F489052

General Info

Members Datasets Scaffolds Average Seq Length
1050 352 2100 270

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10174885|Ga0207680_101748852
Length 315
Sequence VAVFKAGRQLRRCRCDNDNLIFLEPGGLLSGFLFSLYNDDICMMMILKNKEEIELMRQSALLVSKTLAEVAKILRPGITSMTIDKMIGDFIRDHKAVPSFLDYRGYPFNSCISVNDVVVHGFPNNDPLKEGDIVSIDVGVILNEWHGDHAYTFAIGDPGDEVAQLIRGTKESLYKGIEKAVAGNRVGDISFAIQEHTEKKYGYGVVRELVGHGLGKSLHEDPQVPNYGKRGSGVKMKEGLVLAIEPMINLGTRKVYTEEDGWTVRTEDHKPSVHFEHDVCVKKGRADVLSNYAPIEAAEKANVNLFSAYSTELVV

Samples

Sample ID Description Type Environment
1 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
221 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
222 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
295 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
296 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
297 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
298 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
299 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
300 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
301 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
302 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
303 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
304 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
307 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
308 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
309 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
320 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
321 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
322 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
329 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
330 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
336 2738541278 Niastella sp. CF465 Isolate Unclassified
337 2738541302 Pedobacter sp. CF074 Isolate Unclassified
338 2739367651 Pedobacter sp. OK291 Isolate Unclassified
339 2739367656 Pedobacter sp. CF523 Isolate Unclassified
340 2739367663 Pedobacter sp. YR510 Isolate Unclassified
341 2818991437 Pedobacter terrae 518 Isolate Unclassified
342 2818991444 Filimonas endophytica 3197 Isolate Unclassified
343 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
344 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
345 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
346 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
347 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
348 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
349 2914759650 Rhizosphaericola mali Isolate Rhizosphere
350 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
351 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
352 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.19
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 0.76
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207680_10174885 3300025903 Unclassified 1448
2 MRS1b_contig_3231436 2162886011 Bacteria 1237
3 JGI24739J22299_10001379 3300001989 Bacteria 9127
4 JGI25406J46586_10036777 3300003203 Bacteria 1773
5 JGI25153J46596_10021720 3300003215 Bacteria 2385
6 rootH1_10187333 3300003316 Bacteria 2081
7 rootH2_10037762 3300003320 Bacteria 1598
8 rootH2_10069215 3300003320 Bacteria 8580
9 rootH2_10138765 3300003320 Bacteria 2357
10 rootH2_10155317 3300003320 Bacteria 1504
11 rootL2_10036246 3300003322 Bacteria 4822
12 rootL2_10062004 3300003322 Bacteria 3019
13 rootL2_10066724 3300003322 Bacteria 3127
14 rootL2_10156908 3300003322 Bacteria 3141
15 rootL2_10199815 3300003322 Bacteria 5835
16 rootL2_10278758 3300003322 Bacteria 2645
17 rootL2_10317439 3300003322 Bacteria 2198
18 rootH1_10041523 3300003323 Bacteria 3402
19 rootH1_10046893 3300003323 Bacteria 2017
20 rootH1_10096119 3300003323 Bacteria 12588
21 JGI25160J50197_1001095 3300003354 Bacteria 13838
22 Ga0055535_1003322 3300003761 Unclassified 4636
23 Ga0055536_1000003 3300003781 Bacteria 447744
24 Ga0055530_10001176 3300003791 Bacteria 20232
25 Ga0055531_10000133 3300003794 Bacteria 84995
26 Ga0055531_10000166 3300003794 Bacteria 74728
27 Ga0065714_10002192 3300005288 Bacteria 92967
28 Ga0065714_10088526 3300005288 Bacteria 2014
29 Ga0065714_10128866 3300005288 Bacteria 1257
30 Ga0065704_10204218 3300005289 Bacteria 1134
31 Ga0065712_10011320 3300005290 Bacteria 2533
32 Ga0065712_10020395 3300005290 Unclassified 1384
33 Ga0065712_10074886 3300005290 Bacteria 3987
34 Ga0065712_10162279 3300005290 Bacteria 1278
35 Ga0065712_10209505 3300005290 Bacteria 1078
36 Ga0065712_10315571 3300005290 Bacteria 837
37 Ga0065715_10005801 3300005293 Bacteria 3037
38 Ga0065707_10112842 3300005295 Bacteria 2347
39 Ga0065707_10294102 3300005295 Bacteria 1018
40 Ga0065707_10301143 3300005295 Bacteria 1004
41 Ga0070658_10094269 3300005327 Bacteria 2470
42 Ga0070658_10150547 3300005327 Bacteria 1948
43 Ga0070658_10422714 3300005327 Bacteria 1146
44 Ga0070676_10017260 3300005328 Bacteria 3995
45 Ga0070676_10035933 3300005328 Bacteria 2852
46 Ga0070676_10275360 3300005328 Bacteria 1132
47 Ga0070683_100001488 3300005329 Bacteria 18077
48 Ga0070683_100006686 3300005329 Bacteria 9680
49 Ga0070683_100013377 3300005329 Bacteria 7155
50 Ga0070683_100139428 3300005329 Bacteria 2297
51 Ga0070683_100496968 3300005329 Bacteria 1165
52 Ga0070670_100043938 3300005331 Bacteria 3841
53 Ga0070670_100067766 3300005331 Bacteria 3062
54 Ga0070670_100166339 3300005331 Bacteria 1912
55 Ga0068869_100014592 3300005334 Bacteria 5253
56 Ga0068869_100040382 3300005334 Bacteria 3337
57 Ga0068869_100112960 3300005334 Bacteria 2068
58 Ga0068869_100259567 3300005334 Unclassified 1391
59 Ga0070666_10000191 3300005335 Bacteria 42149
60 Ga0070666_10000736 3300005335 Bacteria 19845
61 Ga0070666_10020630 3300005335 Bacteria 4261
62 Ga0070666_10024266 3300005335 Bacteria 3949
63 Ga0070666_10027930 3300005335 Bacteria 3700
64 Ga0070666_10032894 3300005335 Bacteria 3428
65 Ga0070666_10286860 3300005335 Unclassified 1171
66 Ga0070680_100001401 3300005336 Bacteria 17413
67 Ga0070680_100041558 3300005336 Bacteria 3728
68 Ga0070682_100002086 3300005337 Bacteria 11122
69 Ga0070682_100023351 3300005337 Bacteria 3670
70 Ga0070682_100035375 3300005337 Bacteria 3049
71 Ga0070682_100108505 3300005337 Bacteria 1845
72 Ga0068868_100004630 3300005338 Bacteria 9650
73 Ga0068868_100006935 3300005338 Bacteria 8051
74 Ga0068868_100023189 3300005338 Bacteria 4695
75 Ga0068868_100097784 3300005338 Unclassified 2372
76 Ga0068868_100144787 3300005338 Bacteria 1953
77 Ga0068868_100146899 3300005338 Unclassified 1939
78 Ga0068868_100367617 3300005338 Bacteria 1235
79 Ga0070660_100012064 3300005339 Bacteria 6167
80 Ga0070660_100368188 3300005339 Bacteria 1185
81 Ga0070689_100010221 3300005340 Bacteria 6685
82 Ga0070689_100027952 3300005340 Bacteria 4258
83 Ga0070689_100032331 3300005340 Bacteria 3979
84 Ga0070689_100073429 3300005340 Bacteria 2675
85 Ga0070689_100265952 3300005340 Bacteria 1418
86 Ga0070689_100309677 3300005340 Unclassified 1316
87 Ga0070691_10005091 3300005341 Bacteria 5973
88 Ga0070687_100033870 3300005343 Bacteria 2525
89 Ga0070661_100015125 3300005344 Bacteria 5444
90 Ga0070661_100016234 3300005344 Bacteria 5260
91 Ga0070661_100027839 3300005344 Bacteria 4073
92 Ga0070668_100004151 3300005347 Bacteria 10731
93 Ga0070668_100011116 3300005347 Bacteria 6701
94 Ga0070668_100020025 3300005347 Bacteria 5045
95 Ga0070668_100184107 3300005347 Bacteria 1708
96 Ga0070669_100008748 3300005353 Bacteria 7222
97 Ga0070669_100396208 3300005353 Unclassified 1129
98 Ga0070669_100451207 3300005353 Bacteria 1060
99 Ga0070675_100085433 3300005354 Bacteria 2636
100 Ga0070675_100105888 3300005354 Bacteria 2373
101 Ga0070675_100112578 3300005354 Bacteria 2304
102 Ga0070675_100133412 3300005354 Bacteria 2118
103 Ga0070675_100138132 3300005354 Bacteria 2081
104 Ga0070675_100250983 3300005354 Bacteria 1548
105 Ga0070675_100292360 3300005354 Bacteria 1434
106 Ga0070675_100741612 3300005354 Bacteria 896
107 Ga0070671_100029574 3300005355 Bacteria 4517
108 Ga0070671_100053645 3300005355 Bacteria 3351
109 Ga0070671_100116246 3300005355 Bacteria 2249
110 Ga0070674_100002220 3300005356 Bacteria 10679
111 Ga0070673_100006656 3300005364 Bacteria 7534
112 Ga0070673_100016732 3300005364 Bacteria 5194
113 Ga0070673_100019294 3300005364 Bacteria 4894
114 Ga0070673_100024297 3300005364 Bacteria 4441
115 Ga0070673_100042547 3300005364 Bacteria 3503
116 Ga0070673_100051203 3300005364 Bacteria 3232
117 Ga0070673_100419848 3300005364 Bacteria 1199
118 Ga0070673_100443434 3300005364 Bacteria 1167
119 Ga0070688_100013545 3300005365 Bacteria 4603
120 Ga0070688_100037093 3300005365 Bacteria 2969
121 Ga0070688_100052736 3300005365 Bacteria 2542
122 Ga0070688_100111398 3300005365 Unclassified 1821
123 Ga0070688_100201536 3300005365 Bacteria 1392
124 Ga0070659_100026473 3300005366 Bacteria 4463
125 Ga0070659_100031231 3300005366 Bacteria 4125
126 Ga0070659_100245588 3300005366 Bacteria 1482
127 Ga0070667_100000248 3300005367 Bacteria 61183
128 Ga0070667_100003905 3300005367 Bacteria 12660
129 Ga0070667_100031740 3300005367 Bacteria 4403
130 Ga0070667_100096997 3300005367 Unclassified 2543
131 Ga0070667_100113769 3300005367 Unclassified 2349
132 Ga0070667_100267577 3300005367 Unclassified 1532
133 Ga0070667_100312033 3300005367 Bacteria 1418
134 Ga0070700_100022637 3300005441 Bacteria 3668
135 Ga0070678_100105608 3300005456 Bacteria 2193
136 Ga0070678_100321889 3300005456 Bacteria 1321
137 Ga0070662_100004870 3300005457 Bacteria 8518
138 Ga0070662_100011898 3300005457 Bacteria 5752
139 Ga0070662_100021120 3300005457 Bacteria 4443
140 Ga0070662_100022782 3300005457 Bacteria 4293
141 Ga0070681_10004039 3300005458 Bacteria 13846
142 Ga0070681_10049604 3300005458 Bacteria 4191
143 Ga0070681_10129083 3300005458 Bacteria 2460
144 Ga0068867_100032795 3300005459 Bacteria 3758
145 Ga0068867_100128708 3300005459 Bacteria 1965
146 Ga0068867_100137671 3300005459 Bacteria 1905
147 Ga0068867_100418364 3300005459 Bacteria 1135
148 Ga0070685_10016702 3300005466 Bacteria 3915
149 Ga0070685_10092079 3300005466 Bacteria 1836
150 Ga0070698_100002802 3300005471 Bacteria 19186
151 Ga0070698_100006186 3300005471 Bacteria 13034
152 Ga0070698_100016568 3300005471 Bacteria 7777
153 Ga0070699_100471264 3300005518 Bacteria 1139
154 Ga0070679_100002167 3300005530 Bacteria 17712
155 Ga0070679_100056240 3300005530 Bacteria 3920
156 Ga0070684_100003339 3300005535 Bacteria 12014
157 Ga0070684_100058514 3300005535 Bacteria 3368
158 Ga0070684_100060911 3300005535 Bacteria 3302
159 Ga0070684_100063429 3300005535 Bacteria 3239
160 Ga0068853_100000250 3300005539 Bacteria 37737
161 Ga0068853_100003318 3300005539 Bacteria 12319
162 Ga0068853_100006139 3300005539 Bacteria 9517
163 Ga0068853_100030359 3300005539 Bacteria 4565
164 Ga0068853_100043755 3300005539 Bacteria 3831
165 Ga0068853_100084468 3300005539 Unclassified 2782
166 Ga0068853_100145967 3300005539 Bacteria 2126
167 Ga0068853_100221844 3300005539 Bacteria 1727
168 Ga0068853_100272722 3300005539 Bacteria 1558
169 Ga0068853_100307260 3300005539 Bacteria 1467
170 Ga0068853_100370851 3300005539 Unclassified 1335
171 Ga0068853_100382177 3300005539 Bacteria 1315
172 Ga0070672_100001565 3300005543 Bacteria 14168
173 Ga0070693_100067745 3300005547 Bacteria 2093
174 Ga0070665_100018617 3300005548 Bacteria 6960
175 Ga0070665_100085759 3300005548 Bacteria 3155
176 Ga0070704_100193181 3300005549 Bacteria 1638
177 Ga0068855_100000133 3300005563 Bacteria 94906
178 Ga0068855_100003486 3300005563 Bacteria 19264
179 Ga0070664_100004058 3300005564 Bacteria 11762
180 Ga0070664_100030677 3300005564 Bacteria 4487
181 Ga0070664_100053226 3300005564 Bacteria 3431
182 Ga0070664_100126731 3300005564 Bacteria 2240
183 Ga0070664_100372022 3300005564 Bacteria 1303
184 Ga0070664_100423727 3300005564 Bacteria 1219
185 Ga0070664_100484441 3300005564 Bacteria 1138
186 Ga0068857_100010012 3300005577 Bacteria 8231
187 Ga0068857_100023615 3300005577 Bacteria 5414
188 Ga0068857_100137417 3300005577 Bacteria 2207
189 Ga0068857_100178481 3300005577 Bacteria 1932
190 Ga0068857_100224023 3300005577 Unclassified 1718
191 Ga0068857_100255602 3300005577 Bacteria 1607
192 Ga0068854_100005730 3300005578 Bacteria 7853
193 Ga0068854_100047179 3300005578 Bacteria 3069
194 Ga0068854_100063403 3300005578 Bacteria 2683
195 Ga0068854_100069838 3300005578 Bacteria 2566
196 Ga0068856_100004245 3300005614 Bacteria 14307
197 Ga0068856_100014967 3300005614 Bacteria 7492
198 Ga0068856_100048124 3300005614 Bacteria 4201
199 Ga0068856_100086534 3300005614 Bacteria 3114
200 Ga0068852_100001400 3300005616 Bacteria 16228
201 Ga0068852_100008317 3300005616 Bacteria 7636
202 Ga0068852_100009108 3300005616 Bacteria 7349
203 Ga0068852_100032096 3300005616 Bacteria 4344
204 Ga0068852_100064916 3300005616 Bacteria 3184
205 Ga0068852_100168770 3300005616 Bacteria 2049
206 Ga0068852_100175248 3300005616 Bacteria 2013
207 Ga0068852_100242383 3300005616 Bacteria 1724
208 Ga0068852_100258940 3300005616 Unclassified 1670
209 Ga0068852_100324612 3300005616 Bacteria 1496
210 Ga0068859_100000037 3300005617 Bacteria 165480
211 Ga0068859_100002491 3300005617 Bacteria 18742
212 Ga0068859_100134497 3300005617 Bacteria 2544
213 Ga0068859_100172495 3300005617 Unclassified 2244
214 Ga0068859_100230504 3300005617 Bacteria 1940
215 Ga0068859_101003427 3300005617 Bacteria 917
216 Ga0068864_100012286 3300005618 Bacteria 7077
217 Ga0068864_100015889 3300005618 Bacteria 6265
218 Ga0068864_100018148 3300005618 Bacteria 5872
219 Ga0068864_100053299 3300005618 Bacteria 3489
220 Ga0068864_100082595 3300005618 Bacteria 2820
221 Ga0068864_100096024 3300005618 Bacteria 2623
222 Ga0068866_10143664 3300005718 Bacteria 1373
223 Ga0068866_10212241 3300005718 Unclassified 1163
224 Ga0068861_100010689 3300005719 Bacteria 6376
225 Ga0068861_100130693 3300005719 Bacteria 2038
226 Ga0068861_100161210 3300005719 Bacteria 1850
227 Ga0068861_100315205 3300005719 Bacteria 1360
228 Ga0068851_10026295 3300005834 Bacteria 2859
229 Ga0068851_10075595 3300005834 Bacteria 1750
230 Ga0068851_10124041 3300005834 Bacteria 1391
231 Ga0068851_10150963 3300005834 Bacteria 1270
232 Ga0068870_10006960 3300005840 Bacteria 5016
233 Ga0068870_10029248 3300005840 Bacteria 2774
234 Ga0068870_10044049 3300005840 Bacteria 2330
235 Ga0068870_10221306 3300005840 Bacteria 1159
236 Ga0068863_100001373 3300005841 Bacteria 24175
237 Ga0068863_100004306 3300005841 Bacteria 14020
238 Ga0068863_100038107 3300005841 Bacteria 4575
239 Ga0068863_100051623 3300005841 Bacteria 3897
240 Ga0068863_100062458 3300005841 Bacteria 3523
241 Ga0068863_100160218 3300005841 Bacteria 2155
242 Ga0068863_100400242 3300005841 Unclassified 1343
243 Ga0068863_100578756 3300005841 Bacteria 1110
244 Ga0068858_100071652 3300005842 Bacteria 3215
245 Ga0068858_100516390 3300005842 Bacteria 1155
246 Ga0068860_100000097 3300005843 Bacteria 146573
247 Ga0068860_100004260 3300005843 Bacteria 14650
248 Ga0068860_100006743 3300005843 Bacteria 11515
249 Ga0068860_100008499 3300005843 Bacteria 10228
250 Ga0068860_100019489 3300005843 Bacteria 6577
251 Ga0068860_100022955 3300005843 Bacteria 6033
252 Ga0068860_100319797 3300005843 Bacteria 1523
253 Ga0068860_100857837 3300005843 Bacteria 923
254 Ga0068862_100007901 3300005844 Bacteria 8802
255 Ga0068862_100008890 3300005844 Bacteria 8317
256 Ga0068862_100110622 3300005844 Bacteria 2411
257 Ga0068862_100187982 3300005844 Bacteria 1857
258 Ga0068862_100317394 3300005844 Unclassified 1437
259 Ga0081539_10004959 3300005985 Bacteria 14110
260 Ga0070716_100233610 3300006173 Bacteria 1243
261 Ga0075366_10005546 3300006195 Bacteria 6839
262 Ga0075366_10005748 3300006195 Bacteria 6733
263 Ga0075366_10014280 3300006195 Bacteria 4535
264 Ga0097621_100044821 3300006237 Bacteria 3570
265 Ga0097621_100070259 3300006237 Bacteria 2891
266 Ga0097621_100090377 3300006237 Bacteria 2562
267 Ga0097621_100109305 3300006237 Bacteria 2335
268 Ga0097621_100271363 3300006237 Bacteria 1491
269 Ga0097621_100354670 3300006237 Unclassified 1305
270 Ga0097621_100610755 3300006237 Bacteria 998
271 Ga0068871_100004890 3300006358 Bacteria 9357
272 Ga0068871_100015089 3300006358 Bacteria 5775
273 Ga0068871_100024794 3300006358 Bacteria 4655
274 Ga0068871_100044750 3300006358 Bacteria 3562
275 Ga0068871_100087735 3300006358 Unclassified 2587
276 Ga0068871_100133402 3300006358 Unclassified 2107
277 Ga0075428_100081557 3300006844 Bacteria 3530
278 Ga0075430_100011474 3300006846 Bacteria 7527
279 Ga0075431_100022872 3300006847 Bacteria 6389
280 Ga0075431_100152015 3300006847 Unclassified 2383
281 Ga0075434_100374703 3300006871 Bacteria 1444
282 Ga0075429_100007351 3300006880 Bacteria 9561
283 Ga0075429_100079091 3300006880 Bacteria 2866
284 Ga0068865_100003571 3300006881 Bacteria 9342
285 Ga0068865_100046762 3300006881 Bacteria 2971
286 Ga0068865_100229034 3300006881 Bacteria 1457
287 Ga0068865_100352328 3300006881 Bacteria 1193
288 Ga0097620_100000037 3300006931 Bacteria 165480
289 Ga0097620_100002491 3300006931 Bacteria 18742
290 Ga0097620_100134504 3300006931 Bacteria 2544
291 Ga0097620_100172490 3300006931 Unclassified 2244
292 Ga0097620_100230494 3300006931 Bacteria 1940
293 Ga0097620_101003323 3300006931 Bacteria 917
294 Ga0105251_10071058 3300009011 Unclassified 1620
295 Ga0105240_10000398 3300009093 Bacteria 81045
296 Ga0105240_10001595 3300009093 Bacteria 38516
297 Ga0105240_10016926 3300009093 Bacteria 9853
298 Ga0105240_10031869 3300009093 Bacteria 6830
299 Ga0105240_10050768 3300009093 Bacteria 5226
300 Ga0105240_10074719 3300009093 Bacteria 4182
301 Ga0105240_10295321 3300009093 Bacteria 1856
302 Ga0111539_10009984 3300009094 Bacteria 11968
303 Ga0111539_10037511 3300009094 Bacteria 5851
304 Ga0111539_10054054 3300009094 Bacteria 4779
305 Ga0111539_10066150 3300009094 Bacteria 4269
306 Ga0111539_10140184 3300009094 Bacteria 2831
307 Ga0111539_10272888 3300009094 Bacteria 1968
308 Ga0111539_10804181 3300009094 Unclassified 1094
309 Ga0105245_10091135 3300009098 Bacteria 2805
310 Ga0114129_10006463 3300009147 Bacteria 16621
311 Ga0114129_10025561 3300009147 Bacteria 8366
312 Ga0114129_10059189 3300009147 Bacteria 5356
313 Ga0114129_10095068 3300009147 Bacteria 4127
314 Ga0114129_11109264 3300009147 Bacteria 990
315 Ga0105243_10118580 3300009148 Bacteria 2227
316 Ga0105241_10000537 3300009174 Bacteria 28565
317 Ga0105241_10000769 3300009174 Bacteria 24406
318 Ga0105241_10004422 3300009174 Bacteria 10394
319 Ga0105241_10029296 3300009174 Bacteria 4107
320 Ga0105241_10076487 3300009174 Unclassified 2611
321 Ga0105241_10135527 3300009174 Bacteria 1999
322 Ga0105241_10271373 3300009174 Bacteria 1445
323 Ga0105241_10273302 3300009174 Bacteria 1440
324 Ga0105242_10059726 3300009176 Bacteria 3130
325 Ga0105242_10083142 3300009176 Bacteria 2680
326 Ga0105242_10105247 3300009176 Unclassified 2396
327 Ga0105242_10143570 3300009176 Bacteria 2074
328 Ga0105242_10289430 3300009176 Bacteria 1491
329 Ga0105248_10092740 3300009177 Bacteria 3401
330 Ga0105248_10104833 3300009177 Bacteria 3188
331 Ga0105248_10182101 3300009177 Bacteria 2367
332 Ga0105248_10308124 3300009177 Bacteria 1783
333 Ga0105248_10488875 3300009177 Unclassified 1387
334 Ga0105248_11012099 3300009177 Bacteria 939
335 Ga0105237_10001588 3300009545 Bacteria 29579
336 Ga0105237_10001799 3300009545 Bacteria 27692
337 Ga0105237_10002614 3300009545 Bacteria 22176
338 Ga0105237_10007892 3300009545 Bacteria 11597
339 Ga0105237_10037741 3300009545 Bacteria 4882
340 Ga0105237_10384591 3300009545 Unclassified 1408
341 Ga0105238_10008067 3300009551 Bacteria 10530
342 Ga0105238_10051614 3300009551 Bacteria 4136
343 Ga0105238_10111019 3300009551 Bacteria 2722
344 Ga0105238_10130087 3300009551 Unclassified 2495
345 Ga0105238_10341939 3300009551 Bacteria 1485
346 Ga0105238_10522541 3300009551 Bacteria 1189
347 Ga0105249_10009374 3300009553 Bacteria 8565
348 Ga0105249_10029286 3300009553 Bacteria 4972
349 Ga0105249_10042127 3300009553 Bacteria 4151
350 Ga0105249_10050930 3300009553 Bacteria 3776
351 Ga0105249_10101172 3300009553 Bacteria 2710
352 Ga0105249_10474095 3300009553 Bacteria 1293
353 Ga0105239_10000436 3300010375 Bacteria 61031
354 Ga0105239_10002246 3300010375 Bacteria 24694
355 Ga0105239_10009301 3300010375 Bacteria 11107
356 Ga0105239_10010718 3300010375 Bacteria 10239
357 Ga0105239_10045244 3300010375 Bacteria 4824
358 Ga0105239_10063312 3300010375 Bacteria 4061
359 Ga0105239_10131025 3300010375 Bacteria 2789
360 Ga0105239_10933445 3300010375 Bacteria 996
361 Ga0105239_11010697 3300010375 Bacteria 956
362 Ga0105246_10098378 3300011119 Bacteria 2125
363 Ga0105246_10272180 3300011119 Bacteria 1354
364 Ga0157373_10000127 3300013100 Bacteria 59397
365 Ga0157373_10016509 3300013100 Bacteria 5384
366 Ga0157373_10017789 3300013100 Bacteria 5175
367 Ga0157373_10023280 3300013100 Bacteria 4492
368 Ga0157373_10052762 3300013100 Bacteria 2892
369 Ga0157371_10000009 3300013102 Bacteria 392895
370 Ga0157371_10001161 3300013102 Bacteria 28350
371 Ga0157371_10020069 3300013102 Bacteria 4921
372 Ga0157371_10038115 3300013102 Bacteria 3439
373 Ga0157371_10049377 3300013102 Bacteria 2989
374 Ga0157371_10079931 3300013102 Bacteria 2315
375 Ga0157371_10105007 3300013102 Bacteria 2004
376 Ga0157371_10107026 3300013102 Bacteria 1984
377 Ga0157371_10223539 3300013102 Bacteria 1352
378 Ga0157371_10241886 3300013102 Unclassified 1298
379 Ga0157370_10001172 3300013104 Bacteria 32684
380 Ga0157370_10002300 3300013104 Bacteria 23142
381 Ga0157370_10019212 3300013104 Bacteria 6863
382 Ga0157370_10021508 3300013104 Bacteria 6428
383 Ga0157370_10034319 3300013104 Bacteria 4942
384 Ga0157370_10063717 3300013104 Bacteria 3491
385 Ga0157370_10076387 3300013104 Bacteria 3155
386 Ga0157370_10174610 3300013104 Bacteria 1997
387 Ga0157370_10226086 3300013104 Bacteria 1732
388 Ga0157370_10235449 3300013104 Bacteria 1694
389 Ga0157369_10000006 3300013105 Bacteria 412230
390 Ga0157369_10033658 3300013105 Bacteria 5630
391 Ga0157369_10035022 3300013105 Bacteria 5506
392 Ga0157369_10035205 3300013105 Bacteria 5491
393 Ga0157369_10122279 3300013105 Bacteria 2761
394 Ga0157369_10176508 3300013105 Bacteria 2249
395 Ga0157369_10243984 3300013105 Bacteria 1876
396 Ga0157369_10343900 3300013105 Bacteria 1549
397 Ga0157369_10670862 3300013105 Unclassified 1068
398 Ga0157369_11020687 3300013105 Unclassified 847
399 Ga0157374_10000001 3300013296 Bacteria 1077351
400 Ga0157374_10000500 3300013296 Bacteria 35513
401 Ga0157374_10005963 3300013296 Bacteria 10306
402 Ga0157374_10007705 3300013296 Bacteria 9193
403 Ga0157374_10028847 3300013296 Bacteria 5017
404 Ga0157374_10039891 3300013296 Bacteria 4323
405 Ga0157374_10089069 3300013296 Bacteria 2940
406 Ga0157374_10182509 3300013296 Bacteria 2050
407 Ga0157374_10227752 3300013296 Bacteria 1830
408 Ga0157374_10467323 3300013296 Bacteria 1264
409 Ga0157374_10500423 3300013296 Unclassified 1220
410 Ga0157378_10005638 3300013297 Bacteria 10969
411 Ga0157378_10015524 3300013297 Bacteria 6672
412 Ga0157378_10033932 3300013297 Bacteria 4514
413 Ga0157378_10047605 3300013297 Bacteria 3812
414 Ga0157378_10109236 3300013297 Bacteria 2533
415 Ga0157378_10130335 3300013297 Bacteria 2327
416 Ga0157378_10132689 3300013297 Bacteria 2307
417 Ga0157378_10347359 3300013297 Unclassified 1448
418 Ga0157378_10431856 3300013297 Bacteria 1304
419 Ga0157378_10553984 3300013297 Bacteria 1155
420 Ga0157378_10621602 3300013297 Bacteria 1093
421 Ga0157378_10714107 3300013297 Bacteria 1023
422 Ga0157378_10780236 3300013297 Bacteria 980
423 Ga0163162_10000304 3300013306 Bacteria 45418
424 Ga0163162_10000773 3300013306 Bacteria 29793
425 Ga0163162_10001942 3300013306 Bacteria 19416
426 Ga0163162_10004755 3300013306 Bacteria 13101
427 Ga0163162_10007765 3300013306 Bacteria 10452
428 Ga0163162_10022131 3300013306 Bacteria 6265
429 Ga0163162_10039131 3300013306 Bacteria 4737
430 Ga0163162_10085604 3300013306 Bacteria 3229
431 Ga0163162_10232155 3300013306 Bacteria 1975
432 Ga0163162_10296919 3300013306 Bacteria 1747
433 Ga0163162_10448100 3300013306 Bacteria 1423
434 Ga0163162_10577451 3300013306 Bacteria 1251
435 Ga0157372_10000288 3300013307 Bacteria 56031
436 Ga0157372_10003109 3300013307 Bacteria 17892
437 Ga0157372_10005863 3300013307 Bacteria 13076
438 Ga0157372_10059984 3300013307 Bacteria 4257
439 Ga0157372_10065955 3300013307 Bacteria 4067
440 Ga0157372_10089440 3300013307 Bacteria 3498
441 Ga0157372_10116600 3300013307 Unclassified 3062
442 Ga0157372_10135723 3300013307 Bacteria 2833
443 Ga0157372_10153024 3300013307 Bacteria 2663
444 Ga0157372_10180194 3300013307 Bacteria 2445
445 Ga0157372_10226918 3300013307 Bacteria 2165
446 Ga0157372_10234025 3300013307 Bacteria 2130
447 Ga0157372_10282954 3300013307 Bacteria 1928
448 Ga0157372_10296782 3300013307 Bacteria 1880
449 Ga0157372_10330905 3300013307 Bacteria 1774
450 Ga0157372_10403033 3300013307 Bacteria 1594
451 Ga0157372_10556396 3300013307 Bacteria 1337
452 Ga0157372_10591157 3300013307 Bacteria 1294
453 Ga0157372_10632401 3300013307 Bacteria 1247
454 Ga0157372_10705761 3300013307 Bacteria 1174
455 Ga0157372_10761483 3300013307 Unclassified 1126
456 Ga0157375_10001463 3300013308 Bacteria 20315
457 Ga0157375_10029615 3300013308 Bacteria 5152
458 Ga0157375_10053872 3300013308 Bacteria 3960
459 Ga0157375_10059597 3300013308 Bacteria 3783
460 Ga0157375_10074000 3300013308 Bacteria 3427
461 Ga0157375_10204555 3300013308 Bacteria 2130
462 Ga0157375_10206183 3300013308 Unclassified 2122
463 Ga0157375_10666578 3300013308 Bacteria 1196
464 Ga0163163_10001732 3300014325 Bacteria 18387
465 Ga0163163_10003543 3300014325 Bacteria 13261
466 Ga0163163_10018795 3300014325 Bacteria 6479
467 Ga0163163_10055223 3300014325 Bacteria 3926
468 Ga0163163_10071221 3300014325 Bacteria 3464
469 Ga0163163_10072197 3300014325 Bacteria 3440
470 Ga0163163_10091809 3300014325 Bacteria 3051
471 Ga0163163_10139867 3300014325 Bacteria 2463
472 Ga0163163_10368163 3300014325 Unclassified 1494
473 Ga0163163_10432803 3300014325 Bacteria 1375
474 Ga0163163_10478120 3300014325 Unclassified 1307
475 Ga0157380_10001083 3300014326 Bacteria 17500
476 Ga0157380_10004590 3300014326 Bacteria 9590
477 Ga0157380_10016648 3300014326 Bacteria 5428
478 Ga0157380_10141439 3300014326 Unclassified 2068
479 Ga0157380_10338490 3300014326 Bacteria 1402
480 Ga0182008_10000874 3300014497 Bacteria 20921
481 Ga0157377_10004045 3300014745 Bacteria 6691
482 Ga0157377_10016138 3300014745 Bacteria 3837
483 Ga0157377_10060402 3300014745 Bacteria 2164
484 Ga0157377_10078560 3300014745 Bacteria 1924
485 Ga0157377_10133521 3300014745 Bacteria 1519
486 Ga0157377_10240954 3300014745 Bacteria 1167
487 Ga0157379_10000845 3300014968 Bacteria 24814
488 Ga0157379_10031135 3300014968 Bacteria 4752
489 Ga0157379_10076794 3300014968 Bacteria 2991
490 Ga0157379_10101588 3300014968 Bacteria 2581
491 Ga0157379_10148396 3300014968 Bacteria 2115
492 Ga0157379_10148786 3300014968 Bacteria 2112
493 Ga0157379_10182711 3300014968 Bacteria 1895
494 Ga0157379_10244614 3300014968 Unclassified 1627
495 Ga0157379_10245116 3300014968 Bacteria 1626
496 Ga0157379_10445793 3300014968 Unclassified 1194
497 Ga0157376_10007592 3300014969 Bacteria 7760
498 Ga0157376_10016450 3300014969 Bacteria 5616
499 Ga0157376_10043042 3300014969 Bacteria 3704
500 Ga0157376_10062316 3300014969 Bacteria 3138
501 Ga0157376_10067706 3300014969 Bacteria 3021
502 Ga0157376_10090037 3300014969 Bacteria 2654
503 Ga0157376_10174534 3300014969 Unclassified 1960
504 Ga0157376_10891064 3300014969 Bacteria 907
505 Ga0182006_1000113 3300015261 Bacteria 86691
506 Ga0182006_1000321 3300015261 Bacteria 41748
507 Ga0182006_1006032 3300015261 Bacteria 5673
508 Ga0182007_10000122 3300015262 Bacteria 54069
509 Ga0183373_1006 3300015682 Bacteria 328276
510 Ga0163161_10000089 3300017792 Bacteria 91093
511 Ga0163161_10000218 3300017792 Bacteria 52323
512 Ga0163161_10005594 3300017792 Bacteria 8712
513 Ga0163161_10018758 3300017792 Bacteria 4849
514 Ga0163161_10048358 3300017792 Bacteria 3071
515 Ga0163161_10159294 3300017792 Bacteria 1721
516 Ga0163161_10343880 3300017792 Bacteria 1184
517 Ga0206356_10247902 3300020070 Bacteria 1542
518 Ga0206352_11110991 3300020078 Bacteria 4162
519 Ga0213876_10005132 3300021384 Bacteria 7223
520 Ga0213876_10017527 3300021384 Bacteria 3781
521 Ga0209258_100311 3300025242 Bacteria 76151
522 Ga0209148_1000163 3300025254 Bacteria 137449
523 Ga0209676_1000001 3300025292 Bacteria 1852142
524 Ga0209758_1043894 3300025297 Bacteria 1641
525 Ga0209050_1000016 3300025298 Bacteria 729149
526 Ga0207426_1000105 3300025302 Bacteria 247269
527 Ga0207426_1056957 3300025302 Bacteria 1139
528 Ga0209257_1000001 3300025304 Bacteria 2274655
529 Ga0207697_10040801 3300025315 Bacteria 1905
530 Ga0207656_10013283 3300025321 Bacteria 3144
531 Ga0207656_10079251 3300025321 Bacteria 1473
532 Ga0207656_10144952 3300025321 Unclassified 1121
533 Ga0207682_10120470 3300025893 Bacteria 1163
534 Ga0207642_10067045 3300025899 Bacteria 1693
535 Ga0207680_10000549 3300025903 Bacteria 17807
536 Ga0207680_10000957 3300025903 Bacteria 13597
537 Ga0207680_10020420 3300025903 Unclassified 3565
538 Ga0207680_10036377 3300025903 Bacteria 2835
539 Ga0207680_10176152 3300025903 Bacteria 1443
540 Ga0207680_10198388 3300025903 Bacteria 1366
541 Ga0207647_10000408 3300025904 Bacteria 35295
542 Ga0207647_10018030 3300025904 Unclassified 4786
543 Ga0207647_10030877 3300025904 Unclassified 3453
544 Ga0207685_10036374 3300025905 Bacteria 1805
545 Ga0207645_10003925 3300025907 Bacteria 11107
546 Ga0207645_10018887 3300025907 Bacteria 4528
547 Ga0207643_10003731 3300025908 Bacteria 8185
548 Ga0207643_10008110 3300025908 Bacteria 5636
549 Ga0207643_10044031 3300025908 Unclassified 2519
550 Ga0207643_10245245 3300025908 Bacteria 1102
551 Ga0207705_10006233 3300025909 Bacteria 8858
552 Ga0207705_10035858 3300025909 Bacteria 3549
553 Ga0207705_10217672 3300025909 Unclassified 1450
554 Ga0207705_10257896 3300025909 Bacteria 1331
555 Ga0207654_10002504 3300025911 Bacteria 9335
556 Ga0207654_10005425 3300025911 Bacteria 6450
557 Ga0207654_10014402 3300025911 Bacteria 4086
558 Ga0207707_10000051 3300025912 Bacteria 117204
559 Ga0207707_10028949 3300025912 Bacteria 4841
560 Ga0207707_10166862 3300025912 Bacteria 1924
561 Ga0207707_10356091 3300025912 Bacteria 1261
562 Ga0207695_10000076 3300025913 Bacteria 307969
563 Ga0207695_10000084 3300025913 Bacteria 282392
564 Ga0207695_10000090 3300025913 Bacteria 272143
565 Ga0207695_10003768 3300025913 Bacteria 21047
566 Ga0207695_10009751 3300025913 Bacteria 11818
567 Ga0207695_10025986 3300025913 Bacteria 6543
568 Ga0207695_10039855 3300025913 Bacteria 5045
569 Ga0207695_10072177 3300025913 Bacteria 3524
570 Ga0207671_10001737 3300025914 Bacteria 24547
571 Ga0207671_10002536 3300025914 Bacteria 19453
572 Ga0207671_10003750 3300025914 Bacteria 14958
573 Ga0207671_10015105 3300025914 Bacteria 6068
574 Ga0207671_10219998 3300025914 Unclassified 1487
575 Ga0207660_10008132 3300025917 Bacteria 6786
576 Ga0207662_10426410 3300025918 Bacteria 903
577 Ga0207657_10015740 3300025919 Bacteria 7314
578 Ga0207649_10022827 3300025920 Bacteria 3616
579 Ga0207649_10028571 3300025920 Bacteria 3284
580 Ga0207649_10172387 3300025920 Bacteria 1508
581 Ga0207652_10008635 3300025921 Bacteria 8199
582 Ga0207652_10251572 3300025921 Bacteria 1593
583 Ga0207681_10016068 3300025923 Bacteria 4675
584 Ga0207681_10070088 3300025923 Bacteria 2441
585 Ga0207681_10333529 3300025923 Bacteria 1210
586 Ga0207694_10045720 3300025924 Bacteria 3382
587 Ga0207694_10086839 3300025924 Bacteria 2463
588 Ga0207694_10143076 3300025924 Bacteria 1924
589 Ga0207694_10281860 3300025924 Bacteria 1365
590 Ga0207650_10031890 3300025925 Bacteria 3809
591 Ga0207650_10043633 3300025925 Bacteria 3292
592 Ga0207650_10080435 3300025925 Bacteria 2470
593 Ga0207650_10131371 3300025925 Bacteria 1959
594 Ga0207650_10158597 3300025925 Unclassified 1791
595 Ga0207650_10225661 3300025925 Bacteria 1509
596 Ga0207659_10028675 3300025926 Bacteria 3785
597 Ga0207659_10096785 3300025926 Bacteria 2216
598 Ga0207659_10107339 3300025926 Bacteria 2116
599 Ga0207659_10157027 3300025926 Bacteria 1782
600 Ga0207659_10282086 3300025926 Bacteria 1358
601 Ga0207659_10362485 3300025926 Bacteria 1205
602 Ga0207659_10475067 3300025926 Bacteria 1056
603 Ga0207687_10149957 3300025927 Bacteria 1778
604 Ga0207644_10092279 3300025931 Bacteria 2259
605 Ga0207644_10188833 3300025931 Bacteria 1619
606 Ga0207644_10292607 3300025931 Bacteria 1310
607 Ga0207644_10535585 3300025931 Bacteria 968
608 Ga0207690_10018477 3300025932 Bacteria 4275
609 Ga0207690_10238817 3300025932 Unclassified 1399
610 Ga0207690_10402467 3300025932 Bacteria 1092
611 Ga0207706_10006356 3300025933 Bacteria 10978
612 Ga0207706_10014853 3300025933 Bacteria 7051
613 Ga0207706_10026565 3300025933 Bacteria 5181
614 Ga0207706_10045674 3300025933 Bacteria 3880
615 Ga0207706_10065864 3300025933 Bacteria 3189
616 Ga0207706_10352759 3300025933 Bacteria 1279
617 Ga0207686_10014467 3300025934 Bacteria 4394
618 Ga0207686_10060441 3300025934 Bacteria 2399
619 Ga0207686_10105841 3300025934 Bacteria 1887
620 Ga0207686_10137709 3300025934 Unclassified 1683
621 Ga0207686_10186980 3300025934 Unclassified 1473
622 Ga0207686_10461705 3300025934 Unclassified 979
623 Ga0207670_10033019 3300025936 Bacteria 3332
624 Ga0207670_10060645 3300025936 Bacteria 2578
625 Ga0207670_10085704 3300025936 Unclassified 2214
626 Ga0207670_10094592 3300025936 Bacteria 2120
627 Ga0207669_10145645 3300025937 Unclassified 1651
628 Ga0207704_10062204 3300025938 Bacteria 2320
629 Ga0207704_10113506 3300025938 Unclassified 1837
630 Ga0207691_10000001 3300025940 Bacteria 220829
631 Ga0207691_10002741 3300025940 Bacteria 17182
632 Ga0207691_10329902 3300025940 Bacteria 1307
633 Ga0207711_10267904 3300025941 Bacteria 1571
634 Ga0207711_10461652 3300025941 Bacteria 1182
635 Ga0207689_10005940 3300025942 Bacteria 10808
636 Ga0207689_10006806 3300025942 Bacteria 10058
637 Ga0207689_10007410 3300025942 Bacteria 9621
638 Ga0207689_10008752 3300025942 Bacteria 8802
639 Ga0207689_10011365 3300025942 Bacteria 7633
640 Ga0207689_10013953 3300025942 Bacteria 6843
641 Ga0207689_10016323 3300025942 Bacteria 6289
642 Ga0207689_10063505 3300025942 Unclassified 3038
643 Ga0207689_10092895 3300025942 Unclassified 2479
644 Ga0207689_10263759 3300025942 Unclassified 1425
645 Ga0207661_10021833 3300025944 Bacteria 4804
646 Ga0207661_10060351 3300025944 Unclassified 3059
647 Ga0207661_10126442 3300025944 Bacteria 2184
648 Ga0207661_10320475 3300025944 Unclassified 1393
649 Ga0207661_10491821 3300025944 Bacteria 1120
650 Ga0207661_10642799 3300025944 Bacteria 975
651 Ga0207679_10016136 3300025945 Bacteria 4954
652 Ga0207679_10021807 3300025945 Bacteria 4350
653 Ga0207679_10033718 3300025945 Bacteria 3605
654 Ga0207679_10038027 3300025945 Bacteria 3426
655 Ga0207679_10281556 3300025945 Bacteria 1426
656 Ga0207679_10390783 3300025945 Bacteria 1222
657 Ga0207667_10000453 3300025949 Bacteria 54929
658 Ga0207667_10033746 3300025949 Bacteria 5500
659 Ga0207667_10063294 3300025949 Bacteria 3865
660 Ga0207667_10118422 3300025949 Bacteria 2729
661 Ga0207651_10014865 3300025960 Bacteria 4507
662 Ga0207651_10022746 3300025960 Bacteria 3841
663 Ga0207651_10030229 3300025960 Bacteria 3446
664 Ga0207651_10031501 3300025960 Bacteria 3391
665 Ga0207651_10033814 3300025960 Bacteria 3302
666 Ga0207651_10036594 3300025960 Unclassified 3206
667 Ga0207651_10054997 3300025960 Bacteria 2731
668 Ga0207651_10084792 3300025960 Bacteria 2296
669 Ga0207651_10120053 3300025960 Bacteria 1992
670 Ga0207651_10199934 3300025960 Bacteria 1601
671 Ga0207712_10023997 3300025961 Bacteria 4032
672 Ga0207712_10037794 3300025961 Bacteria 3296
673 Ga0207712_10042125 3300025961 Unclassified 3142
674 Ga0207712_10048392 3300025961 Bacteria 2957
675 Ga0207712_10054866 3300025961 Bacteria 2800
676 Ga0207712_10137405 3300025961 Bacteria 1871
677 Ga0207668_10000869 3300025972 Bacteria 18234
678 Ga0207668_10091974 3300025972 Bacteria 2231
679 Ga0207668_10164368 3300025972 Bacteria 1733
680 Ga0207668_10225935 3300025972 Bacteria 1506
681 Ga0207640_10022058 3300025981 Bacteria 3805
682 Ga0207640_10077085 3300025981 Bacteria 2265
683 Ga0207658_10002877 3300025986 Bacteria 12335
684 Ga0207658_10020539 3300025986 Bacteria 4573
685 Ga0207658_10020590 3300025986 Bacteria 4567
686 Ga0207658_10039811 3300025986 Bacteria 3393
687 Ga0207658_10052257 3300025986 Bacteria 3015
688 Ga0207658_10058281 3300025986 Bacteria 2873
689 Ga0207658_10150083 3300025986 Bacteria 1898
690 Ga0207658_10163679 3300025986 Unclassified 1825
691 Ga0207677_10050769 3300026023 Bacteria 2807
692 Ga0207677_10080481 3300026023 Bacteria 2334
693 Ga0207677_10097811 3300026023 Bacteria 2151
694 Ga0207677_10345930 3300026023 Bacteria 1244
695 Ga0207703_10004088 3300026035 Bacteria 12037
696 Ga0207703_10022141 3300026035 Bacteria 4981
697 Ga0207703_10051716 3300026035 Bacteria 3331
698 Ga0207703_10661373 3300026035 Unclassified 991
699 Ga0207639_10002238 3300026041 Bacteria 13008
700 Ga0207639_10047581 3300026041 Bacteria 3242
701 Ga0207639_10105075 3300026041 Bacteria 2290
702 Ga0207639_10144591 3300026041 Bacteria 1985
703 Ga0207639_10196012 3300026041 Bacteria 1729
704 Ga0207639_10243757 3300026041 Bacteria 1564
705 Ga0207639_10247394 3300026041 Bacteria 1553
706 Ga0207639_10263551 3300026041 Bacteria 1508
707 Ga0207639_10324443 3300026041 Unclassified 1368
708 Ga0207639_10329494 3300026041 Unclassified 1358
709 Ga0207639_10421351 3300026041 Bacteria 1207
710 Ga0207678_10019197 3300026067 Bacteria 6002
711 Ga0207708_10039000 3300026075 Bacteria 3619
712 Ga0207708_10048195 3300026075 Bacteria 3243
713 Ga0207702_10026997 3300026078 Bacteria 4768
714 Ga0207702_10114466 3300026078 Unclassified 2404
715 Ga0207641_10000121 3300026088 Bacteria 114943
716 Ga0207641_10010823 3300026088 Bacteria 7474
717 Ga0207641_10013957 3300026088 Bacteria 6586
718 Ga0207641_10019401 3300026088 Bacteria 5581
719 Ga0207641_10119627 3300026088 Bacteria 2348
720 Ga0207641_10394484 3300026088 Unclassified 1328
721 Ga0207648_10002625 3300026089 Bacteria 19241
722 Ga0207648_10013430 3300026089 Bacteria 7622
723 Ga0207648_10016514 3300026089 Bacteria 6742
724 Ga0207648_10027371 3300026089 Bacteria 5061
725 Ga0207648_10144627 3300026089 Bacteria 2097
726 Ga0207648_10200755 3300026089 Bacteria 1768
727 Ga0207648_10337183 3300026089 Bacteria 1357
728 Ga0207648_10463175 3300026089 Unclassified 1156
729 Ga0207676_10038439 3300026095 Bacteria 3653
730 Ga0207676_10055443 3300026095 Bacteria 3111
731 Ga0207676_10070734 3300026095 Bacteria 2799
732 Ga0207676_10078366 3300026095 Unclassified 2676
733 Ga0207676_10475099 3300026095 Bacteria 1183
734 Ga0207674_10005332 3300026116 Bacteria 15297
735 Ga0207674_10007100 3300026116 Bacteria 13087
736 Ga0207674_10015613 3300026116 Bacteria 8336
737 Ga0207674_10051135 3300026116 Bacteria 4217
738 Ga0207674_10236693 3300026116 Bacteria 1773
739 Ga0207674_10330493 3300026116 Bacteria 1474
740 Ga0207674_10568319 3300026116 Bacteria 1095
741 Ga0207675_100002059 3300026118 Bacteria 20054
742 Ga0207675_100031608 3300026118 Bacteria 4931
743 Ga0207675_100070660 3300026118 Bacteria 3263
744 Ga0207675_100099312 3300026118 Bacteria 2742
745 Ga0207675_100440014 3300026118 Bacteria 1290
746 Ga0207683_10017329 3300026121 Bacteria 6139
747 Ga0207683_10030237 3300026121 Bacteria 4692
748 Ga0207683_10180996 3300026121 Bacteria 1911
749 Ga0207698_10005783 3300026142 Bacteria 7674
750 Ga0207698_10019868 3300026142 Bacteria 4611
751 Ga0207698_10208239 3300026142 Unclassified 1757
752 Ga0207698_10231367 3300026142 Unclassified 1678
753 Ga0207428_10033868 3300027907 Bacteria 4190
754 Ga0207428_10183035 3300027907 Bacteria 1582
755 Ga0268266_10000038 3300028379 Bacteria 325729
756 Ga0268266_10010826 3300028379 Bacteria 7945
757 Ga0268266_10191628 3300028379 Bacteria 1867
758 Ga0268266_10280725 3300028379 Bacteria 1548
759 Ga0268265_10027892 3300028380 Bacteria 4037
760 Ga0268265_10110087 3300028380 Unclassified 2247
761 Ga0268265_10118546 3300028380 Bacteria 2176
762 Ga0268265_10143991 3300028380 Bacteria 1999
763 Ga0268264_10000167 3300028381 Bacteria 146190
764 Ga0268264_10003997 3300028381 Bacteria 12625
765 Ga0268264_10009265 3300028381 Bacteria 8152
766 Ga0268264_10013426 3300028381 Bacteria 6743
767 Ga0268264_10022499 3300028381 Bacteria 5146
768 Ga0268264_10115863 3300028381 Bacteria 2354
769 Ga0268264_10278666 3300028381 Unclassified 1565
770 Ga0268264_10289823 3300028381 Bacteria 1537
771 Ga0268264_10323383 3300028381 Bacteria 1459
772 Ga0265336_10000007 3300028666 Bacteria 339898
773 Ga0307517_10025139 3300028786 Bacteria 7299
774 Ga0307515_10000469 3300028794 Bacteria 96345
775 Ga0307511_10008283 3300030521 Bacteria 10405
776 Ga0307512_10245653 3300030522 Unclassified 899
777 Ga0265327_10076362 3300031251 Bacteria 1665
778 Ga0265316_10002446 3300031344 Bacteria 19266
779 Ga0307513_10077739 3300031456 Bacteria 3435
780 Ga0307509_10052614 3300031507 Bacteria 4346
781 Ga0307509_10136415 3300031507 Bacteria 2398
782 Ga0307508_10001613 3300031616 Bacteria 25177
783 Ga0307508_10256541 3300031616 Bacteria 1344
784 Ga0316576_10001081 3300031727 Bacteria 14158
785 Ga0316576_10048308 3300031727 Unclassified 3086
786 Ga0316578_10004394 3300031728 Bacteria 6652
787 Ga0307516_10004268 3300031730 Bacteria 17759
788 Ga0307516_10058896 3300031730 Bacteria 3737
789 Ga0307516_10164433 3300031730 Unclassified 1966
790 Ga0307405_10000018 3300031731 Bacteria 182495
791 Ga0307406_10056552 3300031901 Bacteria 2513
792 Ga0307407_10000015 3300031903 Bacteria 143258
793 Ga0307412_10093985 3300031911 Bacteria 2105
794 Ga0307409_100124233 3300031995 Bacteria 2192
795 Ga0307409_100585077 3300031995 Bacteria 1101
796 Ga0307416_100000025 3300032002 Bacteria 178154
797 Ga0307416_100185000 3300032002 Bacteria 1957
798 Ga0307416_100503717 3300032002 Bacteria 1276
799 Ga0307414_10003961 3300032004 Bacteria 7985
800 Ga0307414_10027951 3300032004 Bacteria 3652
801 Ga0307510_10000380 3300033180 Bacteria 42243
802 Ga0373923_0091968 3300035111 Unclassified 1328
803 Ga0373955_0223970 3300035172 Bacteria 1124
804 Ga0373935_0065008 3300035692 Bacteria 2340
805 Ga0373937_0027762 3300036401 Bacteria 5121
806 Ga0316582_0063175 3300036647 Bacteria 2379
807 Ga0316584_0007005 3300036712 Bacteria 7674
808 Ga0395900_0072926 3300037418 Bacteria 3529
809 Ga0395900_0341038 3300037418 Bacteria 1474
810 Ga0395900_0567408 3300037418 Unclassified 1078
811 Ga0395905_0002823 3300037471 Bacteria 19037
812 Ga0395905_0005630 3300037471 Bacteria 12747
813 Ga0395905_0128646 3300037471 Bacteria 2382
814 Ga0400489_00932 3300039093 Bacteria 9350
815 Ga0436365_0337807 3300039437 Bacteria 1343
816 Ga0436365_0446442 3300039437 Bacteria 2630
817 Ga0436365_0968987 3300039437 Bacteria 46063
818 Ga0436365_1161992 3300039437 Unclassified 2551
819 Ga0436365_1480084 3300039437 Bacteria 25831
820 Ga0439436_0000998 3300041404 Bacteria 7881
821 Ga0439436_0056906 3300041404 Bacteria 1097
822 Ga0439439_0007187 3300041406 Bacteria 2597
823 Ga0451793_1128229 3300041452 Bacteria 914
824 Ga0451798_0789946 3300041458 Unclassified 967
825 Ga0451851_0973538 3300041507 Bacteria 996
826 Ga0439445_0015644 3300042004 Bacteria 1860
827 Ga0439448_0045488 3300042005 Bacteria 1429
828 Ga0439449_0002063 3300042007 Bacteria 7909
829 Ga0439449_0064488 3300042007 Bacteria 1351
830 Ga0439457_004078 3300042014 Bacteria 3867
831 Ga0439457_071486 3300042014 Bacteria 791
832 Ga0451577_0013904 3300042876 Bacteria 7516
833 Ga0451577_0024955 3300042876 Bacteria 5429
834 Ga0451577_0122476 3300042876 Bacteria 2330
835 Ga0451577_0166623 3300042876 Bacteria 1985
836 Ga0451577_0179508 3300042876 Bacteria 1908
837 Ga0451577_0513468 3300042876 Unclassified 1088
838 Ga0451577_1046607 3300042876 Unclassified 732
839 Ga0466969_0000246 3300044656 Bacteria 29777
840 Ga0466969_0065958 3300044656 Bacteria 1749
841 Ga0466972_0000025 3300044658 Bacteria 186601
842 Ga0466972_0005074 3300044658 Bacteria 6598
843 Ga0466972_0016146 3300044658 Bacteria 3732
844 Ga0466972_0105800 3300044658 Unclassified 1330
845 Ga0453683_0009005 3300044673 Bacteria 6671
846 Ga0453683_0022263 3300044673 Bacteria 4043
847 Ga0453683_0051960 3300044673 Bacteria 2566
848 Ga0453683_0095683 3300044673 Unclassified 1863
849 Ga0466965_0200193 3300044683 Unclassified 1059
850 Ga0466966_0004412 3300044684 Bacteria 9283
851 Ga0466961_0060606 3300044693 Bacteria 2406
852 Ga0466961_0082362 3300044693 Bacteria 2036
853 Ga0453684_0000440 3300044712 Bacteria 169397
854 Ga0453684_0012498 3300044712 Bacteria 13983
855 Ga0453684_0031999 3300044712 Bacteria 7376
856 Ga0453684_0035092 3300044712 Bacteria 6941
857 Ga0453684_0047532 3300044712 Bacteria 5689
858 Ga0453684_0133499 3300044712 Bacteria 2976
859 Ga0453684_0291212 3300044712 Bacteria 1859
860 Ga0453684_0342687 3300044712 Bacteria 1687
861 Ga0453684_0468530 3300044712 Bacteria 1399
862 Ga0453684_0541906 3300044712 Bacteria 1283
863 Ga0466971_0029515 3300044719 Bacteria 2453
864 Ga0466968_0091591 3300044735 Bacteria 1348
865 Ga0466970_0005458 3300044765 Bacteria 6310
866 Ga0466970_0043793 3300044765 Bacteria 2382
867 Ga0466959_0000017 3300045049 Bacteria 143170
868 Ga0466959_0021114 3300045049 Bacteria 4800
869 Ga0451576_0027225 3300045051 Bacteria 6142
870 Ga0451576_0033773 3300045051 Bacteria 5436
871 Ga0451576_0047592 3300045051 Bacteria 4507
872 Ga0451576_0157120 3300045051 Bacteria 2372
873 Ga0451576_0767533 3300045051 Bacteria 1013
874 Ga0466958_0069216 3300045836 Bacteria 2158
875 Ga0466967_0098688 3300045976 Bacteria 2667
876 Ga0495650_0031147 3300046471 Bacteria 2405
877 Ga0495580_0020527 3300046472 Bacteria 4888
878 Ga0495580_0130700 3300046472 Unclassified 1742
879 Ga0495594_0028749 3300046499 Bacteria 3001
880 Ga0495606_0003054 3300046507 Bacteria 18247
881 Ga0495608_0224629 3300046511 Bacteria 1177
882 Ga0495610_0000047 3300046512 Bacteria 151516
883 Ga0495610_0000904 3300046512 Bacteria 27595
884 Ga0495628_0049106 3300046516 Unclassified 3342
885 Ga0495630_0006664 3300046517 Bacteria 8231
886 Ga0495643_0049652 3300046522 Bacteria 2262
887 Ga0495648_0136981 3300046524 Bacteria 1293
888 Ga0495652_0208384 3300046529 Bacteria 1478
889 Ga0495598_0022199 3300046537 Bacteria 1696
890 Ga0495667_0099636 3300046559 Bacteria 1881
891 Ga0495667_0268170 3300046559 Bacteria 1085
892 Ga0495668_0000453 3300046616 Bacteria 52477
893 Ga0495668_0001518 3300046616 Bacteria 22075
894 Ga0495634_0079528 3300046642 Bacteria 2147
895 Ga0495634_0125601 3300046642 Bacteria 1639
896 Ga0495611_0003370 3300046648 Bacteria 7051
897 Ga0495625_0073581 3300046660 Bacteria 2395
898 Ga0495657_0306092 3300046675 Bacteria 947
899 Ga0495623_0301213 3300046679 Bacteria 886
900 Ga0495646_0245927 3300046680 Bacteria 960
901 Ga0495658_0002499 3300046683 Bacteria 9248
902 Ga0495649_0044299 3300046694 Bacteria 2429
903 Ga0495649_0083012 3300046694 Bacteria 1712
904 Ga0495604_0042067 3300047317 Bacteria 3582
905 Ga0495672_0108430 3300047320 Bacteria 1494
906 Ga0495687_000001 3300047443 Bacteria 1215582
907 Ga0495675_0182826 3300047444 Bacteria 1283
908 Ga0495686_0000004 3300047472 Bacteria 869019
909 Ga0495686_0000577 3300047472 Bacteria 51975
910 Ga0495686_0028262 3300047472 Bacteria 3652
911 Ga0495686_0106869 3300047472 Bacteria 1682
912 Ga0495686_0178938 3300047472 Bacteria 1230
913 Ga0496101_0010154 3300048904 Bacteria 6211
914 Ga0496101_0337118 3300048904 Bacteria 1184
915 Ga0496104_0524509 3300048907 Bacteria 1096
916 Ga0496104_0629802 3300048907 Bacteria 982
917 Ga0496106_0196170 3300048909 Bacteria 1606
918 Ga0496112_0061676 3300048915 Bacteria 3697
919 Ga0496121_0000030 3300048924 Bacteria 412079
920 Ga0496124_0051801 3300048927 Bacteria 3491
921 Ga0496126_0016712 3300048929 Bacteria 7331
922 Ga0501031_0116888 3300049568 Bacteria 1742
923 Ga0501032_0002071 3300049569 Bacteria 15830
924 Ga0501032_0109448 3300049569 Bacteria 1829
925 Ga0501033_0076666 3300049570 Bacteria 2454
926 Ga0501033_0241911 3300049570 Unclassified 1280
927 Ga0501034_0014513 3300049571 Bacteria 8112
928 Ga0501034_0089868 3300049571 Unclassified 3069
929 Ga0501034_0143815 3300049571 Bacteria 2363
930 Ga0501036_0010214 3300049572 Bacteria 7738
931 Ga0501036_0016999 3300049572 Bacteria 6078
932 Ga0501036_0057478 3300049572 Bacteria 3295
933 Ga0501037_0082387 3300049573 Bacteria 2331
934 Ga0501038_0038680 3300049574 Bacteria 4176
935 Ga0501039_0020673 3300049575 Bacteria 5044
936 Ga0501040_0166313 3300049576 Unclassified 1561
937 Ga0501043_0001446 3300049579 Bacteria 20739
938 Ga0501043_0142998 3300049579 Bacteria 1873
939 Ga0501043_0208303 3300049579 Unclassified 1516
940 Ga0501043_0235371 3300049579 Bacteria 1413
941 Ga0501046_0026523 3300049580 Bacteria 4732
942 Ga0501046_0042705 3300049580 Bacteria 3614
943 Ga0501046_0251713 3300049580 Bacteria 1300
944 Ga0501047_0000014 3300049581 Bacteria 321541
945 Ga0501047_0031616 3300049581 Bacteria 5106
946 Ga0501047_0045624 3300049581 Bacteria 4238
947 Ga0501047_0108355 3300049581 Bacteria 2660
948 Ga0501047_0110170 3300049581 Bacteria 2636
949 Ga0501047_0282844 3300049581 Bacteria 1503
950 Ga0501048_0010340 3300049582 Bacteria 6974
951 Ga0501067_0035163 3300049583 Bacteria 2782
952 Ga0501070_0009038 3300049586 Bacteria 8429
953 Ga0501071_0041001 3300049587 Bacteria 3315
954 Ga0501072_0091876 3300049588 Bacteria 2410
955 Ga0501073_0002480 3300049589 Bacteria 13772
956 Ga0501073_0032328 3300049589 Bacteria 3729
957 Ga0501202_004157 3300049652 Bacteria 2524
958 Ga0501207_005672 3300049654 Bacteria 1734
959 Ga0501223_031393 3300049663 Bacteria 1033
960 Ga0501233_046619 3300049668 Bacteria 1037
961 Ga0501242_013656 3300049674 Bacteria 999
962 Ga0501253_024416 3300049683 Bacteria 1096
963 Ga0501257_036941 3300049686 Bacteria 1191
964 Ga0501259_001982 3300049688 Bacteria 3383
965 Ga0501259_007371 3300049688 Bacteria 1760
966 Ga0501261_004784 3300049690 Bacteria 1688
967 Ga0501221_037622 3300049704 Bacteria 1042
968 Ga0501225_0001750 3300049705 Bacteria 6807
969 Ga0501225_0004489 3300049705 Bacteria 4155
970 Ga0501225_0029915 3300049705 Bacteria 1497
971 Ga0501225_0048119 3300049705 Bacteria 1184
972 Ga0501080_0035066 3300049742 Bacteria 4683
973 Ga0501080_0173263 3300049742 Bacteria 1989
974 Ga0501241_008348 3300049758 Bacteria 1891
975 Ga0501266_004386 3300049763 Bacteria 1746
976 Ga0501268_011400 3300049765 Bacteria 1402
977 Ga0501269_001678 3300049766 Bacteria 2826
978 Ga0501035_0012769 3300049822 Bacteria 7759
979 Ga0501035_0119494 3300049822 Bacteria 2305
980 Ga0501044_0004256 3300049823 Bacteria 16057
981 Ga0501044_0027270 3300049823 Bacteria 6039
982 Ga0501044_0078101 3300049823 Unclassified 3355
983 Ga0501044_0129257 3300049823 Bacteria 2521
984 Ga0501044_0210760 3300049823 Unclassified 1897
985 Ga0501044_0243013 3300049823 Bacteria 1743
986 Ga0501044_0420384 3300049823 Unclassified 1247
987 nmdc:mga0k408_19225_c1 3300050493 Bacteria 3816
988 nmdc:mga0k408_28497_c1 3300050493 Bacteria 3175
989 nmdc:mga0k408_34103_c1 3300050493 Bacteria 2913
990 nmdc:mga0k408_355166_c1 3300050493 Bacteria 874
991 nmdc:mga0k408_54699_c1 3300050493 Bacteria 2313
992 nmdc:mga05p37_327139_c1 3300050507 Bacteria 1812
993 nmdc:mga05p37_3944_c1 3300050507 Bacteria 17380
994 nmdc:mga05p37_85778_c2 3300050507 Bacteria 3129
995 nmdc:mga05p37_93236_c1 3300050507 Unclassified 3710
996 nmdc:mga09592_457896_c1 3300050508 Bacteria 1100
997 nmdc:mga09592_74593_c1 3300050508 Bacteria 2883
998 nmdc:mga06r32_79583_c1 3300050510 Unclassified 3188
999 nmdc:mga08y16_18379_c1 3300050511 Bacteria 7369
1000 nmdc:mga08y16_259415_c1 3300050511 Bacteria 1795
1001 nmdc:mga08y16_90253_c1 3300050511 Bacteria 3194
1002 Ga0495595_0026950 3300053084 Bacteria 2557
1003 Ga0500578_0000136 3300053086 Bacteria 88612
1004 Ga0500578_0219597 3300053086 Bacteria 1156
1005 Ga0500644_0000344 3300053088 Bacteria 23446
1006 Ga0500646_0011763 3300053090 Bacteria 2253
1007 Ga0500646_0062022 3300053090 Unclassified 1102
1008 Ga0500583_0000127 3300053092 Bacteria 35082
1009 Ga0500583_0004905 3300053092 Bacteria 4423
1010 Ga0500583_0011554 3300053092 Bacteria 3333
1011 Ga0500583_0021234 3300053092 Unclassified 2697
1012 Ga0500583_0091634 3300053092 Bacteria 1480
1013 Ga0500562_000061 3300053108 Bacteria 53142
1014 Ga0500568_0000439 3300053139 Bacteria 31243
1015 Ga0500588_0000910 3300053146 Bacteria 5216
1016 Ga0500588_0018497 3300053146 Bacteria 1837
1017 Ga0500604_0007195 3300053151 Bacteria 2947
1018 Ga0500616_0000698 3300053153 Bacteria 39124
1019 Ga0500616_0010292 3300053153 Bacteria 5605
1020 Ga0500616_0017066 3300053153 Bacteria 4121
1021 Ga0500616_0045533 3300053153 Bacteria 2337
1022 Ga0500622_0000156 3300053156 Bacteria 71907
1023 Ga0500622_0000655 3300053156 Bacteria 30835
1024 Ga0500622_0004617 3300053156 Bacteria 8545
1025 Ga0500622_0020704 3300053156 Bacteria 3492
1026 Ga0500636_0136494 3300053177 Bacteria 1362
1027 Ga0500637_0047204 3300053178 Bacteria 2446
1028 Ga0500611_000032 3300053727 Bacteria 83927
1029 Ga0500645_062147 3300053730 Bacteria 1078
1030 Ga0501084_0027666 3300054114 Bacteria 4738
1031 Ga0501082_0128401 3300060353 Bacteria 2199
1032 Ga0466962_0003273 3300061719 Bacteria 7694
1033 2586210394 2585427687 Bacteria 5544917
1034 2738726220 2738541278 Bacteria 9755573
1035 2738856020 2738541302 Bacteria 5944758
1036 2739591027 2739367651 Bacteria 6359826
1037 2739618073 2739367656 Bacteria 5152243
1038 2739647443 2739367663 Bacteria 5040914
1039 2819549961 2818991437 Bacteria 5805520
1040 2819590262 2818991444 Bacteria 6968812
1041 2842723438 2842722452 Bacteria 6263924
1042 2842909932 2842909656 Bacteria 6185908
1043 2849284791 2849281842 Bacteria 6065644
1044 2857632211 2857627736 Bacteria 5625397
1045 2881957873 2881955468 Bacteria 3545609
1046 2904445970 2904445276 Bacteria 5310396
1047 2914763482 2914759650 Bacteria 4701441
1048 2929155029 2929154850 Bacteria 6753285
1049 2946000281 2945997725 Bacteria 6404843
1050 2954017168 2954016120 Bacteria 6446024
1051 Ga0207680_10174885
1052 MRS1b_contig_3231436
1053 JGI24739J22299_10001379
1054 JGI25406J46586_10036777
1055 JGI25153J46596_10021720
1056 rootH1_10187333
1057 rootH2_10037762
1058 rootH2_10069215
1059 rootH2_10138765
1060 rootH2_10155317
1061 rootL2_10036246
1062 rootL2_10062004
1063 rootL2_10066724
1064 rootL2_10156908
1065 rootL2_10199815
1066 rootL2_10278758
1067 rootL2_10317439
1068 rootH1_10041523
1069 rootH1_10046893
1070 rootH1_10096119
1071 JGI25160J50197_1001095
1072 Ga0055535_1003322
1073 Ga0055536_1000003
1074 Ga0055530_10001176
1075 Ga0055531_10000133
1076 Ga0055531_10000166
1077 Ga0065714_10002192
1078 Ga0065714_10088526
1079 Ga0065714_10128866
1080 Ga0065704_10204218
1081 Ga0065712_10011320
1082 Ga0065712_10020395
1083 Ga0065712_10074886
1084 Ga0065712_10162279
1085 Ga0065712_10209505
1086 Ga0065712_10315571
1087 Ga0065715_10005801
1088 Ga0065707_10112842
1089 Ga0065707_10294102
1090 Ga0065707_10301143
1091 Ga0070658_10094269
1092 Ga0070658_10150547
1093 Ga0070658_10422714
1094 Ga0070676_10017260
1095 Ga0070676_10035933
1096 Ga0070676_10275360
1097 Ga0070683_100001488
1098 Ga0070683_100006686
1099 Ga0070683_100013377
1100 Ga0070683_100139428
1101 Ga0070683_100496968
1102 Ga0070670_100043938
1103 Ga0070670_100067766
1104 Ga0070670_100166339
1105 Ga0068869_100014592
1106 Ga0068869_100040382
1107 Ga0068869_100112960
1108 Ga0068869_100259567
1109 Ga0070666_10000191
1110 Ga0070666_10000736
1111 Ga0070666_10020630
1112 Ga0070666_10024266
1113 Ga0070666_10027930
1114 Ga0070666_10032894
1115 Ga0070666_10286860
1116 Ga0070680_100001401
1117 Ga0070680_100041558
1118 Ga0070682_100002086
1119 Ga0070682_100023351
1120 Ga0070682_100035375
1121 Ga0070682_100108505
1122 Ga0068868_100004630
1123 Ga0068868_100006935
1124 Ga0068868_100023189
1125 Ga0068868_100097784
1126 Ga0068868_100144787
1127 Ga0068868_100146899
1128 Ga0068868_100367617
1129 Ga0070660_100012064
1130 Ga0070660_100368188
1131 Ga0070689_100010221
1132 Ga0070689_100027952
1133 Ga0070689_100032331
1134 Ga0070689_100073429
1135 Ga0070689_100265952
1136 Ga0070689_100309677
1137 Ga0070691_10005091
1138 Ga0070687_100033870
1139 Ga0070661_100015125
1140 Ga0070661_100016234
1141 Ga0070661_100027839
1142 Ga0070668_100004151
1143 Ga0070668_100011116
1144 Ga0070668_100020025
1145 Ga0070668_100184107
1146 Ga0070669_100008748
1147 Ga0070669_100396208
1148 Ga0070669_100451207
1149 Ga0070675_100085433
1150 Ga0070675_100105888
1151 Ga0070675_100112578
1152 Ga0070675_100133412
1153 Ga0070675_100138132
1154 Ga0070675_100250983
1155 Ga0070675_100292360
1156 Ga0070675_100741612
1157 Ga0070671_100029574
1158 Ga0070671_100053645
1159 Ga0070671_100116246
1160 Ga0070674_100002220
1161 Ga0070673_100006656
1162 Ga0070673_100016732
1163 Ga0070673_100019294
1164 Ga0070673_100024297
1165 Ga0070673_100042547
1166 Ga0070673_100051203
1167 Ga0070673_100419848
1168 Ga0070673_100443434
1169 Ga0070688_100013545
1170 Ga0070688_100037093
1171 Ga0070688_100052736
1172 Ga0070688_100111398
1173 Ga0070688_100201536
1174 Ga0070659_100026473
1175 Ga0070659_100031231
1176 Ga0070659_100245588
1177 Ga0070667_100000248
1178 Ga0070667_100003905
1179 Ga0070667_100031740
1180 Ga0070667_100096997
1181 Ga0070667_100113769
1182 Ga0070667_100267577
1183 Ga0070667_100312033
1184 Ga0070700_100022637
1185 Ga0070678_100105608
1186 Ga0070678_100321889
1187 Ga0070662_100004870
1188 Ga0070662_100011898
1189 Ga0070662_100021120
1190 Ga0070662_100022782
1191 Ga0070681_10004039
1192 Ga0070681_10049604
1193 Ga0070681_10129083
1194 Ga0068867_100032795
1195 Ga0068867_100128708
1196 Ga0068867_100137671
1197 Ga0068867_100418364
1198 Ga0070685_10016702
1199 Ga0070685_10092079
1200 Ga0070698_100002802
1201 Ga0070698_100006186
1202 Ga0070698_100016568
1203 Ga0070699_100471264
1204 Ga0070679_100002167
1205 Ga0070679_100056240
1206 Ga0070684_100003339
1207 Ga0070684_100058514
1208 Ga0070684_100060911
1209 Ga0070684_100063429
1210 Ga0068853_100000250
1211 Ga0068853_100003318
1212 Ga0068853_100006139
1213 Ga0068853_100030359
1214 Ga0068853_100043755
1215 Ga0068853_100084468
1216 Ga0068853_100145967
1217 Ga0068853_100221844
1218 Ga0068853_100272722
1219 Ga0068853_100307260
1220 Ga0068853_100370851
1221 Ga0068853_100382177
1222 Ga0070672_100001565
1223 Ga0070693_100067745
1224 Ga0070665_100018617
1225 Ga0070665_100085759
1226 Ga0070704_100193181
1227 Ga0068855_100000133
1228 Ga0068855_100003486
1229 Ga0070664_100004058
1230 Ga0070664_100030677
1231 Ga0070664_100053226
1232 Ga0070664_100126731
1233 Ga0070664_100372022
1234 Ga0070664_100423727
1235 Ga0070664_100484441
1236 Ga0068857_100010012
1237 Ga0068857_100023615
1238 Ga0068857_100137417
1239 Ga0068857_100178481
1240 Ga0068857_100224023
1241 Ga0068857_100255602
1242 Ga0068854_100005730
1243 Ga0068854_100047179
1244 Ga0068854_100063403
1245 Ga0068854_100069838
1246 Ga0068856_100004245
1247 Ga0068856_100014967
1248 Ga0068856_100048124
1249 Ga0068856_100086534
1250 Ga0068852_100001400
1251 Ga0068852_100008317
1252 Ga0068852_100009108
1253 Ga0068852_100032096
1254 Ga0068852_100064916
1255 Ga0068852_100168770
1256 Ga0068852_100175248
1257 Ga0068852_100242383
1258 Ga0068852_100258940
1259 Ga0068852_100324612
1260 Ga0068859_100000037
1261 Ga0068859_100002491
1262 Ga0068859_100134497
1263 Ga0068859_100172495
1264 Ga0068859_100230504
1265 Ga0068859_101003427
1266 Ga0068864_100012286
1267 Ga0068864_100015889
1268 Ga0068864_100018148
1269 Ga0068864_100053299
1270 Ga0068864_100082595
1271 Ga0068864_100096024
1272 Ga0068866_10143664
1273 Ga0068866_10212241
1274 Ga0068861_100010689
1275 Ga0068861_100130693
1276 Ga0068861_100161210
1277 Ga0068861_100315205
1278 Ga0068851_10026295
1279 Ga0068851_10075595
1280 Ga0068851_10124041
1281 Ga0068851_10150963
1282 Ga0068870_10006960
1283 Ga0068870_10029248
1284 Ga0068870_10044049
1285 Ga0068870_10221306
1286 Ga0068863_100001373
1287 Ga0068863_100004306
1288 Ga0068863_100038107
1289 Ga0068863_100051623
1290 Ga0068863_100062458
1291 Ga0068863_100160218
1292 Ga0068863_100400242
1293 Ga0068863_100578756
1294 Ga0068858_100071652
1295 Ga0068858_100516390
1296 Ga0068860_100000097
1297 Ga0068860_100004260
1298 Ga0068860_100006743
1299 Ga0068860_100008499
1300 Ga0068860_100019489
1301 Ga0068860_100022955
1302 Ga0068860_100319797
1303 Ga0068860_100857837
1304 Ga0068862_100007901
1305 Ga0068862_100008890
1306 Ga0068862_100110622
1307 Ga0068862_100187982
1308 Ga0068862_100317394
1309 Ga0081539_10004959
1310 Ga0070716_100233610
1311 Ga0075366_10005546
1312 Ga0075366_10005748
1313 Ga0075366_10014280
1314 Ga0097621_100044821
1315 Ga0097621_100070259
1316 Ga0097621_100090377
1317 Ga0097621_100109305
1318 Ga0097621_100271363
1319 Ga0097621_100354670
1320 Ga0097621_100610755
1321 Ga0068871_100004890
1322 Ga0068871_100015089
1323 Ga0068871_100024794
1324 Ga0068871_100044750
1325 Ga0068871_100087735
1326 Ga0068871_100133402
1327 Ga0075428_100081557
1328 Ga0075430_100011474
1329 Ga0075431_100022872
1330 Ga0075431_100152015
1331 Ga0075434_100374703
1332 Ga0075429_100007351
1333 Ga0075429_100079091
1334 Ga0068865_100003571
1335 Ga0068865_100046762
1336 Ga0068865_100229034
1337 Ga0068865_100352328
1338 Ga0097620_100000037
1339 Ga0097620_100002491
1340 Ga0097620_100134504
1341 Ga0097620_100172490
1342 Ga0097620_100230494
1343 Ga0097620_101003323
1344 Ga0105251_10071058
1345 Ga0105240_10000398
1346 Ga0105240_10001595
1347 Ga0105240_10016926
1348 Ga0105240_10031869
1349 Ga0105240_10050768
1350 Ga0105240_10074719
1351 Ga0105240_10295321
1352 Ga0111539_10009984
1353 Ga0111539_10037511
1354 Ga0111539_10054054
1355 Ga0111539_10066150
1356 Ga0111539_10140184
1357 Ga0111539_10272888
1358 Ga0111539_10804181
1359 Ga0105245_10091135
1360 Ga0114129_10006463
1361 Ga0114129_10025561
1362 Ga0114129_10059189
1363 Ga0114129_10095068
1364 Ga0114129_11109264
1365 Ga0105243_10118580
1366 Ga0105241_10000537
1367 Ga0105241_10000769
1368 Ga0105241_10004422
1369 Ga0105241_10029296
1370 Ga0105241_10076487
1371 Ga0105241_10135527
1372 Ga0105241_10271373
1373 Ga0105241_10273302
1374 Ga0105242_10059726
1375 Ga0105242_10083142
1376 Ga0105242_10105247
1377 Ga0105242_10143570
1378 Ga0105242_10289430
1379 Ga0105248_10092740
1380 Ga0105248_10104833
1381 Ga0105248_10182101
1382 Ga0105248_10308124
1383 Ga0105248_10488875
1384 Ga0105248_11012099
1385 Ga0105237_10001588
1386 Ga0105237_10001799
1387 Ga0105237_10002614
1388 Ga0105237_10007892
1389 Ga0105237_10037741
1390 Ga0105237_10384591
1391 Ga0105238_10008067
1392 Ga0105238_10051614
1393 Ga0105238_10111019
1394 Ga0105238_10130087
1395 Ga0105238_10341939
1396 Ga0105238_10522541
1397 Ga0105249_10009374
1398 Ga0105249_10029286
1399 Ga0105249_10042127
1400 Ga0105249_10050930
1401 Ga0105249_10101172
1402 Ga0105249_10474095
1403 Ga0105239_10000436
1404 Ga0105239_10002246
1405 Ga0105239_10009301
1406 Ga0105239_10010718
1407 Ga0105239_10045244
1408 Ga0105239_10063312
1409 Ga0105239_10131025
1410 Ga0105239_10933445
1411 Ga0105239_11010697
1412 Ga0105246_10098378
1413 Ga0105246_10272180
1414 Ga0157373_10000127
1415 Ga0157373_10016509
1416 Ga0157373_10017789
1417 Ga0157373_10023280
1418 Ga0157373_10052762
1419 Ga0157371_10000009
1420 Ga0157371_10001161
1421 Ga0157371_10020069
1422 Ga0157371_10038115
1423 Ga0157371_10049377
1424 Ga0157371_10079931
1425 Ga0157371_10105007
1426 Ga0157371_10107026
1427 Ga0157371_10223539
1428 Ga0157371_10241886
1429 Ga0157370_10001172
1430 Ga0157370_10002300
1431 Ga0157370_10019212
1432 Ga0157370_10021508
1433 Ga0157370_10034319
1434 Ga0157370_10063717
1435 Ga0157370_10076387
1436 Ga0157370_10174610
1437 Ga0157370_10226086
1438 Ga0157370_10235449
1439 Ga0157369_10000006
1440 Ga0157369_10033658
1441 Ga0157369_10035022
1442 Ga0157369_10035205
1443 Ga0157369_10122279
1444 Ga0157369_10176508
1445 Ga0157369_10243984
1446 Ga0157369_10343900
1447 Ga0157369_10670862
1448 Ga0157369_11020687
1449 Ga0157374_10000001
1450 Ga0157374_10000500
1451 Ga0157374_10005963
1452 Ga0157374_10007705
1453 Ga0157374_10028847
1454 Ga0157374_10039891
1455 Ga0157374_10089069
1456 Ga0157374_10182509
1457 Ga0157374_10227752
1458 Ga0157374_10467323
1459 Ga0157374_10500423
1460 Ga0157378_10005638
1461 Ga0157378_10015524
1462 Ga0157378_10033932
1463 Ga0157378_10047605
1464 Ga0157378_10109236
1465 Ga0157378_10130335
1466 Ga0157378_10132689
1467 Ga0157378_10347359
1468 Ga0157378_10431856
1469 Ga0157378_10553984
1470 Ga0157378_10621602
1471 Ga0157378_10714107
1472 Ga0157378_10780236
1473 Ga0163162_10000304
1474 Ga0163162_10000773
1475 Ga0163162_10001942
1476 Ga0163162_10004755
1477 Ga0163162_10007765
1478 Ga0163162_10022131
1479 Ga0163162_10039131
1480 Ga0163162_10085604
1481 Ga0163162_10232155
1482 Ga0163162_10296919
1483 Ga0163162_10448100
1484 Ga0163162_10577451
1485 Ga0157372_10000288
1486 Ga0157372_10003109
1487 Ga0157372_10005863
1488 Ga0157372_10059984
1489 Ga0157372_10065955
1490 Ga0157372_10089440
1491 Ga0157372_10116600
1492 Ga0157372_10135723
1493 Ga0157372_10153024
1494 Ga0157372_10180194
1495 Ga0157372_10226918
1496 Ga0157372_10234025
1497 Ga0157372_10282954
1498 Ga0157372_10296782
1499 Ga0157372_10330905
1500 Ga0157372_10403033
1501 Ga0157372_10556396
1502 Ga0157372_10591157
1503 Ga0157372_10632401
1504 Ga0157372_10705761
1505 Ga0157372_10761483
1506 Ga0157375_10001463
1507 Ga0157375_10029615
1508 Ga0157375_10053872
1509 Ga0157375_10059597
1510 Ga0157375_10074000
1511 Ga0157375_10204555
1512 Ga0157375_10206183
1513 Ga0157375_10666578
1514 Ga0163163_10001732
1515 Ga0163163_10003543
1516 Ga0163163_10018795
1517 Ga0163163_10055223
1518 Ga0163163_10071221
1519 Ga0163163_10072197
1520 Ga0163163_10091809
1521 Ga0163163_10139867
1522 Ga0163163_10368163
1523 Ga0163163_10432803
1524 Ga0163163_10478120
1525 Ga0157380_10001083
1526 Ga0157380_10004590
1527 Ga0157380_10016648
1528 Ga0157380_10141439
1529 Ga0157380_10338490
1530 Ga0182008_10000874
1531 Ga0157377_10004045
1532 Ga0157377_10016138
1533 Ga0157377_10060402
1534 Ga0157377_10078560
1535 Ga0157377_10133521
1536 Ga0157377_10240954
1537 Ga0157379_10000845
1538 Ga0157379_10031135
1539 Ga0157379_10076794
1540 Ga0157379_10101588
1541 Ga0157379_10148396
1542 Ga0157379_10148786
1543 Ga0157379_10182711
1544 Ga0157379_10244614
1545 Ga0157379_10245116
1546 Ga0157379_10445793
1547 Ga0157376_10007592
1548 Ga0157376_10016450
1549 Ga0157376_10043042
1550 Ga0157376_10062316
1551 Ga0157376_10067706
1552 Ga0157376_10090037
1553 Ga0157376_10174534
1554 Ga0157376_10891064
1555 Ga0182006_1000113
1556 Ga0182006_1000321
1557 Ga0182006_1006032
1558 Ga0182007_10000122
1559 Ga0183373_1006
1560 Ga0163161_10000089
1561 Ga0163161_10000218
1562 Ga0163161_10005594
1563 Ga0163161_10018758
1564 Ga0163161_10048358
1565 Ga0163161_10159294
1566 Ga0163161_10343880
1567 Ga0206356_10247902
1568 Ga0206352_11110991
1569 Ga0213876_10005132
1570 Ga0213876_10017527
1571 Ga0209258_100311
1572 Ga0209148_1000163
1573 Ga0209676_1000001
1574 Ga0209758_1043894
1575 Ga0209050_1000016
1576 Ga0207426_1000105
1577 Ga0207426_1056957
1578 Ga0209257_1000001
1579 Ga0207697_10040801
1580 Ga0207656_10013283
1581 Ga0207656_10079251
1582 Ga0207656_10144952
1583 Ga0207682_10120470
1584 Ga0207642_10067045
1585 Ga0207680_10000549
1586 Ga0207680_10000957
1587 Ga0207680_10020420
1588 Ga0207680_10036377
1589 Ga0207680_10176152
1590 Ga0207680_10198388
1591 Ga0207647_10000408
1592 Ga0207647_10018030
1593 Ga0207647_10030877
1594 Ga0207685_10036374
1595 Ga0207645_10003925
1596 Ga0207645_10018887
1597 Ga0207643_10003731
1598 Ga0207643_10008110
1599 Ga0207643_10044031
1600 Ga0207643_10245245
1601 Ga0207705_10006233
1602 Ga0207705_10035858
1603 Ga0207705_10217672
1604 Ga0207705_10257896
1605 Ga0207654_10002504
1606 Ga0207654_10005425
1607 Ga0207654_10014402
1608 Ga0207707_10000051
1609 Ga0207707_10028949
1610 Ga0207707_10166862
1611 Ga0207707_10356091
1612 Ga0207695_10000076
1613 Ga0207695_10000084
1614 Ga0207695_10000090
1615 Ga0207695_10003768
1616 Ga0207695_10009751
1617 Ga0207695_10025986
1618 Ga0207695_10039855
1619 Ga0207695_10072177
1620 Ga0207671_10001737
1621 Ga0207671_10002536
1622 Ga0207671_10003750
1623 Ga0207671_10015105
1624 Ga0207671_10219998
1625 Ga0207660_10008132
1626 Ga0207662_10426410
1627 Ga0207657_10015740
1628 Ga0207649_10022827
1629 Ga0207649_10028571
1630 Ga0207649_10172387
1631 Ga0207652_10008635
1632 Ga0207652_10251572
1633 Ga0207681_10016068
1634 Ga0207681_10070088
1635 Ga0207681_10333529
1636 Ga0207694_10045720
1637 Ga0207694_10086839
1638 Ga0207694_10143076
1639 Ga0207694_10281860
1640 Ga0207650_10031890
1641 Ga0207650_10043633
1642 Ga0207650_10080435
1643 Ga0207650_10131371
1644 Ga0207650_10158597
1645 Ga0207650_10225661
1646 Ga0207659_10028675
1647 Ga0207659_10096785
1648 Ga0207659_10107339
1649 Ga0207659_10157027
1650 Ga0207659_10282086
1651 Ga0207659_10362485
1652 Ga0207659_10475067
1653 Ga0207687_10149957
1654 Ga0207644_10092279
1655 Ga0207644_10188833
1656 Ga0207644_10292607
1657 Ga0207644_10535585
1658 Ga0207690_10018477
1659 Ga0207690_10238817
1660 Ga0207690_10402467
1661 Ga0207706_10006356
1662 Ga0207706_10014853
1663 Ga0207706_10026565
1664 Ga0207706_10045674
1665 Ga0207706_10065864
1666 Ga0207706_10352759
1667 Ga0207686_10014467
1668 Ga0207686_10060441
1669 Ga0207686_10105841
1670 Ga0207686_10137709
1671 Ga0207686_10186980
1672 Ga0207686_10461705
1673 Ga0207670_10033019
1674 Ga0207670_10060645
1675 Ga0207670_10085704
1676 Ga0207670_10094592
1677 Ga0207669_10145645
1678 Ga0207704_10062204
1679 Ga0207704_10113506
1680 Ga0207691_10000001
1681 Ga0207691_10002741
1682 Ga0207691_10329902
1683 Ga0207711_10267904
1684 Ga0207711_10461652
1685 Ga0207689_10005940
1686 Ga0207689_10006806
1687 Ga0207689_10007410
1688 Ga0207689_10008752
1689 Ga0207689_10011365
1690 Ga0207689_10013953
1691 Ga0207689_10016323
1692 Ga0207689_10063505
1693 Ga0207689_10092895
1694 Ga0207689_10263759
1695 Ga0207661_10021833
1696 Ga0207661_10060351
1697 Ga0207661_10126442
1698 Ga0207661_10320475
1699 Ga0207661_10491821
1700 Ga0207661_10642799
1701 Ga0207679_10016136
1702 Ga0207679_10021807
1703 Ga0207679_10033718
1704 Ga0207679_10038027
1705 Ga0207679_10281556
1706 Ga0207679_10390783
1707 Ga0207667_10000453
1708 Ga0207667_10033746
1709 Ga0207667_10063294
1710 Ga0207667_10118422
1711 Ga0207651_10014865
1712 Ga0207651_10022746
1713 Ga0207651_10030229
1714 Ga0207651_10031501
1715 Ga0207651_10033814
1716 Ga0207651_10036594
1717 Ga0207651_10054997
1718 Ga0207651_10084792
1719 Ga0207651_10120053
1720 Ga0207651_10199934
1721 Ga0207712_10023997
1722 Ga0207712_10037794
1723 Ga0207712_10042125
1724 Ga0207712_10048392
1725 Ga0207712_10054866
1726 Ga0207712_10137405
1727 Ga0207668_10000869
1728 Ga0207668_10091974
1729 Ga0207668_10164368
1730 Ga0207668_10225935
1731 Ga0207640_10022058
1732 Ga0207640_10077085
1733 Ga0207658_10002877
1734 Ga0207658_10020539
1735 Ga0207658_10020590
1736 Ga0207658_10039811
1737 Ga0207658_10052257
1738 Ga0207658_10058281
1739 Ga0207658_10150083
1740 Ga0207658_10163679
1741 Ga0207677_10050769
1742 Ga0207677_10080481
1743 Ga0207677_10097811
1744 Ga0207677_10345930
1745 Ga0207703_10004088
1746 Ga0207703_10022141
1747 Ga0207703_10051716
1748 Ga0207703_10661373
1749 Ga0207639_10002238
1750 Ga0207639_10047581
1751 Ga0207639_10105075
1752 Ga0207639_10144591
1753 Ga0207639_10196012
1754 Ga0207639_10243757
1755 Ga0207639_10247394
1756 Ga0207639_10263551
1757 Ga0207639_10324443
1758 Ga0207639_10329494
1759 Ga0207639_10421351
1760 Ga0207678_10019197
1761 Ga0207708_10039000
1762 Ga0207708_10048195
1763 Ga0207702_10026997
1764 Ga0207702_10114466
1765 Ga0207641_10000121
1766 Ga0207641_10010823
1767 Ga0207641_10013957
1768 Ga0207641_10019401
1769 Ga0207641_10119627
1770 Ga0207641_10394484
1771 Ga0207648_10002625
1772 Ga0207648_10013430
1773 Ga0207648_10016514
1774 Ga0207648_10027371
1775 Ga0207648_10144627
1776 Ga0207648_10200755
1777 Ga0207648_10337183
1778 Ga0207648_10463175
1779 Ga0207676_10038439
1780 Ga0207676_10055443
1781 Ga0207676_10070734
1782 Ga0207676_10078366
1783 Ga0207676_10475099
1784 Ga0207674_10005332
1785 Ga0207674_10007100
1786 Ga0207674_10015613
1787 Ga0207674_10051135
1788 Ga0207674_10236693
1789 Ga0207674_10330493
1790 Ga0207674_10568319
1791 Ga0207675_100002059
1792 Ga0207675_100031608
1793 Ga0207675_100070660
1794 Ga0207675_100099312
1795 Ga0207675_100440014
1796 Ga0207683_10017329
1797 Ga0207683_10030237
1798 Ga0207683_10180996
1799 Ga0207698_10005783
1800 Ga0207698_10019868
1801 Ga0207698_10208239
1802 Ga0207698_10231367
1803 Ga0207428_10033868
1804 Ga0207428_10183035
1805 Ga0268266_10000038
1806 Ga0268266_10010826
1807 Ga0268266_10191628
1808 Ga0268266_10280725
1809 Ga0268265_10027892
1810 Ga0268265_10110087
1811 Ga0268265_10118546
1812 Ga0268265_10143991
1813 Ga0268264_10000167
1814 Ga0268264_10003997
1815 Ga0268264_10009265
1816 Ga0268264_10013426
1817 Ga0268264_10022499
1818 Ga0268264_10115863
1819 Ga0268264_10278666
1820 Ga0268264_10289823
1821 Ga0268264_10323383
1822 Ga0265336_10000007
1823 Ga0307517_10025139
1824 Ga0307515_10000469
1825 Ga0307511_10008283
1826 Ga0307512_10245653
1827 Ga0265327_10076362
1828 Ga0265316_10002446
1829 Ga0307513_10077739
1830 Ga0307509_10052614
1831 Ga0307509_10136415
1832 Ga0307508_10001613
1833 Ga0307508_10256541
1834 Ga0316576_10001081
1835 Ga0316576_10048308
1836 Ga0316578_10004394
1837 Ga0307516_10004268
1838 Ga0307516_10058896
1839 Ga0307516_10164433
1840 Ga0307405_10000018
1841 Ga0307406_10056552
1842 Ga0307407_10000015
1843 Ga0307412_10093985
1844 Ga0307409_100124233
1845 Ga0307409_100585077
1846 Ga0307416_100000025
1847 Ga0307416_100185000
1848 Ga0307416_100503717
1849 Ga0307414_10003961
1850 Ga0307414_10027951
1851 Ga0307510_10000380
1852 Ga0373923_0091968
1853 Ga0373955_0223970
1854 Ga0373935_0065008
1855 Ga0373937_0027762
1856 Ga0316582_0063175
1857 Ga0316584_0007005
1858 Ga0395900_0072926
1859 Ga0395900_0341038
1860 Ga0395900_0567408
1861 Ga0395905_0002823
1862 Ga0395905_0005630
1863 Ga0395905_0128646
1864 Ga0400489_00932
1865 Ga0436365_0337807
1866 Ga0436365_0446442
1867 Ga0436365_0968987
1868 Ga0436365_1161992
1869 Ga0436365_1480084
1870 Ga0439436_0000998
1871 Ga0439436_0056906
1872 Ga0439439_0007187
1873 Ga0451793_1128229
1874 Ga0451798_0789946
1875 Ga0451851_0973538
1876 Ga0439445_0015644
1877 Ga0439448_0045488
1878 Ga0439449_0002063
1879 Ga0439449_0064488
1880 Ga0439457_004078
1881 Ga0439457_071486
1882 Ga0451577_0013904
1883 Ga0451577_0024955
1884 Ga0451577_0122476
1885 Ga0451577_0166623
1886 Ga0451577_0179508
1887 Ga0451577_0513468
1888 Ga0451577_1046607
1889 Ga0466969_0000246
1890 Ga0466969_0065958
1891 Ga0466972_0000025
1892 Ga0466972_0005074
1893 Ga0466972_0016146
1894 Ga0466972_0105800
1895 Ga0453683_0009005
1896 Ga0453683_0022263
1897 Ga0453683_0051960
1898 Ga0453683_0095683
1899 Ga0466965_0200193
1900 Ga0466966_0004412
1901 Ga0466961_0060606
1902 Ga0466961_0082362
1903 Ga0453684_0000440
1904 Ga0453684_0012498
1905 Ga0453684_0031999
1906 Ga0453684_0035092
1907 Ga0453684_0047532
1908 Ga0453684_0133499
1909 Ga0453684_0291212
1910 Ga0453684_0342687
1911 Ga0453684_0468530
1912 Ga0453684_0541906
1913 Ga0466971_0029515
1914 Ga0466968_0091591
1915 Ga0466970_0005458
1916 Ga0466970_0043793
1917 Ga0466959_0000017
1918 Ga0466959_0021114
1919 Ga0451576_0027225
1920 Ga0451576_0033773
1921 Ga0451576_0047592
1922 Ga0451576_0157120
1923 Ga0451576_0767533
1924 Ga0466958_0069216
1925 Ga0466967_0098688
1926 Ga0495650_0031147
1927 Ga0495580_0020527
1928 Ga0495580_0130700
1929 Ga0495594_0028749
1930 Ga0495606_0003054
1931 Ga0495608_0224629
1932 Ga0495610_0000047
1933 Ga0495610_0000904
1934 Ga0495628_0049106
1935 Ga0495630_0006664
1936 Ga0495643_0049652
1937 Ga0495648_0136981
1938 Ga0495652_0208384
1939 Ga0495598_0022199
1940 Ga0495667_0099636
1941 Ga0495667_0268170
1942 Ga0495668_0000453
1943 Ga0495668_0001518
1944 Ga0495634_0079528
1945 Ga0495634_0125601
1946 Ga0495611_0003370
1947 Ga0495625_0073581
1948 Ga0495657_0306092
1949 Ga0495623_0301213
1950 Ga0495646_0245927
1951 Ga0495658_0002499
1952 Ga0495649_0044299
1953 Ga0495649_0083012
1954 Ga0495604_0042067
1955 Ga0495672_0108430
1956 Ga0495687_000001
1957 Ga0495675_0182826
1958 Ga0495686_0000004
1959 Ga0495686_0000577
1960 Ga0495686_0028262
1961 Ga0495686_0106869
1962 Ga0495686_0178938
1963 Ga0496101_0010154
1964 Ga0496101_0337118
1965 Ga0496104_0524509
1966 Ga0496104_0629802
1967 Ga0496106_0196170
1968 Ga0496112_0061676
1969 Ga0496121_0000030
1970 Ga0496124_0051801
1971 Ga0496126_0016712
1972 Ga0501031_0116888
1973 Ga0501032_0002071
1974 Ga0501032_0109448
1975 Ga0501033_0076666
1976 Ga0501033_0241911
1977 Ga0501034_0014513
1978 Ga0501034_0089868
1979 Ga0501034_0143815
1980 Ga0501036_0010214
1981 Ga0501036_0016999
1982 Ga0501036_0057478
1983 Ga0501037_0082387
1984 Ga0501038_0038680
1985 Ga0501039_0020673
1986 Ga0501040_0166313
1987 Ga0501043_0001446
1988 Ga0501043_0142998
1989 Ga0501043_0208303
1990 Ga0501043_0235371
1991 Ga0501046_0026523
1992 Ga0501046_0042705
1993 Ga0501046_0251713
1994 Ga0501047_0000014
1995 Ga0501047_0031616
1996 Ga0501047_0045624
1997 Ga0501047_0108355
1998 Ga0501047_0110170
1999 Ga0501047_0282844
2000 Ga0501048_0010340
2001 Ga0501067_0035163
2002 Ga0501070_0009038
2003 Ga0501071_0041001
2004 Ga0501072_0091876
2005 Ga0501073_0002480
2006 Ga0501073_0032328
2007 Ga0501202_004157
2008 Ga0501207_005672
2009 Ga0501223_031393
2010 Ga0501233_046619
2011 Ga0501242_013656
2012 Ga0501253_024416
2013 Ga0501257_036941
2014 Ga0501259_001982
2015 Ga0501259_007371
2016 Ga0501261_004784
2017 Ga0501221_037622
2018 Ga0501225_0001750
2019 Ga0501225_0004489
2020 Ga0501225_0029915
2021 Ga0501225_0048119
2022 Ga0501080_0035066
2023 Ga0501080_0173263
2024 Ga0501241_008348
2025 Ga0501266_004386
2026 Ga0501268_011400
2027 Ga0501269_001678
2028 Ga0501035_0012769
2029 Ga0501035_0119494
2030 Ga0501044_0004256
2031 Ga0501044_0027270
2032 Ga0501044_0078101
2033 Ga0501044_0129257
2034 Ga0501044_0210760
2035 Ga0501044_0243013
2036 Ga0501044_0420384
2037 nmdc:mga0k408_19225_c1
2038 nmdc:mga0k408_28497_c1
2039 nmdc:mga0k408_34103_c1
2040 nmdc:mga0k408_355166_c1
2041 nmdc:mga0k408_54699_c1
2042 nmdc:mga05p37_327139_c1
2043 nmdc:mga05p37_3944_c1
2044 nmdc:mga05p37_85778_c2
2045 nmdc:mga05p37_93236_c1
2046 nmdc:mga09592_457896_c1
2047 nmdc:mga09592_74593_c1
2048 nmdc:mga06r32_79583_c1
2049 nmdc:mga08y16_18379_c1
2050 nmdc:mga08y16_259415_c1
2051 nmdc:mga08y16_90253_c1
2052 Ga0495595_0026950
2053 Ga0500578_0000136
2054 Ga0500578_0219597
2055 Ga0500644_0000344
2056 Ga0500646_0011763
2057 Ga0500646_0062022
2058 Ga0500583_0000127
2059 Ga0500583_0004905
2060 Ga0500583_0011554
2061 Ga0500583_0021234
2062 Ga0500583_0091634
2063 Ga0500562_000061
2064 Ga0500568_0000439
2065 Ga0500588_0000910
2066 Ga0500588_0018497
2067 Ga0500604_0007195
2068 Ga0500616_0000698
2069 Ga0500616_0010292
2070 Ga0500616_0017066
2071 Ga0500616_0045533
2072 Ga0500622_0000156
2073 Ga0500622_0000655
2074 Ga0500622_0004617
2075 Ga0500622_0020704
2076 Ga0500636_0136494
2077 Ga0500637_0047204
2078 Ga0500611_000032
2079 Ga0500645_062147
2080 Ga0501084_0027666
2081 Ga0501082_0128401
2082 Ga0466962_0003273
2083 2586210394
2084 2738726220
2085 2738856020
2086 2739591027
2087 2739618073
2088 2739647443
2089 2819549961
2090 2819590262
2091 2842723438
2092 2842909932
2093 2849284791
2094 2857632211
2095 2881957873
2096 2904445970
2097 2914763482
2098 2929155029
2099 2946000281
2100 2954017168

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

54

283

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.985 1 248
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.981 1 250
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9803 1 248
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9764 1 248
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9758 1 248
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9828 1 248 3.90.230.10
af_A0A1D6PU20_39_318_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9776 1 248 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9776 48 248 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9774 1 249 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9768 13 124 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A317EX38-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9975 1 263 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3M1YZQ6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9959 2 253 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A6EHP3-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9953 23 258 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A661YHV2-F1-model_v4 deleted 0.9945 1 223
AF-A0A2D5LTK2-F1-model_v4 deleted 0.9931 1 255

Map