025903 Bacteria 2312
535 Ga0207680_10153721 3300025903 Bacteria 1536
536 Ga0207680_10245461 3300025903 Bacteria 1235
537 Ga0207680_10394917 3300025903 Bacteria 977
538 Ga0207647_10052716 3300025904 Bacteria 2510
539 Ga0207699_10020606 3300025906 Bacteria 3538
540 Ga0207699_10085520 3300025906 Bacteria 1967
541 Ga0207699_10157381 3300025906 Bacteria 1509
542 Ga0207645_10000617 3300025907 Bacteria 29514
543 Ga0207645_10005474 3300025907 Bacteria 9191
544 Ga0207645_10006124 3300025907 Bacteria 8642
545 Ga0207645_10056183 3300025907 Bacteria 2513
546 Ga0207645_10077362 3300025907 Bacteria 2132
547 Ga0207645_10085960 3300025907 Bacteria 2020
548 Ga0207645_10092917 3300025907 Bacteria 1941
549 Ga0207645_10140804 3300025907 Bacteria 1572
550 Ga0207643_10000339 3300025908 Bacteria 31901
551 Ga0207643_10003075 3300025908 Bacteria 8969
552 Ga0207643_10010591 3300025908 Bacteria 4966
553 Ga0207643_10029469 3300025908 Bacteria 3052
554 Ga0207643_10105459 3300025908 Bacteria 1656
555 Ga0207705_10064159 3300025909 Bacteria 2654
556 Ga0207705_10334841 3300025909 Bacteria 1164
557 Ga0207654_10030031 3300025911 Bacteria 2980
558 Ga0207654_10096111 3300025911 Bacteria 1816
559 Ga0207654_10521344 3300025911 Bacteria 841
560 Ga0207707_10020569 3300025912 Bacteria 5764
561 Ga0207707_10020864 3300025912 Bacteria 5723
562 Ga0207707_10048223 3300025912 Bacteria 3710
563 Ga0207707_10171977 3300025912 Bacteria 1893
564 Ga0207707_10332782 3300025912 Bacteria 1310
565 Ga0207707_10569557 3300025912 Bacteria 961
566 Ga0207695_10019928 3300025913 Bacteria 7703
567 Ga0207695_10094834 3300025913 Bacteria 2990
568 Ga0207695_10434002 3300025913 Bacteria 1197
569 Ga0207671_10186234 3300025914 Bacteria 1617
570 Ga0207693_10039705 3300025915 Bacteria 3706
571 Ga0207693_10065781 3300025915 Bacteria 2838
572 Ga0207693_10477383 3300025915 Bacteria 974
573 Ga0207663_10011679 3300025916 Bacteria 4725
574 Ga0207663_10667240 3300025916 Bacteria 821
575 Ga0207660_10043511 3300025917 Bacteria 3157
576 Ga0207660_10091054 3300025917 Bacteria 2261
577 Ga0207660_10502515 3300025917 Bacteria 984
578 Ga0207662_10002747 3300025918 Bacteria 8885
579 Ga0207662_10197189 3300025918 Bacteria 1302
580 Ga0207657_10000708 3300025919 Bacteria 35432
581 Ga0207657_10003687 3300025919 Bacteria 16291
582 Ga0207657_10004347 3300025919 Bacteria 15008
583 Ga0207657_10044990 3300025919 Bacteria 3877
584 Ga0207657_10070048 3300025919 Bacteria 2973
585 Ga0207657_10208380 3300025919 Bacteria 1570
586 Ga0207657_10270713 3300025919 Bacteria 1350
587 Ga0207649_10012593 3300025920 Bacteria 4698
588 Ga0207649_10034021 3300025920 Bacteria 3049
589 Ga0207649_10412851 3300025920 Bacteria 1012
590 Ga0207652_10012975 3300025921 Bacteria 6742
591 Ga0207652_10096051 3300025921 Bacteria 2611
592 Ga0207652_10178685 3300025921 Bacteria 1906
593 Ga0207652_10254755 3300025921 Bacteria 1583
594 Ga0207652_10445134 3300025921 Bacteria 1168
595 Ga0207652_10487075 3300025921 Bacteria 1111
596 Ga0207681_10004220 3300025923 Bacteria 8880
597 Ga0207681_10017941 3300025923 Bacteria 4451
598 Ga0207681_10236657 3300025923 Bacteria 1419
599 Ga0207681_10291470 3300025923 Bacteria 1288
600 Ga0207681_10338946 3300025923 Bacteria 1200
601 Ga0207681_10402746 3300025923 Bacteria 1105
602 Ga0207694_10002353 3300025924 Bacteria 15459
603 Ga0207694_10102170 3300025924 Bacteria 2273
604 Ga0207694_10283959 3300025924 Bacteria 1360
605 Ga0207650_10001496 3300025925 Bacteria 16715
606 Ga0207650_10002524 3300025925 Bacteria 12699
607 Ga0207650_10006069 3300025925 Bacteria 8241
608 Ga0207650_10009870 3300025925 Bacteria 6529
609 Ga0207650_10218699 3300025925 Bacteria 1532
610 Ga0207650_10327182 3300025925 Bacteria 1256
611 Ga0207650_10420310 3300025925 Bacteria 1109
612 Ga0207659_10007042 3300025926 Bacteria 6903
613 Ga0207659_10007154 3300025926 Bacteria 6849
614 Ga0207659_10009884 3300025926 Bacteria 5971
615 Ga0207659_10349226 3300025926 Bacteria 1227
616 Ga0207659_10656752 3300025926 Bacteria 896
617 Ga0207687_10001243 3300025927 Bacteria 17449
618 Ga0207687_10002550 3300025927 Bacteria 12371
619 Ga0207687_10015968 3300025927 Bacteria 4927
620 Ga0207687_10077199 3300025927 Bacteria 2395
621 Ga0207700_10000120 3300025928 Bacteria 46325
622 Ga0207700_10003229 3300025928 Bacteria 9413
623 Ga0207664_10001435 3300025929 Bacteria 15668
624 Ga0207664_10013227 3300025929 Bacteria 5914
625 Ga0207664_10084149 3300025929 Bacteria 2594
626 Ga0207644_10008486 3300025931 Bacteria 6727
627 Ga0207644_10018762 3300025931 Bacteria 4684
628 Ga0207644_10022271 3300025931 Bacteria 4327
629 Ga0207644_10065396 3300025931 Bacteria 2644
630 Ga0207644_10264571 3300025931 Bacteria 1376
631 Ga0207644_10274705 3300025931 Bacteria 1351
632 Ga0207644_10328884 3300025931 Bacteria 1237
633 Ga0207690_10001354 3300025932 Bacteria 15380
634 Ga0207690_10004135 3300025932 Bacteria 8575
635 Ga0207690_10078832 3300025932 Bacteria 2294
636 Ga0207690_10458092 3300025932 Bacteria 1026
637 Ga0207706_10000133 3300025933 Bacteria 80935
638 Ga0207706_10026786 3300025933 Bacteria 5160
639 Ga0207706_10070740 3300025933 Bacteria 3069
640 Ga0207706_10095375 3300025933 Bacteria 2617
641 Ga0207706_10127868 3300025933 Bacteria 2234
642 Ga0207706_10190842 3300025933 Bacteria 1798
643 Ga0207706_10215873 3300025933 Bacteria 1680
644 Ga0207706_10218530 3300025933 Bacteria 1669
645 Ga0207686_10000084 3300025934 Bacteria 79402
646 Ga0207686_10006296 3300025934 Bacteria 6384
647 Ga0207686_10078144 3300025934 Bacteria 2151
648 Ga0207686_10169889 3300025934 Bacteria 1537
649 Ga0207686_10245324 3300025934 Bacteria 1306
650 Ga0207709_10003776 3300025935 Bacteria 8901
651 Ga0207709_10083640 3300025935 Bacteria 2064
652 Ga0207670_10021569 3300025936 Bacteria 3977
653 Ga0207670_10037639 3300025936 Bacteria 3154
654 Ga0207670_10063605 3300025936 Bacteria 2526
655 Ga0207670_10169806 3300025936 Bacteria 1634
656 Ga0207670_10253332 3300025936 Bacteria 1361
657 Ga0207669_10023657 3300025937 Bacteria 3286
658 Ga0207669_10040048 3300025937 Bacteria 2714
659 Ga0207669_10056519 3300025937 Bacteria 2384
660 Ga0207669_10155370 3300025937 Bacteria 1608
661 Ga0207669_10214414 3300025937 Bacteria 1408
662 Ga0207704_10000722 3300025938 Bacteria 14494
663 Ga0207704_10011741 3300025938 Bacteria 4326
664 Ga0207704_10019197 3300025938 Bacteria 3586
665 Ga0207704_10123398 3300025938 Bacteria 1778
666 Ga0207704_10153328 3300025938 Bacteria 1629
667 Ga0207704_10196419 3300025938 Bacteria 1472
668 Ga0207704_10291557 3300025938 Bacteria 1245
669 Ga0207704_10780327 3300025938 Bacteria 797
670 Ga0207665_10020509 3300025939 Bacteria 4344
671 Ga0207665_10089964 3300025939 Bacteria 2127
672 Ga0207691_10000170 3300025940 Bacteria 60463
673 Ga0207691_10000282 3300025940 Bacteria 50196
674 Ga0207691_10000856 3300025940 Bacteria 30200
675 Ga0207691_10001299 3300025940 Bacteria 24940
676 Ga0207691_10009678 3300025940 Bacteria 9246
677 Ga0207691_10011409 3300025940 Bacteria 8527
678 Ga0207691_10064835 3300025940 Bacteria 3308
679 Ga0207691_10075725 3300025940 Bacteria 3034
680 Ga0207691_10078713 3300025940 Bacteria 2967
681 Ga0207691_10093880 3300025940 Bacteria 2685
682 Ga0207691_10114050 3300025940 Bacteria 2401
683 Ga0207691_10133265 3300025940 Bacteria 2193
684 Ga0207691_10154894 3300025940 Bacteria 2013
685 Ga0207691_10215334 3300025940 Bacteria 1667
686 Ga0207691_10478884 3300025940 Bacteria 1058
687 Ga0207711_10014719 3300025941 Bacteria 6499
688 Ga0207711_10016910 3300025941 Bacteria 6059
689 Ga0207711_10023818 3300025941 Bacteria 5125
690 Ga0207711_10074048 3300025941 Bacteria 2961
691 Ga0207711_10170744 3300025941 Bacteria 1973
692 Ga0207711_10200102 3300025941 Bacteria 1823
693 Ga0207711_10405645 3300025941 Bacteria 1267
694 Ga0207711_10442719 3300025941 Bacteria 1209
695 Ga0207689_10000236 3300025942 Bacteria 49281
696 Ga0207689_10002206 3300025942 Bacteria 18258
697 Ga0207689_10003506 3300025942 Bacteria 14336
698 Ga0207689_10014507 3300025942 Bacteria 6702
699 Ga0207689_10019197 3300025942 Bacteria 5764
700 Ga0207689_10021123 3300025942 Bacteria 5472
701 Ga0207689_10062741 3300025942 Bacteria 3056
702 Ga0207689_10159472 3300025942 Bacteria 1859
703 Ga0207661_10012274 3300025944 Bacteria 6222
704 Ga0207661_10125350 3300025944 Bacteria 2193
705 Ga0207661_10230031 3300025944 Bacteria 1641
706 Ga0207661_10247756 3300025944 Bacteria 1583
707 Ga0207661_10521527 3300025944 Bacteria 1087
708 Ga0207661_10621659 3300025944 Bacteria 992
709 Ga0207679_10003266 3300025945 Bacteria 10015
710 Ga0207679_10005340 3300025945 Bacteria 8055
711 Ga0207679_10030046 3300025945 Bacteria 3791
712 Ga0207679_10136589 3300025945 Bacteria 1975
713 Ga0207667_10000842 3300025949 Bacteria 39549
714 Ga0207667_10005196 3300025949 Bacteria 15889
715 Ga0207667_10006930 3300025949 Bacteria 13696
716 Ga0207667_10021027 3300025949 Bacteria 7237
717 Ga0207667_10061536 3300025949 Bacteria 3927
718 Ga0207667_10073834 3300025949 Bacteria 3544
719 Ga0207667_10164428 3300025949 Bacteria 2282
720 Ga0207667_10455700 3300025949 Bacteria 1299
721 Ga0207651_10004556 3300025960 Bacteria 7009
722 Ga0207651_10012121 3300025960 Bacteria 4861
723 Ga0207651_10019594 3300025960 Bacteria 4059
724 Ga0207651_10026400 3300025960 Bacteria 3628
725 Ga0207651_10037630 3300025960 Bacteria 3171
726 Ga0207651_10116425 3300025960 Bacteria 2017
727 Ga0207651_10171712 3300025960 Bacteria 1710
728 Ga0207651_10183459 3300025960 Bacteria 1662
729 Ga0207651_10363388 3300025960 Bacteria 1222
730 Ga0207712_10048998 3300025961 Bacteria 2941
731 Ga0207712_10061954 3300025961 Bacteria 2657
732 Ga0207712_10802747 3300025961 Bacteria 827
733 Ga0207668_10003009 3300025972 Bacteria 9879
734 Ga0207668_10013117 3300025972 Bacteria 5093
735 Ga0207668_10043078 3300025972 Bacteria 3060
736 Ga0207668_10096489 3300025972 Bacteria 2185
737 Ga0207668_10098599 3300025972 Bacteria 2165
738 Ga0207668_10177473 3300025972 Bacteria 1677
739 Ga0207668_10269106 3300025972 Bacteria 1392
740 Ga0207668_10342029 3300025972 Bacteria 1248
741 Ga0207640_10013209 3300025981 Bacteria 4727
742 Ga0207640_10059061 3300025981 Bacteria 2530
743 Ga0207640_10068522 3300025981 Bacteria 2378
744 Ga0207658_10001473 3300025986 Bacteria 18303
745 Ga0207658_10011230 3300025986 Bacteria 6102
746 Ga0207658_10023044 3300025986 Bacteria 4341
747 Ga0207658_10059532 3300025986 Bacteria 2846
748 Ga0207658_10071019 3300025986 Bacteria 2635
749 Ga0207658_10308199 3300025986 Bacteria 1366
750 Ga0207658_10413937 3300025986 Bacteria 1187
751 Ga0207677_10000852 3300026023 Bacteria 17466
752 Ga0207677_10009840 3300026023 Bacteria 5389
753 Ga0207677_10016499 3300026023 Bacteria 4379
754 Ga0207677_10195651 3300026023 Bacteria 1603
755 Ga0207677_10379395 3300026023 Bacteria 1193
756 Ga0207677_10428655 3300026023 Bacteria 1128
757 Ga0207677_10611817 3300026023 Bacteria 957
758 Ga0207703_10001478 3300026035 Bacteria 21420
759 Ga0207703_10001789 3300026035 Bacteria 19164
760 Ga0207703_10008677 3300026035 Bacteria 8023
761 Ga0207703_10008824 3300026035 Bacteria 7948
762 Ga0207703_10036752 3300026035 Bacteria 3899
763 Ga0207703_10113313 3300026035 Bacteria 2318
764 Ga0207639_10009524 3300026041 Bacteria 6706
765 Ga0207639_10016349 3300026041 Bacteria 5247
766 Ga0207639_10421621 3300026041 Bacteria 1206
767 Ga0207639_10704690 3300026041 Bacteria 937
768 Ga0207678_10002750 3300026067 Bacteria 15930
769 Ga0207678_10007239 3300026067 Bacteria 9840
770 Ga0207678_10029950 3300026067 Bacteria 4752
771 Ga0207678_10085428 3300026067 Bacteria 2697
772 Ga0207678_10109082 3300026067 Bacteria 2361
773 Ga0207678_10160214 3300026067 Bacteria 1922
774 Ga0207678_10175535 3300026067 Bacteria 1830
775 Ga0207678_10207928 3300026067 Bacteria 1674
776 Ga0207708_10000049 3300026075 Bacteria 114743
777 Ga0207708_10003721 3300026075 Bacteria 11259
778 Ga0207708_10012750 3300026075 Bacteria 6268
779 Ga0207708_10072079 3300026075 Bacteria 2647
780 Ga0207702_10005844 3300026078 Bacteria 10700
781 Ga0207702_10010663 3300026078 Bacteria 7678
782 Ga0207702_10149474 3300026078 Bacteria 2123
783 Ga0207702_10340502 3300026078 Bacteria 1433
784 Ga0207702_10424417 3300026078 Bacteria 1286
785 Ga0207641_10004545 3300026088 Bacteria 11992
786 Ga0207641_10007973 3300026088 Bacteria 8777
787 Ga0207641_10015556 3300026088 Bacteria 6234
788 Ga0207641_10041625 3300026088 Bacteria 3850
789 Ga0207641_10062254 3300026088 Bacteria 3183
790 Ga0207641_10068108 3300026088 Bacteria 3051
791 Ga0207641_10075028 3300026088 Bacteria 2919
792 Ga0207641_10077467 3300026088 Bacteria 2877
793 Ga0207641_10077757 3300026088 Bacteria 2872
794 Ga0207641_10130083 3300026088 Bacteria 2259
795 Ga0207641_10301373 3300026088 Bacteria 1514
796 Ga0207641_10403331 3300026088 Bacteria 1313
797 Ga0207648_10000161 3300026089 Bacteria 69095
798 Ga0207648_10000203 3300026089 Bacteria 63192
799 Ga0207648_10004392 3300026089 Bacteria 14495
800 Ga0207648_10009080 3300026089 Bacteria 9558
801 Ga0207648_10014175 3300026089 Bacteria 7371
802 Ga0207648_10064069 3300026089 Bacteria 3204
803 Ga0207648_10065879 3300026089 Bacteria 3158
804 Ga0207648_10077179 3300026089 Bacteria 2904
805 Ga0207648_10182776 3300026089 Bacteria 1856
806 Ga0207648_10200444 3300026089 Bacteria 1770
807 Ga0207648_10228721 3300026089 Bacteria 1654
808 Ga0207648_10692478 3300026089 Bacteria 944
809 Ga0207676_10000303 3300026095 Bacteria 42242
810 Ga0207676_10003405 3300026095 Bacteria 11240
811 Ga0207676_10004337 3300026095 Bacteria 10036
812 Ga0207676_10004631 3300026095 Bacteria 9733
813 Ga0207676_10008662 3300026095 Bacteria 7232
814 Ga0207676_10013409 3300026095 Bacteria 5887
815 Ga0207676_10083181 3300026095 Bacteria 2606
816 Ga0207676_10227422 3300026095 Bacteria 1665
817 Ga0207676_10274361 3300026095 Bacteria 1528
818 Ga0207676_10573369 3300026095 Bacteria 1081
819 Ga0207674_10000182 3300026116 Bacteria 77228
820 Ga0207674_10003596 3300026116 Bacteria 18901
821 Ga0207674_10003869 3300026116 Bacteria 18251
822 Ga0207674_10009059 3300026116 Bacteria 11429
823 Ga0207674_10037808 3300026116 Bacteria 5016
824 Ga0207674_10065805 3300026116 Bacteria 3653
825 Ga0207674_10235964 3300026116 Bacteria 1776
826 Ga0207674_10327281 3300026116 Bacteria 1482
827 Ga0207675_100000176 3300026118 Bacteria 57464
828 Ga0207675_100002544 3300026118 Bacteria 18052
829 Ga0207675_100011066 3300026118 Bacteria 8452
830 Ga0207675_100032048 3300026118 Bacteria 4895
831 Ga0207675_100128148 3300026118 Bacteria 2405
832 Ga0207675_100144580 3300026118 Bacteria 2261
833 Ga0207675_100169409 3300026118 Bacteria 2087
834 Ga0207683_10000005 3300026121 Bacteria 187889
835 Ga0207683_10000428 3300026121 Bacteria 38922
836 Ga0207683_10000937 3300026121 Bacteria 26779
837 Ga0207683_10002423 3300026121 Bacteria 16292
838 Ga0207683_10006645 3300026121 Bacteria 9894
839 Ga0207683_10007710 3300026121 Bacteria 9219
840 Ga0207683_10008432 3300026121 Bacteria 8822
841 Ga0207683_10054325 3300026121 Bacteria 3513
842 Ga0207683_10168050 3300026121 Bacteria 1985
843 Ga0207683_10243781 3300026121 Bacteria 1639
844 Ga0207698_10034545 3300026142 Bacteria 3687
845 Ga0207698_10066461 3300026142 Bacteria 2838
846 Ga0207698_10202372 3300026142 Bacteria 1779
847 Ga0207698_10318518 3300026142 Bacteria 1455
848 Ga0207698_10552670 3300026142 Bacteria 1129
849 Ga0209995_1003464 3300027471 Bacteria 2513
850 Ga0209968_1013348 3300027526 Bacteria 1288
851 Ga0209982_1021189 3300027552 Bacteria 1001
852 Ga0209983_1008199 3300027665 Bacteria 2136
853 Ga0209971_1025035 3300027682 Bacteria 1425
854 Ga0209971_1026260 3300027682 Bacteria 1392
855 Ga0209998_10003436 3300027717 Bacteria 3466
856 Ga0209974_10000182 3300027876 Bacteria 19774
857 Ga0209974_10014903 3300027876 Bacteria 2581
858 Ga0268266_10014515 3300028379 Bacteria 6771
859 Ga0268266_10059050 3300028379 Bacteria 3304
860 Ga0268266_10099870 3300028379 Bacteria 2555
861 Ga0268266_10147164 3300028379 Bacteria 2119
862 Ga0268266_10192683 3300028379 Bacteria 1862
863 Ga0268265_10019192 3300028380 Bacteria 4747
864 Ga0268265_10073817 3300028380 Bacteria 2666
865 Ga0268265_10175897 3300028380 Bacteria 1834
866 Ga0268265_10307754 3300028380 Bacteria 1429
867 Ga0268265_10365587 3300028380 Bacteria 1322
868 Ga0268265_10428239 3300028380 Bacteria 1230
869 Ga0268264_10001280 3300028381 Bacteria 23831
870 Ga0268264_10006200 3300028381 Bacteria 10095
871 Ga0268264_10010758 3300028381 Bacteria 7558
872 Ga0268264_10030419 3300028381 Bacteria 4425
873 Ga0268264_10032240 3300028381 Bacteria 4298
874 Ga0268264_10062932 3300028381 Bacteria 3117
875 Ga0268264_10082035 3300028381 Bacteria 2758
876 Ga0268264_10183516 3300028381 Bacteria 1902
877 Ga0268264_10250719 3300028381 Bacteria 1644
878 Ga0268264_10322822 3300028381 Bacteria 1460
879 Ga0268264_10365509 3300028381 Bacteria 1378
880 Ga0265330_10024652 3300031235 Bacteria 2728
881 Ga0265332_10001132 3300031238 Bacteria 15490
882 Ga0265325_10080998 3300031241 Bacteria 1614
883 Ga0265329_10019176 3300031242 Bacteria 2325
884 Ga0265339_10099004 3300031249 Bacteria 1520
885 Ga0265331_10005857 3300031250 Bacteria 7359
886 Ga0265327_10027420 3300031251 Bacteria 3279
887 Ga0307408_100012198 3300031548 Bacteria 5687
888 Ga0307408_100063482 3300031548 Bacteria 2702
889 Ga0265314_10004158 3300031711 Bacteria 13616
890 Ga0265342_10047547 3300031712 Bacteria 2574
891 Ga0307405_10016897 3300031731 Bacteria 3991
892 Ga0307405_10018136 3300031731 Bacteria 3877
893 Ga0307405_10110609 3300031731 Bacteria 1861
894 Ga0307413_10013526 3300031824 Bacteria 4107
895 Ga0307410_10015385 3300031852 Bacteria 4535
896 Ga0307410_10048545 3300031852 Bacteria 2844
897 Ga0307410_10066494 3300031852 Bacteria 2483
898 Ga0307406_10002618 3300031901 Bacteria 9802
899 Ga0307406_10027451 3300031901 Bacteria 3430
900 Ga0307406_10077922 3300031901 Bacteria 2194
901 Ga0307407_10082351 3300031903 Bacteria 1950
902 Ga0307412_10003937 3300031911 Bacteria 8274
903 Ga0307412_10017599 3300031911 Bacteria 4279
904 Ga0307409_100354140 3300031995 Bacteria 1386
905 Ga0307409_100539312 3300031995 Bacteria 1143
906 Ga0307416_100012917 3300032002 Bacteria 5651
907 Ga0307414_10013576 3300032004 Bacteria 4855
908 Ga0307411_10002951 3300032005 Bacteria 7718
909 Ga0307411_10035772 3300032005 Bacteria 3105
910 Ga0307411_10136835 3300032005 Bacteria 1800
911 Ga0307415_100059733 3300032126 Bacteria 2631
912 Ga0307415_100160175 3300032126 Bacteria 1743
913 Ga0373926_0049542 3300035083 Bacteria 1513
914 Ga0373934_0135271 3300035086 Bacteria 1006
915 Ga0373944_0084703 3300035089 Bacteria 1052
916 Ga0373949_0074502 3300035090 Bacteria 895
917 Ga0373952_0053103 3300035092 Bacteria 972
918 Ga0373923_0153680 3300035111 Bacteria 1046
919 Ga0373936_0024196 3300035113 Bacteria 2370
920 Ga0373936_0109952 3300035113 Bacteria 1170
921 Ga0373939_0112240 3300035114 Bacteria 951
922 Ga0373945_0086580 3300035116 Bacteria 1207
923 Ga0373953_0013597 3300035117 Bacteria 2909
924 Ga0373954_0024342 3300035118 Bacteria 2760
925 Ga0373954_0034602 3300035118 Bacteria 2340
926 Ga0373954_0209769 3300035118 Bacteria 957
927 Ga0373957_0122498 3300035120 Bacteria 1053
928 Ga0373943_0013078 3300035170 Bacteria 3744
929 Ga0373943_0033450 3300035170 Bacteria 2449
930 Ga0373946_0051370 3300035171 Bacteria 1725
931 Ga0373946_0085172 3300035171 Bacteria 1391
932 Ga0373955_0093324 3300035172 Bacteria 1718
933 Ga0373924_0019622 3300035410 Bacteria 2621
934 Ga0373931_0103010 3300035691 Bacteria 1608
935 Ga0373935_0069408 3300035692 Bacteria 2270
936 Ga0373935_0189095 3300035692 Bacteria 1417
937 Ga0373935_0292449 3300035692 Bacteria 1149
938 Ga0373927_0051545 3300035695 Bacteria 2661
939 Ga0373927_0112335 3300035695 Bacteria 1776
940 Ga0373933_0022450 3300035724 Bacteria 3594
941 Ga0373947_0012424 3300035725 Bacteria 4879
942 Ga0373947_0056215 3300035725 Bacteria 2378
943 Ga0373947_0141098 3300035725 Bacteria 1545
944 Ga0373937_0099971 3300036401 Bacteria 2691
945 Ga0373937_0186714 3300036401 Bacteria 1947
946 Ga0373937_0187180 3300036401 Bacteria 1945
947 Ga0373937_0595121 3300036401 Bacteria 1050
948 Ga0373937_0687265 3300036401 Bacteria 969
949 Ga0373925_0003719 3300037068 Bacteria 11712
950 Ga0373925_0027605 3300037068 Bacteria 4155
951 Ga0373925_0053964 3300037068 Bacteria 3005
952 Ga0395899_0197887 3300037312 Bacteria 1403
953 Ga0395905_0248208 3300037471 Bacteria 1663
954 Ga0395901_0010265 3300038443 Bacteria 9485
955 Ga0395901_0726746 3300038443 Bacteria 988
956 Ga0439453_0045260 3300041408 Bacteria 875
957 Ga0451791_0463474 3300041451 Bacteria 1148
958 Ga0451798_0985042 3300041458 Unclassified 972
959 Ga0439458_0087045 3300042157 Bacteria 801
960 Ga0451577_0096892 3300042876 Bacteria 2634
961 Ga0453684_0597705 3300044712 Bacteria 1210
962 Ga0466957_0084986 3300044842 Bacteria 1976
963 Ga0451576_0711689 3300045051 Bacteria 1055
964 Ga0495582_0127335 3300046473 Bacteria 1437
965 Ga0495662_0148595 3300046476 Bacteria 1154
966 Ga0495664_0088195 3300046477 Bacteria 1864
967 Ga0495630_0044817 3300046517 Bacteria 3306
968 Ga0495665_0246344 3300046531 Bacteria 920
969 Ga0495587_0126742 3300046536 Bacteria 1461
970 Ga0495598_0044149 3300046537 Unclassified 1316
971 Ga0495621_0006481 3300046539 Bacteria 3422
972 Ga0495621_0018739 3300046539 Bacteria 2252
973 Ga0495588_0152447 3300046674 Bacteria 1221
974 Ga0495657_0058787 3300046675 Bacteria 2552
975 Ga0495623_0018162 3300046679 Bacteria 4542
976 Ga0495647_0014896 3300046681 Bacteria 2715
977 Ga0495647_0061359 3300046681 Bacteria 1484
978 Ga0495658_0022680 3300046683 Bacteria 3323
979 Ga0495658_0030393 3300046683 Bacteria 2932
980 Ga0495613_0007212 3300046689 Bacteria 8277
981 Ga0495600_0196236 3300046809 Bacteria 1297
982 Ga0495581_0208680 3300047315 Bacteria 1142
983 Ga0495604_0383431 3300047317 Bacteria 928
984 Ga0495674_0430247 3300047319 Bacteria 1062
985 Ga0495680_0097927 3300047322 Bacteria 2189
986 Ga0495675_0273482 3300047444 Bacteria 1009
987 Ga0495681_0154797 3300047470 Bacteria 959
988 Ga0495684_0028410 3300047471 Bacteria 4294
989 Ga0495602_0142971 3300048088 Bacteria 1892
990 Ga0495614_0196682 3300048089 Bacteria 911
991 Ga0496100_0059322 3300048903 Bacteria 2514
992 Ga0496100_0353438 3300048903 Bacteria 1110
993 Ga0496101_0034815 3300048904 Bacteria 3560
994 Ga0496101_0206473 3300048904 Bacteria 1520
995 Ga0496101_0238527 3300048904 Bacteria 1415
996 Ga0496102_0007429 3300048905 Bacteria 9361
997 Ga0496102_0066908 3300048905 Bacteria 3294
998 Ga0496102_0389830 3300048905 Bacteria 1310
999 Ga0496103_0149810 3300048906 Bacteria 1494
1000 Ga0496105_0035267 3300048908 Bacteria 4117
1001 Ga0496106_0000821 3300048909 Bacteria 22535
1002 Ga0496106_0155429 3300048909 Bacteria 1806
1003 Ga0496106_0353531 3300048909 Bacteria 1180
1004 Ga0496107_0008579 3300048910 Bacteria 7075
1005 Ga0496107_0186871 3300048910 Bacteria 1539
1006 Ga0496107_0499629 3300048910 Bacteria 902
1007 Ga0496108_0040439 3300048911 Bacteria 3887
1008 Ga0496108_0243296 3300048911 Bacteria 1565
1009 Ga0496109_0061929 3300048912 Bacteria 3421
1010 Ga0496109_0112873 3300048912 Bacteria 2527
1011 Ga0496109_0133435 3300048912 Bacteria 2319
1012 Ga0496109_0142846 3300048912 Bacteria 2239
1013 Ga0496109_0143501 3300048912 Bacteria 2233
1014 Ga0496110_0283965 3300048913 Bacteria 1507
1015 Ga0496112_0010957 3300048915 Bacteria 8256
1016 Ga0496112_0063809 3300048915 Bacteria 3634
1017 Ga0496112_0312284 3300048915 Bacteria 1517
1018 Ga0496112_0526512 3300048915 Bacteria 1116
1019 Ga0496113_0060894 3300048916 Bacteria 2847
1020 Ga0496115_0072671 3300048918 Bacteria 2791
1021 Ga0501032_0216667 3300049569 Bacteria 1247
1022 Ga0501034_0010922 3300049571 Bacteria 9435
1023 Ga0501034_0365149 3300049571 Bacteria 1370
1024 Ga0501036_0267470 3300049572 Bacteria 1432
1025 Ga0501039_0419622 3300049575 Bacteria 1051
1026 Ga0501041_0169912 3300049577 Bacteria 1364
1027 Ga0501067_0031936 3300049583 Bacteria 2922
1028 Ga0501068_0000533 3300049584 Bacteria 19224
1029 Ga0501070_0027035 3300049586 Bacteria 4813
1030 Ga0501072_0000279 3300049588 Bacteria 36892
1031 Ga0501072_0251075 3300049588 Bacteria 1409
1032 Ga0501073_0000403 3300049589 Bacteria 29490
1033 Ga0501074_0006847 3300049590 Bacteria 8235
1034 Ga0501080_0000762 3300049742 Bacteria 26133
1035 Ga0501081_0225964 3300049743 Bacteria 1362
1036 Ga0501081_0304237 3300049743 Bacteria 1170
1037 Ga0501083_0331550 3300049744 Bacteria 989
1038 Ga0501035_0497372 3300049822 Bacteria 1004
1039 nmdc:mga08y16_155281_c1 3300050511 Bacteria 2378
1040 nmdc:mga08y16_40120_c1 3300050511 Bacteria 4908
1041 nmdc:mga0n895_142058_c1 3300050512 Bacteria 2429
1042 nmdc:mga0n895_340741_c1 3300050512 Bacteria 1518
1043 nmdc:mga0n895_501753_c1 3300050512 Bacteria 1222
1044 nmdc:mga0n895_536706_c1 3300050512 Bacteria 1176
1045 nmdc:mga0rr50_150638_c1 3300050513 Bacteria 1879
1046 Ga0495619_0224226 3300053085 Bacteria 1302
1047 Ga0500650_0169800 3300053098 Bacteria 1003
1048 Ga0501084_0273123 3300054114 Bacteria 1427
1049 Ga0501082_0354474 3300060353 Bacteria 1279
1050 Ga0530510_0143070 3300061734 Bacteria 1763

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0072671 Ga0496115_0072671_1790_2548 228
2 3300027471 Ga0209995_1003464 Ga0209995_10034642 234
3 3300049572 Ga0501036_0267470 Ga0501036_0267470_713_1417 234
4 3300005330 Ga0070690_100000076 Ga0070690_10000007634 235
5 3300005334 Ga0068869_100001183 Ga0068869_10000118315 235
6 3300005334 Ga0068869_100156574 Ga0068869_1001565742 235
7 3300005339 Ga0070660_100196004 Ga0070660_1001960043 235
8 3300005340 Ga0070689_100005432 Ga0070689_1000054328 235
9 3300005341 Ga0070691_10003688 Ga0070691_100036882 235
10 3300005356 Ga0070674_100028845 Ga0070674_1000288453 235
11 3300005438 Ga0070701_10000399 Ga0070701_100003995 235
12 3300005440 Ga0070705_100104478 Ga0070705_1001044783 235
13 3300005441 Ga0070700_100000695 Ga0070700_10000069513 235
14 3300005444 Ga0070694_100017434 Ga0070694_1000174345 235
15 3300005455 Ga0070663_100180459 Ga0070663_1001804592 235
16 3300005456 Ga0070678_100005377 Ga0070678_1000053777 235
17 3300005458 Ga0070681_10021992 Ga0070681_100219926 235
18 3300005459 Ga0068867_100004404 Ga0068867_10000440410 235
19 3300005459 Ga0068867_100046777 Ga0068867_1000467774 235
20 3300005530 Ga0070679_100124868 Ga0070679_1001248683 235
21 3300005539 Ga0068853_100047579 Ga0068853_1000475794 235
22 3300005539 Ga0068853_100105281 Ga0068853_1001052812 235
23 3300005544 Ga0070686_100000265 Ga0070686_10000026525 235
24 3300005544 Ga0070686_100296934 Ga0070686_1002969341 235
25 3300005544 Ga0070686_100622145 Ga0070686_1006221451 235
26 3300005545 Ga0070695_100010977 Ga0070695_1000109773 235
27 3300005545 Ga0070695_100032469 Ga0070695_1000324693 235
28 3300005546 Ga0070696_100027813 Ga0070696_1000278134 235
29 3300005546 Ga0070696_100030558 Ga0070696_1000305585 235
30 3300005546 Ga0070696_100212328 Ga0070696_1002123281 235
31 3300005547 Ga0070693_100012997 Ga0070693_1000129975 235
32 3300005564 Ga0070664_100159028 Ga0070664_1001590283 235
33 3300005577 Ga0068857_100059544 Ga0068857_1000595442 235
34 3300005615 Ga0070702_100000169 Ga0070702_10000016924 235
35 3300005617 Ga0068859_100003358 Ga0068859_1000033587 235
36 3300005718 Ga0068866_10000107 Ga0068866_1000010727 235
37 3300005719 Ga0068861_100001908 Ga0068861_10000190811 235
38 3300005840 Ga0068870_10052619 Ga0068870_100526192 235
39 3300005842 Ga0068858_100002634 Ga0068858_1000026345 235
40 3300005843 Ga0068860_100010005 Ga0068860_1000100055 235
41 3300006237 Ga0097621_100015018 Ga0097621_1000150185 235
42 3300006358 Ga0068871_100001255 Ga0068871_10000125514 235
43 3300006881 Ga0068865_100000281 Ga0068865_1000002815 235
44 3300006931 Ga0097620_100003358 Ga0097620_1000033587 235
45 3300009098 Ga0105245_10000511 Ga0105245_1000051114 235
46 3300009148 Ga0105243_10001212 Ga0105243_1000121211 235
47 3300009176 Ga0105242_10002499 Ga0105242_1000249914 235
48 3300009176 Ga0105242_10324829 Ga0105242_103248291 235
49 3300009545 Ga0105237_10050061 Ga0105237_100500612 235
50 3300009551 Ga0105238_10076233 Ga0105238_100762332 235
51 3300009553 Ga0105249_10014809 Ga0105249_100148095 235
52 3300010375 Ga0105239_10254400 Ga0105239_102544003 235
53 3300013297 Ga0157378_10249147 Ga0157378_102491471 235
54 3300013306 Ga0163162_10015531 Ga0163162_100155315 235
55 3300013308 Ga0157375_10114144 Ga0157375_101141443 235
56 3300014326 Ga0157380_10003477 Ga0157380_1000347713 235
57 3300014968 Ga0157379_10021513 Ga0157379_100215136 235
58 3300014969 Ga0157376_10491953 Ga0157376_104919532 235
59 3300025899 Ga0207642_10005957 Ga0207642_100059573 235
60 3300025908 Ga0207643_10003075 Ga0207643_100030753 235
61 3300025911 Ga0207654_10521344 Ga0207654_105213441 235
62 3300025912 Ga0207707_10332782 Ga0207707_103327822 235
63 3300025914 Ga0207671_10186234 Ga0207671_101862341 235
64 3300025917 Ga0207660_10502515 Ga0207660_105025151 235
65 3300025918 Ga0207662_10197189 Ga0207662_101971892 235
66 3300025919 Ga0207657_10270713 Ga0207657_102707132 235
67 3300025924 Ga0207694_10102170 Ga0207694_101021702 235
68 3300025927 Ga0207687_10002550 Ga0207687_1000255011 235
69 3300025934 Ga0207686_10000084 Ga0207686_1000008462 235
70 3300025934 Ga0207686_10245324 Ga0207686_102453242 235
71 3300025935 Ga0207709_10003776 Ga0207709_100037767 235
72 3300025935 Ga0207709_10083640 Ga0207709_100836403 235
73 3300025936 Ga0207670_10021569 Ga0207670_100215695 235
74 3300025938 Ga0207704_10000722 Ga0207704_100007227 235
75 3300025942 Ga0207689_10003506 Ga0207689_1000350614 235
76 3300025942 Ga0207689_10159472 Ga0207689_101594722 235
77 3300025961 Ga0207712_10061954 Ga0207712_100619542 235
78 3300026023 Ga0207677_10016499 Ga0207677_100164994 235
79 3300026023 Ga0207677_10195651 Ga0207677_101956513 235
80 3300026035 Ga0207703_10001789 Ga0207703_1000178920 235
81 3300026041 Ga0207639_10009524 Ga0207639_100095244 235
82 3300026067 Ga0207678_10109082 Ga0207678_101090822 235
83 3300026075 Ga0207708_10000049 Ga0207708_1000004949 235
84 3300026075 Ga0207708_10003721 Ga0207708_100037217 235
85 3300026089 Ga0207648_10000161 Ga0207648_1000016150 235
86 3300026089 Ga0207648_10064069 Ga0207648_100640692 235
87 3300026089 Ga0207648_10692478 Ga0207648_106924782 235
88 3300026116 Ga0207674_10065805 Ga0207674_100658054 235
89 3300026118 Ga0207675_100000176 Ga0207675_10000017626 235
90 3300026121 Ga0207683_10008432 Ga0207683_100084326 235
91 3300028380 Ga0268265_10019192 Ga0268265_100191923 235
92 3300028381 Ga0268264_10010758 Ga0268264_100107587 235
93 3300028381 Ga0268264_10365509 Ga0268264_103655092 235
94 3300036401 Ga0373937_0187180 Ga0373937_0187180_131_883 235
95 3300041458 Ga0451798_0985042 Ga0451798_0985042_74_895 235
96 3300048912 Ga0496109_0133435 Ga0496109_0133435_1174_1926 235
97 3300049569 Ga0501032_0216667 Ga0501032_0216667_87_842 235
98 3300049571 Ga0501034_0010922 Ga0501034_0010922_2564_3316 235
99 3300049571 Ga0501034_0365149 Ga0501034_0365149_566_1318 235
100 3300049584 Ga0501068_0000533 Ga0501068_0000533_10777_11529 235
101 3300049586 Ga0501070_0027035 Ga0501070_0027035_730_1482 235
102 3300049588 Ga0501072_0000279 Ga0501072_0000279_19738_20490 235
103 3300049589 Ga0501073_0000403 Ga0501073_0000403_11068_11820 235
104 3300049590 Ga0501074_0006847 Ga0501074_0006847_7398_8150 235
105 3300049742 Ga0501080_0000762 Ga0501080_0000762_15330_16082 235
106 3300049743 Ga0501081_0304237 Ga0501081_0304237_184_936 235
107 3300049744 Ga0501083_0331550 Ga0501083_0331550_68_820 235
108 3300049822 Ga0501035_0497372 Ga0501035_0497372_202_954 235
109 3300053098 Ga0500650_0169800 Ga0500650_0169800_21_773 235
110 3300054114 Ga0501084_0273123 Ga0501084_0273123_586_1338 235
111 3300060353 Ga0501082_0354474 Ga0501082_0354474_399_1151 235
112 3300006844 Ga0075428_100729616 Ga0075428_1007296161 236
113 3300006846 Ga0075430_100332586 Ga0075430_1003325862 236
114 3300006847 Ga0075431_100404444 Ga0075431_1004044442 236
115 3300041408 Ga0439453_0045260 Ga0439453_0045260_106_834 236
116 3300042876 Ga0451577_0096892 Ga0451577_0096892_352_1107 236
117 3300049575 Ga0501039_0419622 Ga0501039_0419622_246_1001 236
118 3300049588 Ga0501072_0251075 Ga0501072_0251075_132_887 236
119 3300049743 Ga0501081_0225964 Ga0501081_0225964_478_1233 236
120 3300061734 Ga0530510_0143070 Ga0530510_0143070_781_1536 236
121 3300001976 JGI24752J21851_1005003 JGI24752J21851_10050032 237
122 3300001991 JGI24743J22301_10004821 JGI24743J22301_100048212 237
123 3300002239 JGI24034J26672_10015764 JGI24034J26672_100157642 237
124 3300005293 Ga0065715_10127545 Ga0065715_101275452 237
125 3300005293 Ga0065715_10290220 Ga0065715_102902202 237
126 3300005327 Ga0070658_10125697 Ga0070658_101256972 237
127 3300005327 Ga0070658_10254008 Ga0070658_102540082 237
128 3300005327 Ga0070658_10291819 Ga0070658_102918191 237
129 3300005328 Ga0070676_10000862 Ga0070676_100008625 237
130 3300005328 Ga0070676_10030341 Ga0070676_100303414 237
131 3300005328 Ga0070676_10038891 Ga0070676_100388912 237
132 3300005328 Ga0070676_10072225 Ga0070676_100722253 237
133 3300005328 Ga0070676_10108269 Ga0070676_101082692 237
134 3300005329 Ga0070683_100001287 Ga0070683_1000012877 237
135 3300005329 Ga0070683_100012440 Ga0070683_1000124403 237
136 3300005329 Ga0070683_100031022 Ga0070683_1000310224 237
137 3300005329 Ga0070683_100234752 Ga0070683_1002347522 237
138 3300005329 Ga0070683_100377037 Ga0070683_1003770372 237
139 3300005330 Ga0070690_100007192 Ga0070690_1000071925 237
140 3300005330 Ga0070690_100034185 Ga0070690_1000341853 237
141 3300005330 Ga0070690_100115903 Ga0070690_1001159031 237
142 3300005330 Ga0070690_100247875 Ga0070690_1002478752 237
143 3300005331 Ga0070670_100002815 Ga0070670_1000028159 237
144 3300005331 Ga0070670_100019908 Ga0070670_1000199084 237
145 3300005331 Ga0070670_100134100 Ga0070670_1001341002 237
146 3300005331 Ga0070670_100205058 Ga0070670_1002050582 237
147 3300005331 Ga0070670_100361202 Ga0070670_1003612022 237
148 3300005333 Ga0070677_10003277 Ga0070677_100032774 237
149 3300005333 Ga0070677_10008080 Ga0070677_100080804 237
150 3300005334 Ga0068869_100000088 Ga0068869_1000000883 237
151 3300005334 Ga0068869_100000717 Ga0068869_10000071717 237
152 3300005334 Ga0068869_100028801 Ga0068869_1000288012 237
153 3300005334 Ga0068869_100060879 Ga0068869_1000608794 237
154 3300005334 Ga0068869_100348418 Ga0068869_1003484182 237
155 3300005335 Ga0070666_10019183 Ga0070666_100191833 237
156 3300005335 Ga0070666_10041096 Ga0070666_100410964 237
157 3300005335 Ga0070666_10076366 Ga0070666_100763663 237
158 3300005335 Ga0070666_10080253 Ga0070666_100802532 237
159 3300005335 Ga0070666_10383584 Ga0070666_103835841 237
160 3300005336 Ga0070680_100092124 Ga0070680_1000921242 237
161 3300005336 Ga0070680_100247497 Ga0070680_1002474972 237
162 3300005336 Ga0070680_100346249 Ga0070680_1003462491 237
163 3300005337 Ga0070682_100057269 Ga0070682_1000572693 237
164 3300005338 Ga0068868_100010467 Ga0068868_1000104675 237
165 3300005338 Ga0068868_100025737 Ga0068868_1000257373 237
166 3300005338 Ga0068868_100100558 Ga0068868_1001005582 237
167 3300005338 Ga0068868_100124166 Ga0068868_1001241663 237
168 3300005338 Ga0068868_100223011 Ga0068868_1002230112 237
169 3300005338 Ga0068868_100305234 Ga0068868_1003052342 237
170 3300005338 Ga0068868_100336109 Ga0068868_1003361091 237
171 3300005339 Ga0070660_100001693 Ga0070660_1000016933 237
172 3300005339 Ga0070660_100027181 Ga0070660_1000271815 237
173 3300005339 Ga0070660_100068215 Ga0070660_1000682153 237
174 3300005339 Ga0070660_100220072 Ga0070660_1002200721 237
175 3300005340 Ga0070689_100005991 Ga0070689_1000059916 237
176 3300005340 Ga0070689_100047955 Ga0070689_1000479553 237
177 3300005340 Ga0070689_100063003 Ga0070689_1000630033 237
178 3300005340 Ga0070689_100305314 Ga0070689_1003053142 237
179 3300005341 Ga0070691_10063733 Ga0070691_100637331 237
180 3300005343 Ga0070687_100009320 Ga0070687_1000093204 237
181 3300005344 Ga0070661_100006074 Ga0070661_1000060747 237
182 3300005344 Ga0070661_100010193 Ga0070661_1000101935 237
183 3300005344 Ga0070661_100020639 Ga0070661_1000206394 237
184 3300005345 Ga0070692_10096736 Ga0070692_100967362 237
185 3300005345 Ga0070692_10175038 Ga0070692_101750382 237
186 3300005347 Ga0070668_100002207 Ga0070668_1000022077 237
187 3300005347 Ga0070668_100003003 Ga0070668_1000030039 237
188 3300005347 Ga0070668_100015878 Ga0070668_1000158785 237
189 3300005347 Ga0070668_100077656 Ga0070668_1000776563 237
190 3300005347 Ga0070668_100088342 Ga0070668_1000883422 237
191 3300005347 Ga0070668_100088391 Ga0070668_1000883912 237
192 3300005347 Ga0070668_100105635 Ga0070668_1001056353 237
193 3300005347 Ga0070668_100143510 Ga0070668_1001435102 237
194 3300005347 Ga0070668_100159150 Ga0070668_1001591502 237
195 3300005347 Ga0070668_100344462 Ga0070668_1003444621 237
196 3300005353 Ga0070669_100001156 Ga0070669_1000011567 237
197 3300005353 Ga0070669_100013323 Ga0070669_1000133233 237
198 3300005353 Ga0070669_100025892 Ga0070669_1000258922 237
199 3300005353 Ga0070669_100046555 Ga0070669_1000465553 237
200 3300005353 Ga0070669_100085778 Ga0070669_1000857783 237
201 3300005353 Ga0070669_100242557 Ga0070669_1002425572 237
202 3300005353 Ga0070669_100258135 Ga0070669_1002581352 237
203 3300005354 Ga0070675_100004311 Ga0070675_1000043113 237
204 3300005354 Ga0070675_100017285 Ga0070675_1000172855 237
205 3300005354 Ga0070675_100022702 Ga0070675_1000227022 237
206 3300005354 Ga0070675_100046835 Ga0070675_1000468354 237
207 3300005354 Ga0070675_100050884 Ga0070675_1000508841 237
208 3300005355 Ga0070671_100002321 Ga0070671_1000023218 237
209 3300005355 Ga0070671_100003085 Ga0070671_10000308512 237
210 3300005355 Ga0070671_100015150 Ga0070671_1000151502 237
211 3300005355 Ga0070671_100053520 Ga0070671_1000535202 237
212 3300005355 Ga0070671_100060051 Ga0070671_1000600512 237
213 3300005355 Ga0070671_100152688 Ga0070671_1001526882 237
214 3300005355 Ga0070671_100198530 Ga0070671_1001985301 237
215 3300005356 Ga0070674_100000201 Ga0070674_10000020129 237
216 3300005356 Ga0070674_100006528 Ga0070674_1000065285 237
217 3300005356 Ga0070674_100015303 Ga0070674_1000153035 237
218 3300005356 Ga0070674_100193571 Ga0070674_1001935712 237
219 3300005356 Ga0070674_100232750 Ga0070674_1002327502 237
220 3300005356 Ga0070674_100271511 Ga0070674_1002715111 237
221 3300005364 Ga0070673_100001215 Ga0070673_1000012157 237
222 3300005364 Ga0070673_100014731 Ga0070673_1000147315 237
223 3300005364 Ga0070673_100014757 Ga0070673_1000147576 237
224 3300005364 Ga0070673_100023959 Ga0070673_1000239594 237
225 3300005364 Ga0070673_100084963 Ga0070673_1000849633 237
226 3300005365 Ga0070688_100000896 Ga0070688_1000008964 237
227 3300005365 Ga0070688_100003476 Ga0070688_1000034766 237
228 3300005365 Ga0070688_100032259 Ga0070688_1000322594 237
229 3300005366 Ga0070659_100005062 Ga0070659_1000050627 237
230 3300005366 Ga0070659_100017470 Ga0070659_1000174704 237
231 3300005366 Ga0070659_100060510 Ga0070659_1000605102 237
232 3300005366 Ga0070659_100081795 Ga0070659_1000817952 237
233 3300005367 Ga0070667_100003209 Ga0070667_1000032098 237
234 3300005367 Ga0070667_100005512 Ga0070667_1000055125 237
235 3300005367 Ga0070667_100006580 Ga0070667_1000065803 237
236 3300005367 Ga0070667_100050405 Ga0070667_1000504053 237
237 3300005367 Ga0070667_100051843 Ga0070667_1000518434 237
238 3300005367 Ga0070667_100234265 Ga0070667_1002342653 237
239 3300005367 Ga0070667_100262909 Ga0070667_1002629092 237
240 3300005367 Ga0070667_100275423 Ga0070667_1002754232 237
241 3300005434 Ga0070709_10004984 Ga0070709_100049846 237
242 3300005434 Ga0070709_10122109 Ga0070709_101221092 237
243 3300005435 Ga0070714_100005782 Ga0070714_1000057825 237
244 3300005435 Ga0070714_100013363 Ga0070714_1000133634 237
245 3300005435 Ga0070714_100121574 Ga0070714_1001215742 237
246 3300005436 Ga0070713_100000039 Ga0070713_10000003957 237
247 3300005436 Ga0070713_100004462 Ga0070713_1000044629 237
248 3300005436 Ga0070713_100037161 Ga0070713_1000371613 237
249 3300005436 Ga0070713_100080634 Ga0070713_1000806342 237
250 3300005438 Ga0070701_10075718 Ga0070701_100757183 237
251 3300005438 Ga0070701_10101812 Ga0070701_101018122 237
252 3300005439 Ga0070711_100010984 Ga0070711_1000109845 237
253 3300005439 Ga0070711_100042986 Ga0070711_1000429863 237
254 3300005440 Ga0070705_100074130 Ga0070705_1000741302 237
255 3300005440 Ga0070705_100086692 Ga0070705_1000866922 237
256 3300005440 Ga0070705_100173360 Ga0070705_1001733601 237
257 3300005441 Ga0070700_100011858 Ga0070700_1000118583 237
258 3300005444 Ga0070694_100070645 Ga0070694_1000706452 237
259 3300005445 Ga0070708_100001846 Ga0070708_10000184613 237
260 3300005455 Ga0070663_100009903 Ga0070663_1000099035 237
261 3300005455 Ga0070663_100031301 Ga0070663_1000313014 237
262 3300005455 Ga0070663_100031697 Ga0070663_1000316972 237
263 3300005455 Ga0070663_100164775 Ga0070663_1001647753 237
264 3300005455 Ga0070663_100241612 Ga0070663_1002416121 237
265 3300005456 Ga0070678_100000169 Ga0070678_1000001698 237
266 3300005456 Ga0070678_100002373 Ga0070678_1000023732 237
267 3300005456 Ga0070678_100003566 Ga0070678_1000035669 237
268 3300005456 Ga0070678_100008313 Ga0070678_1000083136 237
269 3300005456 Ga0070678_100043852 Ga0070678_1000438523 237
270 3300005456 Ga0070678_100074831 Ga0070678_1000748312 237
271 3300005456 Ga0070678_100485488 Ga0070678_1004854881 237
272 3300005456 Ga0070678_100505638 Ga0070678_1005056381 237
273 3300005457 Ga0070662_100000554 Ga0070662_1000005548 237
274 3300005457 Ga0070662_100037635 Ga0070662_1000376354 237
275 3300005457 Ga0070662_100040446 Ga0070662_1000404463 237
276 3300005457 Ga0070662_100093697 Ga0070662_1000936973 237
277 3300005457 Ga0070662_100269277 Ga0070662_1002692772 237
278 3300005458 Ga0070681_10006907 Ga0070681_100069076 237
279 3300005458 Ga0070681_10065344 Ga0070681_100653442 237
280 3300005458 Ga0070681_10378656 Ga0070681_103786561 237
281 3300005459 Ga0068867_100001455 Ga0068867_1000014553 237
282 3300005459 Ga0068867_100002460 Ga0068867_1000024609 237
283 3300005459 Ga0068867_100047495 Ga0068867_1000474953 237
284 3300005459 Ga0068867_100076291 Ga0068867_1000762911 237
285 3300005459 Ga0068867_100212268 Ga0068867_1002122682 237
286 3300005459 Ga0068867_100234012 Ga0068867_1002340122 237
287 3300005459 Ga0068867_100391734 Ga0068867_1003917342 237
288 3300005466 Ga0070685_10002112 Ga0070685_100021128 237
289 3300005466 Ga0070685_10025251 Ga0070685_100252513 237
290 3300005471 Ga0070698_100396666 Ga0070698_1003966661 237
291 3300005518 Ga0070699_100086564 Ga0070699_1000865642 237
292 3300005518 Ga0070699_100087382 Ga0070699_1000873823 237
293 3300005530 Ga0070679_100034376 Ga0070679_1000343764 237
294 3300005530 Ga0070679_100098982 Ga0070679_1000989824 237
295 3300005530 Ga0070679_100407258 Ga0070679_1004072582 237
296 3300005535 Ga0070684_100001168 Ga0070684_1000011685 237
297 3300005535 Ga0070684_100014961 Ga0070684_1000149613 237
298 3300005539 Ga0068853_100004198 Ga0068853_1000041983 237
299 3300005539 Ga0068853_100013365 Ga0068853_1000133653 237
300 3300005539 Ga0068853_100016992 Ga0068853_1000169924 237
301 3300005539 Ga0068853_100080012 Ga0068853_1000800122 237
302 3300005539 Ga0068853_100083060 Ga0068853_1000830602 237
303 3300005539 Ga0068853_100384572 Ga0068853_1003845722 237
304 3300005539 Ga0068853_100431284 Ga0068853_1004312842 237
305 3300005539 Ga0068853_100533199 Ga0068853_1005331991 237
306 3300005543 Ga0070672_100000440 Ga0070672_1000004402 237
307 3300005543 Ga0070672_100005197 Ga0070672_1000051979 237
308 3300005543 Ga0070672_100049300 Ga0070672_1000493002 237
309 3300005543 Ga0070672_100050443 Ga0070672_1000504432 237
310 3300005543 Ga0070672_100061572 Ga0070672_1000615723 237
311 3300005543 Ga0070672_100086223 Ga0070672_1000862233 237
312 3300005543 Ga0070672_100122859 Ga0070672_1001228593 237
313 3300005543 Ga0070672_100125117 Ga0070672_1001251172 237
314 3300005543 Ga0070672_100129992 Ga0070672_1001299922 237
315 3300005543 Ga0070672_100307976 Ga0070672_1003079762 237
316 3300005545 Ga0070695_100038044 Ga0070695_1000380442 237
317 3300005546 Ga0070696_100057565 Ga0070696_1000575653 237
318 3300005546 Ga0070696_100440431 Ga0070696_1004404311 237
319 3300005547 Ga0070693_100123847 Ga0070693_1001238472 237
320 3300005547 Ga0070693_100190158 Ga0070693_1001901582 237
321 3300005548 Ga0070665_100001395 Ga0070665_10000139523 237
322 3300005548 Ga0070665_100074886 Ga0070665_1000748862 237
323 3300005548 Ga0070665_100185487 Ga0070665_1001854873 237
324 3300005548 Ga0070665_100284673 Ga0070665_1002846732 237
325 3300005548 Ga0070665_100347234 Ga0070665_1003472343 237
326 3300005549 Ga0070704_100069699 Ga0070704_1000696992 237
327 3300005563 Ga0068855_100007680 Ga0068855_1000076808 237
328 3300005563 Ga0068855_100046728 Ga0068855_1000467284 237
329 3300005563 Ga0068855_100066105 Ga0068855_1000661053 237
330 3300005563 Ga0068855_100082939 Ga0068855_1000829393 237
331 3300005563 Ga0068855_100324526 Ga0068855_1003245262 237
332 3300005563 Ga0068855_100461052 Ga0068855_1004610522 237
333 3300005564 Ga0070664_100004095 Ga0070664_1000040958 237
334 3300005564 Ga0070664_100021991 Ga0070664_1000219913 237
335 3300005564 Ga0070664_100029333 Ga0070664_1000293333 237
336 3300005564 Ga0070664_100089347 Ga0070664_1000893472 237
337 3300005564 Ga0070664_100116008 Ga0070664_1001160082 237
338 3300005564 Ga0070664_100137742 Ga0070664_1001377422 237
339 3300005564 Ga0070664_100269714 Ga0070664_1002697142 237
340 3300005564 Ga0070664_100358199 Ga0070664_1003581992 237
341 3300005577 Ga0068857_100000465 Ga0068857_1000004657 237
342 3300005577 Ga0068857_100012046 Ga0068857_1000120466 237
343 3300005577 Ga0068857_100028444 Ga0068857_1000284443 237
344 3300005577 Ga0068857_100375812 Ga0068857_1003758122 237
345 3300005578 Ga0068854_100008411 Ga0068854_1000084113 237
346 3300005578 Ga0068854_100011787 Ga0068854_1000117876 237
347 3300005578 Ga0068854_100016344 Ga0068854_1000163444 237
348 3300005578 Ga0068854_100398130 Ga0068854_1003981301 237
349 3300005614 Ga0068856_100000962 Ga0068856_10000096217 237
350 3300005614 Ga0068856_100001205 Ga0068856_10000120513 237
351 3300005614 Ga0068856_100053867 Ga0068856_1000538673 237
352 3300005614 Ga0068856_100095061 Ga0068856_1000950612 237
353 3300005614 Ga0068856_100334627 Ga0068856_1003346271 237
354 3300005615 Ga0070702_100036658 Ga0070702_1000366583 237
355 3300005615 Ga0070702_100040204 Ga0070702_1000402043 237
356 3300005615 Ga0070702_100055160 Ga0070702_1000551602 237
357 3300005615 Ga0070702_100121365 Ga0070702_1001213652 237
358 3300005616 Ga0068852_100020943 Ga0068852_1000209435 237
359 3300005616 Ga0068852_100044998 Ga0068852_1000449984 237
360 3300005616 Ga0068852_100060515 Ga0068852_1000605152 237
361 3300005616 Ga0068852_100182963 Ga0068852_1001829632 237
362 3300005616 Ga0068852_100219713 Ga0068852_1002197132 237
363 3300005616 Ga0068852_100227600 Ga0068852_1002276002 237
364 3300005616 Ga0068852_100287974 Ga0068852_1002879743 237
365 3300005617 Ga0068859_100002809 Ga0068859_1000028098 237
366 3300005617 Ga0068859_100019571 Ga0068859_1000195715 237
367 3300005617 Ga0068859_100066896 Ga0068859_1000668964 237
368 3300005617 Ga0068859_100093881 Ga0068859_1000938813 237
369 3300005617 Ga0068859_100104174 Ga0068859_1001041743 237
370 3300005617 Ga0068859_100292570 Ga0068859_1002925702 237
371 3300005617 Ga0068859_100426994 Ga0068859_1004269942 237
372 3300005618 Ga0068864_100001769 Ga0068864_1000017693 237
373 3300005618 Ga0068864_100003838 Ga0068864_1000038385 237
374 3300005618 Ga0068864_100007835 Ga0068864_1000078359 237
375 3300005618 Ga0068864_100014828 Ga0068864_1000148283 237
376 3300005618 Ga0068864_100015696 Ga0068864_1000156962 237
377 3300005618 Ga0068864_100017807 Ga0068864_1000178075 237
378 3300005618 Ga0068864_100048679 Ga0068864_1000486793 237
379 3300005618 Ga0068864_100241597 Ga0068864_1002415972 237
380 3300005618 Ga0068864_100260814 Ga0068864_1002608142 237
381 3300005718 Ga0068866_10002377 Ga0068866_100023774 237
382 3300005718 Ga0068866_10055787 Ga0068866_100557872 237
383 3300005719 Ga0068861_100002714 Ga0068861_1000027147 237
384 3300005719 Ga0068861_100017867 Ga0068861_1000178676 237
385 3300005719 Ga0068861_100036343 Ga0068861_1000363432 237
386 3300005719 Ga0068861_100087450 Ga0068861_1000874503 237
387 3300005834 Ga0068851_10001492 Ga0068851_1000149210 237
388 3300005834 Ga0068851_10003124 Ga0068851_100031246 237
389 3300005834 Ga0068851_10003579 Ga0068851_100035796 237
390 3300005834 Ga0068851_10024911 Ga0068851_100249114 237
391 3300005840 Ga0068870_10008706 Ga0068870_100087065 237
392 3300005840 Ga0068870_10017986 Ga0068870_100179863 237
393 3300005840 Ga0068870_10025091 Ga0068870_100250912 237
394 3300005840 Ga0068870_10176239 Ga0068870_101762391 237
395 3300005841 Ga0068863_100007665 Ga0068863_10000766510 237
396 3300005841 Ga0068863_100007669 Ga0068863_1000076694 237
397 3300005841 Ga0068863_100013004 Ga0068863_1000130047 237
398 3300005841 Ga0068863_100053915 Ga0068863_1000539154 237
399 3300005841 Ga0068863_100125651 Ga0068863_1001256513 237
400 3300005841 Ga0068863_100127265 Ga0068863_1001272653 237
401 3300005841 Ga0068863_100131432 Ga0068863_1001314323 237
402 3300005841 Ga0068863_100149131 Ga0068863_1001491312 237
403 3300005841 Ga0068863_100189917 Ga0068863_1001899173 237
404 3300005841 Ga0068863_100247590 Ga0068863_1002475902 237
405 3300005841 Ga0068863_100287822 Ga0068863_1002878223 237
406 3300005842 Ga0068858_100006556 Ga0068858_1000065569 237
407 3300005842 Ga0068858_100012060 Ga0068858_1000120602 237
408 3300005842 Ga0068858_100037867 Ga0068858_1000378672 237
409 3300005842 Ga0068858_100065474 Ga0068858_1000654743 237
410 3300005842 Ga0068858_100167891 Ga0068858_1001678912 237
411 3300005842 Ga0068858_100404486 Ga0068858_1004044862 237
412 3300005842 Ga0068858_100448955 Ga0068858_1004489551 237
413 3300005843 Ga0068860_100008429 Ga0068860_10000842910 237
414 3300005843 Ga0068860_100023819 Ga0068860_1000238194 237
415 3300005843 Ga0068860_100030005 Ga0068860_1000300053 237
416 3300005843 Ga0068860_100032212 Ga0068860_1000322126 237
417 3300005843 Ga0068860_100042964 Ga0068860_1000429642 237
418 3300005843 Ga0068860_100053859 Ga0068860_1000538593 237
419 3300005843 Ga0068860_100062653 Ga0068860_1000626533 237
420 3300005843 Ga0068860_100145146 Ga0068860_1001451463 237
421 3300005843 Ga0068860_100192197 Ga0068860_1001921971 237
422 3300005843 Ga0068860_100233796 Ga0068860_1002337963 237
423 3300005843 Ga0068860_100327203 Ga0068860_1003272033 237
424 3300005844 Ga0068862_100005712 Ga0068862_1000057123 237
425 3300005844 Ga0068862_100041412 Ga0068862_1000414124 237
426 3300005844 Ga0068862_100048687 Ga0068862_1000486872 237
427 3300005844 Ga0068862_100070328 Ga0068862_1000703282 237
428 3300005844 Ga0068862_100086797 Ga0068862_1000867972 237
429 3300005844 Ga0068862_100087654 Ga0068862_1000876543 237
430 3300005844 Ga0068862_100093715 Ga0068862_1000937154 237
431 3300005844 Ga0068862_100227551 Ga0068862_1002275512 237
432 3300005844 Ga0068862_100388021 Ga0068862_1003880212 237
433 3300005985 Ga0081539_10004036 Ga0081539_1000403615 237
434 3300006173 Ga0070716_100110016 Ga0070716_1001100162 237
435 3300006175 Ga0070712_100031277 Ga0070712_1000312774 237
436 3300006175 Ga0070712_100238042 Ga0070712_1002380422 237
437 3300006237 Ga0097621_100004128 Ga0097621_1000041287 237
438 3300006237 Ga0097621_100019995 Ga0097621_1000199955 237
439 3300006237 Ga0097621_100082429 Ga0097621_1000824293 237
440 3300006237 Ga0097621_100107011 Ga0097621_1001070112 237
441 3300006237 Ga0097621_100152761 Ga0097621_1001527612 237
442 3300006237 Ga0097621_100333176 Ga0097621_1003331762 237
443 3300006237 Ga0097621_100378555 Ga0097621_1003785552 237
444 3300006358 Ga0068871_100003622 Ga0068871_10000362210 237
445 3300006358 Ga0068871_100020253 Ga0068871_1000202533 237
446 3300006358 Ga0068871_100020467 Ga0068871_1000204675 237
447 3300006358 Ga0068871_100035781 Ga0068871_1000357814 237
448 3300006358 Ga0068871_100061281 Ga0068871_1000612811 237
449 3300006358 Ga0068871_100075397 Ga0068871_1000753972 237
450 3300006358 Ga0068871_100090925 Ga0068871_1000909252 237
451 3300006358 Ga0068871_100300808 Ga0068871_1003008082 237
452 3300006358 Ga0068871_100591902 Ga0068871_1005919022 237
453 3300006844 Ga0075428_100130851 Ga0075428_1001308512 237
454 3300006871 Ga0075434_100202202 Ga0075434_1002022021 237
455 3300006871 Ga0075434_100510365 Ga0075434_1005103652 237
456 3300006880 Ga0075429_100405365 Ga0075429_1004053652 237
457 3300006881 Ga0068865_100071695 Ga0068865_1000716952 237
458 3300006881 Ga0068865_100101425 Ga0068865_1001014253 237
459 3300006881 Ga0068865_100107727 Ga0068865_1001077272 237
460 3300006881 Ga0068865_100125400 Ga0068865_1001254001 237
461 3300006881 Ga0068865_100645659 Ga0068865_1006456591 237
462 3300006914 Ga0075436_100085811 Ga0075436_1000858113 237
463 3300006914 Ga0075436_100197575 Ga0075436_1001975752 237
464 3300006931 Ga0097620_100002809 Ga0097620_1000028098 237
465 3300006931 Ga0097620_100019569 Ga0097620_1000195694 237
466 3300006931 Ga0097620_100066904 Ga0097620_1000669044 237
467 3300006931 Ga0097620_100093880 Ga0097620_1000938803 237
468 3300006931 Ga0097620_100104175 Ga0097620_1001041753 237
469 3300006931 Ga0097620_100292562 Ga0097620_1002925623 237
470 3300006931 Ga0097620_100427006 Ga0097620_1004270062 237
471 3300007076 Ga0075435_100300789 Ga0075435_1003007892 237
472 3300009093 Ga0105240_10010941 Ga0105240_100109416 237
473 3300009093 Ga0105240_10018465 Ga0105240_100184654 237
474 3300009093 Ga0105240_10061726 Ga0105240_100617264 237
475 3300009093 Ga0105240_10330625 Ga0105240_103306253 237
476 3300009094 Ga0111539_10053147 Ga0111539_100531476 237
477 3300009098 Ga0105245_10034453 Ga0105245_100344534 237
478 3300009098 Ga0105245_10051712 Ga0105245_100517122 237
479 3300009098 Ga0105245_10097516 Ga0105245_100975162 237
480 3300009101 Ga0105247_10219055 Ga0105247_102190552 237
481 3300009148 Ga0105243_10212867 Ga0105243_102128672 237
482 3300009174 Ga0105241_10012701 Ga0105241_100127013 237
483 3300009174 Ga0105241_10104896 Ga0105241_101048963 237
484 3300009176 Ga0105242_10014168 Ga0105242_100141683 237
485 3300009176 Ga0105242_10038238 Ga0105242_100382382 237
486 3300009176 Ga0105242_10130741 Ga0105242_101307412 237
487 3300009176 Ga0105242_10164332 Ga0105242_101643323 237
488 3300009176 Ga0105242_10239056 Ga0105242_102390562 237
489 3300009177 Ga0105248_10007610 Ga0105248_100076109 237
490 3300009177 Ga0105248_10019862 Ga0105248_100198623 237
491 3300009177 Ga0105248_10048080 Ga0105248_100480804 237
492 3300009177 Ga0105248_10161258 Ga0105248_101612581 237
493 3300009177 Ga0105248_10180308 Ga0105248_101803082 237
494 3300009177 Ga0105248_10247179 Ga0105248_102471791 237
495 3300009177 Ga0105248_10938239 Ga0105248_109382391 237
496 3300009545 Ga0105237_10033884 Ga0105237_100338842 237
497 3300009545 Ga0105237_10058469 Ga0105237_100584693 237
498 3300009545 Ga0105237_10393642 Ga0105237_103936422 237
499 3300009551 Ga0105238_10000817 Ga0105238_100008175 237
500 3300009551 Ga0105238_10007607 Ga0105238_100076072 237
501 3300009551 Ga0105238_10067792 Ga0105238_100677925 237
502 3300009553 Ga0105249_10046471 Ga0105249_100464714 237
503 3300009553 Ga0105249_10112822 Ga0105249_101128222 237
504 3300010375 Ga0105239_10143552 Ga0105239_101435522 237
505 3300010375 Ga0105239_10491997 Ga0105239_104919972 237
506 3300013100 Ga0157373_10001602 Ga0157373_100016023 237
507 3300013100 Ga0157373_10017961 Ga0157373_100179612 237
508 3300013100 Ga0157373_10069308 Ga0157373_100693083 237
509 3300013100 Ga0157373_10437123 Ga0157373_104371232 237
510 3300013102 Ga0157371_10010228 Ga0157371_100102285 237
511 3300013102 Ga0157371_10029894 Ga0157371_100298944 237
512 3300013102 Ga0157371_10047846 Ga0157371_100478463 237
513 3300013102 Ga0157371_10236011 Ga0157371_102360112 237
514 3300013104 Ga0157370_10008792 Ga0157370_1000879211 237
515 3300013104 Ga0157370_10017286 Ga0157370_100172865 237
516 3300013104 Ga0157370_10050351 Ga0157370_100503514 237
517 3300013104 Ga0157370_10069275 Ga0157370_100692753 237
518 3300013104 Ga0157370_10160044 Ga0157370_101600442 237
519 3300013104 Ga0157370_10391572 Ga0157370_103915722 237
520 3300013105 Ga0157369_10064425 Ga0157369_100644255 237
521 3300013105 Ga0157369_10098306 Ga0157369_100983063 237
522 3300013105 Ga0157369_10150200 Ga0157369_101502001 237
523 3300013296 Ga0157374_10043219 Ga0157374_100432193 237
524 3300013296 Ga0157374_10093604 Ga0157374_100936042 237
525 3300013296 Ga0157374_10267005 Ga0157374_102670051 237
526 3300013296 Ga0157374_10283231 Ga0157374_102832312 237
527 3300013296 Ga0157374_10707758 Ga0157374_107077581 237
528 3300013297 Ga0157378_10010461 Ga0157378_100104614 237
529 3300013297 Ga0157378_10027168 Ga0157378_100271682 237
530 3300013297 Ga0157378_10057901 Ga0157378_100579013 237
531 3300013297 Ga0157378_10256624 Ga0157378_102566241 237
532 3300013306 Ga0163162_10004211 Ga0163162_100042116 237
533 3300013306 Ga0163162_10025286 Ga0163162_100252862 237
534 3300013306 Ga0163162_10047462 Ga0163162_100474624 237
535 3300013306 Ga0163162_10071918 Ga0163162_100719183 237
536 3300013307 Ga0157372_10007349 Ga0157372_100073492 237
537 3300013307 Ga0157372_10009688 Ga0157372_100096885 237
538 3300013307 Ga0157372_10015367 Ga0157372_100153672 237
539 3300013307 Ga0157372_10043059 Ga0157372_100430594 237
540 3300013307 Ga0157372_10686247 Ga0157372_106862472 237
541 3300013308 Ga0157375_10012219 Ga0157375_100122195 237
542 3300013308 Ga0157375_10015352 Ga0157375_100153525 237
543 3300013308 Ga0157375_10041117 Ga0157375_100411174 237
544 3300013308 Ga0157375_10068792 Ga0157375_100687922 237
545 3300013308 Ga0157375_10111297 Ga0157375_101112973 237
546 3300013308 Ga0157375_10140113 Ga0157375_101401132 237
547 3300013308 Ga0157375_10156544 Ga0157375_101565442 237
548 3300013308 Ga0157375_10337562 Ga0157375_103375623 237
549 3300014325 Ga0163163_10019983 Ga0163163_100199835 237
550 3300014325 Ga0163163_10033099 Ga0163163_100330995 237
551 3300014325 Ga0163163_10033527 Ga0163163_100335275 237
552 3300014325 Ga0163163_10038819 Ga0163163_100388194 237
553 3300014325 Ga0163163_10222634 Ga0163163_102226343 237
554 3300014325 Ga0163163_10361973 Ga0163163_103619732 237
555 3300014325 Ga0163163_10539130 Ga0163163_105391302 237
556 3300014326 Ga0157380_10011897 Ga0157380_100118972 237
557 3300014326 Ga0157380_10195321 Ga0157380_101953213 237
558 3300014326 Ga0157380_10560146 Ga0157380_105601462 237
559 3300014497 Ga0182008_10080964 Ga0182008_100809642 237
560 3300014745 Ga0157377_10002721 Ga0157377_100027216 237
561 3300014968 Ga0157379_10024362 Ga0157379_100243624 237
562 3300014968 Ga0157379_10026641 Ga0157379_100266413 237
563 3300014968 Ga0157379_10061926 Ga0157379_100619262 237
564 3300014968 Ga0157379_10073753 Ga0157379_100737534 237
565 3300014968 Ga0157379_10130031 Ga0157379_101300313 237
566 3300014968 Ga0157379_10198580 Ga0157379_101985801 237
567 3300014968 Ga0157379_10214470 Ga0157379_102144702 237
568 3300014969 Ga0157376_10024082 Ga0157376_100240824 237
569 3300014969 Ga0157376_10062975 Ga0157376_100629752 237
570 3300014969 Ga0157376_10064154 Ga0157376_100641544 237
571 3300014969 Ga0157376_10080059 Ga0157376_100800592 237
572 3300014969 Ga0157376_10086054 Ga0157376_100860542 237
573 3300014969 Ga0157376_10122623 Ga0157376_101226233 237
574 3300014969 Ga0157376_10481526 Ga0157376_104815262 237
575 3300017792 Ga0163161_10034950 Ga0163161_100349503 237
576 3300017792 Ga0163161_10161956 Ga0163161_101619562 237
577 3300017792 Ga0163161_10175493 Ga0163161_101754932 237
578 3300017792 Ga0163161_10236639 Ga0163161_102366393 237
579 3300020082 Ga0206353_11413114 Ga0206353_114131143 237
580 3300025315 Ga0207697_10000331 Ga0207697_1000033126 237
581 3300025315 Ga0207697_10028371 Ga0207697_100283711 237
582 3300025321 Ga0207656_10023601 Ga0207656_100236011 237
583 3300025321 Ga0207656_10097702 Ga0207656_100977022 237
584 3300025321 Ga0207656_10111576 Ga0207656_101115762 237
585 3300025893 Ga0207682_10000010 Ga0207682_1000001041 237
586 3300025893 Ga0207682_10004862 Ga0207682_100048622 237
587 3300025893 Ga0207682_10025216 Ga0207682_100252161 237
588 3300025893 Ga0207682_10071046 Ga0207682_100710462 237
589 3300025899 Ga0207642_10004760 Ga0207642_100047603 237
590 3300025899 Ga0207642_10064870 Ga0207642_100648702 237
591 3300025899 Ga0207642_10297612 Ga0207642_102976121 237
592 3300025901 Ga0207688_10016279 Ga0207688_100162792 237
593 3300025901 Ga0207688_10031894 Ga0207688_100318943 237
594 3300025903 Ga0207680_10030182 Ga0207680_100301821 237
595 3300025903 Ga0207680_10060062 Ga0207680_100600623 237
596 3300025903 Ga0207680_10153721 Ga0207680_101537212 237
597 3300025903 Ga0207680_10245461 Ga0207680_102454612 237
598 3300025903 Ga0207680_10394917 Ga0207680_103949172 237
599 3300025904 Ga0207647_10052716 Ga0207647_100527164 237
600 3300025906 Ga0207699_10020606 Ga0207699_100206063 237
601 3300025906 Ga0207699_10085520 Ga0207699_100855202 237
602 3300025906 Ga0207699_10157381 Ga0207699_101573811 237
603 3300025907 Ga0207645_10000617 Ga0207645_100006174 237
604 3300025907 Ga0207645_10005474 Ga0207645_100054748 237
605 3300025907 Ga0207645_10006124 Ga0207645_100061249 237
606 3300025907 Ga0207645_10056183 Ga0207645_100561834 237
607 3300025907 Ga0207645_10077362 Ga0207645_100773622 237
608 3300025907 Ga0207645_10085960 Ga0207645_100859602 237
609 3300025907 Ga0207645_10092917 Ga0207645_100929172 237
610 3300025907 Ga0207645_10140804 Ga0207645_101408042 237
611 3300025908 Ga0207643_10000339 Ga0207643_1000033928 237
612 3300025908 Ga0207643_10010591 Ga0207643_100105915 237
613 3300025908 Ga0207643_10029469 Ga0207643_100294693 237
614 3300025908 Ga0207643_10105459 Ga0207643_101054591 237
615 3300025909 Ga0207705_10064159 Ga0207705_100641593 237
616 3300025909 Ga0207705_10334841 Ga0207705_103348411 237
617 3300025911 Ga0207654_10030031 Ga0207654_100300313 237
618 3300025911 Ga0207654_10096111 Ga0207654_100961112 237
619 3300025912 Ga0207707_10020569 Ga0207707_100205696 237
620 3300025912 Ga0207707_10020864 Ga0207707_100208647 237
621 3300025912 Ga0207707_10048223 Ga0207707_100482232 237
622 3300025912 Ga0207707_10171977 Ga0207707_101719773 237
623 3300025912 Ga0207707_10569557 Ga0207707_105695571 237
624 3300025913 Ga0207695_10019928 Ga0207695_100199286 237
625 3300025913 Ga0207695_10094834 Ga0207695_100948343 237
626 3300025913 Ga0207695_10434002 Ga0207695_104340022 237
627 3300025915 Ga0207693_10039705 Ga0207693_100397052 237
628 3300025915 Ga0207693_10065781 Ga0207693_100657814 237
629 3300025915 Ga0207693_10477383 Ga0207693_104773831 237
630 3300025916 Ga0207663_10011679 Ga0207663_100116791 237
631 3300025916 Ga0207663_10667240 Ga0207663_106672401 237
632 3300025917 Ga0207660_10043511 Ga0207660_100435111 237
633 3300025917 Ga0207660_10091054 Ga0207660_100910543 237
634 3300025918 Ga0207662_10002747 Ga0207662_100027476 237
635 3300025919 Ga0207657_10000708 Ga0207657_100007083 237
636 3300025919 Ga0207657_10003687 Ga0207657_100036877 237
637 3300025919 Ga0207657_10004347 Ga0207657_1000434712 237
638 3300025919 Ga0207657_10044990 Ga0207657_100449901 237
639 3300025919 Ga0207657_10070048 Ga0207657_100700483 237
640 3300025919 Ga0207657_10208380 Ga0207657_102083802 237
641 3300025920 Ga0207649_10012593 Ga0207649_100125935 237
642 3300025920 Ga0207649_10034021 Ga0207649_100340212 237
643 3300025920 Ga0207649_10412851 Ga0207649_104128512 237
644 3300025921 Ga0207652_10012975 Ga0207652_100129752 237
645 3300025921 Ga0207652_10096051 Ga0207652_100960512 237
646 3300025921 Ga0207652_10178685 Ga0207652_101786851 237
647 3300025921 Ga0207652_10254755 Ga0207652_102547552 237
648 3300025921 Ga0207652_10445134 Ga0207652_104451341 237
649 3300025921 Ga0207652_10487075 Ga0207652_104870751 237
650 3300025923 Ga0207681_10004220 Ga0207681_100042204 237
651 3300025923 Ga0207681_10017941 Ga0207681_100179415 237
652 3300025923 Ga0207681_10236657 Ga0207681_102366572 237
653 3300025923 Ga0207681_10291470 Ga0207681_102914702 237
654 3300025923 Ga0207681_10338946 Ga0207681_103389462 237
655 3300025923 Ga0207681_10402746 Ga0207681_104027461 237
656 3300025924 Ga0207694_10002353 Ga0207694_1000235313 237
657 3300025924 Ga0207694_10283959 Ga0207694_102839592 237
658 3300025925 Ga0207650_10001496 Ga0207650_100014963 237
659 3300025925 Ga0207650_10002524 Ga0207650_100025243 237
660 3300025925 Ga0207650_10006069 Ga0207650_100060691 237
661 3300025925 Ga0207650_10009870 Ga0207650_100098706 237
662 3300025925 Ga0207650_10218699 Ga0207650_102186992 237
663 3300025925 Ga0207650_10327182 Ga0207650_103271822 237
664 3300025925 Ga0207650_10420310 Ga0207650_104203101 237
665 3300025926 Ga0207659_10007042 Ga0207659_100070425 237
666 3300025926 Ga0207659_10007154 Ga0207659_100071545 237
667 3300025926 Ga0207659_10009884 Ga0207659_100098843 237
668 3300025926 Ga0207659_10349226 Ga0207659_103492262 237
669 3300025926 Ga0207659_10656752 Ga0207659_106567521 237
670 3300025927 Ga0207687_10001243 Ga0207687_100012435 237
671 3300025927 Ga0207687_10015968 Ga0207687_100159684 237
672 3300025927 Ga0207687_10077199 Ga0207687_100771993 237
673 3300025928 Ga0207700_10000120 Ga0207700_1000012020 237
674 3300025928 Ga0207700_10003229 Ga0207700_100032293 237
675 3300025929 Ga0207664_10001435 Ga0207664_1000143514 237
676 3300025929 Ga0207664_10013227 Ga0207664_100132272 237
677 3300025929 Ga0207664_10084149 Ga0207664_100841493 237
678 3300025931 Ga0207644_10008486 Ga0207644_100084866 237
679 3300025931 Ga0207644_10018762 Ga0207644_100187622 237
680 3300025931 Ga0207644_10022271 Ga0207644_100222712 237
681 3300025931 Ga0207644_10065396 Ga0207644_100653962 237
682 3300025931 Ga0207644_10264571 Ga0207644_102645711 237
683 3300025931 Ga0207644_10274705 Ga0207644_102747052 237
684 3300025931 Ga0207644_10328884 Ga0207644_103288842 237
685 3300025932 Ga0207690_10001354 Ga0207690_1000135411 237
686 3300025932 Ga0207690_10004135 Ga0207690_100041353 237
687 3300025932 Ga0207690_10078832 Ga0207690_100788322 237
688 3300025932 Ga0207690_10458092 Ga0207690_104580921 237
689 3300025933 Ga0207706_10000133 Ga0207706_1000013348 237
690 3300025933 Ga0207706_10026786 Ga0207706_100267864 237
691 3300025933 Ga0207706_10070740 Ga0207706_100707402 237
692 3300025933 Ga0207706_10095375 Ga0207706_100953753 237
693 3300025933 Ga0207706_10127868 Ga0207706_101278683 237
694 3300025933 Ga0207706_10190842 Ga0207706_101908422 237
695 3300025933 Ga0207706_10215873 Ga0207706_102158732 237
696 3300025933 Ga0207706_10218530 Ga0207706_102185302 237
697 3300025934 Ga0207686_10006296 Ga0207686_100062962 237
698 3300025934 Ga0207686_10078144 Ga0207686_100781443 237
699 3300025934 Ga0207686_10169889 Ga0207686_101698892 237
700 3300025936 Ga0207670_10037639 Ga0207670_100376394 237
701 3300025936 Ga0207670_10063605 Ga0207670_100636052 237
702 3300025936 Ga0207670_10169806 Ga0207670_101698062 237
703 3300025936 Ga0207670_10253332 Ga0207670_102533322 237
704 3300025937 Ga0207669_10023657 Ga0207669_100236574 237
705 3300025937 Ga0207669_10040048 Ga0207669_100400483 237
706 3300025937 Ga0207669_10056519 Ga0207669_100565193 237
707 3300025937 Ga0207669_10155370 Ga0207669_101553702 237
708 3300025937 Ga0207669_10214414 Ga0207669_102144141 237
709 3300025938 Ga0207704_10011741 Ga0207704_100117414 237
710 3300025938 Ga0207704_10019197 Ga0207704_100191972 237
711 3300025938 Ga0207704_10123398 Ga0207704_101233982 237
712 3300025938 Ga0207704_10153328 Ga0207704_101533282 237
713 3300025938 Ga0207704_10196419 Ga0207704_101964191 237
714 3300025938 Ga0207704_10291557 Ga0207704_102915572 237
715 3300025938 Ga0207704_10780327 Ga0207704_107803271 237
716 3300025939 Ga0207665_10020509 Ga0207665_100205094 237
717 3300025939 Ga0207665_10089964 Ga0207665_100899643 237
718 3300025940 Ga0207691_10000170 Ga0207691_1000017050 237
719 3300025940 Ga0207691_10000282 Ga0207691_1000028239 237
720 3300025940 Ga0207691_10000856 Ga0207691_100008566 237
721 3300025940 Ga0207691_10001299 Ga0207691_100012995 237
722 3300025940 Ga0207691_10009678 Ga0207691_100096786 237
723 3300025940 Ga0207691_10011409 Ga0207691_100114095 237
724 3300025940 Ga0207691_10064835 Ga0207691_100648352 237
725 3300025940 Ga0207691_10075725 Ga0207691_100757254 237
726 3300025940 Ga0207691_10078713 Ga0207691_100787132 237
727 3300025940 Ga0207691_10093880 Ga0207691_100938802 237
728 3300025940 Ga0207691_10114050 Ga0207691_101140504 237
729 3300025940 Ga0207691_10133265 Ga0207691_101332654 237
730 3300025940 Ga0207691_10154894 Ga0207691_101548943 237
731 3300025940 Ga0207691_10215334 Ga0207691_102153342 237
732 3300025940 Ga0207691_10478884 Ga0207691_104788841 237
733 3300025941 Ga0207711_10014719 Ga0207711_100147193 237
734 3300025941 Ga0207711_10016910 Ga0207711_100169102 237
735 3300025941 Ga0207711_10023818 Ga0207711_100238185 237
736 3300025941 Ga0207711_10074048 Ga0207711_100740483 237
737 3300025941 Ga0207711_10170744 Ga0207711_101707443 237
738 3300025941 Ga0207711_10200102 Ga0207711_102001023 237
739 3300025941 Ga0207711_10405645 Ga0207711_104056452 237
740 3300025941 Ga0207711_10442719 Ga0207711_104427192 237
741 3300025942 Ga0207689_10000236 Ga0207689_1000023650 237
742 3300025942 Ga0207689_10002206 Ga0207689_1000220613 237
743 3300025942 Ga0207689_10014507 Ga0207689_100145075 237
744 3300025942 Ga0207689_10019197 Ga0207689_100191974 237
745 3300025942 Ga0207689_10021123 Ga0207689_100211235 237
746 3300025942 Ga0207689_10062741 Ga0207689_100627412 237
747 3300025944 Ga0207661_10012274 Ga0207661_100122746 237
748 3300025944 Ga0207661_10125350 Ga0207661_101253502 237
749 3300025944 Ga0207661_10230031 Ga0207661_102300312 237
750 3300025944 Ga0207661_10247756 Ga0207661_102477562 237
751 3300025944 Ga0207661_10521527 Ga0207661_105215272 237
752 3300025944 Ga0207661_10621659 Ga0207661_106216591 237
753 3300025945 Ga0207679_10003266 Ga0207679_100032665 237
754 3300025945 Ga0207679_10005340 Ga0207679_100053405 237
755 3300025945 Ga0207679_10030046 Ga0207679_100300464 237
756 3300025945 Ga0207679_10136589 Ga0207679_101365892 237
757 3300025949 Ga0207667_10000842 Ga0207667_1000084218 237
758 3300025949 Ga0207667_10005196 Ga0207667_100051964 237
759 3300025949 Ga0207667_10006930 Ga0207667_100069302 237
760 3300025949 Ga0207667_10021027 Ga0207667_100210275 237
761 3300025949 Ga0207667_10061536 Ga0207667_100615362 237
762 3300025949 Ga0207667_10073834 Ga0207667_100738343 237
763 3300025949 Ga0207667_10164428 Ga0207667_101644283 237
764 3300025949 Ga0207667_10455700 Ga0207667_104557002 237
765 3300025960 Ga0207651_10004556 Ga0207651_100045567 237
766 3300025960 Ga0207651_10012121 Ga0207651_100121211 237
767 3300025960 Ga0207651_10019594 Ga0207651_100195944 237
768 3300025960 Ga0207651_10026400 Ga0207651_100264004 237
769 3300025960 Ga0207651_10037630 Ga0207651_100376302 237
770 3300025960 Ga0207651_10116425 Ga0207651_101164252 237
771 3300025960 Ga0207651_10171712 Ga0207651_101717122 237
772 3300025960 Ga0207651_10183459 Ga0207651_101834592 237
773 3300025960 Ga0207651_10363388 Ga0207651_103633881 237
774 3300025961 Ga0207712_10048998 Ga0207712_100489984 237
775 3300025961 Ga0207712_10802747 Ga0207712_108027471 237
776 3300025972 Ga0207668_10003009 Ga0207668_100030093 237
777 3300025972 Ga0207668_10013117 Ga0207668_100131173 237
778 3300025972 Ga0207668_10043078 Ga0207668_100430783 237
779 3300025972 Ga0207668_10096489 Ga0207668_100964892 237
780 3300025972 Ga0207668_10098599 Ga0207668_100985993 237
781 3300025972 Ga0207668_10177473 Ga0207668_101774732 237
782 3300025972 Ga0207668_10269106 Ga0207668_102691062 237
783 3300025972 Ga0207668_10342029 Ga0207668_103420292 237
784 3300025981 Ga0207640_10013209 Ga0207640_100132091 237
785 3300025981 Ga0207640_10059061 Ga0207640_100590613 237
786 3300025981 Ga0207640_10068522 Ga0207640_100685223 237
787 3300025986 Ga0207658_10001473 Ga0207658_1000147320 237
788 3300025986 Ga0207658_10011230 Ga0207658_100112306 237
789 3300025986 Ga0207658_10023044 Ga0207658_100230445 237
790 3300025986 Ga0207658_10059532 Ga0207658_100595322 237
791 3300025986 Ga0207658_10071019 Ga0207658_100710193 237
792 3300025986 Ga0207658_10308199 Ga0207658_103081992 237
793 3300025986 Ga0207658_10413937 Ga0207658_104139372 237
794 3300026023 Ga0207677_10000852 Ga0207677_1000085214 237
795 3300026023 Ga0207677_10009840 Ga0207677_100098403 237
796 3300026023 Ga0207677_10379395 Ga0207677_103793952 237
797 3300026023 Ga0207677_10428655 Ga0207677_104286552 237
798 3300026023 Ga0207677_10611817 Ga0207677_106118171 237
799 3300026035 Ga0207703_10001478 Ga0207703_1000147813 237
800 3300026035 Ga0207703_10008677 Ga0207703_100086775 237
801 3300026035 Ga0207703_10008824 Ga0207703_100088245 237
802 3300026035 Ga0207703_10036752 Ga0207703_100367524 237
803 3300026035 Ga0207703_10113313 Ga0207703_101133133 237
804 3300026041 Ga0207639_10016349 Ga0207639_100163493 237
805 3300026041 Ga0207639_10421621 Ga0207639_104216212 237
806 3300026041 Ga0207639_10704690 Ga0207639_107046901 237
807 3300026067 Ga0207678_10002750 Ga0207678_100027508 237
808 3300026067 Ga0207678_10007239 Ga0207678_100072396 237
809 3300026067 Ga0207678_10029950 Ga0207678_100299503 237
810 3300026067 Ga0207678_10085428 Ga0207678_100854282 237
811 3300026067 Ga0207678_10160214 Ga0207678_101602142 237
812 3300026067 Ga0207678_10175535 Ga0207678_101755353 237
813 3300026067 Ga0207678_10207928 Ga0207678_102079283 237
814 3300026075 Ga0207708_10012750 Ga0207708_100127504 237
815 3300026075 Ga0207708_10072079 Ga0207708_100720793 237
816 3300026078 Ga0207702_10005844 Ga0207702_100058446 237
817 3300026078 Ga0207702_10010663 Ga0207702_100106632 237
818 3300026078 Ga0207702_10149474 Ga0207702_101494743 237
819 3300026078 Ga0207702_10340502 Ga0207702_103405022 237
820 3300026078 Ga0207702_10424417 Ga0207702_104244172 237
821 3300026088 Ga0207641_10004545 Ga0207641_100045459 237
822 3300026088 Ga0207641_10007973 Ga0207641_100079735 237
823 3300026088 Ga0207641_10015556 Ga0207641_100155564 237
824 3300026088 Ga0207641_10041625 Ga0207641_100416252 237
825 3300026088 Ga0207641_10062254 Ga0207641_100622542 237
826 3300026088 Ga0207641_10068108 Ga0207641_100681082 237
827 3300026088 Ga0207641_10075028 Ga0207641_100750283 237
828 3300026088 Ga0207641_10077467 Ga0207641_100774674 237
829 3300026088 Ga0207641_10077757 Ga0207641_100777574 237
830 3300026088 Ga0207641_10130083 Ga0207641_101300833 237
831 3300026088 Ga0207641_10301373 Ga0207641_103013732 237
832 3300026088 Ga0207641_10403331 Ga0207641_104033311 237
833 3300026089 Ga0207648_10000203 Ga0207648_1000020315 237
834 3300026089 Ga0207648_10004392 Ga0207648_100043923 237
835 3300026089 Ga0207648_10009080 Ga0207648_100090808 237
836 3300026089 Ga0207648_10014175 Ga0207648_100141753 237
837 3300026089 Ga0207648_10065879 Ga0207648_100658793 237
838 3300026089 Ga0207648_10077179 Ga0207648_100771794 237
839 3300026089 Ga0207648_10182776 Ga0207648_101827762 237
840 3300026089 Ga0207648_10200444 Ga0207648_102004442 237
841 3300026089 Ga0207648_10228721 Ga0207648_102287213 237
842 3300026095 Ga0207676_10000303 Ga0207676_1000030332 237
843 3300026095 Ga0207676_10003405 Ga0207676_100034053 237
844 3300026095 Ga0207676_10004337 Ga0207676_1000433710 237
845 3300026095 Ga0207676_10004631 Ga0207676_100046312 237
846 3300026095 Ga0207676_10008662 Ga0207676_100086624 237
847 3300026095 Ga0207676_10013409 Ga0207676_100134094 237
848 3300026095 Ga0207676_10083181 Ga0207676_100831813 237
849 3300026095 Ga0207676_10227422 Ga0207676_102274222 237
850 3300026095 Ga0207676_10274361 Ga0207676_102743612 237
851 3300026095 Ga0207676_10573369 Ga0207676_105733691 237
852 3300026116 Ga0207674_10000182 Ga0207674_1000018248 237
853 3300026116 Ga0207674_10003596 Ga0207674_100035962 237
854 3300026116 Ga0207674_10003869 Ga0207674_1000386918 237
855 3300026116 Ga0207674_10009059 Ga0207674_100090591 237
856 3300026116 Ga0207674_10037808 Ga0207674_100378084 237
857 3300026116 Ga0207674_10235964 Ga0207674_102359642 237
858 3300026116 Ga0207674_10327281 Ga0207674_103272812 237
859 3300026118 Ga0207675_100002544 Ga0207675_1000025443 237
860 3300026118 Ga0207675_100011066 Ga0207675_1000110667 237
861 3300026118 Ga0207675_100032048 Ga0207675_1000320484 237
862 3300026118 Ga0207675_100128148 Ga0207675_1001281483 237
863 3300026118 Ga0207675_100144580 Ga0207675_1001445803 237
864 3300026118 Ga0207675_100169409 Ga0207675_1001694093 237
865 3300026121 Ga0207683_10000005 Ga0207683_10000005130 237
866 3300026121 Ga0207683_10000428 Ga0207683_1000042830 237
867 3300026121 Ga0207683_10000937 Ga0207683_100009373 237
868 3300026121 Ga0207683_10002423 Ga0207683_1000242313 237
869 3300026121 Ga0207683_10006645 Ga0207683_100066452 237
870 3300026121 Ga0207683_10007710 Ga0207683_100077108 237
871 3300026121 Ga0207683_10054325 Ga0207683_100543253 237
872 3300026121 Ga0207683_10168050 Ga0207683_101680501 237
873 3300026121 Ga0207683_10243781 Ga0207683_102437812 237
874 3300026142 Ga0207698_10034545 Ga0207698_100345453 237
875 3300026142 Ga0207698_10066461 Ga0207698_100664613 237
876 3300026142 Ga0207698_10202372 Ga0207698_102023722 237
877 3300026142 Ga0207698_10318518 Ga0207698_103185182 237
878 3300026142 Ga0207698_10552670 Ga0207698_105526702 237
879 3300027526 Ga0209968_1013348 Ga0209968_10133482 237
880 3300027552 Ga0209982_1021189 Ga0209982_10211891 237
881 3300027665 Ga0209983_1008199 Ga0209983_10081992 237
882 3300027682 Ga0209971_1025035 Ga0209971_10250352 237
883 3300027682 Ga0209971_1026260 Ga0209971_10262602 237
884 3300027717 Ga0209998_10003436 Ga0209998_100034363 237
885 3300027876 Ga0209974_10000182 Ga0209974_1000018213 237
886 3300027876 Ga0209974_10014903 Ga0209974_100149034 237
887 3300028379 Ga0268266_10014515 Ga0268266_100145158 237
888 3300028379 Ga0268266_10059050 Ga0268266_100590503 237
889 3300028379 Ga0268266_10099870 Ga0268266_100998702 237
890 3300028379 Ga0268266_10147164 Ga0268266_101471642 237
891 3300028379 Ga0268266_10192683 Ga0268266_101926832 237
892 3300028380 Ga0268265_10073817 Ga0268265_100738173 237
893 3300028380 Ga0268265_10175897 Ga0268265_101758972 237
894 3300028380 Ga0268265_10307754 Ga0268265_103077541 237
895 3300028380 Ga0268265_10365587 Ga0268265_103655872 237
896 3300028380 Ga0268265_10428239 Ga0268265_104282392 237
897 3300028381 Ga0268264_10001280 Ga0268264_1000128020 237
898 3300028381 Ga0268264_10006200 Ga0268264_100062007 237
899 3300028381 Ga0268264_10030419 Ga0268264_100304191 237
900 3300028381 Ga0268264_10032240 Ga0268264_100322405 237
901 3300028381 Ga0268264_10062932 Ga0268264_100629322 237
902 3300028381 Ga0268264_10082035 Ga0268264_100820352 237
903 3300028381 Ga0268264_10183516 Ga0268264_101835163 237
904 3300028381 Ga0268264_10250719 Ga0268264_102507192 237
905 3300028381 Ga0268264_10322822 Ga0268264_103228222 237
906 3300031235 Ga0265330_10024652 Ga0265330_100246524 237
907 3300031238 Ga0265332_10001132 Ga0265332_1000113214 237
908 3300031241 Ga0265325_10080998 Ga0265325_100809982 237
909 3300031242 Ga0265329_10019176 Ga0265329_100191761 237
910 3300031249 Ga0265339_10099004 Ga0265339_100990041 237
911 3300031250 Ga0265331_10005857 Ga0265331_100058577 237
912 3300031251 Ga0265327_10027420 Ga0265327_100274204 237
913 3300031548 Ga0307408_100012198 Ga0307408_1000121985 237
914 3300031548 Ga0307408_100063482 Ga0307408_1000634822 237
915 3300031711 Ga0265314_10004158 Ga0265314_100041582 237
916 3300031712 Ga0265342_10047547 Ga0265342_100475473 237
917 3300031731 Ga0307405_10016897 Ga0307405_100168972 237
918 3300031731 Ga0307405_10018136 Ga0307405_100181363 237
919 3300031731 Ga0307405_10110609 Ga0307405_101106093 237
920 3300031824 Ga0307413_10013526 Ga0307413_100135263 237
921 3300031852 Ga0307410_10015385 Ga0307410_100153853 237
922 3300031852 Ga0307410_10048545 Ga0307410_100485453 237
923 3300031852 Ga0307410_10066494 Ga0307410_100664942 237
924 3300031901 Ga0307406_10002618 Ga0307406_100026188 237
925 3300031901 Ga0307406_10027451 Ga0307406_100274513 237
926 3300031901 Ga0307406_10077922 Ga0307406_100779223 237
927 3300031903 Ga0307407_10082351 Ga0307407_100823513 237
928 3300031911 Ga0307412_10003937 Ga0307412_100039377 237
929 3300031911 Ga0307412_10017599 Ga0307412_100175994 237
930 3300031995 Ga0307409_100354140 Ga0307409_1003541402 237
931 3300031995 Ga0307409_100539312 Ga0307409_1005393122 237
932 3300032002 Ga0307416_100012917 Ga0307416_1000129172 237
933 3300032004 Ga0307414_10013576 Ga0307414_100135765 237
934 3300032005 Ga0307411_10002951 Ga0307411_100029514 237
935 3300032005 Ga0307411_10035772 Ga0307411_100357724 237
936 3300032005 Ga0307411_10136835 Ga0307411_101368352 237
937 3300032126 Ga0307415_100059733 Ga0307415_1000597333 237
938 3300032126 Ga0307415_100160175 Ga0307415_1001601752 237
939 3300035083 Ga0373926_0049542 Ga0373926_0049542_56_814 237
940 3300035086 Ga0373934_0135271 Ga0373934_0135271_207_965 237
941 3300035089 Ga0373944_0084703 Ga0373944_0084703_77_835 237
942 3300035090 Ga0373949_0074502 Ga0373949_0074502_121_879 237
943 3300035092 Ga0373952_0053103 Ga0373952_0053103_75_908 237
944 3300035111 Ga0373923_0153680 Ga0373923_0153680_10_768 237
945 3300035113 Ga0373936_0024196 Ga0373936_0024196_517_1275 237
946 3300035113 Ga0373936_0109952 Ga0373936_0109952_32_817 237
947 3300035114 Ga0373939_0112240 Ga0373939_0112240_68_826 237
948 3300035116 Ga0373945_0086580 Ga0373945_0086580_336_1094 237
949 3300035117 Ga0373953_0013597 Ga0373953_0013597_45_803 237
950 3300035118 Ga0373954_0024342 Ga0373954_0024342_1260_2018 237
951 3300035118 Ga0373954_0034602 Ga0373954_0034602_112_870 237
952 3300035118 Ga0373954_0209769 Ga0373954_0209769_147_905 237
953 3300035120 Ga0373957_0122498 Ga0373957_0122498_148_906 237
954 3300035170 Ga0373943_0013078 Ga0373943_0013078_912_1670 237
955 3300035170 Ga0373943_0033450 Ga0373943_0033450_745_1503 237
956 3300035171 Ga0373946_0051370 Ga0373946_0051370_177_935 237
957 3300035171 Ga0373946_0085172 Ga0373946_0085172_69_827 237
958 3300035172 Ga0373955_0093324 Ga0373955_0093324_375_1133 237
959 3300035410 Ga0373924_0019622 Ga0373924_0019622_793_1551 237
960 3300035691 Ga0373931_0103010 Ga0373931_0103010_680_1438 237
961 3300035692 Ga0373935_0069408 Ga0373935_0069408_1152_1910 237
962 3300035692 Ga0373935_0189095 Ga0373935_0189095_129_887 237
963 3300035692 Ga0373935_0292449 Ga0373935_0292449_326_1084 237
964 3300035695 Ga0373927_0051545 Ga0373927_0051545_378_1136 237
965 3300035695 Ga0373927_0112335 Ga0373927_0112335_189_1016 237
966 3300035724 Ga0373933_0022450 Ga0373933_0022450_838_1596 237
967 3300035725 Ga0373947_0012424 Ga0373947_0012424_3881_4639 237
968 3300035725 Ga0373947_0056215 Ga0373947_0056215_1232_1990 237
969 3300035725 Ga0373947_0141098 Ga0373947_0141098_710_1468 237
970 3300036401 Ga0373937_0099971 Ga0373937_0099971_1037_1795 237
971 3300036401 Ga0373937_0186714 Ga0373937_0186714_228_1046 237
972 3300036401 Ga0373937_0595121 Ga0373937_0595121_144_1016 237
973 3300036401 Ga0373937_0687265 Ga0373937_0687265_119_877 237
974 3300037068 Ga0373925_0003719 Ga0373925_0003719_10000_10758 237
975 3300037068 Ga0373925_0027605 Ga0373925_0027605_2313_3071 237
976 3300037068 Ga0373925_0053964 Ga0373925_0053964_1457_2215 237
977 3300037312 Ga0395899_0197887 Ga0395899_0197887_101_859 237
978 3300037471 Ga0395905_0248208 Ga0395905_0248208_361_1119 237
979 3300038443 Ga0395901_0010265 Ga0395901_0010265_2391_3149 237
980 3300038443 Ga0395901_0726746 Ga0395901_0726746_205_963 237
981 3300041451 Ga0451791_0463474 Ga0451791_0463474_82_840 237
982 3300042157 Ga0439458_0087045 Ga0439458_0087045_14_772 237
983 3300044712 Ga0453684_0597705 Ga0453684_0597705_353_1111 237
984 3300044842 Ga0466957_0084986 Ga0466957_0084986_673_1431 237
985 3300045051 Ga0451576_0711689 Ga0451576_0711689_281_1018 237
986 3300046473 Ga0495582_0127335 Ga0495582_0127335_563_1321 237
987 3300046476 Ga0495662_0148595 Ga0495662_0148595_221_979 237
988 3300046477 Ga0495664_0088195 Ga0495664_0088195_43_801 237
989 3300046517 Ga0495630_0044817 Ga0495630_0044817_532_1290 237
990 3300046531 Ga0495665_0246344 Ga0495665_0246344_113_871 237
991 3300046536 Ga0495587_0126742 Ga0495587_0126742_622_1380 237
992 3300046537 Ga0495598_0044149 Ga0495598_0044149_84_842 237
993 3300046539 Ga0495621_0006481 Ga0495621_0006481_1228_1986 237
994 3300046539 Ga0495621_0018739 Ga0495621_0018739_260_1018 237
995 3300046674 Ga0495588_0152447 Ga0495588_0152447_204_962 237
996 3300046675 Ga0495657_0058787 Ga0495657_0058787_1633_2451 237
997 3300046679 Ga0495623_0018162 Ga0495623_0018162_1464_2222 237
998 3300046681 Ga0495647_0014896 Ga0495647_0014896_242_1000 237
999 3300046681 Ga0495647_0061359 Ga0495647_0061359_194_952 237
1000 3300046683 Ga0495658_0022680 Ga0495658_0022680_2368_3126 237
1001 3300046683 Ga0495658_0030393 Ga0495658_0030393_1434_2192 237
1002 3300046689 Ga0495613_0007212 Ga0495613_0007212_6998_7756 237
1003 3300046809 Ga0495600_0196236 Ga0495600_0196236_508_1266 237
1004 3300047315 Ga0495581_0208680 Ga0495581_0208680_323_1081 237
1005 3300047317 Ga0495604_0383431 Ga0495604_0383431_20_778 237
1006 3300047319 Ga0495674_0430247 Ga0495674_0430247_130_888 237
1007 3300047322 Ga0495680_0097927 Ga0495680_0097927_1342_2100 237
1008 3300047444 Ga0495675_0273482 Ga0495675_0273482_145_903 237
1009 3300047470 Ga0495681_0154797 Ga0495681_0154797_101_859 237
1010 3300047471 Ga0495684_0028410 Ga0495684_0028410_1140_1898 237
1011 3300048088 Ga0495602_0142971 Ga0495602_0142971_127_945 237
1012 3300048089 Ga0495614_0196682 Ga0495614_0196682_23_781 237
1013 3300048903 Ga0496100_0059322 Ga0496100_0059322_1553_2311 237
1014 3300048903 Ga0496100_0353438 Ga0496100_0353438_257_1090 237
1015 3300048904 Ga0496101_0034815 Ga0496101_0034815_809_1567 237
1016 3300048904 Ga0496101_0206473 Ga0496101_0206473_17_775 237
1017 3300048904 Ga0496101_0238527 Ga0496101_0238527_226_984 237
1018 3300048905 Ga0496102_0007429 Ga0496102_0007429_2687_3445 237
1019 3300048905 Ga0496102_0066908 Ga0496102_0066908_1298_2056 237
1020 3300048905 Ga0496102_0389830 Ga0496102_0389830_277_1035 237
1021 3300048906 Ga0496103_0149810 Ga0496103_0149810_631_1389 237
1022 3300048908 Ga0496105_0035267 Ga0496105_0035267_2355_3113 237
1023 3300048909 Ga0496106_0000821 Ga0496106_0000821_13362_14195 237
1024 3300048909 Ga0496106_0155429 Ga0496106_0155429_241_999 237
1025 3300048909 Ga0496106_0353531 Ga0496106_0353531_382_1140 237
1026 3300048910 Ga0496107_0008579 Ga0496107_0008579_3172_4005 237
1027 3300048910 Ga0496107_0186871 Ga0496107_0186871_142_900 237
1028 3300048910 Ga0496107_0499629 Ga0496107_0499629_39_797 237
1029 3300048911 Ga0496108_0040439 Ga0496108_0040439_1674_2432 237
1030 3300048911 Ga0496108_0243296 Ga0496108_0243296_475_1233 237
1031 3300048912 Ga0496109_0061929 Ga0496109_0061929_21_779 237
1032 3300048912 Ga0496109_0112873 Ga0496109_0112873_470_1228 237
1033 3300048912 Ga0496109_0142846 Ga0496109_0142846_654_1412 237
1034 3300048912 Ga0496109_0143501 Ga0496109_0143501_1099_1857 237
1035 3300048913 Ga0496110_0283965 Ga0496110_0283965_320_1078 237
1036 3300048915 Ga0496112_0010957 Ga0496112_0010957_3959_4777 237
1037 3300048915 Ga0496112_0063809 Ga0496112_0063809_2352_3119 237
1038 3300048915 Ga0496112_0312284 Ga0496112_0312284_271_1029 237
1039 3300048915 Ga0496112_0526512 Ga0496112_0526512_251_1009 237
1040 3300048916 Ga0496113_0060894 Ga0496113_0060894_173_991 237
1041 3300049577 Ga0501041_0169912 Ga0501041_0169912_443_1231 237
1042 3300049583 Ga0501067_0031936 Ga0501067_0031936_1859_2617 237
1043 3300050511 nmdc:mga08y16_155281_c1 nmdc:mga08y16_155281_c1_1653_2366 237
1044 3300050511 nmdc:mga08y16_40120_c1 nmdc:mga08y16_40120_c1_496_1254 237
1045 3300050512 nmdc:mga0n895_142058_c1 nmdc:mga0n895_142058_c1_922_1719 237
1046 3300050512 nmdc:mga0n895_340741_c1 nmdc:mga0n895_340741_c1_269_1027 237
1047 3300050512 nmdc:mga0n895_501753_c1 nmdc:mga0n895_501753_c1_52_810 237
1048 3300050512 nmdc:mga0n895_536706_c1 nmdc:mga0n895_536706_c1_118_876 237
1049 3300050513 nmdc:mga0rr50_150638_c1 nmdc:mga0rr50_150638_c1_640_1398 237
1050 3300053085 Ga0495619_0224226 Ga0495619_0224226_351_1124 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07072

ZapD

Cell division protein

39

248

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gnp-assembly1.cif.gz_A-2 crystal structure of a z-ring associated protein from salmonella typhimurium 0.8881 2 235
5koa-assembly1.cif.gz_B structure of escherichia coli zapd bound to the c-terminal tail of ftsz 0.884 2 235
2oez-assembly1.cif.gz_A protein of unknown function (duf1342) from vibrio parahaemolyticus 0.8761 2 235
5dko-assembly1.cif.gz_A-2 the structure of escherichia coli zapd 0.8708 2 235
2oez-assembly1.cif.gz_B protein of unknown function (duf1342) from vibrio parahaemolyticus 0.8661 2 235
ID Description Score Start End Superfamily
af_P36680_13_175_1.10.3900.10 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.9065 2 156 1.10.3900.10
2oezA02 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.9008 2 160 1.10.3900.10
5imjB02 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.8744 2 160 1.10.3900.10
af_P36680_13_175_1.10.3900.10 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.8551 2 156 1.10.3900.10
af_P36680_176_247_2.60.440.10 Mainly Beta;Sandwich;YacF-like;YacF-like domains 0.8511 159 235 2.60.440.10
ID Description Score Start End GO Terms
AF-W7WA72-F1-model_v4 Z ring-associated protein D 0.9678 2 149 GO:0032153
GO:0043093
AF-A0A520CK88-F1-model_v4 Cell division protein ZapD 0.9568 2 160 GO:0032153
GO:0043093
AF-A0A2N2U3Q9-F1-model_v4 deleted 0.9542 2 117
AF-A0A7Y4W5S5-F1-model_v4 Cell division protein ZapD (Z ring-associated protein D) 0.9538 2 237 GO:0000917
GO:0005737
GO:0032153
GO:0043093
AF-A0A6M4GQ16-F1-model_v4 Cell division protein ZapD (Z ring-associated protein D) 0.9526 2 237 GO:0000917
GO:0005737
GO:0032153
GO:0043093

Feature Viewer

pLDDT pTM Quality
93.5 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map