F489052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1050 | 352 | 2100 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300025903|Ga0207680_10174885|Ga0207680_101748852 |
| Length | 315 |
| Sequence | VAVFKAGRQLRRCRCDNDNLIFLEPGGLLSGFLFSLYNDDICMMMILKNKEEIELMRQSALLVSKTLAEVAKILRPGITSMTIDKMIGDFIRDHKAVPSFLDYRGYPFNSCISVNDVVVHGFPNNDPLKEGDIVSIDVGVILNEWHGDHAYTFAIGDPGDEVAQLIRGTKESLYKGIEKAVAGNRVGDISFAIQEHTEKKYGYGVVRELVGHGLGKSLHEDPQVPNYGKRGSGVKMKEGLVLAIEPMINLGTRKVYTEEDGWTVRTEDHKPSVHFEHDVCVKKGRADVLSNYAPIEAAEKANVNLFSAYSTELVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 195 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 220 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 295 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 296 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 300 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 301 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 304 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 308 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 321 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 322 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 323 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 328 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 330 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 331 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 335 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 336 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 337 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 338 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 339 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 340 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 341 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 342 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 343 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 344 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 345 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 346 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 347 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 348 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 349 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 350 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 351 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 352 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0.19 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.76 |
| Nodule | 0 |
| Rhizoplane | 0.76 |
| Rhizosphere | 89.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207680_10174885 | 3300025903 | Unclassified | 1448 |
| 2 | MRS1b_contig_3231436 | 2162886011 | Bacteria | 1237 |
| 3 | JGI24739J22299_10001379 | 3300001989 | Bacteria | 9127 |
| 4 | JGI25406J46586_10036777 | 3300003203 | Bacteria | 1773 |
| 5 | JGI25153J46596_10021720 | 3300003215 | Bacteria | 2385 |
| 6 | rootH1_10187333 | 3300003316 | Bacteria | 2081 |
| 7 | rootH2_10037762 | 3300003320 | Bacteria | 1598 |
| 8 | rootH2_10069215 | 3300003320 | Bacteria | 8580 |
| 9 | rootH2_10138765 | 3300003320 | Bacteria | 2357 |
| 10 | rootH2_10155317 | 3300003320 | Bacteria | 1504 |
| 11 | rootL2_10036246 | 3300003322 | Bacteria | 4822 |
| 12 | rootL2_10062004 | 3300003322 | Bacteria | 3019 |
| 13 | rootL2_10066724 | 3300003322 | Bacteria | 3127 |
| 14 | rootL2_10156908 | 3300003322 | Bacteria | 3141 |
| 15 | rootL2_10199815 | 3300003322 | Bacteria | 5835 |
| 16 | rootL2_10278758 | 3300003322 | Bacteria | 2645 |
| 17 | rootL2_10317439 | 3300003322 | Bacteria | 2198 |
| 18 | rootH1_10041523 | 3300003323 | Bacteria | 3402 |
| 19 | rootH1_10046893 | 3300003323 | Bacteria | 2017 |
| 20 | rootH1_10096119 | 3300003323 | Bacteria | 12588 |
| 21 | JGI25160J50197_1001095 | 3300003354 | Bacteria | 13838 |
| 22 | Ga0055535_1003322 | 3300003761 | Unclassified | 4636 |
| 23 | Ga0055536_1000003 | 3300003781 | Bacteria | 447744 |
| 24 | Ga0055530_10001176 | 3300003791 | Bacteria | 20232 |
| 25 | Ga0055531_10000133 | 3300003794 | Bacteria | 84995 |
| 26 | Ga0055531_10000166 | 3300003794 | Bacteria | 74728 |
| 27 | Ga0065714_10002192 | 3300005288 | Bacteria | 92967 |
| 28 | Ga0065714_10088526 | 3300005288 | Bacteria | 2014 |
| 29 | Ga0065714_10128866 | 3300005288 | Bacteria | 1257 |
| 30 | Ga0065704_10204218 | 3300005289 | Bacteria | 1134 |
| 31 | Ga0065712_10011320 | 3300005290 | Bacteria | 2533 |
| 32 | Ga0065712_10020395 | 3300005290 | Unclassified | 1384 |
| 33 | Ga0065712_10074886 | 3300005290 | Bacteria | 3987 |
| 34 | Ga0065712_10162279 | 3300005290 | Bacteria | 1278 |
| 35 | Ga0065712_10209505 | 3300005290 | Bacteria | 1078 |
| 36 | Ga0065712_10315571 | 3300005290 | Bacteria | 837 |
| 37 | Ga0065715_10005801 | 3300005293 | Bacteria | 3037 |
| 38 | Ga0065707_10112842 | 3300005295 | Bacteria | 2347 |
| 39 | Ga0065707_10294102 | 3300005295 | Bacteria | 1018 |
| 40 | Ga0065707_10301143 | 3300005295 | Bacteria | 1004 |
| 41 | Ga0070658_10094269 | 3300005327 | Bacteria | 2470 |
| 42 | Ga0070658_10150547 | 3300005327 | Bacteria | 1948 |
| 43 | Ga0070658_10422714 | 3300005327 | Bacteria | 1146 |
| 44 | Ga0070676_10017260 | 3300005328 | Bacteria | 3995 |
| 45 | Ga0070676_10035933 | 3300005328 | Bacteria | 2852 |
| 46 | Ga0070676_10275360 | 3300005328 | Bacteria | 1132 |
| 47 | Ga0070683_100001488 | 3300005329 | Bacteria | 18077 |
| 48 | Ga0070683_100006686 | 3300005329 | Bacteria | 9680 |
| 49 | Ga0070683_100013377 | 3300005329 | Bacteria | 7155 |
| 50 | Ga0070683_100139428 | 3300005329 | Bacteria | 2297 |
| 51 | Ga0070683_100496968 | 3300005329 | Bacteria | 1165 |
| 52 | Ga0070670_100043938 | 3300005331 | Bacteria | 3841 |
| 53 | Ga0070670_100067766 | 3300005331 | Bacteria | 3062 |
| 54 | Ga0070670_100166339 | 3300005331 | Bacteria | 1912 |
| 55 | Ga0068869_100014592 | 3300005334 | Bacteria | 5253 |
| 56 | Ga0068869_100040382 | 3300005334 | Bacteria | 3337 |
| 57 | Ga0068869_100112960 | 3300005334 | Bacteria | 2068 |
| 58 | Ga0068869_100259567 | 3300005334 | Unclassified | 1391 |
| 59 | Ga0070666_10000191 | 3300005335 | Bacteria | 42149 |
| 60 | Ga0070666_10000736 | 3300005335 | Bacteria | 19845 |
| 61 | Ga0070666_10020630 | 3300005335 | Bacteria | 4261 |
| 62 | Ga0070666_10024266 | 3300005335 | Bacteria | 3949 |
| 63 | Ga0070666_10027930 | 3300005335 | Bacteria | 3700 |
| 64 | Ga0070666_10032894 | 3300005335 | Bacteria | 3428 |
| 65 | Ga0070666_10286860 | 3300005335 | Unclassified | 1171 |
| 66 | Ga0070680_100001401 | 3300005336 | Bacteria | 17413 |
| 67 | Ga0070680_100041558 | 3300005336 | Bacteria | 3728 |
| 68 | Ga0070682_100002086 | 3300005337 | Bacteria | 11122 |
| 69 | Ga0070682_100023351 | 3300005337 | Bacteria | 3670 |
| 70 | Ga0070682_100035375 | 3300005337 | Bacteria | 3049 |
| 71 | Ga0070682_100108505 | 3300005337 | Bacteria | 1845 |
| 72 | Ga0068868_100004630 | 3300005338 | Bacteria | 9650 |
| 73 | Ga0068868_100006935 | 3300005338 | Bacteria | 8051 |
| 74 | Ga0068868_100023189 | 3300005338 | Bacteria | 4695 |
| 75 | Ga0068868_100097784 | 3300005338 | Unclassified | 2372 |
| 76 | Ga0068868_100144787 | 3300005338 | Bacteria | 1953 |
| 77 | Ga0068868_100146899 | 3300005338 | Unclassified | 1939 |
| 78 | Ga0068868_100367617 | 3300005338 | Bacteria | 1235 |
| 79 | Ga0070660_100012064 | 3300005339 | Bacteria | 6167 |
| 80 | Ga0070660_100368188 | 3300005339 | Bacteria | 1185 |
| 81 | Ga0070689_100010221 | 3300005340 | Bacteria | 6685 |
| 82 | Ga0070689_100027952 | 3300005340 | Bacteria | 4258 |
| 83 | Ga0070689_100032331 | 3300005340 | Bacteria | 3979 |
| 84 | Ga0070689_100073429 | 3300005340 | Bacteria | 2675 |
| 85 | Ga0070689_100265952 | 3300005340 | Bacteria | 1418 |
| 86 | Ga0070689_100309677 | 3300005340 | Unclassified | 1316 |
| 87 | Ga0070691_10005091 | 3300005341 | Bacteria | 5973 |
| 88 | Ga0070687_100033870 | 3300005343 | Bacteria | 2525 |
| 89 | Ga0070661_100015125 | 3300005344 | Bacteria | 5444 |
| 90 | Ga0070661_100016234 | 3300005344 | Bacteria | 5260 |
| 91 | Ga0070661_100027839 | 3300005344 | Bacteria | 4073 |
| 92 | Ga0070668_100004151 | 3300005347 | Bacteria | 10731 |
| 93 | Ga0070668_100011116 | 3300005347 | Bacteria | 6701 |
| 94 | Ga0070668_100020025 | 3300005347 | Bacteria | 5045 |
| 95 | Ga0070668_100184107 | 3300005347 | Bacteria | 1708 |
| 96 | Ga0070669_100008748 | 3300005353 | Bacteria | 7222 |
| 97 | Ga0070669_100396208 | 3300005353 | Unclassified | 1129 |
| 98 | Ga0070669_100451207 | 3300005353 | Bacteria | 1060 |
| 99 | Ga0070675_100085433 | 3300005354 | Bacteria | 2636 |
| 100 | Ga0070675_100105888 | 3300005354 | Bacteria | 2373 |
| 101 | Ga0070675_100112578 | 3300005354 | Bacteria | 2304 |
| 102 | Ga0070675_100133412 | 3300005354 | Bacteria | 2118 |
| 103 | Ga0070675_100138132 | 3300005354 | Bacteria | 2081 |
| 104 | Ga0070675_100250983 | 3300005354 | Bacteria | 1548 |
| 105 | Ga0070675_100292360 | 3300005354 | Bacteria | 1434 |
| 106 | Ga0070675_100741612 | 3300005354 | Bacteria | 896 |
| 107 | Ga0070671_100029574 | 3300005355 | Bacteria | 4517 |
| 108 | Ga0070671_100053645 | 3300005355 | Bacteria | 3351 |
| 109 | Ga0070671_100116246 | 3300005355 | Bacteria | 2249 |
| 110 | Ga0070674_100002220 | 3300005356 | Bacteria | 10679 |
| 111 | Ga0070673_100006656 | 3300005364 | Bacteria | 7534 |
| 112 | Ga0070673_100016732 | 3300005364 | Bacteria | 5194 |
| 113 | Ga0070673_100019294 | 3300005364 | Bacteria | 4894 |
| 114 | Ga0070673_100024297 | 3300005364 | Bacteria | 4441 |
| 115 | Ga0070673_100042547 | 3300005364 | Bacteria | 3503 |
| 116 | Ga0070673_100051203 | 3300005364 | Bacteria | 3232 |
| 117 | Ga0070673_100419848 | 3300005364 | Bacteria | 1199 |
| 118 | Ga0070673_100443434 | 3300005364 | Bacteria | 1167 |
| 119 | Ga0070688_100013545 | 3300005365 | Bacteria | 4603 |
| 120 | Ga0070688_100037093 | 3300005365 | Bacteria | 2969 |
| 121 | Ga0070688_100052736 | 3300005365 | Bacteria | 2542 |
| 122 | Ga0070688_100111398 | 3300005365 | Unclassified | 1821 |
| 123 | Ga0070688_100201536 | 3300005365 | Bacteria | 1392 |
| 124 | Ga0070659_100026473 | 3300005366 | Bacteria | 4463 |
| 125 | Ga0070659_100031231 | 3300005366 | Bacteria | 4125 |
| 126 | Ga0070659_100245588 | 3300005366 | Bacteria | 1482 |
| 127 | Ga0070667_100000248 | 3300005367 | Bacteria | 61183 |
| 128 | Ga0070667_100003905 | 3300005367 | Bacteria | 12660 |
| 129 | Ga0070667_100031740 | 3300005367 | Bacteria | 4403 |
| 130 | Ga0070667_100096997 | 3300005367 | Unclassified | 2543 |
| 131 | Ga0070667_100113769 | 3300005367 | Unclassified | 2349 |
| 132 | Ga0070667_100267577 | 3300005367 | Unclassified | 1532 |
| 133 | Ga0070667_100312033 | 3300005367 | Bacteria | 1418 |
| 134 | Ga0070700_100022637 | 3300005441 | Bacteria | 3668 |
| 135 | Ga0070678_100105608 | 3300005456 | Bacteria | 2193 |
| 136 | Ga0070678_100321889 | 3300005456 | Bacteria | 1321 |
| 137 | Ga0070662_100004870 | 3300005457 | Bacteria | 8518 |
| 138 | Ga0070662_100011898 | 3300005457 | Bacteria | 5752 |
| 139 | Ga0070662_100021120 | 3300005457 | Bacteria | 4443 |
| 140 | Ga0070662_100022782 | 3300005457 | Bacteria | 4293 |
| 141 | Ga0070681_10004039 | 3300005458 | Bacteria | 13846 |
| 142 | Ga0070681_10049604 | 3300005458 | Bacteria | 4191 |
| 143 | Ga0070681_10129083 | 3300005458 | Bacteria | 2460 |
| 144 | Ga0068867_100032795 | 3300005459 | Bacteria | 3758 |
| 145 | Ga0068867_100128708 | 3300005459 | Bacteria | 1965 |
| 146 | Ga0068867_100137671 | 3300005459 | Bacteria | 1905 |
| 147 | Ga0068867_100418364 | 3300005459 | Bacteria | 1135 |
| 148 | Ga0070685_10016702 | 3300005466 | Bacteria | 3915 |
| 149 | Ga0070685_10092079 | 3300005466 | Bacteria | 1836 |
| 150 | Ga0070698_100002802 | 3300005471 | Bacteria | 19186 |
| 151 | Ga0070698_100006186 | 3300005471 | Bacteria | 13034 |
| 152 | Ga0070698_100016568 | 3300005471 | Bacteria | 7777 |
| 153 | Ga0070699_100471264 | 3300005518 | Bacteria | 1139 |
| 154 | Ga0070679_100002167 | 3300005530 | Bacteria | 17712 |
| 155 | Ga0070679_100056240 | 3300005530 | Bacteria | 3920 |
| 156 | Ga0070684_100003339 | 3300005535 | Bacteria | 12014 |
| 157 | Ga0070684_100058514 | 3300005535 | Bacteria | 3368 |
| 158 | Ga0070684_100060911 | 3300005535 | Bacteria | 3302 |
| 159 | Ga0070684_100063429 | 3300005535 | Bacteria | 3239 |
| 160 | Ga0068853_100000250 | 3300005539 | Bacteria | 37737 |
| 161 | Ga0068853_100003318 | 3300005539 | Bacteria | 12319 |
| 162 | Ga0068853_100006139 | 3300005539 | Bacteria | 9517 |
| 163 | Ga0068853_100030359 | 3300005539 | Bacteria | 4565 |
| 164 | Ga0068853_100043755 | 3300005539 | Bacteria | 3831 |
| 165 | Ga0068853_100084468 | 3300005539 | Unclassified | 2782 |
| 166 | Ga0068853_100145967 | 3300005539 | Bacteria | 2126 |
| 167 | Ga0068853_100221844 | 3300005539 | Bacteria | 1727 |
| 168 | Ga0068853_100272722 | 3300005539 | Bacteria | 1558 |
| 169 | Ga0068853_100307260 | 3300005539 | Bacteria | 1467 |
| 170 | Ga0068853_100370851 | 3300005539 | Unclassified | 1335 |
| 171 | Ga0068853_100382177 | 3300005539 | Bacteria | 1315 |
| 172 | Ga0070672_100001565 | 3300005543 | Bacteria | 14168 |
| 173 | Ga0070693_100067745 | 3300005547 | Bacteria | 2093 |
| 174 | Ga0070665_100018617 | 3300005548 | Bacteria | 6960 |
| 175 | Ga0070665_100085759 | 3300005548 | Bacteria | 3155 |
| 176 | Ga0070704_100193181 | 3300005549 | Bacteria | 1638 |
| 177 | Ga0068855_100000133 | 3300005563 | Bacteria | 94906 |
| 178 | Ga0068855_100003486 | 3300005563 | Bacteria | 19264 |
| 179 | Ga0070664_100004058 | 3300005564 | Bacteria | 11762 |
| 180 | Ga0070664_100030677 | 3300005564 | Bacteria | 4487 |
| 181 | Ga0070664_100053226 | 3300005564 | Bacteria | 3431 |
| 182 | Ga0070664_100126731 | 3300005564 | Bacteria | 2240 |
| 183 | Ga0070664_100372022 | 3300005564 | Bacteria | 1303 |
| 184 | Ga0070664_100423727 | 3300005564 | Bacteria | 1219 |
| 185 | Ga0070664_100484441 | 3300005564 | Bacteria | 1138 |
| 186 | Ga0068857_100010012 | 3300005577 | Bacteria | 8231 |
| 187 | Ga0068857_100023615 | 3300005577 | Bacteria | 5414 |
| 188 | Ga0068857_100137417 | 3300005577 | Bacteria | 2207 |
| 189 | Ga0068857_100178481 | 3300005577 | Bacteria | 1932 |
| 190 | Ga0068857_100224023 | 3300005577 | Unclassified | 1718 |
| 191 | Ga0068857_100255602 | 3300005577 | Bacteria | 1607 |
| 192 | Ga0068854_100005730 | 3300005578 | Bacteria | 7853 |
| 193 | Ga0068854_100047179 | 3300005578 | Bacteria | 3069 |
| 194 | Ga0068854_100063403 | 3300005578 | Bacteria | 2683 |
| 195 | Ga0068854_100069838 | 3300005578 | Bacteria | 2566 |
| 196 | Ga0068856_100004245 | 3300005614 | Bacteria | 14307 |
| 197 | Ga0068856_100014967 | 3300005614 | Bacteria | 7492 |
| 198 | Ga0068856_100048124 | 3300005614 | Bacteria | 4201 |
| 199 | Ga0068856_100086534 | 3300005614 | Bacteria | 3114 |
| 200 | Ga0068852_100001400 | 3300005616 | Bacteria | 16228 |
| 201 | Ga0068852_100008317 | 3300005616 | Bacteria | 7636 |
| 202 | Ga0068852_100009108 | 3300005616 | Bacteria | 7349 |
| 203 | Ga0068852_100032096 | 3300005616 | Bacteria | 4344 |
| 204 | Ga0068852_100064916 | 3300005616 | Bacteria | 3184 |
| 205 | Ga0068852_100168770 | 3300005616 | Bacteria | 2049 |
| 206 | Ga0068852_100175248 | 3300005616 | Bacteria | 2013 |
| 207 | Ga0068852_100242383 | 3300005616 | Bacteria | 1724 |
| 208 | Ga0068852_100258940 | 3300005616 | Unclassified | 1670 |
| 209 | Ga0068852_100324612 | 3300005616 | Bacteria | 1496 |
| 210 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 211 | Ga0068859_100002491 | 3300005617 | Bacteria | 18742 |
| 212 | Ga0068859_100134497 | 3300005617 | Bacteria | 2544 |
| 213 | Ga0068859_100172495 | 3300005617 | Unclassified | 2244 |
| 214 | Ga0068859_100230504 | 3300005617 | Bacteria | 1940 |
| 215 | Ga0068859_101003427 | 3300005617 | Bacteria | 917 |
| 216 | Ga0068864_100012286 | 3300005618 | Bacteria | 7077 |
| 217 | Ga0068864_100015889 | 3300005618 | Bacteria | 6265 |
| 218 | Ga0068864_100018148 | 3300005618 | Bacteria | 5872 |
| 219 | Ga0068864_100053299 | 3300005618 | Bacteria | 3489 |
| 220 | Ga0068864_100082595 | 3300005618 | Bacteria | 2820 |
| 221 | Ga0068864_100096024 | 3300005618 | Bacteria | 2623 |
| 222 | Ga0068866_10143664 | 3300005718 | Bacteria | 1373 |
| 223 | Ga0068866_10212241 | 3300005718 | Unclassified | 1163 |
| 224 | Ga0068861_100010689 | 3300005719 | Bacteria | 6376 |
| 225 | Ga0068861_100130693 | 3300005719 | Bacteria | 2038 |
| 226 | Ga0068861_100161210 | 3300005719 | Bacteria | 1850 |
| 227 | Ga0068861_100315205 | 3300005719 | Bacteria | 1360 |
| 228 | Ga0068851_10026295 | 3300005834 | Bacteria | 2859 |
| 229 | Ga0068851_10075595 | 3300005834 | Bacteria | 1750 |
| 230 | Ga0068851_10124041 | 3300005834 | Bacteria | 1391 |
| 231 | Ga0068851_10150963 | 3300005834 | Bacteria | 1270 |
| 232 | Ga0068870_10006960 | 3300005840 | Bacteria | 5016 |
| 233 | Ga0068870_10029248 | 3300005840 | Bacteria | 2774 |
| 234 | Ga0068870_10044049 | 3300005840 | Bacteria | 2330 |
| 235 | Ga0068870_10221306 | 3300005840 | Bacteria | 1159 |
| 236 | Ga0068863_100001373 | 3300005841 | Bacteria | 24175 |
| 237 | Ga0068863_100004306 | 3300005841 | Bacteria | 14020 |
| 238 | Ga0068863_100038107 | 3300005841 | Bacteria | 4575 |
| 239 | Ga0068863_100051623 | 3300005841 | Bacteria | 3897 |
| 240 | Ga0068863_100062458 | 3300005841 | Bacteria | 3523 |
| 241 | Ga0068863_100160218 | 3300005841 | Bacteria | 2155 |
| 242 | Ga0068863_100400242 | 3300005841 | Unclassified | 1343 |
| 243 | Ga0068863_100578756 | 3300005841 | Bacteria | 1110 |
| 244 | Ga0068858_100071652 | 3300005842 | Bacteria | 3215 |
| 245 | Ga0068858_100516390 | 3300005842 | Bacteria | 1155 |
| 246 | Ga0068860_100000097 | 3300005843 | Bacteria | 146573 |
| 247 | Ga0068860_100004260 | 3300005843 | Bacteria | 14650 |
| 248 | Ga0068860_100006743 | 3300005843 | Bacteria | 11515 |
| 249 | Ga0068860_100008499 | 3300005843 | Bacteria | 10228 |
| 250 | Ga0068860_100019489 | 3300005843 | Bacteria | 6577 |
| 251 | Ga0068860_100022955 | 3300005843 | Bacteria | 6033 |
| 252 | Ga0068860_100319797 | 3300005843 | Bacteria | 1523 |
| 253 | Ga0068860_100857837 | 3300005843 | Bacteria | 923 |
| 254 | Ga0068862_100007901 | 3300005844 | Bacteria | 8802 |
| 255 | Ga0068862_100008890 | 3300005844 | Bacteria | 8317 |
| 256 | Ga0068862_100110622 | 3300005844 | Bacteria | 2411 |
| 257 | Ga0068862_100187982 | 3300005844 | Bacteria | 1857 |
| 258 | Ga0068862_100317394 | 3300005844 | Unclassified | 1437 |
| 259 | Ga0081539_10004959 | 3300005985 | Bacteria | 14110 |
| 260 | Ga0070716_100233610 | 3300006173 | Bacteria | 1243 |
| 261 | Ga0075366_10005546 | 3300006195 | Bacteria | 6839 |
| 262 | Ga0075366_10005748 | 3300006195 | Bacteria | 6733 |
| 263 | Ga0075366_10014280 | 3300006195 | Bacteria | 4535 |
| 264 | Ga0097621_100044821 | 3300006237 | Bacteria | 3570 |
| 265 | Ga0097621_100070259 | 3300006237 | Bacteria | 2891 |
| 266 | Ga0097621_100090377 | 3300006237 | Bacteria | 2562 |
| 267 | Ga0097621_100109305 | 3300006237 | Bacteria | 2335 |
| 268 | Ga0097621_100271363 | 3300006237 | Bacteria | 1491 |
| 269 | Ga0097621_100354670 | 3300006237 | Unclassified | 1305 |
| 270 | Ga0097621_100610755 | 3300006237 | Bacteria | 998 |
| 271 | Ga0068871_100004890 | 3300006358 | Bacteria | 9357 |
| 272 | Ga0068871_100015089 | 3300006358 | Bacteria | 5775 |
| 273 | Ga0068871_100024794 | 3300006358 | Bacteria | 4655 |
| 274 | Ga0068871_100044750 | 3300006358 | Bacteria | 3562 |
| 275 | Ga0068871_100087735 | 3300006358 | Unclassified | 2587 |
| 276 | Ga0068871_100133402 | 3300006358 | Unclassified | 2107 |
| 277 | Ga0075428_100081557 | 3300006844 | Bacteria | 3530 |
| 278 | Ga0075430_100011474 | 3300006846 | Bacteria | 7527 |
| 279 | Ga0075431_100022872 | 3300006847 | Bacteria | 6389 |
| 280 | Ga0075431_100152015 | 3300006847 | Unclassified | 2383 |
| 281 | Ga0075434_100374703 | 3300006871 | Bacteria | 1444 |
| 282 | Ga0075429_100007351 | 3300006880 | Bacteria | 9561 |
| 283 | Ga0075429_100079091 | 3300006880 | Bacteria | 2866 |
| 284 | Ga0068865_100003571 | 3300006881 | Bacteria | 9342 |
| 285 | Ga0068865_100046762 | 3300006881 | Bacteria | 2971 |
| 286 | Ga0068865_100229034 | 3300006881 | Bacteria | 1457 |
| 287 | Ga0068865_100352328 | 3300006881 | Bacteria | 1193 |
| 288 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 289 | Ga0097620_100002491 | 3300006931 | Bacteria | 18742 |
| 290 | Ga0097620_100134504 | 3300006931 | Bacteria | 2544 |
| 291 | Ga0097620_100172490 | 3300006931 | Unclassified | 2244 |
| 292 | Ga0097620_100230494 | 3300006931 | Bacteria | 1940 |
| 293 | Ga0097620_101003323 | 3300006931 | Bacteria | 917 |
| 294 | Ga0105251_10071058 | 3300009011 | Unclassified | 1620 |
| 295 | Ga0105240_10000398 | 3300009093 | Bacteria | 81045 |
| 296 | Ga0105240_10001595 | 3300009093 | Bacteria | 38516 |
| 297 | Ga0105240_10016926 | 3300009093 | Bacteria | 9853 |
| 298 | Ga0105240_10031869 | 3300009093 | Bacteria | 6830 |
| 299 | Ga0105240_10050768 | 3300009093 | Bacteria | 5226 |
| 300 | Ga0105240_10074719 | 3300009093 | Bacteria | 4182 |
| 301 | Ga0105240_10295321 | 3300009093 | Bacteria | 1856 |
| 302 | Ga0111539_10009984 | 3300009094 | Bacteria | 11968 |
| 303 | Ga0111539_10037511 | 3300009094 | Bacteria | 5851 |
| 304 | Ga0111539_10054054 | 3300009094 | Bacteria | 4779 |
| 305 | Ga0111539_10066150 | 3300009094 | Bacteria | 4269 |
| 306 | Ga0111539_10140184 | 3300009094 | Bacteria | 2831 |
| 307 | Ga0111539_10272888 | 3300009094 | Bacteria | 1968 |
| 308 | Ga0111539_10804181 | 3300009094 | Unclassified | 1094 |
| 309 | Ga0105245_10091135 | 3300009098 | Bacteria | 2805 |
| 310 | Ga0114129_10006463 | 3300009147 | Bacteria | 16621 |
| 311 | Ga0114129_10025561 | 3300009147 | Bacteria | 8366 |
| 312 | Ga0114129_10059189 | 3300009147 | Bacteria | 5356 |
| 313 | Ga0114129_10095068 | 3300009147 | Bacteria | 4127 |
| 314 | Ga0114129_11109264 | 3300009147 | Bacteria | 990 |
| 315 | Ga0105243_10118580 | 3300009148 | Bacteria | 2227 |
| 316 | Ga0105241_10000537 | 3300009174 | Bacteria | 28565 |
| 317 | Ga0105241_10000769 | 3300009174 | Bacteria | 24406 |
| 318 | Ga0105241_10004422 | 3300009174 | Bacteria | 10394 |
| 319 | Ga0105241_10029296 | 3300009174 | Bacteria | 4107 |
| 320 | Ga0105241_10076487 | 3300009174 | Unclassified | 2611 |
| 321 | Ga0105241_10135527 | 3300009174 | Bacteria | 1999 |
| 322 | Ga0105241_10271373 | 3300009174 | Bacteria | 1445 |
| 323 | Ga0105241_10273302 | 3300009174 | Bacteria | 1440 |
| 324 | Ga0105242_10059726 | 3300009176 | Bacteria | 3130 |
| 325 | Ga0105242_10083142 | 3300009176 | Bacteria | 2680 |
| 326 | Ga0105242_10105247 | 3300009176 | Unclassified | 2396 |
| 327 | Ga0105242_10143570 | 3300009176 | Bacteria | 2074 |
| 328 | Ga0105242_10289430 | 3300009176 | Bacteria | 1491 |
| 329 | Ga0105248_10092740 | 3300009177 | Bacteria | 3401 |
| 330 | Ga0105248_10104833 | 3300009177 | Bacteria | 3188 |
| 331 | Ga0105248_10182101 | 3300009177 | Bacteria | 2367 |
| 332 | Ga0105248_10308124 | 3300009177 | Bacteria | 1783 |
| 333 | Ga0105248_10488875 | 3300009177 | Unclassified | 1387 |
| 334 | Ga0105248_11012099 | 3300009177 | Bacteria | 939 |
| 335 | Ga0105237_10001588 | 3300009545 | Bacteria | 29579 |
| 336 | Ga0105237_10001799 | 3300009545 | Bacteria | 27692 |
| 337 | Ga0105237_10002614 | 3300009545 | Bacteria | 22176 |
| 338 | Ga0105237_10007892 | 3300009545 | Bacteria | 11597 |
| 339 | Ga0105237_10037741 | 3300009545 | Bacteria | 4882 |
| 340 | Ga0105237_10384591 | 3300009545 | Unclassified | 1408 |
| 341 | Ga0105238_10008067 | 3300009551 | Bacteria | 10530 |
| 342 | Ga0105238_10051614 | 3300009551 | Bacteria | 4136 |
| 343 | Ga0105238_10111019 | 3300009551 | Bacteria | 2722 |
| 344 | Ga0105238_10130087 | 3300009551 | Unclassified | 2495 |
| 345 | Ga0105238_10341939 | 3300009551 | Bacteria | 1485 |
| 346 | Ga0105238_10522541 | 3300009551 | Bacteria | 1189 |
| 347 | Ga0105249_10009374 | 3300009553 | Bacteria | 8565 |
| 348 | Ga0105249_10029286 | 3300009553 | Bacteria | 4972 |
| 349 | Ga0105249_10042127 | 3300009553 | Bacteria | 4151 |
| 350 | Ga0105249_10050930 | 3300009553 | Bacteria | 3776 |
| 351 | Ga0105249_10101172 | 3300009553 | Bacteria | 2710 |
| 352 | Ga0105249_10474095 | 3300009553 | Bacteria | 1293 |
| 353 | Ga0105239_10000436 | 3300010375 | Bacteria | 61031 |
| 354 | Ga0105239_10002246 | 3300010375 | Bacteria | 24694 |
| 355 | Ga0105239_10009301 | 3300010375 | Bacteria | 11107 |
| 356 | Ga0105239_10010718 | 3300010375 | Bacteria | 10239 |
| 357 | Ga0105239_10045244 | 3300010375 | Bacteria | 4824 |
| 358 | Ga0105239_10063312 | 3300010375 | Bacteria | 4061 |
| 359 | Ga0105239_10131025 | 3300010375 | Bacteria | 2789 |
| 360 | Ga0105239_10933445 | 3300010375 | Bacteria | 996 |
| 361 | Ga0105239_11010697 | 3300010375 | Bacteria | 956 |
| 362 | Ga0105246_10098378 | 3300011119 | Bacteria | 2125 |
| 363 | Ga0105246_10272180 | 3300011119 | Bacteria | 1354 |
| 364 | Ga0157373_10000127 | 3300013100 | Bacteria | 59397 |
| 365 | Ga0157373_10016509 | 3300013100 | Bacteria | 5384 |
| 366 | Ga0157373_10017789 | 3300013100 | Bacteria | 5175 |
| 367 | Ga0157373_10023280 | 3300013100 | Bacteria | 4492 |
| 368 | Ga0157373_10052762 | 3300013100 | Bacteria | 2892 |
| 369 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 370 | Ga0157371_10001161 | 3300013102 | Bacteria | 28350 |
| 371 | Ga0157371_10020069 | 3300013102 | Bacteria | 4921 |
| 372 | Ga0157371_10038115 | 3300013102 | Bacteria | 3439 |
| 373 | Ga0157371_10049377 | 3300013102 | Bacteria | 2989 |
| 374 | Ga0157371_10079931 | 3300013102 | Bacteria | 2315 |
| 375 | Ga0157371_10105007 | 3300013102 | Bacteria | 2004 |
| 376 | Ga0157371_10107026 | 3300013102 | Bacteria | 1984 |
| 377 | Ga0157371_10223539 | 3300013102 | Bacteria | 1352 |
| 378 | Ga0157371_10241886 | 3300013102 | Unclassified | 1298 |
| 379 | Ga0157370_10001172 | 3300013104 | Bacteria | 32684 |
| 380 | Ga0157370_10002300 | 3300013104 | Bacteria | 23142 |
| 381 | Ga0157370_10019212 | 3300013104 | Bacteria | 6863 |
| 382 | Ga0157370_10021508 | 3300013104 | Bacteria | 6428 |
| 383 | Ga0157370_10034319 | 3300013104 | Bacteria | 4942 |
| 384 | Ga0157370_10063717 | 3300013104 | Bacteria | 3491 |
| 385 | Ga0157370_10076387 | 3300013104 | Bacteria | 3155 |
| 386 | Ga0157370_10174610 | 3300013104 | Bacteria | 1997 |
| 387 | Ga0157370_10226086 | 3300013104 | Bacteria | 1732 |
| 388 | Ga0157370_10235449 | 3300013104 | Bacteria | 1694 |
| 389 | Ga0157369_10000006 | 3300013105 | Bacteria | 412230 |
| 390 | Ga0157369_10033658 | 3300013105 | Bacteria | 5630 |
| 391 | Ga0157369_10035022 | 3300013105 | Bacteria | 5506 |
| 392 | Ga0157369_10035205 | 3300013105 | Bacteria | 5491 |
| 393 | Ga0157369_10122279 | 3300013105 | Bacteria | 2761 |
| 394 | Ga0157369_10176508 | 3300013105 | Bacteria | 2249 |
| 395 | Ga0157369_10243984 | 3300013105 | Bacteria | 1876 |
| 396 | Ga0157369_10343900 | 3300013105 | Bacteria | 1549 |
| 397 | Ga0157369_10670862 | 3300013105 | Unclassified | 1068 |
| 398 | Ga0157369_11020687 | 3300013105 | Unclassified | 847 |
| 399 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 400 | Ga0157374_10000500 | 3300013296 | Bacteria | 35513 |
| 401 | Ga0157374_10005963 | 3300013296 | Bacteria | 10306 |
| 402 | Ga0157374_10007705 | 3300013296 | Bacteria | 9193 |
| 403 | Ga0157374_10028847 | 3300013296 | Bacteria | 5017 |
| 404 | Ga0157374_10039891 | 3300013296 | Bacteria | 4323 |
| 405 | Ga0157374_10089069 | 3300013296 | Bacteria | 2940 |
| 406 | Ga0157374_10182509 | 3300013296 | Bacteria | 2050 |
| 407 | Ga0157374_10227752 | 3300013296 | Bacteria | 1830 |
| 408 | Ga0157374_10467323 | 3300013296 | Bacteria | 1264 |
| 409 | Ga0157374_10500423 | 3300013296 | Unclassified | 1220 |
| 410 | Ga0157378_10005638 | 3300013297 | Bacteria | 10969 |
| 411 | Ga0157378_10015524 | 3300013297 | Bacteria | 6672 |
| 412 | Ga0157378_10033932 | 3300013297 | Bacteria | 4514 |
| 413 | Ga0157378_10047605 | 3300013297 | Bacteria | 3812 |
| 414 | Ga0157378_10109236 | 3300013297 | Bacteria | 2533 |
| 415 | Ga0157378_10130335 | 3300013297 | Bacteria | 2327 |
| 416 | Ga0157378_10132689 | 3300013297 | Bacteria | 2307 |
| 417 | Ga0157378_10347359 | 3300013297 | Unclassified | 1448 |
| 418 | Ga0157378_10431856 | 3300013297 | Bacteria | 1304 |
| 419 | Ga0157378_10553984 | 3300013297 | Bacteria | 1155 |
| 420 | Ga0157378_10621602 | 3300013297 | Bacteria | 1093 |
| 421 | Ga0157378_10714107 | 3300013297 | Bacteria | 1023 |
| 422 | Ga0157378_10780236 | 3300013297 | Bacteria | 980 |
| 423 | Ga0163162_10000304 | 3300013306 | Bacteria | 45418 |
| 424 | Ga0163162_10000773 | 3300013306 | Bacteria | 29793 |
| 425 | Ga0163162_10001942 | 3300013306 | Bacteria | 19416 |
| 426 | Ga0163162_10004755 | 3300013306 | Bacteria | 13101 |
| 427 | Ga0163162_10007765 | 3300013306 | Bacteria | 10452 |
| 428 | Ga0163162_10022131 | 3300013306 | Bacteria | 6265 |
| 429 | Ga0163162_10039131 | 3300013306 | Bacteria | 4737 |
| 430 | Ga0163162_10085604 | 3300013306 | Bacteria | 3229 |
| 431 | Ga0163162_10232155 | 3300013306 | Bacteria | 1975 |
| 432 | Ga0163162_10296919 | 3300013306 | Bacteria | 1747 |
| 433 | Ga0163162_10448100 | 3300013306 | Bacteria | 1423 |
| 434 | Ga0163162_10577451 | 3300013306 | Bacteria | 1251 |
| 435 | Ga0157372_10000288 | 3300013307 | Bacteria | 56031 |
| 436 | Ga0157372_10003109 | 3300013307 | Bacteria | 17892 |
| 437 | Ga0157372_10005863 | 3300013307 | Bacteria | 13076 |
| 438 | Ga0157372_10059984 | 3300013307 | Bacteria | 4257 |
| 439 | Ga0157372_10065955 | 3300013307 | Bacteria | 4067 |
| 440 | Ga0157372_10089440 | 3300013307 | Bacteria | 3498 |
| 441 | Ga0157372_10116600 | 3300013307 | Unclassified | 3062 |
| 442 | Ga0157372_10135723 | 3300013307 | Bacteria | 2833 |
| 443 | Ga0157372_10153024 | 3300013307 | Bacteria | 2663 |
| 444 | Ga0157372_10180194 | 3300013307 | Bacteria | 2445 |
| 445 | Ga0157372_10226918 | 3300013307 | Bacteria | 2165 |
| 446 | Ga0157372_10234025 | 3300013307 | Bacteria | 2130 |
| 447 | Ga0157372_10282954 | 3300013307 | Bacteria | 1928 |
| 448 | Ga0157372_10296782 | 3300013307 | Bacteria | 1880 |
| 449 | Ga0157372_10330905 | 3300013307 | Bacteria | 1774 |
| 450 | Ga0157372_10403033 | 3300013307 | Bacteria | 1594 |
| 451 | Ga0157372_10556396 | 3300013307 | Bacteria | 1337 |
| 452 | Ga0157372_10591157 | 3300013307 | Bacteria | 1294 |
| 453 | Ga0157372_10632401 | 3300013307 | Bacteria | 1247 |
| 454 | Ga0157372_10705761 | 3300013307 | Bacteria | 1174 |
| 455 | Ga0157372_10761483 | 3300013307 | Unclassified | 1126 |
| 456 | Ga0157375_10001463 | 3300013308 | Bacteria | 20315 |
| 457 | Ga0157375_10029615 | 3300013308 | Bacteria | 5152 |
| 458 | Ga0157375_10053872 | 3300013308 | Bacteria | 3960 |
| 459 | Ga0157375_10059597 | 3300013308 | Bacteria | 3783 |
| 460 | Ga0157375_10074000 | 3300013308 | Bacteria | 3427 |
| 461 | Ga0157375_10204555 | 3300013308 | Bacteria | 2130 |
| 462 | Ga0157375_10206183 | 3300013308 | Unclassified | 2122 |
| 463 | Ga0157375_10666578 | 3300013308 | Bacteria | 1196 |
| 464 | Ga0163163_10001732 | 3300014325 | Bacteria | 18387 |
| 465 | Ga0163163_10003543 | 3300014325 | Bacteria | 13261 |
| 466 | Ga0163163_10018795 | 3300014325 | Bacteria | 6479 |
| 467 | Ga0163163_10055223 | 3300014325 | Bacteria | 3926 |
| 468 | Ga0163163_10071221 | 3300014325 | Bacteria | 3464 |
| 469 | Ga0163163_10072197 | 3300014325 | Bacteria | 3440 |
| 470 | Ga0163163_10091809 | 3300014325 | Bacteria | 3051 |
| 471 | Ga0163163_10139867 | 3300014325 | Bacteria | 2463 |
| 472 | Ga0163163_10368163 | 3300014325 | Unclassified | 1494 |
| 473 | Ga0163163_10432803 | 3300014325 | Bacteria | 1375 |
| 474 | Ga0163163_10478120 | 3300014325 | Unclassified | 1307 |
| 475 | Ga0157380_10001083 | 3300014326 | Bacteria | 17500 |
| 476 | Ga0157380_10004590 | 3300014326 | Bacteria | 9590 |
| 477 | Ga0157380_10016648 | 3300014326 | Bacteria | 5428 |
| 478 | Ga0157380_10141439 | 3300014326 | Unclassified | 2068 |
| 479 | Ga0157380_10338490 | 3300014326 | Bacteria | 1402 |
| 480 | Ga0182008_10000874 | 3300014497 | Bacteria | 20921 |
| 481 | Ga0157377_10004045 | 3300014745 | Bacteria | 6691 |
| 482 | Ga0157377_10016138 | 3300014745 | Bacteria | 3837 |
| 483 | Ga0157377_10060402 | 3300014745 | Bacteria | 2164 |
| 484 | Ga0157377_10078560 | 3300014745 | Bacteria | 1924 |
| 485 | Ga0157377_10133521 | 3300014745 | Bacteria | 1519 |
| 486 | Ga0157377_10240954 | 3300014745 | Bacteria | 1167 |
| 487 | Ga0157379_10000845 | 3300014968 | Bacteria | 24814 |
| 488 | Ga0157379_10031135 | 3300014968 | Bacteria | 4752 |
| 489 | Ga0157379_10076794 | 3300014968 | Bacteria | 2991 |
| 490 | Ga0157379_10101588 | 3300014968 | Bacteria | 2581 |
| 491 | Ga0157379_10148396 | 3300014968 | Bacteria | 2115 |
| 492 | Ga0157379_10148786 | 3300014968 | Bacteria | 2112 |
| 493 | Ga0157379_10182711 | 3300014968 | Bacteria | 1895 |
| 494 | Ga0157379_10244614 | 3300014968 | Unclassified | 1627 |
| 495 | Ga0157379_10245116 | 3300014968 | Bacteria | 1626 |
| 496 | Ga0157379_10445793 | 3300014968 | Unclassified | 1194 |
| 497 | Ga0157376_10007592 | 3300014969 | Bacteria | 7760 |
| 498 | Ga0157376_10016450 | 3300014969 | Bacteria | 5616 |
| 499 | Ga0157376_10043042 | 3300014969 | Bacteria | 3704 |
| 500 | Ga0157376_10062316 | 3300014969 | Bacteria | 3138 |
| 501 | Ga0157376_10067706 | 3300014969 | Bacteria | 3021 |
| 502 | Ga0157376_10090037 | 3300014969 | Bacteria | 2654 |
| 503 | Ga0157376_10174534 | 3300014969 | Unclassified | 1960 |
| 504 | Ga0157376_10891064 | 3300014969 | Bacteria | 907 |
| 505 | Ga0182006_1000113 | 3300015261 | Bacteria | 86691 |
| 506 | Ga0182006_1000321 | 3300015261 | Bacteria | 41748 |
| 507 | Ga0182006_1006032 | 3300015261 | Bacteria | 5673 |
| 508 | Ga0182007_10000122 | 3300015262 | Bacteria | 54069 |
| 509 | Ga0183373_1006 | 3300015682 | Bacteria | 328276 |
| 510 | Ga0163161_10000089 | 3300017792 | Bacteria | 91093 |
| 511 | Ga0163161_10000218 | 3300017792 | Bacteria | 52323 |
| 512 | Ga0163161_10005594 | 3300017792 | Bacteria | 8712 |
| 513 | Ga0163161_10018758 | 3300017792 | Bacteria | 4849 |
| 514 | Ga0163161_10048358 | 3300017792 | Bacteria | 3071 |
| 515 | Ga0163161_10159294 | 3300017792 | Bacteria | 1721 |
| 516 | Ga0163161_10343880 | 3300017792 | Bacteria | 1184 |
| 517 | Ga0206356_10247902 | 3300020070 | Bacteria | 1542 |
| 518 | Ga0206352_11110991 | 3300020078 | Bacteria | 4162 |
| 519 | Ga0213876_10005132 | 3300021384 | Bacteria | 7223 |
| 520 | Ga0213876_10017527 | 3300021384 | Bacteria | 3781 |
| 521 | Ga0209258_100311 | 3300025242 | Bacteria | 76151 |
| 522 | Ga0209148_1000163 | 3300025254 | Bacteria | 137449 |
| 523 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 524 | Ga0209758_1043894 | 3300025297 | Bacteria | 1641 |
| 525 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 526 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 527 | Ga0207426_1056957 | 3300025302 | Bacteria | 1139 |
| 528 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 529 | Ga0207697_10040801 | 3300025315 | Bacteria | 1905 |
| 530 | Ga0207656_10013283 | 3300025321 | Bacteria | 3144 |
| 531 | Ga0207656_10079251 | 3300025321 | Bacteria | 1473 |
| 532 | Ga0207656_10144952 | 3300025321 | Unclassified | 1121 |
| 533 | Ga0207682_10120470 | 3300025893 | Bacteria | 1163 |
| 534 | Ga0207642_10067045 | 3300025899 | Bacteria | 1693 |
| 535 | Ga0207680_10000549 | 3300025903 | Bacteria | 17807 |
| 536 | Ga0207680_10000957 | 3300025903 | Bacteria | 13597 |
| 537 | Ga0207680_10020420 | 3300025903 | Unclassified | 3565 |
| 538 | Ga0207680_10036377 | 3300025903 | Bacteria | 2835 |
| 539 | Ga0207680_10176152 | 3300025903 | Bacteria | 1443 |
| 540 | Ga0207680_10198388 | 3300025903 | Bacteria | 1366 |
| 541 | Ga0207647_10000408 | 3300025904 | Bacteria | 35295 |
| 542 | Ga0207647_10018030 | 3300025904 | Unclassified | 4786 |
| 543 | Ga0207647_10030877 | 3300025904 | Unclassified | 3453 |
| 544 | Ga0207685_10036374 | 3300025905 | Bacteria | 1805 |
| 545 | Ga0207645_10003925 | 3300025907 | Bacteria | 11107 |
| 546 | Ga0207645_10018887 | 3300025907 | Bacteria | 4528 |
| 547 | Ga0207643_10003731 | 3300025908 | Bacteria | 8185 |
| 548 | Ga0207643_10008110 | 3300025908 | Bacteria | 5636 |
| 549 | Ga0207643_10044031 | 3300025908 | Unclassified | 2519 |
| 550 | Ga0207643_10245245 | 3300025908 | Bacteria | 1102 |
| 551 | Ga0207705_10006233 | 3300025909 | Bacteria | 8858 |
| 552 | Ga0207705_10035858 | 3300025909 | Bacteria | 3549 |
| 553 | Ga0207705_10217672 | 3300025909 | Unclassified | 1450 |
| 554 | Ga0207705_10257896 | 3300025909 | Bacteria | 1331 |
| 555 | Ga0207654_10002504 | 3300025911 | Bacteria | 9335 |
| 556 | Ga0207654_10005425 | 3300025911 | Bacteria | 6450 |
| 557 | Ga0207654_10014402 | 3300025911 | Bacteria | 4086 |
| 558 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 559 | Ga0207707_10028949 | 3300025912 | Bacteria | 4841 |
| 560 | Ga0207707_10166862 | 3300025912 | Bacteria | 1924 |
| 561 | Ga0207707_10356091 | 3300025912 | Bacteria | 1261 |
| 562 | Ga0207695_10000076 | 3300025913 | Bacteria | 307969 |
| 563 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 564 | Ga0207695_10000090 | 3300025913 | Bacteria | 272143 |
| 565 | Ga0207695_10003768 | 3300025913 | Bacteria | 21047 |
| 566 | Ga0207695_10009751 | 3300025913 | Bacteria | 11818 |
| 567 | Ga0207695_10025986 | 3300025913 | Bacteria | 6543 |
| 568 | Ga0207695_10039855 | 3300025913 | Bacteria | 5045 |
| 569 | Ga0207695_10072177 | 3300025913 | Bacteria | 3524 |
| 570 | Ga0207671_10001737 | 3300025914 | Bacteria | 24547 |
| 571 | Ga0207671_10002536 | 3300025914 | Bacteria | 19453 |
| 572 | Ga0207671_10003750 | 3300025914 | Bacteria | 14958 |
| 573 | Ga0207671_10015105 | 3300025914 | Bacteria | 6068 |
| 574 | Ga0207671_10219998 | 3300025914 | Unclassified | 1487 |
| 575 | Ga0207660_10008132 | 3300025917 | Bacteria | 6786 |
| 576 | Ga0207662_10426410 | 3300025918 | Bacteria | 903 |
| 577 | Ga0207657_10015740 | 3300025919 | Bacteria | 7314 |
| 578 | Ga0207649_10022827 | 3300025920 | Bacteria | 3616 |
| 579 | Ga0207649_10028571 | 3300025920 | Bacteria | 3284 |
| 580 | Ga0207649_10172387 | 3300025920 | Bacteria | 1508 |
| 581 | Ga0207652_10008635 | 3300025921 | Bacteria | 8199 |
| 582 | Ga0207652_10251572 | 3300025921 | Bacteria | 1593 |
| 583 | Ga0207681_10016068 | 3300025923 | Bacteria | 4675 |
| 584 | Ga0207681_10070088 | 3300025923 | Bacteria | 2441 |
| 585 | Ga0207681_10333529 | 3300025923 | Bacteria | 1210 |
| 586 | Ga0207694_10045720 | 3300025924 | Bacteria | 3382 |
| 587 | Ga0207694_10086839 | 3300025924 | Bacteria | 2463 |
| 588 | Ga0207694_10143076 | 3300025924 | Bacteria | 1924 |
| 589 | Ga0207694_10281860 | 3300025924 | Bacteria | 1365 |
| 590 | Ga0207650_10031890 | 3300025925 | Bacteria | 3809 |
| 591 | Ga0207650_10043633 | 3300025925 | Bacteria | 3292 |
| 592 | Ga0207650_10080435 | 3300025925 | Bacteria | 2470 |
| 593 | Ga0207650_10131371 | 3300025925 | Bacteria | 1959 |
| 594 | Ga0207650_10158597 | 3300025925 | Unclassified | 1791 |
| 595 | Ga0207650_10225661 | 3300025925 | Bacteria | 1509 |
| 596 | Ga0207659_10028675 | 3300025926 | Bacteria | 3785 |
| 597 | Ga0207659_10096785 | 3300025926 | Bacteria | 2216 |
| 598 | Ga0207659_10107339 | 3300025926 | Bacteria | 2116 |
| 599 | Ga0207659_10157027 | 3300025926 | Bacteria | 1782 |
| 600 | Ga0207659_10282086 | 3300025926 | Bacteria | 1358 |
| 601 | Ga0207659_10362485 | 3300025926 | Bacteria | 1205 |
| 602 | Ga0207659_10475067 | 3300025926 | Bacteria | 1056 |
| 603 | Ga0207687_10149957 | 3300025927 | Bacteria | 1778 |
| 604 | Ga0207644_10092279 | 3300025931 | Bacteria | 2259 |
| 605 | Ga0207644_10188833 | 3300025931 | Bacteria | 1619 |
| 606 | Ga0207644_10292607 | 3300025931 | Bacteria | 1310 |
| 607 | Ga0207644_10535585 | 3300025931 | Bacteria | 968 |
| 608 | Ga0207690_10018477 | 3300025932 | Bacteria | 4275 |
| 609 | Ga0207690_10238817 | 3300025932 | Unclassified | 1399 |
| 610 | Ga0207690_10402467 | 3300025932 | Bacteria | 1092 |
| 611 | Ga0207706_10006356 | 3300025933 | Bacteria | 10978 |
| 612 | Ga0207706_10014853 | 3300025933 | Bacteria | 7051 |
| 613 | Ga0207706_10026565 | 3300025933 | Bacteria | 5181 |
| 614 | Ga0207706_10045674 | 3300025933 | Bacteria | 3880 |
| 615 | Ga0207706_10065864 | 3300025933 | Bacteria | 3189 |
| 616 | Ga0207706_10352759 | 3300025933 | Bacteria | 1279 |
| 617 | Ga0207686_10014467 | 3300025934 | Bacteria | 4394 |
| 618 | Ga0207686_10060441 | 3300025934 | Bacteria | 2399 |
| 619 | Ga0207686_10105841 | 3300025934 | Bacteria | 1887 |
| 620 | Ga0207686_10137709 | 3300025934 | Unclassified | 1683 |
| 621 | Ga0207686_10186980 | 3300025934 | Unclassified | 1473 |
| 622 | Ga0207686_10461705 | 3300025934 | Unclassified | 979 |
| 623 | Ga0207670_10033019 | 3300025936 | Bacteria | 3332 |
| 624 | Ga0207670_10060645 | 3300025936 | Bacteria | 2578 |
| 625 | Ga0207670_10085704 | 3300025936 | Unclassified | 2214 |
| 626 | Ga0207670_10094592 | 3300025936 | Bacteria | 2120 |
| 627 | Ga0207669_10145645 | 3300025937 | Unclassified | 1651 |
| 628 | Ga0207704_10062204 | 3300025938 | Bacteria | 2320 |
| 629 | Ga0207704_10113506 | 3300025938 | Unclassified | 1837 |
| 630 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 631 | Ga0207691_10002741 | 3300025940 | Bacteria | 17182 |
| 632 | Ga0207691_10329902 | 3300025940 | Bacteria | 1307 |
| 633 | Ga0207711_10267904 | 3300025941 | Bacteria | 1571 |
| 634 | Ga0207711_10461652 | 3300025941 | Bacteria | 1182 |
| 635 | Ga0207689_10005940 | 3300025942 | Bacteria | 10808 |
| 636 | Ga0207689_10006806 | 3300025942 | Bacteria | 10058 |
| 637 | Ga0207689_10007410 | 3300025942 | Bacteria | 9621 |
| 638 | Ga0207689_10008752 | 3300025942 | Bacteria | 8802 |
| 639 | Ga0207689_10011365 | 3300025942 | Bacteria | 7633 |
| 640 | Ga0207689_10013953 | 3300025942 | Bacteria | 6843 |
| 641 | Ga0207689_10016323 | 3300025942 | Bacteria | 6289 |
| 642 | Ga0207689_10063505 | 3300025942 | Unclassified | 3038 |
| 643 | Ga0207689_10092895 | 3300025942 | Unclassified | 2479 |
| 644 | Ga0207689_10263759 | 3300025942 | Unclassified | 1425 |
| 645 | Ga0207661_10021833 | 3300025944 | Bacteria | 4804 |
| 646 | Ga0207661_10060351 | 3300025944 | Unclassified | 3059 |
| 647 | Ga0207661_10126442 | 3300025944 | Bacteria | 2184 |
| 648 | Ga0207661_10320475 | 3300025944 | Unclassified | 1393 |
| 649 | Ga0207661_10491821 | 3300025944 | Bacteria | 1120 |
| 650 | Ga0207661_10642799 | 3300025944 | Bacteria | 975 |
| 651 | Ga0207679_10016136 | 3300025945 | Bacteria | 4954 |
| 652 | Ga0207679_10021807 | 3300025945 | Bacteria | 4350 |
| 653 | Ga0207679_10033718 | 3300025945 | Bacteria | 3605 |
| 654 | Ga0207679_10038027 | 3300025945 | Bacteria | 3426 |
| 655 | Ga0207679_10281556 | 3300025945 | Bacteria | 1426 |
| 656 | Ga0207679_10390783 | 3300025945 | Bacteria | 1222 |
| 657 | Ga0207667_10000453 | 3300025949 | Bacteria | 54929 |
| 658 | Ga0207667_10033746 | 3300025949 | Bacteria | 5500 |
| 659 | Ga0207667_10063294 | 3300025949 | Bacteria | 3865 |
| 660 | Ga0207667_10118422 | 3300025949 | Bacteria | 2729 |
| 661 | Ga0207651_10014865 | 3300025960 | Bacteria | 4507 |
| 662 | Ga0207651_10022746 | 3300025960 | Bacteria | 3841 |
| 663 | Ga0207651_10030229 | 3300025960 | Bacteria | 3446 |
| 664 | Ga0207651_10031501 | 3300025960 | Bacteria | 3391 |
| 665 | Ga0207651_10033814 | 3300025960 | Bacteria | 3302 |
| 666 | Ga0207651_10036594 | 3300025960 | Unclassified | 3206 |
| 667 | Ga0207651_10054997 | 3300025960 | Bacteria | 2731 |
| 668 | Ga0207651_10084792 | 3300025960 | Bacteria | 2296 |
| 669 | Ga0207651_10120053 | 3300025960 | Bacteria | 1992 |
| 670 | Ga0207651_10199934 | 3300025960 | Bacteria | 1601 |
| 671 | Ga0207712_10023997 | 3300025961 | Bacteria | 4032 |
| 672 | Ga0207712_10037794 | 3300025961 | Bacteria | 3296 |
| 673 | Ga0207712_10042125 | 3300025961 | Unclassified | 3142 |
| 674 | Ga0207712_10048392 | 3300025961 | Bacteria | 2957 |
| 675 | Ga0207712_10054866 | 3300025961 | Bacteria | 2800 |
| 676 | Ga0207712_10137405 | 3300025961 | Bacteria | 1871 |
| 677 | Ga0207668_10000869 | 3300025972 | Bacteria | 18234 |
| 678 | Ga0207668_10091974 | 3300025972 | Bacteria | 2231 |
| 679 | Ga0207668_10164368 | 3300025972 | Bacteria | 1733 |
| 680 | Ga0207668_10225935 | 3300025972 | Bacteria | 1506 |
| 681 | Ga0207640_10022058 | 3300025981 | Bacteria | 3805 |
| 682 | Ga0207640_10077085 | 3300025981 | Bacteria | 2265 |
| 683 | Ga0207658_10002877 | 3300025986 | Bacteria | 12335 |
| 684 | Ga0207658_10020539 | 3300025986 | Bacteria | 4573 |
| 685 | Ga0207658_10020590 | 3300025986 | Bacteria | 4567 |
| 686 | Ga0207658_10039811 | 3300025986 | Bacteria | 3393 |
| 687 | Ga0207658_10052257 | 3300025986 | Bacteria | 3015 |
| 688 | Ga0207658_10058281 | 3300025986 | Bacteria | 2873 |
| 689 | Ga0207658_10150083 | 3300025986 | Bacteria | 1898 |
| 690 | Ga0207658_10163679 | 3300025986 | Unclassified | 1825 |
| 691 | Ga0207677_10050769 | 3300026023 | Bacteria | 2807 |
| 692 | Ga0207677_10080481 | 3300026023 | Bacteria | 2334 |
| 693 | Ga0207677_10097811 | 3300026023 | Bacteria | 2151 |
| 694 | Ga0207677_10345930 | 3300026023 | Bacteria | 1244 |
| 695 | Ga0207703_10004088 | 3300026035 | Bacteria | 12037 |
| 696 | Ga0207703_10022141 | 3300026035 | Bacteria | 4981 |
| 697 | Ga0207703_10051716 | 3300026035 | Bacteria | 3331 |
| 698 | Ga0207703_10661373 | 3300026035 | Unclassified | 991 |
| 699 | Ga0207639_10002238 | 3300026041 | Bacteria | 13008 |
| 700 | Ga0207639_10047581 | 3300026041 | Bacteria | 3242 |
| 701 | Ga0207639_10105075 | 3300026041 | Bacteria | 2290 |
| 702 | Ga0207639_10144591 | 3300026041 | Bacteria | 1985 |
| 703 | Ga0207639_10196012 | 3300026041 | Bacteria | 1729 |
| 704 | Ga0207639_10243757 | 3300026041 | Bacteria | 1564 |
| 705 | Ga0207639_10247394 | 3300026041 | Bacteria | 1553 |
| 706 | Ga0207639_10263551 | 3300026041 | Bacteria | 1508 |
| 707 | Ga0207639_10324443 | 3300026041 | Unclassified | 1368 |
| 708 | Ga0207639_10329494 | 3300026041 | Unclassified | 1358 |
| 709 | Ga0207639_10421351 | 3300026041 | Bacteria | 1207 |
| 710 | Ga0207678_10019197 | 3300026067 | Bacteria | 6002 |
| 711 | Ga0207708_10039000 | 3300026075 | Bacteria | 3619 |
| 712 | Ga0207708_10048195 | 3300026075 | Bacteria | 3243 |
| 713 | Ga0207702_10026997 | 3300026078 | Bacteria | 4768 |
| 714 | Ga0207702_10114466 | 3300026078 | Unclassified | 2404 |
| 715 | Ga0207641_10000121 | 3300026088 | Bacteria | 114943 |
| 716 | Ga0207641_10010823 | 3300026088 | Bacteria | 7474 |
| 717 | Ga0207641_10013957 | 3300026088 | Bacteria | 6586 |
| 718 | Ga0207641_10019401 | 3300026088 | Bacteria | 5581 |
| 719 | Ga0207641_10119627 | 3300026088 | Bacteria | 2348 |
| 720 | Ga0207641_10394484 | 3300026088 | Unclassified | 1328 |
| 721 | Ga0207648_10002625 | 3300026089 | Bacteria | 19241 |
| 722 | Ga0207648_10013430 | 3300026089 | Bacteria | 7622 |
| 723 | Ga0207648_10016514 | 3300026089 | Bacteria | 6742 |
| 724 | Ga0207648_10027371 | 3300026089 | Bacteria | 5061 |
| 725 | Ga0207648_10144627 | 3300026089 | Bacteria | 2097 |
| 726 | Ga0207648_10200755 | 3300026089 | Bacteria | 1768 |
| 727 | Ga0207648_10337183 | 3300026089 | Bacteria | 1357 |
| 728 | Ga0207648_10463175 | 3300026089 | Unclassified | 1156 |
| 729 | Ga0207676_10038439 | 3300026095 | Bacteria | 3653 |
| 730 | Ga0207676_10055443 | 3300026095 | Bacteria | 3111 |
| 731 | Ga0207676_10070734 | 3300026095 | Bacteria | 2799 |
| 732 | Ga0207676_10078366 | 3300026095 | Unclassified | 2676 |
| 733 | Ga0207676_10475099 | 3300026095 | Bacteria | 1183 |
| 734 | Ga0207674_10005332 | 3300026116 | Bacteria | 15297 |
| 735 | Ga0207674_10007100 | 3300026116 | Bacteria | 13087 |
| 736 | Ga0207674_10015613 | 3300026116 | Bacteria | 8336 |
| 737 | Ga0207674_10051135 | 3300026116 | Bacteria | 4217 |
| 738 | Ga0207674_10236693 | 3300026116 | Bacteria | 1773 |
| 739 | Ga0207674_10330493 | 3300026116 | Bacteria | 1474 |
| 740 | Ga0207674_10568319 | 3300026116 | Bacteria | 1095 |
| 741 | Ga0207675_100002059 | 3300026118 | Bacteria | 20054 |
| 742 | Ga0207675_100031608 | 3300026118 | Bacteria | 4931 |
| 743 | Ga0207675_100070660 | 3300026118 | Bacteria | 3263 |
| 744 | Ga0207675_100099312 | 3300026118 | Bacteria | 2742 |
| 745 | Ga0207675_100440014 | 3300026118 | Bacteria | 1290 |
| 746 | Ga0207683_10017329 | 3300026121 | Bacteria | 6139 |
| 747 | Ga0207683_10030237 | 3300026121 | Bacteria | 4692 |
| 748 | Ga0207683_10180996 | 3300026121 | Bacteria | 1911 |
| 749 | Ga0207698_10005783 | 3300026142 | Bacteria | 7674 |
| 750 | Ga0207698_10019868 | 3300026142 | Bacteria | 4611 |
| 751 | Ga0207698_10208239 | 3300026142 | Unclassified | 1757 |
| 752 | Ga0207698_10231367 | 3300026142 | Unclassified | 1678 |
| 753 | Ga0207428_10033868 | 3300027907 | Bacteria | 4190 |
| 754 | Ga0207428_10183035 | 3300027907 | Bacteria | 1582 |
| 755 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 756 | Ga0268266_10010826 | 3300028379 | Bacteria | 7945 |
| 757 | Ga0268266_10191628 | 3300028379 | Bacteria | 1867 |
| 758 | Ga0268266_10280725 | 3300028379 | Bacteria | 1548 |
| 759 | Ga0268265_10027892 | 3300028380 | Bacteria | 4037 |
| 760 | Ga0268265_10110087 | 3300028380 | Unclassified | 2247 |
| 761 | Ga0268265_10118546 | 3300028380 | Bacteria | 2176 |
| 762 | Ga0268265_10143991 | 3300028380 | Bacteria | 1999 |
| 763 | Ga0268264_10000167 | 3300028381 | Bacteria | 146190 |
| 764 | Ga0268264_10003997 | 3300028381 | Bacteria | 12625 |
| 765 | Ga0268264_10009265 | 3300028381 | Bacteria | 8152 |
| 766 | Ga0268264_10013426 | 3300028381 | Bacteria | 6743 |
| 767 | Ga0268264_10022499 | 3300028381 | Bacteria | 5146 |
| 768 | Ga0268264_10115863 | 3300028381 | Bacteria | 2354 |
| 769 | Ga0268264_10278666 | 3300028381 | Unclassified | 1565 |
| 770 | Ga0268264_10289823 | 3300028381 | Bacteria | 1537 |
| 771 | Ga0268264_10323383 | 3300028381 | Bacteria | 1459 |
| 772 | Ga0265336_10000007 | 3300028666 | Bacteria | 339898 |
| 773 | Ga0307517_10025139 | 3300028786 | Bacteria | 7299 |
| 774 | Ga0307515_10000469 | 3300028794 | Bacteria | 96345 |
| 775 | Ga0307511_10008283 | 3300030521 | Bacteria | 10405 |
| 776 | Ga0307512_10245653 | 3300030522 | Unclassified | 899 |
| 777 | Ga0265327_10076362 | 3300031251 | Bacteria | 1665 |
| 778 | Ga0265316_10002446 | 3300031344 | Bacteria | 19266 |
| 779 | Ga0307513_10077739 | 3300031456 | Bacteria | 3435 |
| 780 | Ga0307509_10052614 | 3300031507 | Bacteria | 4346 |
| 781 | Ga0307509_10136415 | 3300031507 | Bacteria | 2398 |
| 782 | Ga0307508_10001613 | 3300031616 | Bacteria | 25177 |
| 783 | Ga0307508_10256541 | 3300031616 | Bacteria | 1344 |
| 784 | Ga0316576_10001081 | 3300031727 | Bacteria | 14158 |
| 785 | Ga0316576_10048308 | 3300031727 | Unclassified | 3086 |
| 786 | Ga0316578_10004394 | 3300031728 | Bacteria | 6652 |
| 787 | Ga0307516_10004268 | 3300031730 | Bacteria | 17759 |
| 788 | Ga0307516_10058896 | 3300031730 | Bacteria | 3737 |
| 789 | Ga0307516_10164433 | 3300031730 | Unclassified | 1966 |
| 790 | Ga0307405_10000018 | 3300031731 | Bacteria | 182495 |
| 791 | Ga0307406_10056552 | 3300031901 | Bacteria | 2513 |
| 792 | Ga0307407_10000015 | 3300031903 | Bacteria | 143258 |
| 793 | Ga0307412_10093985 | 3300031911 | Bacteria | 2105 |
| 794 | Ga0307409_100124233 | 3300031995 | Bacteria | 2192 |
| 795 | Ga0307409_100585077 | 3300031995 | Bacteria | 1101 |
| 796 | Ga0307416_100000025 | 3300032002 | Bacteria | 178154 |
| 797 | Ga0307416_100185000 | 3300032002 | Bacteria | 1957 |
| 798 | Ga0307416_100503717 | 3300032002 | Bacteria | 1276 |
| 799 | Ga0307414_10003961 | 3300032004 | Bacteria | 7985 |
| 800 | Ga0307414_10027951 | 3300032004 | Bacteria | 3652 |
| 801 | Ga0307510_10000380 | 3300033180 | Bacteria | 42243 |
| 802 | Ga0373923_0091968 | 3300035111 | Unclassified | 1328 |
| 803 | Ga0373955_0223970 | 3300035172 | Bacteria | 1124 |
| 804 | Ga0373935_0065008 | 3300035692 | Bacteria | 2340 |
| 805 | Ga0373937_0027762 | 3300036401 | Bacteria | 5121 |
| 806 | Ga0316582_0063175 | 3300036647 | Bacteria | 2379 |
| 807 | Ga0316584_0007005 | 3300036712 | Bacteria | 7674 |
| 808 | Ga0395900_0072926 | 3300037418 | Bacteria | 3529 |
| 809 | Ga0395900_0341038 | 3300037418 | Bacteria | 1474 |
| 810 | Ga0395900_0567408 | 3300037418 | Unclassified | 1078 |
| 811 | Ga0395905_0002823 | 3300037471 | Bacteria | 19037 |
| 812 | Ga0395905_0005630 | 3300037471 | Bacteria | 12747 |
| 813 | Ga0395905_0128646 | 3300037471 | Bacteria | 2382 |
| 814 | Ga0400489_00932 | 3300039093 | Bacteria | 9350 |
| 815 | Ga0436365_0337807 | 3300039437 | Bacteria | 1343 |
| 816 | Ga0436365_0446442 | 3300039437 | Bacteria | 2630 |
| 817 | Ga0436365_0968987 | 3300039437 | Bacteria | 46063 |
| 818 | Ga0436365_1161992 | 3300039437 | Unclassified | 2551 |
| 819 | Ga0436365_1480084 | 3300039437 | Bacteria | 25831 |
| 820 | Ga0439436_0000998 | 3300041404 | Bacteria | 7881 |
| 821 | Ga0439436_0056906 | 3300041404 | Bacteria | 1097 |
| 822 | Ga0439439_0007187 | 3300041406 | Bacteria | 2597 |
| 823 | Ga0451793_1128229 | 3300041452 | Bacteria | 914 |
| 824 | Ga0451798_0789946 | 3300041458 | Unclassified | 967 |
| 825 | Ga0451851_0973538 | 3300041507 | Bacteria | 996 |
| 826 | Ga0439445_0015644 | 3300042004 | Bacteria | 1860 |
| 827 | Ga0439448_0045488 | 3300042005 | Bacteria | 1429 |
| 828 | Ga0439449_0002063 | 3300042007 | Bacteria | 7909 |
| 829 | Ga0439449_0064488 | 3300042007 | Bacteria | 1351 |
| 830 | Ga0439457_004078 | 3300042014 | Bacteria | 3867 |
| 831 | Ga0439457_071486 | 3300042014 | Bacteria | 791 |
| 832 | Ga0451577_0013904 | 3300042876 | Bacteria | 7516 |
| 833 | Ga0451577_0024955 | 3300042876 | Bacteria | 5429 |
| 834 | Ga0451577_0122476 | 3300042876 | Bacteria | 2330 |
| 835 | Ga0451577_0166623 | 3300042876 | Bacteria | 1985 |
| 836 | Ga0451577_0179508 | 3300042876 | Bacteria | 1908 |
| 837 | Ga0451577_0513468 | 3300042876 | Unclassified | 1088 |
| 838 | Ga0451577_1046607 | 3300042876 | Unclassified | 732 |
| 839 | Ga0466969_0000246 | 3300044656 | Bacteria | 29777 |
| 840 | Ga0466969_0065958 | 3300044656 | Bacteria | 1749 |
| 841 | Ga0466972_0000025 | 3300044658 | Bacteria | 186601 |
| 842 | Ga0466972_0005074 | 3300044658 | Bacteria | 6598 |
| 843 | Ga0466972_0016146 | 3300044658 | Bacteria | 3732 |
| 844 | Ga0466972_0105800 | 3300044658 | Unclassified | 1330 |
| 845 | Ga0453683_0009005 | 3300044673 | Bacteria | 6671 |
| 846 | Ga0453683_0022263 | 3300044673 | Bacteria | 4043 |
| 847 | Ga0453683_0051960 | 3300044673 | Bacteria | 2566 |
| 848 | Ga0453683_0095683 | 3300044673 | Unclassified | 1863 |
| 849 | Ga0466965_0200193 | 3300044683 | Unclassified | 1059 |
| 850 | Ga0466966_0004412 | 3300044684 | Bacteria | 9283 |
| 851 | Ga0466961_0060606 | 3300044693 | Bacteria | 2406 |
| 852 | Ga0466961_0082362 | 3300044693 | Bacteria | 2036 |
| 853 | Ga0453684_0000440 | 3300044712 | Bacteria | 169397 |
| 854 | Ga0453684_0012498 | 3300044712 | Bacteria | 13983 |
| 855 | Ga0453684_0031999 | 3300044712 | Bacteria | 7376 |
| 856 | Ga0453684_0035092 | 3300044712 | Bacteria | 6941 |
| 857 | Ga0453684_0047532 | 3300044712 | Bacteria | 5689 |
| 858 | Ga0453684_0133499 | 3300044712 | Bacteria | 2976 |
| 859 | Ga0453684_0291212 | 3300044712 | Bacteria | 1859 |
| 860 | Ga0453684_0342687 | 3300044712 | Bacteria | 1687 |
| 861 | Ga0453684_0468530 | 3300044712 | Bacteria | 1399 |
| 862 | Ga0453684_0541906 | 3300044712 | Bacteria | 1283 |
| 863 | Ga0466971_0029515 | 3300044719 | Bacteria | 2453 |
| 864 | Ga0466968_0091591 | 3300044735 | Bacteria | 1348 |
| 865 | Ga0466970_0005458 | 3300044765 | Bacteria | 6310 |
| 866 | Ga0466970_0043793 | 3300044765 | Bacteria | 2382 |
| 867 | Ga0466959_0000017 | 3300045049 | Bacteria | 143170 |
| 868 | Ga0466959_0021114 | 3300045049 | Bacteria | 4800 |
| 869 | Ga0451576_0027225 | 3300045051 | Bacteria | 6142 |
| 870 | Ga0451576_0033773 | 3300045051 | Bacteria | 5436 |
| 871 | Ga0451576_0047592 | 3300045051 | Bacteria | 4507 |
| 872 | Ga0451576_0157120 | 3300045051 | Bacteria | 2372 |
| 873 | Ga0451576_0767533 | 3300045051 | Bacteria | 1013 |
| 874 | Ga0466958_0069216 | 3300045836 | Bacteria | 2158 |
| 875 | Ga0466967_0098688 | 3300045976 | Bacteria | 2667 |
| 876 | Ga0495650_0031147 | 3300046471 | Bacteria | 2405 |
| 877 | Ga0495580_0020527 | 3300046472 | Bacteria | 4888 |
| 878 | Ga0495580_0130700 | 3300046472 | Unclassified | 1742 |
| 879 | Ga0495594_0028749 | 3300046499 | Bacteria | 3001 |
| 880 | Ga0495606_0003054 | 3300046507 | Bacteria | 18247 |
| 881 | Ga0495608_0224629 | 3300046511 | Bacteria | 1177 |
| 882 | Ga0495610_0000047 | 3300046512 | Bacteria | 151516 |
| 883 | Ga0495610_0000904 | 3300046512 | Bacteria | 27595 |
| 884 | Ga0495628_0049106 | 3300046516 | Unclassified | 3342 |
| 885 | Ga0495630_0006664 | 3300046517 | Bacteria | 8231 |
| 886 | Ga0495643_0049652 | 3300046522 | Bacteria | 2262 |
| 887 | Ga0495648_0136981 | 3300046524 | Bacteria | 1293 |
| 888 | Ga0495652_0208384 | 3300046529 | Bacteria | 1478 |
| 889 | Ga0495598_0022199 | 3300046537 | Bacteria | 1696 |
| 890 | Ga0495667_0099636 | 3300046559 | Bacteria | 1881 |
| 891 | Ga0495667_0268170 | 3300046559 | Bacteria | 1085 |
| 892 | Ga0495668_0000453 | 3300046616 | Bacteria | 52477 |
| 893 | Ga0495668_0001518 | 3300046616 | Bacteria | 22075 |
| 894 | Ga0495634_0079528 | 3300046642 | Bacteria | 2147 |
| 895 | Ga0495634_0125601 | 3300046642 | Bacteria | 1639 |
| 896 | Ga0495611_0003370 | 3300046648 | Bacteria | 7051 |
| 897 | Ga0495625_0073581 | 3300046660 | Bacteria | 2395 |
| 898 | Ga0495657_0306092 | 3300046675 | Bacteria | 947 |
| 899 | Ga0495623_0301213 | 3300046679 | Bacteria | 886 |
| 900 | Ga0495646_0245927 | 3300046680 | Bacteria | 960 |
| 901 | Ga0495658_0002499 | 3300046683 | Bacteria | 9248 |
| 902 | Ga0495649_0044299 | 3300046694 | Bacteria | 2429 |
| 903 | Ga0495649_0083012 | 3300046694 | Bacteria | 1712 |
| 904 | Ga0495604_0042067 | 3300047317 | Bacteria | 3582 |
| 905 | Ga0495672_0108430 | 3300047320 | Bacteria | 1494 |
| 906 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 907 | Ga0495675_0182826 | 3300047444 | Bacteria | 1283 |
| 908 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 909 | Ga0495686_0000577 | 3300047472 | Bacteria | 51975 |
| 910 | Ga0495686_0028262 | 3300047472 | Bacteria | 3652 |
| 911 | Ga0495686_0106869 | 3300047472 | Bacteria | 1682 |
| 912 | Ga0495686_0178938 | 3300047472 | Bacteria | 1230 |
| 913 | Ga0496101_0010154 | 3300048904 | Bacteria | 6211 |
| 914 | Ga0496101_0337118 | 3300048904 | Bacteria | 1184 |
| 915 | Ga0496104_0524509 | 3300048907 | Bacteria | 1096 |
| 916 | Ga0496104_0629802 | 3300048907 | Bacteria | 982 |
| 917 | Ga0496106_0196170 | 3300048909 | Bacteria | 1606 |
| 918 | Ga0496112_0061676 | 3300048915 | Bacteria | 3697 |
| 919 | Ga0496121_0000030 | 3300048924 | Bacteria | 412079 |
| 920 | Ga0496124_0051801 | 3300048927 | Bacteria | 3491 |
| 921 | Ga0496126_0016712 | 3300048929 | Bacteria | 7331 |
| 922 | Ga0501031_0116888 | 3300049568 | Bacteria | 1742 |
| 923 | Ga0501032_0002071 | 3300049569 | Bacteria | 15830 |
| 924 | Ga0501032_0109448 | 3300049569 | Bacteria | 1829 |
| 925 | Ga0501033_0076666 | 3300049570 | Bacteria | 2454 |
| 926 | Ga0501033_0241911 | 3300049570 | Unclassified | 1280 |
| 927 | Ga0501034_0014513 | 3300049571 | Bacteria | 8112 |
| 928 | Ga0501034_0089868 | 3300049571 | Unclassified | 3069 |
| 929 | Ga0501034_0143815 | 3300049571 | Bacteria | 2363 |
| 930 | Ga0501036_0010214 | 3300049572 | Bacteria | 7738 |
| 931 | Ga0501036_0016999 | 3300049572 | Bacteria | 6078 |
| 932 | Ga0501036_0057478 | 3300049572 | Bacteria | 3295 |
| 933 | Ga0501037_0082387 | 3300049573 | Bacteria | 2331 |
| 934 | Ga0501038_0038680 | 3300049574 | Bacteria | 4176 |
| 935 | Ga0501039_0020673 | 3300049575 | Bacteria | 5044 |
| 936 | Ga0501040_0166313 | 3300049576 | Unclassified | 1561 |
| 937 | Ga0501043_0001446 | 3300049579 | Bacteria | 20739 |
| 938 | Ga0501043_0142998 | 3300049579 | Bacteria | 1873 |
| 939 | Ga0501043_0208303 | 3300049579 | Unclassified | 1516 |
| 940 | Ga0501043_0235371 | 3300049579 | Bacteria | 1413 |
| 941 | Ga0501046_0026523 | 3300049580 | Bacteria | 4732 |
| 942 | Ga0501046_0042705 | 3300049580 | Bacteria | 3614 |
| 943 | Ga0501046_0251713 | 3300049580 | Bacteria | 1300 |
| 944 | Ga0501047_0000014 | 3300049581 | Bacteria | 321541 |
| 945 | Ga0501047_0031616 | 3300049581 | Bacteria | 5106 |
| 946 | Ga0501047_0045624 | 3300049581 | Bacteria | 4238 |
| 947 | Ga0501047_0108355 | 3300049581 | Bacteria | 2660 |
| 948 | Ga0501047_0110170 | 3300049581 | Bacteria | 2636 |
| 949 | Ga0501047_0282844 | 3300049581 | Bacteria | 1503 |
| 950 | Ga0501048_0010340 | 3300049582 | Bacteria | 6974 |
| 951 | Ga0501067_0035163 | 3300049583 | Bacteria | 2782 |
| 952 | Ga0501070_0009038 | 3300049586 | Bacteria | 8429 |
| 953 | Ga0501071_0041001 | 3300049587 | Bacteria | 3315 |
| 954 | Ga0501072_0091876 | 3300049588 | Bacteria | 2410 |
| 955 | Ga0501073_0002480 | 3300049589 | Bacteria | 13772 |
| 956 | Ga0501073_0032328 | 3300049589 | Bacteria | 3729 |
| 957 | Ga0501202_004157 | 3300049652 | Bacteria | 2524 |
| 958 | Ga0501207_005672 | 3300049654 | Bacteria | 1734 |
| 959 | Ga0501223_031393 | 3300049663 | Bacteria | 1033 |
| 960 | Ga0501233_046619 | 3300049668 | Bacteria | 1037 |
| 961 | Ga0501242_013656 | 3300049674 | Bacteria | 999 |
| 962 | Ga0501253_024416 | 3300049683 | Bacteria | 1096 |
| 963 | Ga0501257_036941 | 3300049686 | Bacteria | 1191 |
| 964 | Ga0501259_001982 | 3300049688 | Bacteria | 3383 |
| 965 | Ga0501259_007371 | 3300049688 | Bacteria | 1760 |
| 966 | Ga0501261_004784 | 3300049690 | Bacteria | 1688 |
| 967 | Ga0501221_037622 | 3300049704 | Bacteria | 1042 |
| 968 | Ga0501225_0001750 | 3300049705 | Bacteria | 6807 |
| 969 | Ga0501225_0004489 | 3300049705 | Bacteria | 4155 |
| 970 | Ga0501225_0029915 | 3300049705 | Bacteria | 1497 |
| 971 | Ga0501225_0048119 | 3300049705 | Bacteria | 1184 |
| 972 | Ga0501080_0035066 | 3300049742 | Bacteria | 4683 |
| 973 | Ga0501080_0173263 | 3300049742 | Bacteria | 1989 |
| 974 | Ga0501241_008348 | 3300049758 | Bacteria | 1891 |
| 975 | Ga0501266_004386 | 3300049763 | Bacteria | 1746 |
| 976 | Ga0501268_011400 | 3300049765 | Bacteria | 1402 |
| 977 | Ga0501269_001678 | 3300049766 | Bacteria | 2826 |
| 978 | Ga0501035_0012769 | 3300049822 | Bacteria | 7759 |
| 979 | Ga0501035_0119494 | 3300049822 | Bacteria | 2305 |
| 980 | Ga0501044_0004256 | 3300049823 | Bacteria | 16057 |
| 981 | Ga0501044_0027270 | 3300049823 | Bacteria | 6039 |
| 982 | Ga0501044_0078101 | 3300049823 | Unclassified | 3355 |
| 983 | Ga0501044_0129257 | 3300049823 | Bacteria | 2521 |
| 984 | Ga0501044_0210760 | 3300049823 | Unclassified | 1897 |
| 985 | Ga0501044_0243013 | 3300049823 | Bacteria | 1743 |
| 986 | Ga0501044_0420384 | 3300049823 | Unclassified | 1247 |
| 987 | nmdc:mga0k408_19225_c1 | 3300050493 | Bacteria | 3816 |
| 988 | nmdc:mga0k408_28497_c1 | 3300050493 | Bacteria | 3175 |
| 989 | nmdc:mga0k408_34103_c1 | 3300050493 | Bacteria | 2913 |
| 990 | nmdc:mga0k408_355166_c1 | 3300050493 | Bacteria | 874 |
| 991 | nmdc:mga0k408_54699_c1 | 3300050493 | Bacteria | 2313 |
| 992 | nmdc:mga05p37_327139_c1 | 3300050507 | Bacteria | 1812 |
| 993 | nmdc:mga05p37_3944_c1 | 3300050507 | Bacteria | 17380 |
| 994 | nmdc:mga05p37_85778_c2 | 3300050507 | Bacteria | 3129 |
| 995 | nmdc:mga05p37_93236_c1 | 3300050507 | Unclassified | 3710 |
| 996 | nmdc:mga09592_457896_c1 | 3300050508 | Bacteria | 1100 |
| 997 | nmdc:mga09592_74593_c1 | 3300050508 | Bacteria | 2883 |
| 998 | nmdc:mga06r32_79583_c1 | 3300050510 | Unclassified | 3188 |
| 999 | nmdc:mga08y16_18379_c1 | 3300050511 | Bacteria | 7369 |
| 1000 | nmdc:mga08y16_259415_c1 | 3300050511 | Bacteria | 1795 |
| 1001 | nmdc:mga08y16_90253_c1 | 3300050511 | Bacteria | 3194 |
| 1002 | Ga0495595_0026950 | 3300053084 | Bacteria | 2557 |
| 1003 | Ga0500578_0000136 | 3300053086 | Bacteria | 88612 |
| 1004 | Ga0500578_0219597 | 3300053086 | Bacteria | 1156 |
| 1005 | Ga0500644_0000344 | 3300053088 | Bacteria | 23446 |
| 1006 | Ga0500646_0011763 | 3300053090 | Bacteria | 2253 |
| 1007 | Ga0500646_0062022 | 3300053090 | Unclassified | 1102 |
| 1008 | Ga0500583_0000127 | 3300053092 | Bacteria | 35082 |
| 1009 | Ga0500583_0004905 | 3300053092 | Bacteria | 4423 |
| 1010 | Ga0500583_0011554 | 3300053092 | Bacteria | 3333 |
| 1011 | Ga0500583_0021234 | 3300053092 | Unclassified | 2697 |
| 1012 | Ga0500583_0091634 | 3300053092 | Bacteria | 1480 |
| 1013 | Ga0500562_000061 | 3300053108 | Bacteria | 53142 |
| 1014 | Ga0500568_0000439 | 3300053139 | Bacteria | 31243 |
| 1015 | Ga0500588_0000910 | 3300053146 | Bacteria | 5216 |
| 1016 | Ga0500588_0018497 | 3300053146 | Bacteria | 1837 |
| 1017 | Ga0500604_0007195 | 3300053151 | Bacteria | 2947 |
| 1018 | Ga0500616_0000698 | 3300053153 | Bacteria | 39124 |
| 1019 | Ga0500616_0010292 | 3300053153 | Bacteria | 5605 |
| 1020 | Ga0500616_0017066 | 3300053153 | Bacteria | 4121 |
| 1021 | Ga0500616_0045533 | 3300053153 | Bacteria | 2337 |
| 1022 | Ga0500622_0000156 | 3300053156 | Bacteria | 71907 |
| 1023 | Ga0500622_0000655 | 3300053156 | Bacteria | 30835 |
| 1024 | Ga0500622_0004617 | 3300053156 | Bacteria | 8545 |
| 1025 | Ga0500622_0020704 | 3300053156 | Bacteria | 3492 |
| 1026 | Ga0500636_0136494 | 3300053177 | Bacteria | 1362 |
| 1027 | Ga0500637_0047204 | 3300053178 | Bacteria | 2446 |
| 1028 | Ga0500611_000032 | 3300053727 | Bacteria | 83927 |
| 1029 | Ga0500645_062147 | 3300053730 | Bacteria | 1078 |
| 1030 | Ga0501084_0027666 | 3300054114 | Bacteria | 4738 |
| 1031 | Ga0501082_0128401 | 3300060353 | Bacteria | 2199 |
| 1032 | Ga0466962_0003273 | 3300061719 | Bacteria | 7694 |
| 1033 | 2586210394 | 2585427687 | Bacteria | 5544917 |
| 1034 | 2738726220 | 2738541278 | Bacteria | 9755573 |
| 1035 | 2738856020 | 2738541302 | Bacteria | 5944758 |
| 1036 | 2739591027 | 2739367651 | Bacteria | 6359826 |
| 1037 | 2739618073 | 2739367656 | Bacteria | 5152243 |
| 1038 | 2739647443 | 2739367663 | Bacteria | 5040914 |
| 1039 | 2819549961 | 2818991437 | Bacteria | 5805520 |
| 1040 | 2819590262 | 2818991444 | Bacteria | 6968812 |
| 1041 | 2842723438 | 2842722452 | Bacteria | 6263924 |
| 1042 | 2842909932 | 2842909656 | Bacteria | 6185908 |
| 1043 | 2849284791 | 2849281842 | Bacteria | 6065644 |
| 1044 | 2857632211 | 2857627736 | Bacteria | 5625397 |
| 1045 | 2881957873 | 2881955468 | Bacteria | 3545609 |
| 1046 | 2904445970 | 2904445276 | Bacteria | 5310396 |
| 1047 | 2914763482 | 2914759650 | Bacteria | 4701441 |
| 1048 | 2929155029 | 2929154850 | Bacteria | 6753285 |
| 1049 | 2946000281 | 2945997725 | Bacteria | 6404843 |
| 1050 | 2954017168 | 2954016120 | Bacteria | 6446024 |
| 1051 | Ga0207680_10174885 | |||
| 1052 | MRS1b_contig_3231436 | |||
| 1053 | JGI24739J22299_10001379 | |||
| 1054 | JGI25406J46586_10036777 | |||
| 1055 | JGI25153J46596_10021720 | |||
| 1056 | rootH1_10187333 | |||
| 1057 | rootH2_10037762 | |||
| 1058 | rootH2_10069215 | |||
| 1059 | rootH2_10138765 | |||
| 1060 | rootH2_10155317 | |||
| 1061 | rootL2_10036246 | |||
| 1062 | rootL2_10062004 | |||
| 1063 | rootL2_10066724 | |||
| 1064 | rootL2_10156908 | |||
| 1065 | rootL2_10199815 | |||
| 1066 | rootL2_10278758 | |||
| 1067 | rootL2_10317439 | |||
| 1068 | rootH1_10041523 | |||
| 1069 | rootH1_10046893 | |||
| 1070 | rootH1_10096119 | |||
| 1071 | JGI25160J50197_1001095 | |||
| 1072 | Ga0055535_1003322 | |||
| 1073 | Ga0055536_1000003 | |||
| 1074 | Ga0055530_10001176 | |||
| 1075 | Ga0055531_10000133 | |||
| 1076 | Ga0055531_10000166 | |||
| 1077 | Ga0065714_10002192 | |||
| 1078 | Ga0065714_10088526 | |||
| 1079 | Ga0065714_10128866 | |||
| 1080 | Ga0065704_10204218 | |||
| 1081 | Ga0065712_10011320 | |||
| 1082 | Ga0065712_10020395 | |||
| 1083 | Ga0065712_10074886 | |||
| 1084 | Ga0065712_10162279 | |||
| 1085 | Ga0065712_10209505 | |||
| 1086 | Ga0065712_10315571 | |||
| 1087 | Ga0065715_10005801 | |||
| 1088 | Ga0065707_10112842 | |||
| 1089 | Ga0065707_10294102 | |||
| 1090 | Ga0065707_10301143 | |||
| 1091 | Ga0070658_10094269 | |||
| 1092 | Ga0070658_10150547 | |||
| 1093 | Ga0070658_10422714 | |||
| 1094 | Ga0070676_10017260 | |||
| 1095 | Ga0070676_10035933 | |||
| 1096 | Ga0070676_10275360 | |||
| 1097 | Ga0070683_100001488 | |||
| 1098 | Ga0070683_100006686 | |||
| 1099 | Ga0070683_100013377 | |||
| 1100 | Ga0070683_100139428 | |||
| 1101 | Ga0070683_100496968 | |||
| 1102 | Ga0070670_100043938 | |||
| 1103 | Ga0070670_100067766 | |||
| 1104 | Ga0070670_100166339 | |||
| 1105 | Ga0068869_100014592 | |||
| 1106 | Ga0068869_100040382 | |||
| 1107 | Ga0068869_100112960 | |||
| 1108 | Ga0068869_100259567 | |||
| 1109 | Ga0070666_10000191 | |||
| 1110 | Ga0070666_10000736 | |||
| 1111 | Ga0070666_10020630 | |||
| 1112 | Ga0070666_10024266 | |||
| 1113 | Ga0070666_10027930 | |||
| 1114 | Ga0070666_10032894 | |||
| 1115 | Ga0070666_10286860 | |||
| 1116 | Ga0070680_100001401 | |||
| 1117 | Ga0070680_100041558 | |||
| 1118 | Ga0070682_100002086 | |||
| 1119 | Ga0070682_100023351 | |||
| 1120 | Ga0070682_100035375 | |||
| 1121 | Ga0070682_100108505 | |||
| 1122 | Ga0068868_100004630 | |||
| 1123 | Ga0068868_100006935 | |||
| 1124 | Ga0068868_100023189 | |||
| 1125 | Ga0068868_100097784 | |||
| 1126 | Ga0068868_100144787 | |||
| 1127 | Ga0068868_100146899 | |||
| 1128 | Ga0068868_100367617 | |||
| 1129 | Ga0070660_100012064 | |||
| 1130 | Ga0070660_100368188 | |||
| 1131 | Ga0070689_100010221 | |||
| 1132 | Ga0070689_100027952 | |||
| 1133 | Ga0070689_100032331 | |||
| 1134 | Ga0070689_100073429 | |||
| 1135 | Ga0070689_100265952 | |||
| 1136 | Ga0070689_100309677 | |||
| 1137 | Ga0070691_10005091 | |||
| 1138 | Ga0070687_100033870 | |||
| 1139 | Ga0070661_100015125 | |||
| 1140 | Ga0070661_100016234 | |||
| 1141 | Ga0070661_100027839 | |||
| 1142 | Ga0070668_100004151 | |||
| 1143 | Ga0070668_100011116 | |||
| 1144 | Ga0070668_100020025 | |||
| 1145 | Ga0070668_100184107 | |||
| 1146 | Ga0070669_100008748 | |||
| 1147 | Ga0070669_100396208 | |||
| 1148 | Ga0070669_100451207 | |||
| 1149 | Ga0070675_100085433 | |||
| 1150 | Ga0070675_100105888 | |||
| 1151 | Ga0070675_100112578 | |||
| 1152 | Ga0070675_100133412 | |||
| 1153 | Ga0070675_100138132 | |||
| 1154 | Ga0070675_100250983 | |||
| 1155 | Ga0070675_100292360 | |||
| 1156 | Ga0070675_100741612 | |||
| 1157 | Ga0070671_100029574 | |||
| 1158 | Ga0070671_100053645 | |||
| 1159 | Ga0070671_100116246 | |||
| 1160 | Ga0070674_100002220 | |||
| 1161 | Ga0070673_100006656 | |||
| 1162 | Ga0070673_100016732 | |||
| 1163 | Ga0070673_100019294 | |||
| 1164 | Ga0070673_100024297 | |||
| 1165 | Ga0070673_100042547 | |||
| 1166 | Ga0070673_100051203 | |||
| 1167 | Ga0070673_100419848 | |||
| 1168 | Ga0070673_100443434 | |||
| 1169 | Ga0070688_100013545 | |||
| 1170 | Ga0070688_100037093 | |||
| 1171 | Ga0070688_100052736 | |||
| 1172 | Ga0070688_100111398 | |||
| 1173 | Ga0070688_100201536 | |||
| 1174 | Ga0070659_100026473 | |||
| 1175 | Ga0070659_100031231 | |||
| 1176 | Ga0070659_100245588 | |||
| 1177 | Ga0070667_100000248 | |||
| 1178 | Ga0070667_100003905 | |||
| 1179 | Ga0070667_100031740 | |||
| 1180 | Ga0070667_100096997 | |||
| 1181 | Ga0070667_100113769 | |||
| 1182 | Ga0070667_100267577 | |||
| 1183 | Ga0070667_100312033 | |||
| 1184 | Ga0070700_100022637 | |||
| 1185 | Ga0070678_100105608 | |||
| 1186 | Ga0070678_100321889 | |||
| 1187 | Ga0070662_100004870 | |||
| 1188 | Ga0070662_100011898 | |||
| 1189 | Ga0070662_100021120 | |||
| 1190 | Ga0070662_100022782 | |||
| 1191 | Ga0070681_10004039 | |||
| 1192 | Ga0070681_10049604 | |||
| 1193 | Ga0070681_10129083 | |||
| 1194 | Ga0068867_100032795 | |||
| 1195 | Ga0068867_100128708 | |||
| 1196 | Ga0068867_100137671 | |||
| 1197 | Ga0068867_100418364 | |||
| 1198 | Ga0070685_10016702 | |||
| 1199 | Ga0070685_10092079 | |||
| 1200 | Ga0070698_100002802 | |||
| 1201 | Ga0070698_100006186 | |||
| 1202 | Ga0070698_100016568 | |||
| 1203 | Ga0070699_100471264 | |||
| 1204 | Ga0070679_100002167 | |||
| 1205 | Ga0070679_100056240 | |||
| 1206 | Ga0070684_100003339 | |||
| 1207 | Ga0070684_100058514 | |||
| 1208 | Ga0070684_100060911 | |||
| 1209 | Ga0070684_100063429 | |||
| 1210 | Ga0068853_100000250 | |||
| 1211 | Ga0068853_100003318 | |||
| 1212 | Ga0068853_100006139 | |||
| 1213 | Ga0068853_100030359 | |||
| 1214 | Ga0068853_100043755 | |||
| 1215 | Ga0068853_100084468 | |||
| 1216 | Ga0068853_100145967 | |||
| 1217 | Ga0068853_100221844 | |||
| 1218 | Ga0068853_100272722 | |||
| 1219 | Ga0068853_100307260 | |||
| 1220 | Ga0068853_100370851 | |||
| 1221 | Ga0068853_100382177 | |||
| 1222 | Ga0070672_100001565 | |||
| 1223 | Ga0070693_100067745 | |||
| 1224 | Ga0070665_100018617 | |||
| 1225 | Ga0070665_100085759 | |||
| 1226 | Ga0070704_100193181 | |||
| 1227 | Ga0068855_100000133 | |||
| 1228 | Ga0068855_100003486 | |||
| 1229 | Ga0070664_100004058 | |||
| 1230 | Ga0070664_100030677 | |||
| 1231 | Ga0070664_100053226 | |||
| 1232 | Ga0070664_100126731 | |||
| 1233 | Ga0070664_100372022 | |||
| 1234 | Ga0070664_100423727 | |||
| 1235 | Ga0070664_100484441 | |||
| 1236 | Ga0068857_100010012 | |||
| 1237 | Ga0068857_100023615 | |||
| 1238 | Ga0068857_100137417 | |||
| 1239 | Ga0068857_100178481 | |||
| 1240 | Ga0068857_100224023 | |||
| 1241 | Ga0068857_100255602 | |||
| 1242 | Ga0068854_100005730 | |||
| 1243 | Ga0068854_100047179 | |||
| 1244 | Ga0068854_100063403 | |||
| 1245 | Ga0068854_100069838 | |||
| 1246 | Ga0068856_100004245 | |||
| 1247 | Ga0068856_100014967 | |||
| 1248 | Ga0068856_100048124 | |||
| 1249 | Ga0068856_100086534 | |||
| 1250 | Ga0068852_100001400 | |||
| 1251 | Ga0068852_100008317 | |||
| 1252 | Ga0068852_100009108 | |||
| 1253 | Ga0068852_100032096 | |||
| 1254 | Ga0068852_100064916 | |||
| 1255 | Ga0068852_100168770 | |||
| 1256 | Ga0068852_100175248 | |||
| 1257 | Ga0068852_100242383 | |||
| 1258 | Ga0068852_100258940 | |||
| 1259 | Ga0068852_100324612 | |||
| 1260 | Ga0068859_100000037 | |||
| 1261 | Ga0068859_100002491 | |||
| 1262 | Ga0068859_100134497 | |||
| 1263 | Ga0068859_100172495 | |||
| 1264 | Ga0068859_100230504 | |||
| 1265 | Ga0068859_101003427 | |||
| 1266 | Ga0068864_100012286 | |||
| 1267 | Ga0068864_100015889 | |||
| 1268 | Ga0068864_100018148 | |||
| 1269 | Ga0068864_100053299 | |||
| 1270 | Ga0068864_100082595 | |||
| 1271 | Ga0068864_100096024 | |||
| 1272 | Ga0068866_10143664 | |||
| 1273 | Ga0068866_10212241 | |||
| 1274 | Ga0068861_100010689 | |||
| 1275 | Ga0068861_100130693 | |||
| 1276 | Ga0068861_100161210 | |||
| 1277 | Ga0068861_100315205 | |||
| 1278 | Ga0068851_10026295 | |||
| 1279 | Ga0068851_10075595 | |||
| 1280 | Ga0068851_10124041 | |||
| 1281 | Ga0068851_10150963 | |||
| 1282 | Ga0068870_10006960 | |||
| 1283 | Ga0068870_10029248 | |||
| 1284 | Ga0068870_10044049 | |||
| 1285 | Ga0068870_10221306 | |||
| 1286 | Ga0068863_100001373 | |||
| 1287 | Ga0068863_100004306 | |||
| 1288 | Ga0068863_100038107 | |||
| 1289 | Ga0068863_100051623 | |||
| 1290 | Ga0068863_100062458 | |||
| 1291 | Ga0068863_100160218 | |||
| 1292 | Ga0068863_100400242 | |||
| 1293 | Ga0068863_100578756 | |||
| 1294 | Ga0068858_100071652 | |||
| 1295 | Ga0068858_100516390 | |||
| 1296 | Ga0068860_100000097 | |||
| 1297 | Ga0068860_100004260 | |||
| 1298 | Ga0068860_100006743 | |||
| 1299 | Ga0068860_100008499 | |||
| 1300 | Ga0068860_100019489 | |||
| 1301 | Ga0068860_100022955 | |||
| 1302 | Ga0068860_100319797 | |||
| 1303 | Ga0068860_100857837 | |||
| 1304 | Ga0068862_100007901 | |||
| 1305 | Ga0068862_100008890 | |||
| 1306 | Ga0068862_100110622 | |||
| 1307 | Ga0068862_100187982 | |||
| 1308 | Ga0068862_100317394 | |||
| 1309 | Ga0081539_10004959 | |||
| 1310 | Ga0070716_100233610 | |||
| 1311 | Ga0075366_10005546 | |||
| 1312 | Ga0075366_10005748 | |||
| 1313 | Ga0075366_10014280 | |||
| 1314 | Ga0097621_100044821 | |||
| 1315 | Ga0097621_100070259 | |||
| 1316 | Ga0097621_100090377 | |||
| 1317 | Ga0097621_100109305 | |||
| 1318 | Ga0097621_100271363 | |||
| 1319 | Ga0097621_100354670 | |||
| 1320 | Ga0097621_100610755 | |||
| 1321 | Ga0068871_100004890 | |||
| 1322 | Ga0068871_100015089 | |||
| 1323 | Ga0068871_100024794 | |||
| 1324 | Ga0068871_100044750 | |||
| 1325 | Ga0068871_100087735 | |||
| 1326 | Ga0068871_100133402 | |||
| 1327 | Ga0075428_100081557 | |||
| 1328 | Ga0075430_100011474 | |||
| 1329 | Ga0075431_100022872 | |||
| 1330 | Ga0075431_100152015 | |||
| 1331 | Ga0075434_100374703 | |||
| 1332 | Ga0075429_100007351 | |||
| 1333 | Ga0075429_100079091 | |||
| 1334 | Ga0068865_100003571 | |||
| 1335 | Ga0068865_100046762 | |||
| 1336 | Ga0068865_100229034 | |||
| 1337 | Ga0068865_100352328 | |||
| 1338 | Ga0097620_100000037 | |||
| 1339 | Ga0097620_100002491 | |||
| 1340 | Ga0097620_100134504 | |||
| 1341 | Ga0097620_100172490 | |||
| 1342 | Ga0097620_100230494 | |||
| 1343 | Ga0097620_101003323 | |||
| 1344 | Ga0105251_10071058 | |||
| 1345 | Ga0105240_10000398 | |||
| 1346 | Ga0105240_10001595 | |||
| 1347 | Ga0105240_10016926 | |||
| 1348 | Ga0105240_10031869 | |||
| 1349 | Ga0105240_10050768 | |||
| 1350 | Ga0105240_10074719 | |||
| 1351 | Ga0105240_10295321 | |||
| 1352 | Ga0111539_10009984 | |||
| 1353 | Ga0111539_10037511 | |||
| 1354 | Ga0111539_10054054 | |||
| 1355 | Ga0111539_10066150 | |||
| 1356 | Ga0111539_10140184 | |||
| 1357 | Ga0111539_10272888 | |||
| 1358 | Ga0111539_10804181 | |||
| 1359 | Ga0105245_10091135 | |||
| 1360 | Ga0114129_10006463 | |||
| 1361 | Ga0114129_10025561 | |||
| 1362 | Ga0114129_10059189 | |||
| 1363 | Ga0114129_10095068 | |||
| 1364 | Ga0114129_11109264 | |||
| 1365 | Ga0105243_10118580 | |||
| 1366 | Ga0105241_10000537 | |||
| 1367 | Ga0105241_10000769 | |||
| 1368 | Ga0105241_10004422 | |||
| 1369 | Ga0105241_10029296 | |||
| 1370 | Ga0105241_10076487 | |||
| 1371 | Ga0105241_10135527 | |||
| 1372 | Ga0105241_10271373 | |||
| 1373 | Ga0105241_10273302 | |||
| 1374 | Ga0105242_10059726 | |||
| 1375 | Ga0105242_10083142 | |||
| 1376 | Ga0105242_10105247 | |||
| 1377 | Ga0105242_10143570 | |||
| 1378 | Ga0105242_10289430 | |||
| 1379 | Ga0105248_10092740 | |||
| 1380 | Ga0105248_10104833 | |||
| 1381 | Ga0105248_10182101 | |||
| 1382 | Ga0105248_10308124 | |||
| 1383 | Ga0105248_10488875 | |||
| 1384 | Ga0105248_11012099 | |||
| 1385 | Ga0105237_10001588 | |||
| 1386 | Ga0105237_10001799 | |||
| 1387 | Ga0105237_10002614 | |||
| 1388 | Ga0105237_10007892 | |||
| 1389 | Ga0105237_10037741 | |||
| 1390 | Ga0105237_10384591 | |||
| 1391 | Ga0105238_10008067 | |||
| 1392 | Ga0105238_10051614 | |||
| 1393 | Ga0105238_10111019 | |||
| 1394 | Ga0105238_10130087 | |||
| 1395 | Ga0105238_10341939 | |||
| 1396 | Ga0105238_10522541 | |||
| 1397 | Ga0105249_10009374 | |||
| 1398 | Ga0105249_10029286 | |||
| 1399 | Ga0105249_10042127 | |||
| 1400 | Ga0105249_10050930 | |||
| 1401 | Ga0105249_10101172 | |||
| 1402 | Ga0105249_10474095 | |||
| 1403 | Ga0105239_10000436 | |||
| 1404 | Ga0105239_10002246 | |||
| 1405 | Ga0105239_10009301 | |||
| 1406 | Ga0105239_10010718 | |||
| 1407 | Ga0105239_10045244 | |||
| 1408 | Ga0105239_10063312 | |||
| 1409 | Ga0105239_10131025 | |||
| 1410 | Ga0105239_10933445 | |||
| 1411 | Ga0105239_11010697 | |||
| 1412 | Ga0105246_10098378 | |||
| 1413 | Ga0105246_10272180 | |||
| 1414 | Ga0157373_10000127 | |||
| 1415 | Ga0157373_10016509 | |||
| 1416 | Ga0157373_10017789 | |||
| 1417 | Ga0157373_10023280 | |||
| 1418 | Ga0157373_10052762 | |||
| 1419 | Ga0157371_10000009 | |||
| 1420 | Ga0157371_10001161 | |||
| 1421 | Ga0157371_10020069 | |||
| 1422 | Ga0157371_10038115 | |||
| 1423 | Ga0157371_10049377 | |||
| 1424 | Ga0157371_10079931 | |||
| 1425 | Ga0157371_10105007 | |||
| 1426 | Ga0157371_10107026 | |||
| 1427 | Ga0157371_10223539 | |||
| 1428 | Ga0157371_10241886 | |||
| 1429 | Ga0157370_10001172 | |||
| 1430 | Ga0157370_10002300 | |||
| 1431 | Ga0157370_10019212 | |||
| 1432 | Ga0157370_10021508 | |||
| 1433 | Ga0157370_10034319 | |||
| 1434 | Ga0157370_10063717 | |||
| 1435 | Ga0157370_10076387 | |||
| 1436 | Ga0157370_10174610 | |||
| 1437 | Ga0157370_10226086 | |||
| 1438 | Ga0157370_10235449 | |||
| 1439 | Ga0157369_10000006 | |||
| 1440 | Ga0157369_10033658 | |||
| 1441 | Ga0157369_10035022 | |||
| 1442 | Ga0157369_10035205 | |||
| 1443 | Ga0157369_10122279 | |||
| 1444 | Ga0157369_10176508 | |||
| 1445 | Ga0157369_10243984 | |||
| 1446 | Ga0157369_10343900 | |||
| 1447 | Ga0157369_10670862 | |||
| 1448 | Ga0157369_11020687 | |||
| 1449 | Ga0157374_10000001 | |||
| 1450 | Ga0157374_10000500 | |||
| 1451 | Ga0157374_10005963 | |||
| 1452 | Ga0157374_10007705 | |||
| 1453 | Ga0157374_10028847 | |||
| 1454 | Ga0157374_10039891 | |||
| 1455 | Ga0157374_10089069 | |||
| 1456 | Ga0157374_10182509 | |||
| 1457 | Ga0157374_10227752 | |||
| 1458 | Ga0157374_10467323 | |||
| 1459 | Ga0157374_10500423 | |||
| 1460 | Ga0157378_10005638 | |||
| 1461 | Ga0157378_10015524 | |||
| 1462 | Ga0157378_10033932 | |||
| 1463 | Ga0157378_10047605 | |||
| 1464 | Ga0157378_10109236 | |||
| 1465 | Ga0157378_10130335 | |||
| 1466 | Ga0157378_10132689 | |||
| 1467 | Ga0157378_10347359 | |||
| 1468 | Ga0157378_10431856 | |||
| 1469 | Ga0157378_10553984 | |||
| 1470 | Ga0157378_10621602 | |||
| 1471 | Ga0157378_10714107 | |||
| 1472 | Ga0157378_10780236 | |||
| 1473 | Ga0163162_10000304 | |||
| 1474 | Ga0163162_10000773 | |||
| 1475 | Ga0163162_10001942 | |||
| 1476 | Ga0163162_10004755 | |||
| 1477 | Ga0163162_10007765 | |||
| 1478 | Ga0163162_10022131 | |||
| 1479 | Ga0163162_10039131 | |||
| 1480 | Ga0163162_10085604 | |||
| 1481 | Ga0163162_10232155 | |||
| 1482 | Ga0163162_10296919 | |||
| 1483 | Ga0163162_10448100 | |||
| 1484 | Ga0163162_10577451 | |||
| 1485 | Ga0157372_10000288 | |||
| 1486 | Ga0157372_10003109 | |||
| 1487 | Ga0157372_10005863 | |||
| 1488 | Ga0157372_10059984 | |||
| 1489 | Ga0157372_10065955 | |||
| 1490 | Ga0157372_10089440 | |||
| 1491 | Ga0157372_10116600 | |||
| 1492 | Ga0157372_10135723 | |||
| 1493 | Ga0157372_10153024 | |||
| 1494 | Ga0157372_10180194 | |||
| 1495 | Ga0157372_10226918 | |||
| 1496 | Ga0157372_10234025 | |||
| 1497 | Ga0157372_10282954 | |||
| 1498 | Ga0157372_10296782 | |||
| 1499 | Ga0157372_10330905 | |||
| 1500 | Ga0157372_10403033 | |||
| 1501 | Ga0157372_10556396 | |||
| 1502 | Ga0157372_10591157 | |||
| 1503 | Ga0157372_10632401 | |||
| 1504 | Ga0157372_10705761 | |||
| 1505 | Ga0157372_10761483 | |||
| 1506 | Ga0157375_10001463 | |||
| 1507 | Ga0157375_10029615 | |||
| 1508 | Ga0157375_10053872 | |||
| 1509 | Ga0157375_10059597 | |||
| 1510 | Ga0157375_10074000 | |||
| 1511 | Ga0157375_10204555 | |||
| 1512 | Ga0157375_10206183 | |||
| 1513 | Ga0157375_10666578 | |||
| 1514 | Ga0163163_10001732 | |||
| 1515 | Ga0163163_10003543 | |||
| 1516 | Ga0163163_10018795 | |||
| 1517 | Ga0163163_10055223 | |||
| 1518 | Ga0163163_10071221 | |||
| 1519 | Ga0163163_10072197 | |||
| 1520 | Ga0163163_10091809 | |||
| 1521 | Ga0163163_10139867 | |||
| 1522 | Ga0163163_10368163 | |||
| 1523 | Ga0163163_10432803 | |||
| 1524 | Ga0163163_10478120 | |||
| 1525 | Ga0157380_10001083 | |||
| 1526 | Ga0157380_10004590 | |||
| 1527 | Ga0157380_10016648 | |||
| 1528 | Ga0157380_10141439 | |||
| 1529 | Ga0157380_10338490 | |||
| 1530 | Ga0182008_10000874 | |||
| 1531 | Ga0157377_10004045 | |||
| 1532 | Ga0157377_10016138 | |||
| 1533 | Ga0157377_10060402 | |||
| 1534 | Ga0157377_10078560 | |||
| 1535 | Ga0157377_10133521 | |||
| 1536 | Ga0157377_10240954 | |||
| 1537 | Ga0157379_10000845 | |||
| 1538 | Ga0157379_10031135 | |||
| 1539 | Ga0157379_10076794 | |||
| 1540 | Ga0157379_10101588 | |||
| 1541 | Ga0157379_10148396 | |||
| 1542 | Ga0157379_10148786 | |||
| 1543 | Ga0157379_10182711 | |||
| 1544 | Ga0157379_10244614 | |||
| 1545 | Ga0157379_10245116 | |||
| 1546 | Ga0157379_10445793 | |||
| 1547 | Ga0157376_10007592 | |||
| 1548 | Ga0157376_10016450 | |||
| 1549 | Ga0157376_10043042 | |||
| 1550 | Ga0157376_10062316 | |||
| 1551 | Ga0157376_10067706 | |||
| 1552 | Ga0157376_10090037 | |||
| 1553 | Ga0157376_10174534 | |||
| 1554 | Ga0157376_10891064 | |||
| 1555 | Ga0182006_1000113 | |||
| 1556 | Ga0182006_1000321 | |||
| 1557 | Ga0182006_1006032 | |||
| 1558 | Ga0182007_10000122 | |||
| 1559 | Ga0183373_1006 | |||
| 1560 | Ga0163161_10000089 | |||
| 1561 | Ga0163161_10000218 | |||
| 1562 | Ga0163161_10005594 | |||
| 1563 | Ga0163161_10018758 | |||
| 1564 | Ga0163161_10048358 | |||
| 1565 | Ga0163161_10159294 | |||
| 1566 | Ga0163161_10343880 | |||
| 1567 | Ga0206356_10247902 | |||
| 1568 | Ga0206352_11110991 | |||
| 1569 | Ga0213876_10005132 | |||
| 1570 | Ga0213876_10017527 | |||
| 1571 | Ga0209258_100311 | |||
| 1572 | Ga0209148_1000163 | |||
| 1573 | Ga0209676_1000001 | |||
| 1574 | Ga0209758_1043894 | |||
| 1575 | Ga0209050_1000016 | |||
| 1576 | Ga0207426_1000105 | |||
| 1577 | Ga0207426_1056957 | |||
| 1578 | Ga0209257_1000001 | |||
| 1579 | Ga0207697_10040801 | |||
| 1580 | Ga0207656_10013283 | |||
| 1581 | Ga0207656_10079251 | |||
| 1582 | Ga0207656_10144952 | |||
| 1583 | Ga0207682_10120470 | |||
| 1584 | Ga0207642_10067045 | |||
| 1585 | Ga0207680_10000549 | |||
| 1586 | Ga0207680_10000957 | |||
| 1587 | Ga0207680_10020420 | |||
| 1588 | Ga0207680_10036377 | |||
| 1589 | Ga0207680_10176152 | |||
| 1590 | Ga0207680_10198388 | |||
| 1591 | Ga0207647_10000408 | |||
| 1592 | Ga0207647_10018030 | |||
| 1593 | Ga0207647_10030877 | |||
| 1594 | Ga0207685_10036374 | |||
| 1595 | Ga0207645_10003925 | |||
| 1596 | Ga0207645_10018887 | |||
| 1597 | Ga0207643_10003731 | |||
| 1598 | Ga0207643_10008110 | |||
| 1599 | Ga0207643_10044031 | |||
| 1600 | Ga0207643_10245245 | |||
| 1601 | Ga0207705_10006233 | |||
| 1602 | Ga0207705_10035858 | |||
| 1603 | Ga0207705_10217672 | |||
| 1604 | Ga0207705_10257896 | |||
| 1605 | Ga0207654_10002504 | |||
| 1606 | Ga0207654_10005425 | |||
| 1607 | Ga0207654_10014402 | |||
| 1608 | Ga0207707_10000051 | |||
| 1609 | Ga0207707_10028949 | |||
| 1610 | Ga0207707_10166862 | |||
| 1611 | Ga0207707_10356091 | |||
| 1612 | Ga0207695_10000076 | |||
| 1613 | Ga0207695_10000084 | |||
| 1614 | Ga0207695_10000090 | |||
| 1615 | Ga0207695_10003768 | |||
| 1616 | Ga0207695_10009751 | |||
| 1617 | Ga0207695_10025986 | |||
| 1618 | Ga0207695_10039855 | |||
| 1619 | Ga0207695_10072177 | |||
| 1620 | Ga0207671_10001737 | |||
| 1621 | Ga0207671_10002536 | |||
| 1622 | Ga0207671_10003750 | |||
| 1623 | Ga0207671_10015105 | |||
| 1624 | Ga0207671_10219998 | |||
| 1625 | Ga0207660_10008132 | |||
| 1626 | Ga0207662_10426410 | |||
| 1627 | Ga0207657_10015740 | |||
| 1628 | Ga0207649_10022827 | |||
| 1629 | Ga0207649_10028571 | |||
| 1630 | Ga0207649_10172387 | |||
| 1631 | Ga0207652_10008635 | |||
| 1632 | Ga0207652_10251572 | |||
| 1633 | Ga0207681_10016068 | |||
| 1634 | Ga0207681_10070088 | |||
| 1635 | Ga0207681_10333529 | |||
| 1636 | Ga0207694_10045720 | |||
| 1637 | Ga0207694_10086839 | |||
| 1638 | Ga0207694_10143076 | |||
| 1639 | Ga0207694_10281860 | |||
| 1640 | Ga0207650_10031890 | |||
| 1641 | Ga0207650_10043633 | |||
| 1642 | Ga0207650_10080435 | |||
| 1643 | Ga0207650_10131371 | |||
| 1644 | Ga0207650_10158597 | |||
| 1645 | Ga0207650_10225661 | |||
| 1646 | Ga0207659_10028675 | |||
| 1647 | Ga0207659_10096785 | |||
| 1648 | Ga0207659_10107339 | |||
| 1649 | Ga0207659_10157027 | |||
| 1650 | Ga0207659_10282086 | |||
| 1651 | Ga0207659_10362485 | |||
| 1652 | Ga0207659_10475067 | |||
| 1653 | Ga0207687_10149957 | |||
| 1654 | Ga0207644_10092279 | |||
| 1655 | Ga0207644_10188833 | |||
| 1656 | Ga0207644_10292607 | |||
| 1657 | Ga0207644_10535585 | |||
| 1658 | Ga0207690_10018477 | |||
| 1659 | Ga0207690_10238817 | |||
| 1660 | Ga0207690_10402467 | |||
| 1661 | Ga0207706_10006356 | |||
| 1662 | Ga0207706_10014853 | |||
| 1663 | Ga0207706_10026565 | |||
| 1664 | Ga0207706_10045674 | |||
| 1665 | Ga0207706_10065864 | |||
| 1666 | Ga0207706_10352759 | |||
| 1667 | Ga0207686_10014467 | |||
| 1668 | Ga0207686_10060441 | |||
| 1669 | Ga0207686_10105841 | |||
| 1670 | Ga0207686_10137709 | |||
| 1671 | Ga0207686_10186980 | |||
| 1672 | Ga0207686_10461705 | |||
| 1673 | Ga0207670_10033019 | |||
| 1674 | Ga0207670_10060645 | |||
| 1675 | Ga0207670_10085704 | |||
| 1676 | Ga0207670_10094592 | |||
| 1677 | Ga0207669_10145645 | |||
| 1678 | Ga0207704_10062204 | |||
| 1679 | Ga0207704_10113506 | |||
| 1680 | Ga0207691_10000001 | |||
| 1681 | Ga0207691_10002741 | |||
| 1682 | Ga0207691_10329902 | |||
| 1683 | Ga0207711_10267904 | |||
| 1684 | Ga0207711_10461652 | |||
| 1685 | Ga0207689_10005940 | |||
| 1686 | Ga0207689_10006806 | |||
| 1687 | Ga0207689_10007410 | |||
| 1688 | Ga0207689_10008752 | |||
| 1689 | Ga0207689_10011365 | |||
| 1690 | Ga0207689_10013953 | |||
| 1691 | Ga0207689_10016323 | |||
| 1692 | Ga0207689_10063505 | |||
| 1693 | Ga0207689_10092895 | |||
| 1694 | Ga0207689_10263759 | |||
| 1695 | Ga0207661_10021833 | |||
| 1696 | Ga0207661_10060351 | |||
| 1697 | Ga0207661_10126442 | |||
| 1698 | Ga0207661_10320475 | |||
| 1699 | Ga0207661_10491821 | |||
| 1700 | Ga0207661_10642799 | |||
| 1701 | Ga0207679_10016136 | |||
| 1702 | Ga0207679_10021807 | |||
| 1703 | Ga0207679_10033718 | |||
| 1704 | Ga0207679_10038027 | |||
| 1705 | Ga0207679_10281556 | |||
| 1706 | Ga0207679_10390783 | |||
| 1707 | Ga0207667_10000453 | |||
| 1708 | Ga0207667_10033746 | |||
| 1709 | Ga0207667_10063294 | |||
| 1710 | Ga0207667_10118422 | |||
| 1711 | Ga0207651_10014865 | |||
| 1712 | Ga0207651_10022746 | |||
| 1713 | Ga0207651_10030229 | |||
| 1714 | Ga0207651_10031501 | |||
| 1715 | Ga0207651_10033814 | |||
| 1716 | Ga0207651_10036594 | |||
| 1717 | Ga0207651_10054997 | |||
| 1718 | Ga0207651_10084792 | |||
| 1719 | Ga0207651_10120053 | |||
| 1720 | Ga0207651_10199934 | |||
| 1721 | Ga0207712_10023997 | |||
| 1722 | Ga0207712_10037794 | |||
| 1723 | Ga0207712_10042125 | |||
| 1724 | Ga0207712_10048392 | |||
| 1725 | Ga0207712_10054866 | |||
| 1726 | Ga0207712_10137405 | |||
| 1727 | Ga0207668_10000869 | |||
| 1728 | Ga0207668_10091974 | |||
| 1729 | Ga0207668_10164368 | |||
| 1730 | Ga0207668_10225935 | |||
| 1731 | Ga0207640_10022058 | |||
| 1732 | Ga0207640_10077085 | |||
| 1733 | Ga0207658_10002877 | |||
| 1734 | Ga0207658_10020539 | |||
| 1735 | Ga0207658_10020590 | |||
| 1736 | Ga0207658_10039811 | |||
| 1737 | Ga0207658_10052257 | |||
| 1738 | Ga0207658_10058281 | |||
| 1739 | Ga0207658_10150083 | |||
| 1740 | Ga0207658_10163679 | |||
| 1741 | Ga0207677_10050769 | |||
| 1742 | Ga0207677_10080481 | |||
| 1743 | Ga0207677_10097811 | |||
| 1744 | Ga0207677_10345930 | |||
| 1745 | Ga0207703_10004088 | |||
| 1746 | Ga0207703_10022141 | |||
| 1747 | Ga0207703_10051716 | |||
| 1748 | Ga0207703_10661373 | |||
| 1749 | Ga0207639_10002238 | |||
| 1750 | Ga0207639_10047581 | |||
| 1751 | Ga0207639_10105075 | |||
| 1752 | Ga0207639_10144591 | |||
| 1753 | Ga0207639_10196012 | |||
| 1754 | Ga0207639_10243757 | |||
| 1755 | Ga0207639_10247394 | |||
| 1756 | Ga0207639_10263551 | |||
| 1757 | Ga0207639_10324443 | |||
| 1758 | Ga0207639_10329494 | |||
| 1759 | Ga0207639_10421351 | |||
| 1760 | Ga0207678_10019197 | |||
| 1761 | Ga0207708_10039000 | |||
| 1762 | Ga0207708_10048195 | |||
| 1763 | Ga0207702_10026997 | |||
| 1764 | Ga0207702_10114466 | |||
| 1765 | Ga0207641_10000121 | |||
| 1766 | Ga0207641_10010823 | |||
| 1767 | Ga0207641_10013957 | |||
| 1768 | Ga0207641_10019401 | |||
| 1769 | Ga0207641_10119627 | |||
| 1770 | Ga0207641_10394484 | |||
| 1771 | Ga0207648_10002625 | |||
| 1772 | Ga0207648_10013430 | |||
| 1773 | Ga0207648_10016514 | |||
| 1774 | Ga0207648_10027371 | |||
| 1775 | Ga0207648_10144627 | |||
| 1776 | Ga0207648_10200755 | |||
| 1777 | Ga0207648_10337183 | |||
| 1778 | Ga0207648_10463175 | |||
| 1779 | Ga0207676_10038439 | |||
| 1780 | Ga0207676_10055443 | |||
| 1781 | Ga0207676_10070734 | |||
| 1782 | Ga0207676_10078366 | |||
| 1783 | Ga0207676_10475099 | |||
| 1784 | Ga0207674_10005332 | |||
| 1785 | Ga0207674_10007100 | |||
| 1786 | Ga0207674_10015613 | |||
| 1787 | Ga0207674_10051135 | |||
| 1788 | Ga0207674_10236693 | |||
| 1789 | Ga0207674_10330493 | |||
| 1790 | Ga0207674_10568319 | |||
| 1791 | Ga0207675_100002059 | |||
| 1792 | Ga0207675_100031608 | |||
| 1793 | Ga0207675_100070660 | |||
| 1794 | Ga0207675_100099312 | |||
| 1795 | Ga0207675_100440014 | |||
| 1796 | Ga0207683_10017329 | |||
| 1797 | Ga0207683_10030237 | |||
| 1798 | Ga0207683_10180996 | |||
| 1799 | Ga0207698_10005783 | |||
| 1800 | Ga0207698_10019868 | |||
| 1801 | Ga0207698_10208239 | |||
| 1802 | Ga0207698_10231367 | |||
| 1803 | Ga0207428_10033868 | |||
| 1804 | Ga0207428_10183035 | |||
| 1805 | Ga0268266_10000038 | |||
| 1806 | Ga0268266_10010826 | |||
| 1807 | Ga0268266_10191628 | |||
| 1808 | Ga0268266_10280725 | |||
| 1809 | Ga0268265_10027892 | |||
| 1810 | Ga0268265_10110087 | |||
| 1811 | Ga0268265_10118546 | |||
| 1812 | Ga0268265_10143991 | |||
| 1813 | Ga0268264_10000167 | |||
| 1814 | Ga0268264_10003997 | |||
| 1815 | Ga0268264_10009265 | |||
| 1816 | Ga0268264_10013426 | |||
| 1817 | Ga0268264_10022499 | |||
| 1818 | Ga0268264_10115863 | |||
| 1819 | Ga0268264_10278666 | |||
| 1820 | Ga0268264_10289823 | |||
| 1821 | Ga0268264_10323383 | |||
| 1822 | Ga0265336_10000007 | |||
| 1823 | Ga0307517_10025139 | |||
| 1824 | Ga0307515_10000469 | |||
| 1825 | Ga0307511_10008283 | |||
| 1826 | Ga0307512_10245653 | |||
| 1827 | Ga0265327_10076362 | |||
| 1828 | Ga0265316_10002446 | |||
| 1829 | Ga0307513_10077739 | |||
| 1830 | Ga0307509_10052614 | |||
| 1831 | Ga0307509_10136415 | |||
| 1832 | Ga0307508_10001613 | |||
| 1833 | Ga0307508_10256541 | |||
| 1834 | Ga0316576_10001081 | |||
| 1835 | Ga0316576_10048308 | |||
| 1836 | Ga0316578_10004394 | |||
| 1837 | Ga0307516_10004268 | |||
| 1838 | Ga0307516_10058896 | |||
| 1839 | Ga0307516_10164433 | |||
| 1840 | Ga0307405_10000018 | |||
| 1841 | Ga0307406_10056552 | |||
| 1842 | Ga0307407_10000015 | |||
| 1843 | Ga0307412_10093985 | |||
| 1844 | Ga0307409_100124233 | |||
| 1845 | Ga0307409_100585077 | |||
| 1846 | Ga0307416_100000025 | |||
| 1847 | Ga0307416_100185000 | |||
| 1848 | Ga0307416_100503717 | |||
| 1849 | Ga0307414_10003961 | |||
| 1850 | Ga0307414_10027951 | |||
| 1851 | Ga0307510_10000380 | |||
| 1852 | Ga0373923_0091968 | |||
| 1853 | Ga0373955_0223970 | |||
| 1854 | Ga0373935_0065008 | |||
| 1855 | Ga0373937_0027762 | |||
| 1856 | Ga0316582_0063175 | |||
| 1857 | Ga0316584_0007005 | |||
| 1858 | Ga0395900_0072926 | |||
| 1859 | Ga0395900_0341038 | |||
| 1860 | Ga0395900_0567408 | |||
| 1861 | Ga0395905_0002823 | |||
| 1862 | Ga0395905_0005630 | |||
| 1863 | Ga0395905_0128646 | |||
| 1864 | Ga0400489_00932 | |||
| 1865 | Ga0436365_0337807 | |||
| 1866 | Ga0436365_0446442 | |||
| 1867 | Ga0436365_0968987 | |||
| 1868 | Ga0436365_1161992 | |||
| 1869 | Ga0436365_1480084 | |||
| 1870 | Ga0439436_0000998 | |||
| 1871 | Ga0439436_0056906 | |||
| 1872 | Ga0439439_0007187 | |||
| 1873 | Ga0451793_1128229 | |||
| 1874 | Ga0451798_0789946 | |||
| 1875 | Ga0451851_0973538 | |||
| 1876 | Ga0439445_0015644 | |||
| 1877 | Ga0439448_0045488 | |||
| 1878 | Ga0439449_0002063 | |||
| 1879 | Ga0439449_0064488 | |||
| 1880 | Ga0439457_004078 | |||
| 1881 | Ga0439457_071486 | |||
| 1882 | Ga0451577_0013904 | |||
| 1883 | Ga0451577_0024955 | |||
| 1884 | Ga0451577_0122476 | |||
| 1885 | Ga0451577_0166623 | |||
| 1886 | Ga0451577_0179508 | |||
| 1887 | Ga0451577_0513468 | |||
| 1888 | Ga0451577_1046607 | |||
| 1889 | Ga0466969_0000246 | |||
| 1890 | Ga0466969_0065958 | |||
| 1891 | Ga0466972_0000025 | |||
| 1892 | Ga0466972_0005074 | |||
| 1893 | Ga0466972_0016146 | |||
| 1894 | Ga0466972_0105800 | |||
| 1895 | Ga0453683_0009005 | |||
| 1896 | Ga0453683_0022263 | |||
| 1897 | Ga0453683_0051960 | |||
| 1898 | Ga0453683_0095683 | |||
| 1899 | Ga0466965_0200193 | |||
| 1900 | Ga0466966_0004412 | |||
| 1901 | Ga0466961_0060606 | |||
| 1902 | Ga0466961_0082362 | |||
| 1903 | Ga0453684_0000440 | |||
| 1904 | Ga0453684_0012498 | |||
| 1905 | Ga0453684_0031999 | |||
| 1906 | Ga0453684_0035092 | |||
| 1907 | Ga0453684_0047532 | |||
| 1908 | Ga0453684_0133499 | |||
| 1909 | Ga0453684_0291212 | |||
| 1910 | Ga0453684_0342687 | |||
| 1911 | Ga0453684_0468530 | |||
| 1912 | Ga0453684_0541906 | |||
| 1913 | Ga0466971_0029515 | |||
| 1914 | Ga0466968_0091591 | |||
| 1915 | Ga0466970_0005458 | |||
| 1916 | Ga0466970_0043793 | |||
| 1917 | Ga0466959_0000017 | |||
| 1918 | Ga0466959_0021114 | |||
| 1919 | Ga0451576_0027225 | |||
| 1920 | Ga0451576_0033773 | |||
| 1921 | Ga0451576_0047592 | |||
| 1922 | Ga0451576_0157120 | |||
| 1923 | Ga0451576_0767533 | |||
| 1924 | Ga0466958_0069216 | |||
| 1925 | Ga0466967_0098688 | |||
| 1926 | Ga0495650_0031147 | |||
| 1927 | Ga0495580_0020527 | |||
| 1928 | Ga0495580_0130700 | |||
| 1929 | Ga0495594_0028749 | |||
| 1930 | Ga0495606_0003054 | |||
| 1931 | Ga0495608_0224629 | |||
| 1932 | Ga0495610_0000047 | |||
| 1933 | Ga0495610_0000904 | |||
| 1934 | Ga0495628_0049106 | |||
| 1935 | Ga0495630_0006664 | |||
| 1936 | Ga0495643_0049652 | |||
| 1937 | Ga0495648_0136981 | |||
| 1938 | Ga0495652_0208384 | |||
| 1939 | Ga0495598_0022199 | |||
| 1940 | Ga0495667_0099636 | |||
| 1941 | Ga0495667_0268170 | |||
| 1942 | Ga0495668_0000453 | |||
| 1943 | Ga0495668_0001518 | |||
| 1944 | Ga0495634_0079528 | |||
| 1945 | Ga0495634_0125601 | |||
| 1946 | Ga0495611_0003370 | |||
| 1947 | Ga0495625_0073581 | |||
| 1948 | Ga0495657_0306092 | |||
| 1949 | Ga0495623_0301213 | |||
| 1950 | Ga0495646_0245927 | |||
| 1951 | Ga0495658_0002499 | |||
| 1952 | Ga0495649_0044299 | |||
| 1953 | Ga0495649_0083012 | |||
| 1954 | Ga0495604_0042067 | |||
| 1955 | Ga0495672_0108430 | |||
| 1956 | Ga0495687_000001 | |||
| 1957 | Ga0495675_0182826 | |||
| 1958 | Ga0495686_0000004 | |||
| 1959 | Ga0495686_0000577 | |||
| 1960 | Ga0495686_0028262 | |||
| 1961 | Ga0495686_0106869 | |||
| 1962 | Ga0495686_0178938 | |||
| 1963 | Ga0496101_0010154 | |||
| 1964 | Ga0496101_0337118 | |||
| 1965 | Ga0496104_0524509 | |||
| 1966 | Ga0496104_0629802 | |||
| 1967 | Ga0496106_0196170 | |||
| 1968 | Ga0496112_0061676 | |||
| 1969 | Ga0496121_0000030 | |||
| 1970 | Ga0496124_0051801 | |||
| 1971 | Ga0496126_0016712 | |||
| 1972 | Ga0501031_0116888 | |||
| 1973 | Ga0501032_0002071 | |||
| 1974 | Ga0501032_0109448 | |||
| 1975 | Ga0501033_0076666 | |||
| 1976 | Ga0501033_0241911 | |||
| 1977 | Ga0501034_0014513 | |||
| 1978 | Ga0501034_0089868 | |||
| 1979 | Ga0501034_0143815 | |||
| 1980 | Ga0501036_0010214 | |||
| 1981 | Ga0501036_0016999 | |||
| 1982 | Ga0501036_0057478 | |||
| 1983 | Ga0501037_0082387 | |||
| 1984 | Ga0501038_0038680 | |||
| 1985 | Ga0501039_0020673 | |||
| 1986 | Ga0501040_0166313 | |||
| 1987 | Ga0501043_0001446 | |||
| 1988 | Ga0501043_0142998 | |||
| 1989 | Ga0501043_0208303 | |||
| 1990 | Ga0501043_0235371 | |||
| 1991 | Ga0501046_0026523 | |||
| 1992 | Ga0501046_0042705 | |||
| 1993 | Ga0501046_0251713 | |||
| 1994 | Ga0501047_0000014 | |||
| 1995 | Ga0501047_0031616 | |||
| 1996 | Ga0501047_0045624 | |||
| 1997 | Ga0501047_0108355 | |||
| 1998 | Ga0501047_0110170 | |||
| 1999 | Ga0501047_0282844 | |||
| 2000 | Ga0501048_0010340 | |||
| 2001 | Ga0501067_0035163 | |||
| 2002 | Ga0501070_0009038 | |||
| 2003 | Ga0501071_0041001 | |||
| 2004 | Ga0501072_0091876 | |||
| 2005 | Ga0501073_0002480 | |||
| 2006 | Ga0501073_0032328 | |||
| 2007 | Ga0501202_004157 | |||
| 2008 | Ga0501207_005672 | |||
| 2009 | Ga0501223_031393 | |||
| 2010 | Ga0501233_046619 | |||
| 2011 | Ga0501242_013656 | |||
| 2012 | Ga0501253_024416 | |||
| 2013 | Ga0501257_036941 | |||
| 2014 | Ga0501259_001982 | |||
| 2015 | Ga0501259_007371 | |||
| 2016 | Ga0501261_004784 | |||
| 2017 | Ga0501221_037622 | |||
| 2018 | Ga0501225_0001750 | |||
| 2019 | Ga0501225_0004489 | |||
| 2020 | Ga0501225_0029915 | |||
| 2021 | Ga0501225_0048119 | |||
| 2022 | Ga0501080_0035066 | |||
| 2023 | Ga0501080_0173263 | |||
| 2024 | Ga0501241_008348 | |||
| 2025 | Ga0501266_004386 | |||
| 2026 | Ga0501268_011400 | |||
| 2027 | Ga0501269_001678 | |||
| 2028 | Ga0501035_0012769 | |||
| 2029 | Ga0501035_0119494 | |||
| 2030 | Ga0501044_0004256 | |||
| 2031 | Ga0501044_0027270 | |||
| 2032 | Ga0501044_0078101 | |||
| 2033 | Ga0501044_0129257 | |||
| 2034 | Ga0501044_0210760 | |||
| 2035 | Ga0501044_0243013 | |||
| 2036 | Ga0501044_0420384 | |||
| 2037 | nmdc:mga0k408_19225_c1 | |||
| 2038 | nmdc:mga0k408_28497_c1 | |||
| 2039 | nmdc:mga0k408_34103_c1 | |||
| 2040 | nmdc:mga0k408_355166_c1 | |||
| 2041 | nmdc:mga0k408_54699_c1 | |||
| 2042 | nmdc:mga05p37_327139_c1 | |||
| 2043 | nmdc:mga05p37_3944_c1 | |||
| 2044 | nmdc:mga05p37_85778_c2 | |||
| 2045 | nmdc:mga05p37_93236_c1 | |||
| 2046 | nmdc:mga09592_457896_c1 | |||
| 2047 | nmdc:mga09592_74593_c1 | |||
| 2048 | nmdc:mga06r32_79583_c1 | |||
| 2049 | nmdc:mga08y16_18379_c1 | |||
| 2050 | nmdc:mga08y16_259415_c1 | |||
| 2051 | nmdc:mga08y16_90253_c1 | |||
| 2052 | Ga0495595_0026950 | |||
| 2053 | Ga0500578_0000136 | |||
| 2054 | Ga0500578_0219597 | |||
| 2055 | Ga0500644_0000344 | |||
| 2056 | Ga0500646_0011763 | |||
| 2057 | Ga0500646_0062022 | |||
| 2058 | Ga0500583_0000127 | |||
| 2059 | Ga0500583_0004905 | |||
| 2060 | Ga0500583_0011554 | |||
| 2061 | Ga0500583_0021234 | |||
| 2062 | Ga0500583_0091634 | |||
| 2063 | Ga0500562_000061 | |||
| 2064 | Ga0500568_0000439 | |||
| 2065 | Ga0500588_0000910 | |||
| 2066 | Ga0500588_0018497 | |||
| 2067 | Ga0500604_0007195 | |||
| 2068 | Ga0500616_0000698 | |||
| 2069 | Ga0500616_0010292 | |||
| 2070 | Ga0500616_0017066 | |||
| 2071 | Ga0500616_0045533 | |||
| 2072 | Ga0500622_0000156 | |||
| 2073 | Ga0500622_0000655 | |||
| 2074 | Ga0500622_0004617 | |||
| 2075 | Ga0500622_0020704 | |||
| 2076 | Ga0500636_0136494 | |||
| 2077 | Ga0500637_0047204 | |||
| 2078 | Ga0500611_000032 | |||
| 2079 | Ga0500645_062147 | |||
| 2080 | Ga0501084_0027666 | |||
| 2081 | Ga0501082_0128401 | |||
| 2082 | Ga0466962_0003273 | |||
| 2083 | 2586210394 | |||
| 2084 | 2738726220 | |||
| 2085 | 2738856020 | |||
| 2086 | 2739591027 | |||
| 2087 | 2739618073 | |||
| 2088 | 2739647443 | |||
| 2089 | 2819549961 | |||
| 2090 | 2819590262 | |||
| 2091 | 2842723438 | |||
| 2092 | 2842909932 | |||
| 2093 | 2849284791 | |||
| 2094 | 2857632211 | |||
| 2095 | 2881957873 | |||
| 2096 | 2904445970 | |||
| 2097 | 2914763482 | |||
| 2098 | 2929155029 | |||
| 2099 | 2946000281 | |||
| 2100 | 2954017168 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.985 | 1 | 248 |
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.981 | 1 | 250 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9803 | 1 | 248 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9764 | 1 | 248 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9758 | 1 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9828 | 1 | 248 | 3.90.230.10 |
| af_A0A1D6PU20_39_318_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9776 | 1 | 248 | 3.90.230.10 |
| af_I1J6Q1_1_201_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9776 | 48 | 248 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9774 | 1 | 249 | 3.90.230.10 |
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9768 | 13 | 124 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317EX38-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9975 | 1 | 263 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A3M1YZQ6-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9959 | 2 | 253 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A6EHP3-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9953 | 23 | 258 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A661YHV2-F1-model_v4 | deleted | 0.9945 | 1 | 223 |
|
| AF-A0A2D5LTK2-F1-model_v4 | deleted | 0.9931 | 1 | 255 |
|