F489063

General Info

Members Datasets Scaffolds Average Seq Length
1050 333 2100 251

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0025172|Ga0495601_0025172_177_1010
Length 277
Sequence VLRVRAIALTAMSIAIHDLVKTYGQFTAVNGVSLDVQPGEIHGFLGPNGAGKTTTLRMIAGLLKPTAGRIEVNGHDLAKDPESAKASLGFIPDRPYIYEKLTAGEFLRFHGGLFGMNGSGQNPIGNRVKEMLELFELGRWENELVESFSHGMKQRLVMSAAFLHRPRAVVVDEPMVGLDPRGARLIKDVFRKMSERGVAILMSTHTLEVAEEMCDCISIILKGRIIARGTVDELRALAAGDDASGVLPGDEVDEVELTSVFLKLTGGSGLQEIDEIV

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
214 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
215 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
218 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
219 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
220 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
221 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
330 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.71
Nodule 0
Rhizoplane 2.1
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0025172 3300053077 Bacteria 3668
2 JGI25405J52794_10003721 3300003911 Unclassified 2691
3 Ga0065704_10170200 3300005289 Unclassified 1296
4 Ga0065712_10005714 3300005290 Bacteria 3303
5 Ga0065712_10088511 3300005290 Archaea 2516
6 Ga0065712_10105799 3300005290 Bacteria 1902
7 Ga0065715_10007369 3300005293 Bacteria 5543
8 Ga0065715_10051194 3300005293 Bacteria 985
9 Ga0065715_10096409 3300005293 Bacteria 3813
10 Ga0065707_10002251 3300005295 Bacteria 8627
11 Ga0065707_10005235 3300005295 Bacteria 4356
12 Ga0065707_10085509 3300005295 Bacteria 6100
13 Ga0065707_10165513 3300005295 Bacteria 1526
14 Ga0070676_10006806 3300005328 Bacteria 6126
15 Ga0070676_10321649 3300005328 Bacteria 1055
16 Ga0070683_100006082 3300005329 Bacteria 10117
17 Ga0070683_100121001 3300005329 Bacteria 2473
18 Ga0070683_100165983 3300005329 Archaea 2095
19 Ga0070690_100029154 3300005330 Bacteria 3421
20 Ga0070690_100109929 3300005330 Bacteria 1838
21 Ga0070670_100003674 3300005331 Bacteria 12789
22 Ga0070670_100056795 3300005331 Bacteria 3360
23 Ga0070670_100178229 3300005331 Archaea 1845
24 Ga0070677_10031350 3300005333 Bacteria 2032
25 Ga0068869_100164778 3300005334 Bacteria 1728
26 Ga0068869_100186928 3300005334 Bacteria 1627
27 Ga0068869_100280438 3300005334 Bacteria 1340
28 Ga0068869_100375534 3300005334 Bacteria 1164
29 Ga0070666_10022440 3300005335 Bacteria 4098
30 Ga0070666_10039046 3300005335 Unclassified 3162
31 Ga0070666_10087282 3300005335 Archaea 2138
32 Ga0068868_100025873 3300005338 Bacteria 4468
33 Ga0068868_100028023 3300005338 Bacteria 4302
34 Ga0068868_100079273 3300005338 Bacteria 2631
35 Ga0068868_100241239 3300005338 Bacteria 1519
36 Ga0070689_100005737 3300005340 Bacteria 8512
37 Ga0070689_100008806 3300005340 Bacteria 7126
38 Ga0070689_100009227 3300005340 Bacteria 6985
39 Ga0070689_100011887 3300005340 Bacteria 6249
40 Ga0070691_10044437 3300005341 Bacteria 2107
41 Ga0070687_100062482 3300005343 Bacteria 1972
42 Ga0070687_100161004 3300005343 Bacteria 1326
43 Ga0070661_100016292 3300005344 Bacteria 5254
44 Ga0070661_100499300 3300005344 Bacteria 974
45 Ga0070692_10027343 3300005345 Bacteria 2826
46 Ga0070668_100295055 3300005347 Bacteria 1358
47 Ga0070668_100312884 3300005347 Bacteria 1320
48 Ga0070669_100002795 3300005353 Bacteria 12595
49 Ga0070669_100009439 3300005353 Bacteria 6948
50 Ga0070669_100131441 3300005353 Bacteria 1921
51 Ga0070669_100216352 3300005353 Bacteria 1513
52 Ga0070675_100001411 3300005354 Bacteria 17650
53 Ga0070675_100014315 3300005354 Bacteria 6253
54 Ga0070675_100038263 3300005354 Bacteria 3909
55 Ga0070675_100144890 3300005354 Bacteria 2033
56 Ga0070675_100166641 3300005354 Archaea 1898
57 Ga0070675_100204877 3300005354 Bacteria 1713
58 Ga0070675_100339176 3300005354 Bacteria 1331
59 Ga0070671_100061284 3300005355 Bacteria 3133
60 Ga0070671_100150212 3300005355 Archaea 1967
61 Ga0070671_100280269 3300005355 Bacteria 1418
62 Ga0070674_100014917 3300005356 Bacteria 4839
63 Ga0070674_100020861 3300005356 Bacteria 4196
64 Ga0070674_100026357 3300005356 Bacteria 3795
65 Ga0070674_100035571 3300005356 Bacteria 3336
66 Ga0070674_100138361 3300005356 Bacteria 1824
67 Ga0070674_100139424 3300005356 Bacteria 1818
68 Ga0070673_100006996 3300005364 Bacteria 7393
69 Ga0070673_100011588 3300005364 Bacteria 6022
70 Ga0070673_100012813 3300005364 Bacteria 5771
71 Ga0070673_100069369 3300005364 Bacteria 2825
72 Ga0070673_100090119 3300005364 Bacteria 2505
73 Ga0070673_100389527 3300005364 Bacteria 1244
74 Ga0070688_100068697 3300005365 Bacteria 2260
75 Ga0070659_100074165 3300005366 Bacteria 2710
76 Ga0070667_100042719 3300005367 Bacteria 3804
77 Ga0070667_100138545 3300005367 Archaea 2129
78 Ga0070667_100167371 3300005367 Unclassified 1939
79 Ga0070667_100466462 3300005367 Bacteria 1155
80 Ga0070709_10093260 3300005434 Bacteria 1990
81 Ga0070709_10156519 3300005434 Bacteria 1580
82 Ga0070713_100010981 3300005436 Bacteria 6570
83 Ga0070701_10007454 3300005438 Bacteria 4676
84 Ga0070701_10038327 3300005438 Bacteria 2425
85 Ga0070701_10310978 3300005438 Bacteria 972
86 Ga0070705_100000016 3300005440 Bacteria 90163
87 Ga0070705_100007054 3300005440 Bacteria 5522
88 Ga0070705_100012183 3300005440 Bacteria 4364
89 Ga0070705_100022448 3300005440 Bacteria 3372
90 Ga0070705_100162140 3300005440 Bacteria 1496
91 Ga0070705_100240775 3300005440 Bacteria 1264
92 Ga0070705_100284793 3300005440 Bacteria 1177
93 Ga0070700_100014023 3300005441 Bacteria 4518
94 Ga0070700_100020027 3300005441 Bacteria 3870
95 Ga0070700_100025789 3300005441 Bacteria 3464
96 Ga0070700_100143020 3300005441 Bacteria 1628
97 Ga0070700_100282727 3300005441 Bacteria 1204
98 Ga0070700_100501744 3300005441 Bacteria 933
99 Ga0070694_100000279 3300005444 Bacteria 27271
100 Ga0070694_100051631 3300005444 Bacteria 2777
101 Ga0070694_100054815 3300005444 Bacteria 2702
102 Ga0070694_100080930 3300005444 Unclassified 2258
103 Ga0070694_100112572 3300005444 Bacteria 1941
104 Ga0070708_100255719 3300005445 Bacteria 1646
105 Ga0070708_100267398 3300005445 Bacteria 1608
106 Ga0070708_100317841 3300005445 Bacteria 1467
107 Ga0070708_100467772 3300005445 Bacteria 1189
108 Ga0070678_100022491 3300005456 Bacteria 4180
109 Ga0070678_100252298 3300005456 Bacteria 1480
110 Ga0070662_100040364 3300005457 Bacteria 3322
111 Ga0070662_100152569 3300005457 Unclassified 1800
112 Ga0070681_10138723 3300005458 Bacteria 2361
113 Ga0068867_100002379 3300005459 Bacteria 13223
114 Ga0068867_100024363 3300005459 Bacteria 4335
115 Ga0068867_100050212 3300005459 Bacteria 3073
116 Ga0068867_100080672 3300005459 Bacteria 2451
117 Ga0068867_100860136 3300005459 Bacteria 813
118 Ga0070685_10010288 3300005466 Bacteria 4856
119 Ga0070706_100005121 3300005467 Bacteria 12507
120 Ga0070706_100095894 3300005467 Bacteria 2754
121 Ga0070706_100342967 3300005467 Bacteria 1393
122 Ga0070706_100364722 3300005467 Unclassified 1346
123 Ga0070706_100700205 3300005467 Bacteria 939
124 Ga0070707_100048133 3300005468 Bacteria 4084
125 Ga0070707_100075269 3300005468 Bacteria 3256
126 Ga0070707_100087606 3300005468 Bacteria 3011
127 Ga0070707_100158438 3300005468 Bacteria 2205
128 Ga0070707_100184718 3300005468 Bacteria 2033
129 Ga0070707_100199012 3300005468 Bacteria 1953
130 Ga0070707_100300530 3300005468 Bacteria 1560
131 Ga0070707_100388790 3300005468 Bacteria 1355
132 Ga0070698_100004889 3300005471 Bacteria 14710
133 Ga0070698_100015072 3300005471 Bacteria 8172
134 Ga0070698_100024325 3300005471 Bacteria 6319
135 Ga0070698_100028123 3300005471 Bacteria 5843
136 Ga0070698_100083790 3300005471 Bacteria 3177
137 Ga0070698_100247228 3300005471 Bacteria 1716
138 Ga0070698_100385143 3300005471 Bacteria 1335
139 Ga0070698_100671570 3300005471 Bacteria 978
140 Ga0070699_100000388 3300005518 Bacteria 42659
141 Ga0070699_100001370 3300005518 Bacteria 22398
142 Ga0070699_100001651 3300005518 Bacteria 20364
143 Ga0070699_100014128 3300005518 Bacteria 6869
144 Ga0070699_100025124 3300005518 Bacteria 5136
145 Ga0070699_100027914 3300005518 Bacteria 4868
146 Ga0070699_100061496 3300005518 Bacteria 3254
147 Ga0070699_100081764 3300005518 Bacteria 2816
148 Ga0070699_100108356 3300005518 Bacteria 2438
149 Ga0070699_100195297 3300005518 Bacteria 1799
150 Ga0070699_100379626 3300005518 Bacteria 1276
151 Ga0070679_100028536 3300005530 Bacteria 5503
152 Ga0070684_100001607 3300005535 Bacteria 16329
153 Ga0070684_100005752 3300005535 Bacteria 9531
154 Ga0070684_100163975 3300005535 Bacteria 2017
155 Ga0070697_100006069 3300005536 Bacteria 9349
156 Ga0070697_100028711 3300005536 Bacteria 4456
157 Ga0070697_100104650 3300005536 Bacteria 2353
158 Ga0070697_100213299 3300005536 Bacteria 1644
159 Ga0068853_100295519 3300005539 Bacteria 1496
160 Ga0070672_100005758 3300005543 Bacteria 8261
161 Ga0070672_100059416 3300005543 Bacteria 3008
162 Ga0070672_100084165 3300005543 Bacteria 2554
163 Ga0070686_100024077 3300005544 Bacteria 3647
164 Ga0070686_100167871 3300005544 Bacteria 1550
165 Ga0070686_100389065 3300005544 Bacteria 1058
166 Ga0070686_100465093 3300005544 Bacteria 975
167 Ga0070695_100000061 3300005545 Bacteria 44298
168 Ga0070695_100003902 3300005545 Bacteria 8706
169 Ga0070695_100041240 3300005545 Bacteria 2925
170 Ga0070695_100109023 3300005545 Bacteria 1876
171 Ga0070695_100112542 3300005545 Bacteria 1849
172 Ga0070696_100000571 3300005546 Bacteria 23529
173 Ga0070696_100005465 3300005546 Bacteria 8477
174 Ga0070696_100040027 3300005546 Bacteria 3236
175 Ga0070696_100086982 3300005546 Bacteria 2220
176 Ga0070696_100547662 3300005546 Bacteria 926
177 Ga0070693_100066041 3300005547 Bacteria 2116
178 Ga0070665_100016328 3300005548 Bacteria 7445
179 Ga0070665_100065573 3300005548 Bacteria 3642
180 Ga0070704_100000718 3300005549 Bacteria 16171
181 Ga0070704_100009228 3300005549 Bacteria 5951
182 Ga0070704_100025085 3300005549 Bacteria 3921
183 Ga0070704_100044405 3300005549 Bacteria 3088
184 Ga0070704_100430955 3300005549 Bacteria 1131
185 Ga0070704_100624956 3300005549 Bacteria 949
186 Ga0070664_100002520 3300005564 Bacteria 14761
187 Ga0070664_100016849 3300005564 Bacteria 5998
188 Ga0068857_100042312 3300005577 Bacteria 4041
189 Ga0068857_100138987 3300005577 Archaea 2195
190 Ga0068857_100160805 3300005577 Bacteria 2038
191 Ga0068854_100019045 3300005578 Bacteria 4618
192 Ga0068854_100042743 3300005578 Bacteria 3209
193 Ga0070702_100203421 3300005615 Bacteria 1313
194 Ga0068859_100000940 3300005617 Bacteria 29798
195 Ga0068859_100003972 3300005617 Bacteria 15091
196 Ga0068859_100038713 3300005617 Bacteria 4783
197 Ga0068859_100060701 3300005617 Unclassified 3810
198 Ga0068859_100248282 3300005617 Bacteria 1870
199 Ga0068859_100505346 3300005617 Bacteria 1304
200 Ga0068864_100028303 3300005618 Bacteria 4736
201 Ga0068864_100186160 3300005618 Bacteria 1901
202 Ga0068864_100425635 3300005618 Bacteria 1266
203 Ga0068861_100000753 3300005719 Bacteria 19414
204 Ga0068861_100027954 3300005719 Bacteria 4112
205 Ga0068861_100126847 3300005719 Bacteria 2066
206 Ga0068861_100128155 3300005719 Bacteria 2056
207 Ga0068861_100167648 3300005719 Bacteria 1817
208 Ga0068861_100190742 3300005719 Bacteria 1713
209 Ga0068861_100405535 3300005719 Bacteria 1211
210 Ga0068851_10111766 3300005834 Unclassified 1459
211 Ga0068870_10014038 3300005840 Bacteria 3775
212 Ga0068863_100009319 3300005841 Bacteria 9580
213 Ga0068863_100102559 3300005841 Unclassified 2720
214 Ga0068863_100169327 3300005841 Bacteria 2095
215 Ga0068863_100217153 3300005841 Bacteria 1841
216 Ga0068858_100009204 3300005842 Bacteria 9438
217 Ga0068858_100019683 3300005842 Bacteria 6311
218 Ga0068858_100158144 3300005842 Archaea 2133
219 Ga0068858_100274625 3300005842 Bacteria 1604
220 Ga0068858_100457983 3300005842 Unclassified 1230
221 Ga0068860_100024357 3300005843 Bacteria 5849
222 Ga0068860_100024428 3300005843 Bacteria 5839
223 Ga0068860_100084499 3300005843 Bacteria 3020
224 Ga0068860_100141468 3300005843 Bacteria 2313
225 Ga0068862_100000612 3300005844 Bacteria 37096
226 Ga0068862_100028702 3300005844 Bacteria 4685
227 Ga0068862_100039204 3300005844 Bacteria 4023
228 Ga0068862_100052619 3300005844 Bacteria 3484
229 Ga0068862_100139194 3300005844 Bacteria 2153
230 Ga0068862_100200359 3300005844 Bacteria 1800
231 Ga0068862_100210502 3300005844 Bacteria 1757
232 Ga0068862_100248914 3300005844 Bacteria 1619
233 Ga0081455_10002517 3300005937 Bacteria 21758
234 Ga0081538_10007747 3300005981 Bacteria 9235
235 Ga0081540_1015496 3300005983 Bacteria 4825
236 Ga0081539_10027639 3300005985 Bacteria 3588
237 Ga0081539_10052810 3300005985 Bacteria 2279
238 Ga0075368_10007051 3300006042 Bacteria 3955
239 Ga0075368_10009337 3300006042 Bacteria 3527
240 Ga0075363_100020050 3300006048 Bacteria 3350
241 Ga0075364_10011053 3300006051 Bacteria 5478
242 Ga0075364_10047832 3300006051 Bacteria 2787
243 Ga0075364_10048544 3300006051 Bacteria 2766
244 Ga0075364_10132308 3300006051 Bacteria 1675
245 Ga0075364_10189464 3300006051 Bacteria 1393
246 Ga0075432_10074504 3300006058 Bacteria 1223
247 Ga0070716_100170006 3300006173 Bacteria 1421
248 Ga0075362_10000342 3300006177 Bacteria 13343
249 Ga0075362_10009532 3300006177 Bacteria 3758
250 Ga0075367_10002146 3300006178 Bacteria 8874
251 Ga0075367_10008454 3300006178 Bacteria 5333
252 Ga0075367_10014597 3300006178 Bacteria 4253
253 Ga0075367_10047450 3300006178 Bacteria 2527
254 Ga0075366_10001977 3300006195 Bacteria 10373
255 Ga0075366_10004267 3300006195 Bacteria 7668
256 Ga0097621_100044020 3300006237 Bacteria 3600
257 Ga0097621_100050875 3300006237 Bacteria 3370
258 Ga0097621_100268169 3300006237 Unclassified 1499
259 Ga0097621_100361067 3300006237 Bacteria 1294
260 Ga0097621_100507716 3300006237 Bacteria 1093
261 Ga0075370_10008821 3300006353 Bacteria 5206
262 Ga0075370_10126123 3300006353 Bacteria 1492
263 Ga0068871_100008186 3300006358 Bacteria 7510
264 Ga0068871_100010044 3300006358 Bacteria 6883
265 Ga0068871_100012078 3300006358 Bacteria 6357
266 Ga0068871_100090873 3300006358 Bacteria 2543
267 Ga0068871_100093277 3300006358 Bacteria 2511
268 Ga0068871_100246910 3300006358 Bacteria 1554
269 Ga0075428_100000037 3300006844 Bacteria 105391
270 Ga0075428_100000862 3300006844 Bacteria 31924
271 Ga0075428_100004677 3300006844 Bacteria 15154
272 Ga0075428_100011075 3300006844 Bacteria 10033
273 Ga0075428_100013797 3300006844 Bacteria 8998
274 Ga0075428_100022252 3300006844 Bacteria 7019
275 Ga0075428_100028725 3300006844 Bacteria 6153
276 Ga0075428_100053234 3300006844 Bacteria 4434
277 Ga0075428_100079714 3300006844 Bacteria 3573
278 Ga0075428_100081214 3300006844 Bacteria 3538
279 Ga0075428_100084143 3300006844 Bacteria 3471
280 Ga0075428_100135988 3300006844 Bacteria 2672
281 Ga0075428_100180128 3300006844 Bacteria 2288
282 Ga0075428_100316600 3300006844 Bacteria 1677
283 Ga0075428_100333260 3300006844 Bacteria 1630
284 Ga0075428_100599064 3300006844 Bacteria 1177
285 Ga0075430_100000655 3300006846 Bacteria 26398
286 Ga0075430_100095248 3300006846 Bacteria 2488
287 Ga0075430_100099053 3300006846 Bacteria 2435
288 Ga0075430_100131855 3300006846 Bacteria 2083
289 Ga0075430_100155649 3300006846 Bacteria 1903
290 Ga0075430_100220864 3300006846 Bacteria 1572
291 Ga0075430_100229698 3300006846 Bacteria 1539
292 Ga0075431_100012414 3300006847 Bacteria 8597
293 Ga0075431_100046991 3300006847 Bacteria 4451
294 Ga0075431_100073064 3300006847 Bacteria 3539
295 Ga0075431_100082230 3300006847 Bacteria 3324
296 Ga0075431_100096915 3300006847 Bacteria 3045
297 Ga0075431_100110730 3300006847 Bacteria 2834
298 Ga0075433_10007731 3300006852 Bacteria 8540
299 Ga0075433_10039242 3300006852 Bacteria 4093
300 Ga0075433_10052832 3300006852 Bacteria 3541
301 Ga0075433_10054439 3300006852 Bacteria 3491
302 Ga0075433_10057366 3300006852 Bacteria 3403
303 Ga0075433_10081956 3300006852 Bacteria 2845
304 Ga0075433_10155475 3300006852 Bacteria 2035
305 Ga0075433_10184022 3300006852 Bacteria 1859
306 Ga0075433_10260765 3300006852 Bacteria 1536
307 Ga0075433_10404294 3300006852 Bacteria 1205
308 Ga0075433_10412631 3300006852 Bacteria 1191
309 Ga0075434_100000019 3300006871 Bacteria 73391
310 Ga0075434_100001168 3300006871 Bacteria 21752
311 Ga0075434_100009596 3300006871 Bacteria 9035
312 Ga0075434_100081191 3300006871 Bacteria 3240
313 Ga0075434_100084276 3300006871 Bacteria 3177
314 Ga0075434_100179364 3300006871 Bacteria 2138
315 Ga0075434_100247819 3300006871 Bacteria 1801
316 Ga0075434_100356718 3300006871 Bacteria 1483
317 Ga0075429_100005390 3300006880 Bacteria 11006
318 Ga0075429_100007476 3300006880 Bacteria 9484
319 Ga0075429_100058680 3300006880 Bacteria 3352
320 Ga0075429_100111123 3300006880 Bacteria 2395
321 Ga0068865_100010101 3300006881 Bacteria 5874
322 Ga0068865_100014003 3300006881 Bacteria 5089
323 Ga0068865_100023794 3300006881 Bacteria 4015
324 Ga0068865_100193892 3300006881 Bacteria 1573
325 Ga0075436_100000160 3300006914 Bacteria 41885
326 Ga0075436_100019245 3300006914 Bacteria 4678
327 Ga0075436_100035724 3300006914 Bacteria 3427
328 Ga0075436_100324167 3300006914 Bacteria 1107
329 Ga0097620_100000940 3300006931 Bacteria 29798
330 Ga0097620_100003972 3300006931 Bacteria 15091
331 Ga0097620_100038715 3300006931 Bacteria 4783
332 Ga0097620_100060700 3300006931 Unclassified 3810
333 Ga0097620_100248275 3300006931 Bacteria 1870
334 Ga0097620_100505408 3300006931 Bacteria 1304
335 Ga0075435_100000041 3300007076 Bacteria 66202
336 Ga0075435_100009005 3300007076 Bacteria 7202
337 Ga0075435_100009374 3300007076 Bacteria 7083
338 Ga0075435_100012805 3300007076 Bacteria 6215
339 Ga0075435_100015015 3300007076 Bacteria 5811
340 Ga0075435_100023820 3300007076 Bacteria 4741
341 Ga0075435_100027371 3300007076 Bacteria 4459
342 Ga0075435_100122061 3300007076 Bacteria 2175
343 Ga0075435_100369723 3300007076 Bacteria 1231
344 Ga0099795_10044070 3300007788 Bacteria 1599
345 Ga0105240_10312044 3300009093 Bacteria 1795
346 Ga0105240_10376406 3300009093 Bacteria 1604
347 Ga0111539_10000009 3300009094 Bacteria 375223
348 Ga0111539_10001537 3300009094 Bacteria 30729
349 Ga0111539_10006768 3300009094 Bacteria 14750
350 Ga0111539_10008826 3300009094 Bacteria 12776
351 Ga0111539_10022355 3300009094 Bacteria 7772
352 Ga0111539_10080387 3300009094 Bacteria 3834
353 Ga0111539_10155020 3300009094 Bacteria 2680
354 Ga0111539_10204953 3300009094 Unclassified 2299
355 Ga0111539_10318443 3300009094 Bacteria 1810
356 Ga0111539_10390908 3300009094 Bacteria 1620
357 Ga0111539_10683220 3300009094 Unclassified 1195
358 Ga0111539_10813561 3300009094 Bacteria 1087
359 Ga0105245_10037421 3300009098 Unclassified 4314
360 Ga0105245_10419112 3300009098 Bacteria 1342
361 Ga0105245_10478930 3300009098 Bacteria 1258
362 Ga0105245_10588771 3300009098 Bacteria 1138
363 Ga0105247_10062558 3300009101 Unclassified 2309
364 Ga0114129_10001294 3300009147 Bacteria 33348
365 Ga0114129_10002457 3300009147 Bacteria 25726
366 Ga0114129_10006209 3300009147 Bacteria 16950
367 Ga0114129_10008621 3300009147 Bacteria 14537
368 Ga0114129_10013305 3300009147 Bacteria 11729
369 Ga0114129_10022844 3300009147 Bacteria 8869
370 Ga0114129_10027092 3300009147 Bacteria 8115
371 Ga0114129_10028182 3300009147 Bacteria 7957
372 Ga0114129_10055196 3300009147 Bacteria 5569
373 Ga0114129_10062679 3300009147 Bacteria 5193
374 Ga0114129_10096224 3300009147 Bacteria 4099
375 Ga0114129_10101489 3300009147 Bacteria 3981
376 Ga0114129_10116915 3300009147 Unclassified 3675
377 Ga0114129_10121320 3300009147 Bacteria 3597
378 Ga0114129_10129796 3300009147 Bacteria 3463
379 Ga0114129_10221239 3300009147 Bacteria 2554
380 Ga0114129_10240049 3300009147 Bacteria 2436
381 Ga0114129_10329959 3300009147 Bacteria 2026
382 Ga0114129_10412042 3300009147 Bacteria 1779
383 Ga0114129_10415252 3300009147 Bacteria 1771
384 Ga0114129_10629028 3300009147 Bacteria 1387
385 Ga0114129_10712688 3300009147 Bacteria 1288
386 Ga0114129_10863037 3300009147 Bacteria 1150
387 Ga0114129_11227867 3300009147 Bacteria 932
388 Ga0105243_10255676 3300009148 Bacteria 1566
389 Ga0105243_10781472 3300009148 Bacteria 939
390 Ga0105241_10038324 3300009174 Bacteria 3613
391 Ga0105241_10053004 3300009174 Bacteria 3100
392 Ga0105241_10628713 3300009174 Bacteria 973
393 Ga0105242_10016080 3300009176 Bacteria 5812
394 Ga0105242_10016312 3300009176 Bacteria 5776
395 Ga0105242_10018000 3300009176 Bacteria 5519
396 Ga0105242_10460910 3300009176 Bacteria 1200
397 Ga0105242_10585001 3300009176 Bacteria 1076
398 Ga0105242_10645287 3300009176 Bacteria 1029
399 Ga0105248_10031306 3300009177 Bacteria 5945
400 Ga0105248_10093562 3300009177 Unclassified 3385
401 Ga0105248_10139977 3300009177 Bacteria 2729
402 Ga0105248_10148033 3300009177 Bacteria 2649
403 Ga0105248_10243788 3300009177 Bacteria 2023
404 Ga0105248_10398371 3300009177 Unclassified 1550
405 Ga0105248_10412292 3300009177 Bacteria 1521
406 Ga0105248_10548766 3300009177 Bacteria 1304
407 Ga0105238_10736138 3300009551 Bacteria 999
408 Ga0105249_10003036 3300009553 Bacteria 14480
409 Ga0105249_10022901 3300009553 Bacteria 5600
410 Ga0105249_10049361 3300009553 Bacteria 3838
411 Ga0105249_10131718 3300009553 Bacteria 2388
412 Ga0105249_10222121 3300009553 Bacteria 1859
413 Ga0105249_10314628 3300009553 Bacteria 1575
414 Ga0105249_10321939 3300009553 Unclassified 1558
415 Ga0105249_10524618 3300009553 Bacteria 1232
416 Ga0157374_10030945 3300013296 Bacteria 4861
417 Ga0157374_10225484 3300013296 Archaea 1840
418 Ga0157374_10324324 3300013296 Bacteria 1527
419 Ga0157378_10058289 3300013297 Bacteria 3444
420 Ga0157378_10080042 3300013297 Bacteria 2951
421 Ga0157378_10411257 3300013297 Bacteria 1335
422 Ga0163162_10133984 3300013306 Bacteria 2588
423 Ga0163162_10152375 3300013306 Unclassified 2430
424 Ga0163162_10225525 3300013306 Bacteria 2004
425 Ga0157375_10084503 3300013308 Bacteria 3223
426 Ga0157375_10394347 3300013308 Unclassified 1551
427 Ga0157375_10404597 3300013308 Bacteria 1531
428 Ga0157375_10490619 3300013308 Bacteria 1393
429 Ga0157375_10551188 3300013308 Bacteria 1315
430 Ga0157375_10907241 3300013308 Bacteria 1025
431 Ga0163163_10004353 3300014325 Bacteria 12060
432 Ga0163163_10149794 3300014325 Bacteria 2377
433 Ga0157380_10008295 3300014326 Bacteria 7403
434 Ga0157380_10019709 3300014326 Bacteria 5030
435 Ga0157380_10071434 3300014326 Bacteria 2807
436 Ga0157380_10076260 3300014326 Bacteria 2728
437 Ga0157380_10241933 3300014326 Bacteria 1627
438 Ga0157379_10026173 3300014968 Bacteria 5191
439 Ga0157376_10048399 3300014969 Bacteria 3515
440 Ga0157376_10420505 3300014969 Bacteria 1297
441 Ga0157376_10521425 3300014969 Bacteria 1171
442 Ga0207697_10102455 3300025315 Bacteria 1221
443 Ga0207656_10077204 3300025321 Unclassified 1491
444 Ga0207682_10039732 3300025893 Bacteria 1914
445 Ga0207682_10136217 3300025893 Bacteria 1099
446 Ga0207642_10040535 3300025899 Bacteria 2032
447 Ga0207680_10126590 3300025903 Bacteria 1678
448 Ga0207699_10141209 3300025906 Bacteria 1583
449 Ga0207699_10175738 3300025906 Bacteria 1436
450 Ga0207645_10032234 3300025907 Bacteria 3368
451 Ga0207645_10049279 3300025907 Bacteria 2689
452 Ga0207645_10087849 3300025907 Unclassified 1998
453 Ga0207645_10155466 3300025907 Bacteria 1494
454 Ga0207645_10215451 3300025907 Bacteria 1265
455 Ga0207645_10289435 3300025907 Bacteria 1089
456 Ga0207643_10021437 3300025908 Bacteria 3550
457 Ga0207643_10059667 3300025908 Bacteria 2177
458 Ga0207684_10002898 3300025910 Bacteria 17004
459 Ga0207684_10018006 3300025910 Bacteria 6054
460 Ga0207684_10107159 3300025910 Bacteria 2391
461 Ga0207684_10192771 3300025910 Bacteria 1758
462 Ga0207684_10293250 3300025910 Bacteria 1402
463 Ga0207684_10646670 3300025910 Bacteria 901
464 Ga0207654_10041097 3300025911 Bacteria 2609
465 Ga0207695_10235075 3300025913 Bacteria 1735
466 Ga0207660_10117351 3300025917 Bacteria 2011
467 Ga0207660_10178651 3300025917 Bacteria 1647
468 Ga0207660_10351067 3300025917 Bacteria 1182
469 Ga0207662_10034224 3300025918 Bacteria 2965
470 Ga0207662_10080037 3300025918 Bacteria 1992
471 Ga0207662_10168725 3300025918 Bacteria 1402
472 Ga0207649_10017165 3300025920 Archaea 4100
473 Ga0207646_10004695 3300025922 Bacteria 14724
474 Ga0207646_10017592 3300025922 Bacteria 6680
475 Ga0207646_10090244 3300025922 Bacteria 2743
476 Ga0207646_10112625 3300025922 Unclassified 2442
477 Ga0207646_10126651 3300025922 Bacteria 2297
478 Ga0207646_10229372 3300025922 Bacteria 1678
479 Ga0207646_10306821 3300025922 Bacteria 1434
480 Ga0207646_10327475 3300025922 Bacteria 1384
481 Ga0207681_10005037 3300025923 Bacteria 8123
482 Ga0207681_10017604 3300025923 Bacteria 4489
483 Ga0207681_10104669 3300025923 Bacteria 2048
484 Ga0207681_10201533 3300025923 Bacteria 1528
485 Ga0207650_10036705 3300025925 Bacteria 3567
486 Ga0207650_10110255 3300025925 Bacteria 2129
487 Ga0207650_10218717 3300025925 Archaea 1532
488 Ga0207659_10000188 3300025926 Bacteria 36927
489 Ga0207659_10014321 3300025926 Bacteria 5110
490 Ga0207659_10018680 3300025926 Bacteria 4548
491 Ga0207659_10134331 3300025926 Bacteria 1914
492 Ga0207659_10269349 3300025926 Bacteria 1389
493 Ga0207659_10355032 3300025926 Bacteria 1217
494 Ga0207659_10464624 3300025926 Bacteria 1067
495 Ga0207687_10022568 3300025927 Bacteria 4190
496 Ga0207687_10367888 3300025927 Bacteria 1175
497 Ga0207700_10008063 3300025928 Bacteria 6496
498 Ga0207700_10034985 3300025928 Bacteria 3613
499 Ga0207644_10106522 3300025931 Archaea 2114
500 Ga0207690_10027586 3300025932 Bacteria 3590
501 Ga0207706_10045956 3300025933 Bacteria 3867
502 Ga0207706_10087817 3300025933 Bacteria 2734
503 Ga0207706_10100969 3300025933 Bacteria 2538
504 Ga0207706_10203135 3300025933 Bacteria 1738
505 Ga0207686_10006180 3300025934 Bacteria 6436
506 Ga0207686_10091048 3300025934 Bacteria 2014
507 Ga0207686_10376889 3300025934 Bacteria 1075
508 Ga0207709_10130829 3300025935 Bacteria 1710
509 Ga0207709_10313972 3300025935 Bacteria 1170
510 Ga0207670_10003997 3300025936 Bacteria 7874
511 Ga0207670_10009084 3300025936 Bacteria 5647
512 Ga0207670_10201744 3300025936 Bacteria 1511
513 Ga0207669_10006704 3300025937 Bacteria 5281
514 Ga0207669_10010515 3300025937 Bacteria 4458
515 Ga0207669_10013007 3300025937 Bacteria 4116
516 Ga0207669_10024631 3300025937 Bacteria 3238
517 Ga0207704_10135832 3300025938 Bacteria 1711
518 Ga0207704_10143235 3300025938 Bacteria 1675
519 Ga0207691_10006107 3300025940 Bacteria 11642
520 Ga0207691_10022906 3300025940 Bacteria 5886
521 Ga0207691_10063906 3300025940 Bacteria 3336
522 Ga0207691_10092316 3300025940 Bacteria 2711
523 Ga0207691_10113871 3300025940 Bacteria 2403
524 Ga0207711_10051889 3300025941 Bacteria 3514
525 Ga0207711_10188431 3300025941 Bacteria 1879
526 Ga0207711_10255968 3300025941 Bacteria 1608
527 Ga0207711_10576602 3300025941 Bacteria 1049
528 Ga0207689_10017760 3300025942 Bacteria 6011
529 Ga0207689_10079510 3300025942 Bacteria 2694
530 Ga0207689_10083757 3300025942 Bacteria 2622
531 Ga0207689_10115149 3300025942 Bacteria 2210
532 Ga0207661_10011215 3300025944 Bacteria 6484
533 Ga0207661_10156657 3300025944 Archaea 1973
534 Ga0207679_10002659 3300025945 Bacteria 11028
535 Ga0207679_10124202 3300025945 Bacteria 2060
536 Ga0207679_10126194 3300025945 Bacteria 2045
537 Ga0207679_10363460 3300025945 Unclassified 1264
538 Ga0207667_10278442 3300025949 Bacteria 1709
539 Ga0207651_10023379 3300025960 Bacteria 3800
540 Ga0207651_10025902 3300025960 Unclassified 3653
541 Ga0207651_10052833 3300025960 Bacteria 2773
542 Ga0207651_10111975 3300025960 Bacteria 2051
543 Ga0207651_10195355 3300025960 Bacteria 1617
544 Ga0207651_10204382 3300025960 Bacteria 1585
545 Ga0207651_10268256 3300025960 Bacteria 1405
546 Ga0207712_10018953 3300025961 Bacteria 4489
547 Ga0207712_10088448 3300025961 Bacteria 2274
548 Ga0207712_10155321 3300025961 Bacteria 1772
549 Ga0207712_10453719 3300025961 Bacteria 1088
550 Ga0207712_10474054 3300025961 Unclassified 1066
551 Ga0207668_10063637 3300025972 Bacteria 2603
552 Ga0207668_10150746 3300025972 Bacteria 1800
553 Ga0207668_10185652 3300025972 Bacteria 1644
554 Ga0207640_10030010 3300025981 Bacteria 3345
555 Ga0207640_10037127 3300025981 Bacteria 3063
556 Ga0207658_10181141 3300025986 Bacteria 1744
557 Ga0207658_10226951 3300025986 Archaea 1574
558 Ga0207658_10530718 3300025986 Bacteria 1051
559 Ga0207677_10017072 3300026023 Bacteria 4317
560 Ga0207677_10017810 3300026023 Bacteria 4247
561 Ga0207677_10249195 3300026023 Bacteria 1441
562 Ga0207703_10004262 3300026035 Bacteria 11766
563 Ga0207703_10138768 3300026035 Archaea 2108
564 Ga0207703_10230660 3300026035 Unclassified 1660
565 Ga0207703_10351998 3300026035 Unclassified 1356
566 Ga0207678_10015984 3300026067 Bacteria 6591
567 Ga0207708_10011404 3300026075 Bacteria 6621
568 Ga0207708_10016816 3300026075 Bacteria 5508
569 Ga0207708_10026800 3300026075 Bacteria 4363
570 Ga0207708_10033011 3300026075 Bacteria 3931
571 Ga0207708_10033034 3300026075 Bacteria 3930
572 Ga0207708_10050529 3300026075 Bacteria 3165
573 Ga0207708_10067724 3300026075 Bacteria 2732
574 Ga0207708_10091051 3300026075 Bacteria 2351
575 Ga0207708_10149787 3300026075 Bacteria 1836
576 Ga0207641_10207438 3300026088 Bacteria 1810
577 Ga0207641_10493090 3300026088 Bacteria 1189
578 Ga0207648_10001860 3300026089 Bacteria 23055
579 Ga0207648_10031489 3300026089 Bacteria 4690
580 Ga0207648_10050958 3300026089 Bacteria 3619
581 Ga0207648_10102995 3300026089 Bacteria 2503
582 Ga0207676_10024049 3300026095 Bacteria 4504
583 Ga0207676_10027327 3300026095 Bacteria 4249
584 Ga0207676_10042656 3300026095 Bacteria 3490
585 Ga0207676_10069868 3300026095 Bacteria 2814
586 Ga0207676_10223604 3300026095 Bacteria 1678
587 Ga0207674_10023655 3300026116 Bacteria 6577
588 Ga0207674_10044046 3300026116 Bacteria 4599
589 Ga0207674_10052540 3300026116 Bacteria 4156
590 Ga0207674_10122262 3300026116 Bacteria 2569
591 Ga0207674_10161279 3300026116 Archaea 2196
592 Ga0207675_100006022 3300026118 Bacteria 11541
593 Ga0207675_100022659 3300026118 Bacteria 5845
594 Ga0207675_100048529 3300026118 Bacteria 3963
595 Ga0207675_100050645 3300026118 Bacteria 3875
596 Ga0207675_100051051 3300026118 Unclassified 3859
597 Ga0207675_100061364 3300026118 Bacteria 3509
598 Ga0207675_100339845 3300026118 Bacteria 1469
599 Ga0207675_100427718 3300026118 Bacteria 1308
600 Ga0207683_10039938 3300026121 Bacteria 4093
601 Ga0207683_10053529 3300026121 Bacteria 3539
602 Ga0207683_10078856 3300026121 Bacteria 2919
603 Ga0207683_10461497 3300026121 Bacteria 1171
604 Ga0207698_10360865 3300026142 Bacteria 1376
605 Ga0209813_10007956 3300027866 Bacteria 2660
606 Ga0209974_10086695 3300027876 Bacteria 1082
607 Ga0207428_10000005 3300027907 Bacteria 520045
608 Ga0207428_10000963 3300027907 Bacteria 31936
609 Ga0207428_10001556 3300027907 Bacteria 23960
610 Ga0207428_10001740 3300027907 Bacteria 22291
611 Ga0207428_10019076 3300027907 Bacteria 5849
612 Ga0207428_10061765 3300027907 Unclassified 2965
613 Ga0207428_10217213 3300027907 Bacteria 1434
614 Ga0207428_10428309 3300027907 Unclassified 966
615 Ga0268265_10000183 3300028380 Bacteria 74487
616 Ga0268265_10038688 3300028380 Bacteria 3510
617 Ga0268265_10095582 3300028380 Bacteria 2386
618 Ga0268265_10223540 3300028380 Bacteria 1649
619 Ga0268265_10399988 3300028380 Bacteria 1269
620 Ga0268265_10712833 3300028380 Bacteria 970
621 Ga0268264_10006097 3300028381 Bacteria 10186
622 Ga0268264_10309429 3300028381 Bacteria 1490
623 Ga0265323_10004413 3300028653 Bacteria 6067
624 Ga0265338_10021154 3300028800 Bacteria 6798
625 Ga0265324_10012498 3300029957 Bacteria 3198
626 Ga0316579_10027907 3300031691 Bacteria 2567
627 Ga0316579_10037408 3300031691 Unclassified 2242
628 Ga0265314_10037448 3300031711 Bacteria 3515
629 Ga0316576_10002816 3300031727 Bacteria 10008
630 Ga0316576_10276245 3300031727 Bacteria 1259
631 Ga0316576_10358649 3300031727 Bacteria 1084
632 Ga0307410_10304204 3300031852 Bacteria 1259
633 Ga0307406_10133876 3300031901 Bacteria 1744
634 Ga0307407_10215608 3300031903 Bacteria 1295
635 Ga0307412_10497176 3300031911 Bacteria 1014
636 Ga0307409_100056429 3300031995 Bacteria 3037
637 Ga0307409_100142266 3300031995 Bacteria 2069
638 Ga0307409_100149029 3300031995 Bacteria 2028
639 Ga0307416_100025487 3300032002 Bacteria 4335
640 Ga0307416_100102786 3300032002 Bacteria 2493
641 Ga0307411_10110595 3300032005 Bacteria 1965
642 Ga0307411_10325373 3300032005 Bacteria 1243
643 Ga0307415_100222295 3300032126 Bacteria 1515
644 Ga0373930_0011111 3300034816 Bacteria 1621
645 Ga0373958_0012953 3300034819 Bacteria 1435
646 Ga0373958_0021785 3300034819 Bacteria 1192
647 Ga0373929_0001104 3300035085 Bacteria 5244
648 Ga0373940_0000039 3300035088 Bacteria 14131
649 Ga0373940_0069588 3300035088 Bacteria 1022
650 Ga0373949_0001162 3300035090 Bacteria 7856
651 Ga0373951_0002100 3300035091 Bacteria 5107
652 Ga0373932_0002751 3300035112 Bacteria 4374
653 Ga0373932_0061243 3300035112 Bacteria 1144
654 Ga0373936_0118575 3300035113 Bacteria 1129
655 Ga0373939_0000940 3300035114 Bacteria 7249
656 Ga0373941_0001349 3300035115 Bacteria 5162
657 Ga0373945_0037248 3300035116 Bacteria 1745
658 Ga0373954_0088662 3300035118 Bacteria 1484
659 Ga0373956_0084511 3300035119 Bacteria 1459
660 Ga0373960_0001226 3300035121 Bacteria 5615
661 Ga0373943_0003982 3300035170 Bacteria 6721
662 Ga0373943_0186533 3300035170 Bacteria 1142
663 Ga0373943_0220576 3300035170 Unclassified 1056
664 Ga0373946_0008520 3300035171 Bacteria 3764
665 Ga0373946_0251858 3300035171 Bacteria 862
666 Ga0373955_0074212 3300035172 Bacteria 1908
667 Ga0373955_0075377 3300035172 Bacteria 1896
668 Ga0373942_0000750 3300035207 Bacteria 8943
669 Ga0373961_0002991 3300035241 Bacteria 4263
670 Ga0373961_0064211 3300035241 Bacteria 1122
671 Ga0373962_0000766 3300035242 Bacteria 7324
672 Ga0316574_0049704 3300035398 Bacteria 2608
673 Ga0316574_0165455 3300035398 Bacteria 1424
674 Ga0316574_0267273 3300035398 Bacteria 1091
675 Ga0373924_0010419 3300035410 Bacteria 3425
676 Ga0373924_0121792 3300035410 Bacteria 1132
677 Ga0373931_0001453 3300035691 Bacteria 10179
678 Ga0373931_0065359 3300035691 Bacteria 1971
679 Ga0373935_0026673 3300035692 Bacteria 3569
680 Ga0373935_0261811 3300035692 Bacteria 1213
681 Ga0373927_0031710 3300035695 Bacteria 3444
682 Ga0373933_0024873 3300035724 Bacteria 3431
683 Ga0373933_0132775 3300035724 Bacteria 1566
684 Ga0373937_0003122 3300036401 Bacteria 13861
685 Ga0373937_0031300 3300036401 Bacteria 4820
686 Ga0373937_0279887 3300036401 Bacteria 1575
687 Ga0373937_0300272 3300036401 Bacteria 1518
688 Ga0373937_0361320 3300036401 Bacteria 1376
689 Ga0316582_0033596 3300036647 Bacteria 3152
690 Ga0316582_0094238 3300036647 Bacteria 1975
691 Ga0373925_0005452 3300037068 Bacteria 9475
692 Ga0373925_0196828 3300037068 Bacteria 1601
693 Ga0373925_0455971 3300037068 Bacteria 1047
694 Ga0436365_0993952 3300039437 Bacteria 1004
695 Ga0439461_0008604 3300041410 Bacteria 1833
696 Ga0439433_0007182 3300041999 Bacteria 2404
697 Ga0439441_048546 3300042001 Bacteria 869
698 Ga0439445_0041035 3300042004 Bacteria 1229
699 Ga0439457_107273 3300042014 Bacteria 654
700 Ga0450920_041037 3300042122 Bacteria 923
701 Ga0450923_003766 3300042125 Bacteria 2323
702 Ga0450896_027603 3300042133 Bacteria 850
703 Ga0439446_0006628 3300042156 Bacteria 3028
704 Ga0439446_0009351 3300042156 Bacteria 2624
705 Ga0439434_0020742 3300042435 Bacteria 1974
706 Ga0439434_0024883 3300042435 Bacteria 1807
707 Ga0439435_0005134 3300042436 Bacteria 2865
708 Ga0451577_0001014 3300042876 Bacteria 40843
709 Ga0451577_0028596 3300042876 Bacteria 5039
710 Ga0451577_0092147 3300042876 Bacteria 2706
711 Ga0439440_0100124 3300042993 Bacteria 788
712 Ga0453684_0000004 3300044712 Bacteria 1469893
713 Ga0453684_0066994 3300044712 Bacteria 4569
714 Ga0453684_0168852 3300044712 Bacteria 2580
715 Ga0453684_0547163 3300044712 Bacteria 1276
716 Ga0451576_0002751 3300045051 Bacteria 25497
717 Ga0451576_0004039 3300045051 Bacteria 19473
718 Ga0451576_0011011 3300045051 Bacteria 10327
719 Ga0451576_0035312 3300045051 Bacteria 5305
720 Ga0451576_0093800 3300045051 Bacteria 3121
721 Ga0451576_0289303 3300045051 Bacteria 1713
722 Ga0451576_0388698 3300045051 Bacteria 1462
723 Ga0495592_0147312 3300046454 Bacteria 1631
724 Ga0495603_0006665 3300046455 Bacteria 6930
725 Ga0495629_0001864 3300046459 Bacteria 16488
726 Ga0495638_0020091 3300046460 Bacteria 4414
727 Ga0495651_0124323 3300046462 Bacteria 1891
728 Ga0495651_0188806 3300046462 Bacteria 1452
729 Ga0495580_0154759 3300046472 Bacteria 1588
730 Ga0495639_0095330 3300046475 Bacteria 1400
731 Ga0495639_0232697 3300046475 Bacteria 908
732 Ga0495664_0129466 3300046477 Bacteria 1528
733 Ga0495664_0206431 3300046477 Bacteria 1190
734 Ga0495584_0029632 3300046491 Bacteria 2775
735 Ga0495584_0164844 3300046491 Unclassified 1126
736 Ga0495594_0050120 3300046499 Bacteria 2296
737 Ga0495608_0001856 3300046511 Bacteria 15079
738 Ga0495628_0053229 3300046516 Bacteria 3195
739 Ga0495630_0003013 3300046517 Bacteria 11686
740 Ga0495644_0039341 3300046523 Bacteria 1783
741 Ga0495663_0090808 3300046525 Unclassified 995
742 Ga0495642_0004422 3300046528 Bacteria 5456
743 Ga0495642_0098933 3300046528 Bacteria 1240
744 Ga0495652_0354473 3300046529 Bacteria 1050
745 Ga0495586_0265383 3300046535 Bacteria 981
746 Ga0495587_0085683 3300046536 Bacteria 1824
747 Ga0495598_0003522 3300046537 Bacteria 3337
748 Ga0495598_0012767 3300046537 Bacteria 2070
749 Ga0495609_0049776 3300046538 Bacteria 1869
750 Ga0495609_0196663 3300046538 Bacteria 844
751 Ga0495621_0067618 3300046539 Bacteria 1310
752 Ga0495621_0136917 3300046539 Bacteria 956
753 Ga0495621_0162226 3300046539 Bacteria 884
754 Ga0495645_0003630 3300046543 Bacteria 10481
755 Ga0495645_0011692 3300046543 Bacteria 6179
756 Ga0495645_0206925 3300046543 Bacteria 1327
757 Ga0495633_0018672 3300046558 Bacteria 3519
758 Ga0495667_0023699 3300046559 Bacteria 4134
759 Ga0495656_0017840 3300046615 Bacteria 2715
760 Ga0495656_0058075 3300046615 Bacteria 1678
761 Ga0495635_0062022 3300046663 Bacteria 2567
762 Ga0495635_0150703 3300046663 Bacteria 1583
763 Ga0495659_0010701 3300046664 Bacteria 2950
764 Ga0495659_0013333 3300046664 Bacteria 2677
765 Ga0495659_0042079 3300046664 Bacteria 1634
766 Ga0495659_0049722 3300046664 Bacteria 1523
767 Ga0495659_0104522 3300046664 Bacteria 1100
768 Ga0495588_0024900 3300046674 Bacteria 2977
769 Ga0495599_0039434 3300046678 Bacteria 2968
770 Ga0495599_0100107 3300046678 Bacteria 1807
771 Ga0495658_0015799 3300046683 Bacteria 3878
772 Ga0495658_0150951 3300046683 Bacteria 1427
773 Ga0495658_0151640 3300046683 Bacteria 1424
774 Ga0495669_0013753 3300046684 Bacteria 3454
775 Ga0495669_0019300 3300046684 Bacteria 2941
776 Ga0495669_0037536 3300046684 Bacteria 2144
777 Ga0495669_0096286 3300046684 Unclassified 1371
778 Ga0495613_0000599 3300046689 Bacteria 29031
779 Ga0495613_0161684 3300046689 Bacteria 1593
780 Ga0495613_0267061 3300046689 Bacteria 1191
781 Ga0495600_0003980 3300046809 Bacteria 8780
782 Ga0495600_0063933 3300046809 Bacteria 2405
783 Ga0495604_0014504 3300047317 Bacteria 6284
784 Ga0495636_0100582 3300047318 Bacteria 1264
785 Ga0495674_0050049 3300047319 Bacteria 3688
786 Ga0495674_0074426 3300047319 Bacteria 2925
787 Ga0495672_0001565 3300047320 Bacteria 22401
788 Ga0495677_0026679 3300047445 Bacteria 2095
789 Ga0495685_018711 3300047447 Unclassified 2378
790 Ga0495684_0000310 3300047471 Bacteria 39859
791 Ga0495684_0112833 3300047471 Bacteria 2050
792 Ga0495684_0146073 3300047471 Bacteria 1771
793 Ga0495684_0352374 3300047471 Bacteria 1045
794 Ga0496100_0214982 3300048903 Archaea 1408
795 Ga0496101_0001671 3300048904 Bacteria 13309
796 Ga0496102_0032144 3300048905 Bacteria 4714
797 Ga0496104_0003276 3300048907 Bacteria 13967
798 Ga0496104_0088057 3300048907 Unclassified 2966
799 Ga0496104_0179311 3300048907 Unclassified 2029
800 Ga0496105_0045285 3300048908 Bacteria 3630
801 Ga0496105_0124553 3300048908 Unclassified 2125
802 Ga0496105_0156700 3300048908 Bacteria 1870
803 Ga0496106_0037860 3300048909 Bacteria 3609
804 Ga0496106_0157814 3300048909 Bacteria 1793
805 Ga0496107_0258932 3300048910 Bacteria 1295
806 Ga0496108_0004502 3300048911 Bacteria 11225
807 Ga0496109_0001333 3300048912 Bacteria 20382
808 Ga0496109_0304142 3300048912 Bacteria 1504
809 Ga0496110_0001226 3300048913 Bacteria 18281
810 Ga0496112_0033138 3300048915 Bacteria 5019
811 Ga0496112_0414005 3300048915 Bacteria 1287
812 Ga0496113_0133691 3300048916 Archaea 1948
813 Ga0496114_0001180 3300048917 Bacteria 19796
814 Ga0496114_0233106 3300048917 Bacteria 1618
815 Ga0496115_0228113 3300048918 Unclassified 1536
816 Ga0501298_006448 3300049521 Bacteria 1919
817 Ga0501031_0128708 3300049568 Bacteria 1654
818 Ga0501031_0335599 3300049568 Bacteria 979
819 Ga0501032_0395640 3300049569 Bacteria 888
820 Ga0501033_0060564 3300049570 Bacteria 2792
821 Ga0501034_0004031 3300049571 Bacteria 16482
822 Ga0501036_0013404 3300049572 Bacteria 6812
823 Ga0501036_0063161 3300049572 Bacteria 3136
824 Ga0501036_0075501 3300049572 Bacteria 2850
825 Ga0501036_0096531 3300049572 Bacteria 2499
826 Ga0501036_0205940 3300049572 Bacteria 1654
827 Ga0501037_0075725 3300049573 Bacteria 2444
828 Ga0501038_0043999 3300049574 Bacteria 3881
829 Ga0501038_0063821 3300049574 Bacteria 3143
830 Ga0501038_0160861 3300049574 Bacteria 1825
831 Ga0501039_0111878 3300049575 Bacteria 2135
832 Ga0501039_0158973 3300049575 Bacteria 1776
833 Ga0501039_0170020 3300049575 Bacteria 1714
834 Ga0501040_0004377 3300049576 Bacteria 9182
835 Ga0501040_0006548 3300049576 Bacteria 7562
836 Ga0501040_0033622 3300049576 Bacteria 3475
837 Ga0501040_0111652 3300049576 Bacteria 1912
838 Ga0501040_0130769 3300049576 Bacteria 1765
839 Ga0501041_0047271 3300049577 Bacteria 2619
840 Ga0501041_0162432 3300049577 Bacteria 1397
841 Ga0501041_0196082 3300049577 Bacteria 1265
842 Ga0501041_0218489 3300049577 Bacteria 1196
843 Ga0501042_0022598 3300049578 Bacteria 4395
844 Ga0501042_0315804 3300049578 Bacteria 1129
845 Ga0501042_0469976 3300049578 Bacteria 912
846 Ga0501042_0481416 3300049578 Bacteria 901
847 Ga0501043_0112868 3300049579 Bacteria 2134
848 Ga0501048_0021740 3300049582 Bacteria 4695
849 Ga0501048_0025224 3300049582 Bacteria 4333
850 Ga0501048_0031371 3300049582 Bacteria 3844
851 Ga0501048_0071723 3300049582 Bacteria 2445
852 Ga0501048_0212123 3300049582 Bacteria 1373
853 Ga0501048_0401835 3300049582 Bacteria 979
854 Ga0501067_0285894 3300049583 Bacteria 918
855 Ga0501068_0149337 3300049584 Bacteria 1468
856 Ga0501071_0022159 3300049587 Bacteria 4427
857 Ga0501071_0026347 3300049587 Bacteria 4080
858 Ga0501071_0037102 3300049587 Bacteria 3479
859 Ga0501071_0037251 3300049587 Bacteria 3472
860 Ga0501071_0192236 3300049587 Bacteria 1531
861 Ga0501071_0361244 3300049587 Bacteria 1106
862 Ga0501071_0521535 3300049587 Bacteria 912
863 Ga0501071_0632167 3300049587 Bacteria 823
864 Ga0501072_0007310 3300049588 Bacteria 8376
865 Ga0501072_0022930 3300049588 Bacteria 4846
866 Ga0501072_0025475 3300049588 Bacteria 4608
867 Ga0501072_0264862 3300049588 Bacteria 1368
868 Ga0501072_0270104 3300049588 Bacteria 1353
869 Ga0501073_0004289 3300049589 Bacteria 10697
870 Ga0501073_0045987 3300049589 Bacteria 3072
871 Ga0501074_0061265 3300049590 Bacteria 2711
872 Ga0501074_0061528 3300049590 Bacteria 2705
873 Ga0501074_0149674 3300049590 Bacteria 1669
874 Ga0501074_0178990 3300049590 Bacteria 1513
875 Ga0501075_0010372 3300049591 Bacteria 6546
876 Ga0501075_0014416 3300049591 Bacteria 5663
877 Ga0501075_0015936 3300049591 Bacteria 5405
878 Ga0501075_0026624 3300049591 Bacteria 4259
879 Ga0501075_0027486 3300049591 Bacteria 4193
880 Ga0501075_0339000 3300049591 Bacteria 1146
881 Ga0501075_0430463 3300049591 Bacteria 1006
882 Ga0501076_0008303 3300049592 Bacteria 7609
883 Ga0501076_0014435 3300049592 Bacteria 5950
884 Ga0501076_0018379 3300049592 Bacteria 5329
885 Ga0501076_0024644 3300049592 Bacteria 4653
886 Ga0501076_0033580 3300049592 Bacteria 4006
887 Ga0501076_0112103 3300049592 Bacteria 2206
888 Ga0501076_0277677 3300049592 Bacteria 1372
889 Ga0501076_0558450 3300049592 Bacteria 944
890 Ga0501077_0114031 3300049593 Bacteria 1714
891 Ga0501077_0120443 3300049593 Bacteria 1663
892 Ga0501077_0304536 3300049593 Bacteria 1015
893 Ga0501077_0484655 3300049593 Bacteria 793
894 Ga0501079_0039777 3300049741 Bacteria 3627
895 Ga0501079_0041256 3300049741 Bacteria 3562
896 Ga0501079_0080999 3300049741 Bacteria 2510
897 Ga0501079_0117863 3300049741 Bacteria 2064
898 Ga0501079_0309187 3300049741 Bacteria 1237
899 Ga0501079_0401812 3300049741 Bacteria 1074
900 Ga0501080_0047614 3300049742 Bacteria 3992
901 Ga0501080_0568157 3300049742 Bacteria 1009
902 Ga0501080_0753648 3300049742 Bacteria 856
903 Ga0501081_0008536 3300049743 Bacteria 6659
904 Ga0501081_0009062 3300049743 Bacteria 6469
905 Ga0501081_0038621 3300049743 Bacteria 3263
906 Ga0501081_0059835 3300049743 Bacteria 2638
907 Ga0501081_0062692 3300049743 Bacteria 2579
908 Ga0501081_0223625 3300049743 Bacteria 1369
909 Ga0501081_0415026 3300049743 Bacteria 997
910 Ga0501081_0554685 3300049743 Bacteria 858
911 Ga0501045_0011826 3300049824 Bacteria 6131
912 Ga0501045_0018556 3300049824 Bacteria 4949
913 Ga0501045_0065071 3300049824 Bacteria 2677
914 Ga0501045_0164990 3300049824 Bacteria 1650
915 Ga0501045_0430481 3300049824 Bacteria 981
916 Ga0501045_0477941 3300049824 Bacteria 926
917 nmdc:mga03683_3241_c1 3300050489 Bacteria 5213
918 nmdc:mga03683_66316_c1 3300050489 Bacteria 1535
919 nmdc:mga03n38_220435_c1 3300050490 Bacteria 990
920 nmdc:mga00v17_16883_c1 3300050491 Bacteria 4121
921 nmdc:mga00v17_171208_c1 3300050491 Bacteria 1400
922 nmdc:mga00v17_34078_c1 3300050491 Bacteria 3022
923 nmdc:mga0yw44_2299_c1 3300050492 Bacteria 8079
924 nmdc:mga0yw44_497700_c1 3300050492 Bacteria 827
925 nmdc:mga0k408_28290_c2 3300050493 Bacteria 2777
926 nmdc:mga0k408_4177_c1 3300050493 Bacteria 7666
927 nmdc:mga06z11_17737_c1 3300050494 Bacteria 3238
928 nmdc:mga06z11_3555_c1 3300050494 Bacteria 6037
929 nmdc:mga06z11_50315_c1 3300050494 Bacteria 2129
930 nmdc:mga06z11_5154_c1 3300050494 Bacteria 5214
931 nmdc:mga06z11_9088_c1 3300050494 Bacteria 4174
932 nmdc:mga04h51_126451_c1 3300050495 Bacteria 957
933 nmdc:mga04h51_9279_c1 3300050495 Bacteria 2660
934 nmdc:mga05p37_100630_c1 3300050507 Unclassified 3560
935 nmdc:mga05p37_130274_c1 3300050507 Bacteria 3086
936 nmdc:mga05p37_134259_c1 3300050507 Bacteria 3036
937 nmdc:mga05p37_135291_c1 3300050507 Bacteria 3023
938 nmdc:mga05p37_145751_c1 3300050507 Bacteria 2900
939 nmdc:mga05p37_165753_c1 3300050507 Bacteria 2697
940 nmdc:mga05p37_1682_c1 3300050507 Bacteria 25731
941 nmdc:mga05p37_188854_c1 3300050507 Bacteria 2503
942 nmdc:mga05p37_200646_c1 3300050507 Bacteria 2416
943 nmdc:mga05p37_228487_c1 3300050507 Bacteria 2243
944 nmdc:mga05p37_22858_c1 3300050507 Bacteria 7583
945 nmdc:mga05p37_240985_c1 3300050507 Bacteria 2174
946 nmdc:mga05p37_28735_c1 3300050507 Bacteria 6784
947 nmdc:mga05p37_367296_c1 3300050507 Bacteria 1690
948 nmdc:mga05p37_40463_c1 3300050507 Bacteria 5725
949 nmdc:mga05p37_423797_c1 3300050507 Bacteria 1548
950 nmdc:mga05p37_478081_c1 3300050507 Bacteria 1436
951 nmdc:mga05p37_566944_c1 3300050507 Bacteria 1289
952 nmdc:mga05p37_567032_c1 3300050507 Bacteria 1289
953 nmdc:mga05p37_644_c1 3300050507 Bacteria 38645
954 nmdc:mga05p37_69333_c1 3300050507 Bacteria 4337
955 nmdc:mga05p37_78073_c1 3300050507 Bacteria 4076
956 nmdc:mga05p37_81281_c1 3300050507 Bacteria 3992
957 nmdc:mga05p37_855548_c1 3300050507 Bacteria 987
958 nmdc:mga05p37_86311_c1 3300050507 Bacteria 3868
959 nmdc:mga09592_113139_c1 3300050508 Bacteria 2329
960 nmdc:mga09592_304352_c1 3300050508 Bacteria 1382
961 nmdc:mga09592_314878_c1 3300050508 Bacteria 1356
962 nmdc:mga09592_40921_c1 3300050508 Bacteria 3895
963 nmdc:mga09592_423364_c1 3300050508 Bacteria 1150
964 nmdc:mga09592_4298_c1 3300050508 Bacteria 11503
965 nmdc:mga09592_547400_c1 3300050508 Bacteria 994
966 nmdc:mga09592_7328_c1 3300050508 Bacteria 8967
967 nmdc:mga09592_99751_c1 3300050508 Bacteria 2486
968 nmdc:mga0qj67_144750_c1 3300050509 Bacteria 1927
969 nmdc:mga0qj67_165467_c1 3300050509 Unclassified 1795
970 nmdc:mga0qj67_3318_c1 3300050509 Bacteria 11603
971 nmdc:mga06r32_107564_c1 3300050510 Bacteria 2741
972 nmdc:mga06r32_15924_c1 3300050510 Bacteria 6842
973 nmdc:mga06r32_49931_c1 3300050510 Bacteria 4002
974 nmdc:mga06r32_603924_c1 3300050510 Bacteria 1068
975 nmdc:mga06r32_63212_c1 3300050510 Bacteria 3567
976 nmdc:mga06r32_8083_c1 3300050510 Bacteria 9465
977 nmdc:mga06r32_95924_c1 3300050510 Bacteria 2903
978 nmdc:mga08y16_10460_c1 3300050511 Bacteria 9735
979 nmdc:mga08y16_104809_c1 3300050511 Bacteria 2944
980 nmdc:mga08y16_10929_c1 3300050511 Bacteria 9533
981 nmdc:mga08y16_155249_c1 3300050511 Bacteria 2378
982 nmdc:mga08y16_198729_c1 3300050511 Bacteria 2078
983 nmdc:mga08y16_243215_c1 3300050511 Unclassified 1860
984 nmdc:mga08y16_244777_c1 3300050511 Bacteria 1853
985 nmdc:mga08y16_373840_c1 3300050511 Bacteria 1462
986 nmdc:mga08y16_39988_c1 3300050511 Bacteria 4918
987 nmdc:mga08y16_48405_c1 3300050511 Bacteria 4449
988 nmdc:mga08y16_6292_c1 3300050511 Bacteria 12450
989 nmdc:mga08y16_86790_c1 3300050511 Bacteria 3261
990 nmdc:mga08y16_932_c1 3300050511 Bacteria 28369
991 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
992 nmdc:mga0n895_102951_c1 3300050512 Bacteria 2866
993 nmdc:mga0n895_112926_c1 3300050512 Bacteria 2734
994 nmdc:mga0n895_138646_c1 3300050512 Bacteria 2460
995 nmdc:mga0n895_139651_c1 3300050512 Bacteria 2450
996 nmdc:mga0n895_151826_c1 3300050512 Bacteria 2347
997 nmdc:mga0n895_168218_c1 3300050512 Bacteria 2224
998 nmdc:mga0n895_182632_c1 3300050512 Bacteria 2129
999 nmdc:mga0n895_20798_c1 3300050512 Bacteria 6128
1000 nmdc:mga0n895_4406_c1 3300050512 Bacteria 11564
1001 nmdc:mga0n895_52553_c1 3300050512 Bacteria 4000
1002 nmdc:mga0n895_691527_c1 3300050512 Bacteria 1016
1003 nmdc:mga0n895_700432_c1 3300050512 Bacteria 1009
1004 nmdc:mga0n895_81_c1 3300050512 Bacteria 54736
1005 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1006 nmdc:mga0rr50_28641_c1 3300050513 Bacteria 3918
1007 nmdc:mga0rr50_4248_c1 3300050513 Bacteria 8383
1008 nmdc:mga0rr50_557328_c1 3300050513 Unclassified 976
1009 nmdc:mga0rr50_83187_c1 3300050513 Bacteria 2474
1010 nmdc:mga0rr50_8895_c1 3300050513 Bacteria 6273
1011 nmdc:mga08x19_181099_c1 3300050514 Bacteria 1439
1012 nmdc:mga08x19_265_c1 3300050514 Bacteria 39740
1013 nmdc:mga08x19_310417_c1 3300050514 Bacteria 1096
1014 nmdc:mga08x19_59349_c1 3300050514 Bacteria 2476
1015 nmdc:mga08x19_96849_c1 3300050514 Bacteria 1953
1016 nmdc:mga0a205_115510_c1 3300050515 Bacteria 2583
1017 nmdc:mga0a205_116830_c1 3300050515 Bacteria 2566
1018 nmdc:mga0a205_179962_c1 3300050515 Bacteria 2009
1019 nmdc:mga0a205_3136_c1 3300050515 Bacteria 14660
1020 nmdc:mga0a205_326970_c1 3300050515 Bacteria 1403
1021 nmdc:mga0a205_391940_c1 3300050515 Bacteria 1253
1022 nmdc:mga0a205_456663_c1 3300050515 Bacteria 1137
1023 nmdc:mga0a205_45943_c1 3300050515 Bacteria 4211
1024 nmdc:mga0a205_46215_c1 3300050515 Bacteria 4199
1025 nmdc:mga0a205_47513_c2 3300050515 Bacteria 1872
1026 nmdc:mga0a205_49528_c1 3300050515 Bacteria 4055
1027 nmdc:mga0a205_61542_c1 3300050515 Bacteria 2785
1028 nmdc:mga0sz30_68326_c1 3300050516 Bacteria 1526
1029 Ga0495601_0058386 3300053077 Bacteria 2445
1030 Ga0495595_0043128 3300053084 Bacteria 2068
1031 Ga0495619_0008204 3300053085 Bacteria 6604
1032 Ga0495619_0071124 3300053085 Bacteria 2328
1033 Ga0500646_0081212 3300053090 Bacteria 989
1034 Ga0500555_006197 3300053103 Bacteria 3395
1035 Ga0501084_0008116 3300054114 Bacteria 8651
1036 Ga0501084_0130496 3300054114 Bacteria 2116
1037 Ga0501084_0161438 3300054114 Bacteria 1891
1038 Ga0501084_0216963 3300054114 Bacteria 1614
1039 Ga0501084_0383980 3300054114 Bacteria 1187
1040 Ga0501082_0015946 3300060353 Bacteria 6463
1041 Ga0501082_0024231 3300060353 Bacteria 5233
1042 Ga0501082_0030564 3300060353 Bacteria 4642
1043 Ga0501082_0089298 3300060353 Bacteria 2661
1044 Ga0501082_0291148 3300060353 Bacteria 1422
1045 Ga0501082_0317908 3300060353 Bacteria 1356
1046 Ga0501082_0538040 3300060353 Bacteria 1022
1047 Ga0530510_0006006 3300061734 Bacteria 8426
1048 Ga0530510_0011471 3300061734 Bacteria 6215
1049 Ga0530510_0092624 3300061734 Bacteria 2206
1050 Ga0530510_0157749 3300061734 Bacteria 1678
1051 Ga0495601_0025172
1052 JGI25405J52794_10003721
1053 Ga0065704_10170200
1054 Ga0065712_10005714
1055 Ga0065712_10088511
1056 Ga0065712_10105799
1057 Ga0065715_10007369
1058 Ga0065715_10051194
1059 Ga0065715_10096409
1060 Ga0065707_10002251
1061 Ga0065707_10005235
1062 Ga0065707_10085509
1063 Ga0065707_10165513
1064 Ga0070676_10006806
1065 Ga0070676_10321649
1066 Ga0070683_100006082
1067 Ga0070683_100121001
1068 Ga0070683_100165983
1069 Ga0070690_100029154
1070 Ga0070690_100109929
1071 Ga0070670_100003674
1072 Ga0070670_100056795
1073 Ga0070670_100178229
1074 Ga0070677_10031350
1075 Ga0068869_100164778
1076 Ga0068869_100186928
1077 Ga0068869_100280438
1078 Ga0068869_100375534
1079 Ga0070666_10022440
1080 Ga0070666_10039046
1081 Ga0070666_10087282
1082 Ga0068868_100025873
1083 Ga0068868_100028023
1084 Ga0068868_100079273
1085 Ga0068868_100241239
1086 Ga0070689_100005737
1087 Ga0070689_100008806
1088 Ga0070689_100009227
1089 Ga0070689_100011887
1090 Ga0070691_10044437
1091 Ga0070687_100062482
1092 Ga0070687_100161004
1093 Ga0070661_100016292
1094 Ga0070661_100499300
1095 Ga0070692_10027343
1096 Ga0070668_100295055
1097 Ga0070668_100312884
1098 Ga0070669_100002795
1099 Ga0070669_100009439
1100 Ga0070669_100131441
1101 Ga0070669_100216352
1102 Ga0070675_100001411
1103 Ga0070675_100014315
1104 Ga0070675_100038263
1105 Ga0070675_100144890
1106 Ga0070675_100166641
1107 Ga0070675_100204877
1108 Ga0070675_100339176
1109 Ga0070671_100061284
1110 Ga0070671_100150212
1111 Ga0070671_100280269
1112 Ga0070674_100014917
1113 Ga0070674_100020861
1114 Ga0070674_100026357
1115 Ga0070674_100035571
1116 Ga0070674_100138361
1117 Ga0070674_100139424
1118 Ga0070673_100006996
1119 Ga0070673_100011588
1120 Ga0070673_100012813
1121 Ga0070673_100069369
1122 Ga0070673_100090119
1123 Ga0070673_100389527
1124 Ga0070688_100068697
1125 Ga0070659_100074165
1126 Ga0070667_100042719
1127 Ga0070667_100138545
1128 Ga0070667_100167371
1129 Ga0070667_100466462
1130 Ga0070709_10093260
1131 Ga0070709_10156519
1132 Ga0070713_100010981
1133 Ga0070701_10007454
1134 Ga0070701_10038327
1135 Ga0070701_10310978
1136 Ga0070705_100000016
1137 Ga0070705_100007054
1138 Ga0070705_100012183
1139 Ga0070705_100022448
1140 Ga0070705_100162140
1141 Ga0070705_100240775
1142 Ga0070705_100284793
1143 Ga0070700_100014023
1144 Ga0070700_100020027
1145 Ga0070700_100025789
1146 Ga0070700_100143020
1147 Ga0070700_100282727
1148 Ga0070700_100501744
1149 Ga0070694_100000279
1150 Ga0070694_100051631
1151 Ga0070694_100054815
1152 Ga0070694_100080930
1153 Ga0070694_100112572
1154 Ga0070708_100255719
1155 Ga0070708_100267398
1156 Ga0070708_100317841
1157 Ga0070708_100467772
1158 Ga0070678_100022491
1159 Ga0070678_100252298
1160 Ga0070662_100040364
1161 Ga0070662_100152569
1162 Ga0070681_10138723
1163 Ga0068867_100002379
1164 Ga0068867_100024363
1165 Ga0068867_100050212
1166 Ga0068867_100080672
1167 Ga0068867_100860136
1168 Ga0070685_10010288
1169 Ga0070706_100005121
1170 Ga0070706_100095894
1171 Ga0070706_100342967
1172 Ga0070706_100364722
1173 Ga0070706_100700205
1174 Ga0070707_100048133
1175 Ga0070707_100075269
1176 Ga0070707_100087606
1177 Ga0070707_100158438
1178 Ga0070707_100184718
1179 Ga0070707_100199012
1180 Ga0070707_100300530
1181 Ga0070707_100388790
1182 Ga0070698_100004889
1183 Ga0070698_100015072
1184 Ga0070698_100024325
1185 Ga0070698_100028123
1186 Ga0070698_100083790
1187 Ga0070698_100247228
1188 Ga0070698_100385143
1189 Ga0070698_100671570
1190 Ga0070699_100000388
1191 Ga0070699_100001370
1192 Ga0070699_100001651
1193 Ga0070699_100014128
1194 Ga0070699_100025124
1195 Ga0070699_100027914
1196 Ga0070699_100061496
1197 Ga0070699_100081764
1198 Ga0070699_100108356
1199 Ga0070699_100195297
1200 Ga0070699_100379626
1201 Ga0070679_100028536
1202 Ga0070684_100001607
1203 Ga0070684_100005752
1204 Ga0070684_100163975
1205 Ga0070697_100006069
1206 Ga0070697_100028711
1207 Ga0070697_100104650
1208 Ga0070697_100213299
1209 Ga0068853_100295519
1210 Ga0070672_100005758
1211 Ga0070672_100059416
1212 Ga0070672_100084165
1213 Ga0070686_100024077
1214 Ga0070686_100167871
1215 Ga0070686_100389065
1216 Ga0070686_100465093
1217 Ga0070695_100000061
1218 Ga0070695_100003902
1219 Ga0070695_100041240
1220 Ga0070695_100109023
1221 Ga0070695_100112542
1222 Ga0070696_100000571
1223 Ga0070696_100005465
1224 Ga0070696_100040027
1225 Ga0070696_100086982
1226 Ga0070696_100547662
1227 Ga0070693_100066041
1228 Ga0070665_100016328
1229 Ga0070665_100065573
1230 Ga0070704_100000718
1231 Ga0070704_100009228
1232 Ga0070704_100025085
1233 Ga0070704_100044405
1234 Ga0070704_100430955
1235 Ga0070704_100624956
1236 Ga0070664_100002520
1237 Ga0070664_100016849
1238 Ga0068857_100042312
1239 Ga0068857_100138987
1240 Ga0068857_100160805
1241 Ga0068854_100019045
1242 Ga0068854_100042743
1243 Ga0070702_100203421
1244 Ga0068859_100000940
1245 Ga0068859_100003972
1246 Ga0068859_100038713
1247 Ga0068859_100060701
1248 Ga0068859_100248282
1249 Ga0068859_100505346
1250 Ga0068864_100028303
1251 Ga0068864_100186160
1252 Ga0068864_100425635
1253 Ga0068861_100000753
1254 Ga0068861_100027954
1255 Ga0068861_100126847
1256 Ga0068861_100128155
1257 Ga0068861_100167648
1258 Ga0068861_100190742
1259 Ga0068861_100405535
1260 Ga0068851_10111766
1261 Ga0068870_10014038
1262 Ga0068863_100009319
1263 Ga0068863_100102559
1264 Ga0068863_100169327
1265 Ga0068863_100217153
1266 Ga0068858_100009204
1267 Ga0068858_100019683
1268 Ga0068858_100158144
1269 Ga0068858_100274625
1270 Ga0068858_100457983
1271 Ga0068860_100024357
1272 Ga0068860_100024428
1273 Ga0068860_100084499
1274 Ga0068860_100141468
1275 Ga0068862_100000612
1276 Ga0068862_100028702
1277 Ga0068862_100039204
1278 Ga0068862_100052619
1279 Ga0068862_100139194
1280 Ga0068862_100200359
1281 Ga0068862_100210502
1282 Ga0068862_100248914
1283 Ga0081455_10002517
1284 Ga0081538_10007747
1285 Ga0081540_1015496
1286 Ga0081539_10027639
1287 Ga0081539_10052810
1288 Ga0075368_10007051
1289 Ga0075368_10009337
1290 Ga0075363_100020050
1291 Ga0075364_10011053
1292 Ga0075364_10047832
1293 Ga0075364_10048544
1294 Ga0075364_10132308
1295 Ga0075364_10189464
1296 Ga0075432_10074504
1297 Ga0070716_100170006
1298 Ga0075362_10000342
1299 Ga0075362_10009532
1300 Ga0075367_10002146
1301 Ga0075367_10008454
1302 Ga0075367_10014597
1303 Ga0075367_10047450
1304 Ga0075366_10001977
1305 Ga0075366_10004267
1306 Ga0097621_100044020
1307 Ga0097621_100050875
1308 Ga0097621_100268169
1309 Ga0097621_100361067
1310 Ga0097621_100507716
1311 Ga0075370_10008821
1312 Ga0075370_10126123
1313 Ga0068871_100008186
1314 Ga0068871_100010044
1315 Ga0068871_100012078
1316 Ga0068871_100090873
1317 Ga0068871_100093277
1318 Ga0068871_100246910
1319 Ga0075428_100000037
1320 Ga0075428_100000862
1321 Ga0075428_100004677
1322 Ga0075428_100011075
1323 Ga0075428_100013797
1324 Ga0075428_100022252
1325 Ga0075428_100028725
1326 Ga0075428_100053234
1327 Ga0075428_100079714
1328 Ga0075428_100081214
1329 Ga0075428_100084143
1330 Ga0075428_100135988
1331 Ga0075428_100180128
1332 Ga0075428_100316600
1333 Ga0075428_100333260
1334 Ga0075428_100599064
1335 Ga0075430_100000655
1336 Ga0075430_100095248
1337 Ga0075430_100099053
1338 Ga0075430_100131855
1339 Ga0075430_100155649
1340 Ga0075430_100220864
1341 Ga0075430_100229698
1342 Ga0075431_100012414
1343 Ga0075431_100046991
1344 Ga0075431_100073064
1345 Ga0075431_100082230
1346 Ga0075431_100096915
1347 Ga0075431_100110730
1348 Ga0075433_10007731
1349 Ga0075433_10039242
1350 Ga0075433_10052832
1351 Ga0075433_10054439
1352 Ga0075433_10057366
1353 Ga0075433_10081956
1354 Ga0075433_10155475
1355 Ga0075433_10184022
1356 Ga0075433_10260765
1357 Ga0075433_10404294
1358 Ga0075433_10412631
1359 Ga0075434_100000019
1360 Ga0075434_100001168
1361 Ga0075434_100009596
1362 Ga0075434_100081191
1363 Ga0075434_100084276
1364 Ga0075434_100179364
1365 Ga0075434_100247819
1366 Ga0075434_100356718
1367 Ga0075429_100005390
1368 Ga0075429_100007476
1369 Ga0075429_100058680
1370 Ga0075429_100111123
1371 Ga0068865_100010101
1372 Ga0068865_100014003
1373 Ga0068865_100023794
1374 Ga0068865_100193892
1375 Ga0075436_100000160
1376 Ga0075436_100019245
1377 Ga0075436_100035724
1378 Ga0075436_100324167
1379 Ga0097620_100000940
1380 Ga0097620_100003972
1381 Ga0097620_100038715
1382 Ga0097620_100060700
1383 Ga0097620_100248275
1384 Ga0097620_100505408
1385 Ga0075435_100000041
1386 Ga0075435_100009005
1387 Ga0075435_100009374
1388 Ga0075435_100012805
1389 Ga0075435_100015015
1390 Ga0075435_100023820
1391 Ga0075435_100027371
1392 Ga0075435_100122061
1393 Ga0075435_100369723
1394 Ga0099795_10044070
1395 Ga0105240_10312044
1396 Ga0105240_10376406
1397 Ga0111539_10000009
1398 Ga0111539_10001537
1399 Ga0111539_10006768
1400 Ga0111539_10008826
1401 Ga0111539_10022355
1402 Ga0111539_10080387
1403 Ga0111539_10155020
1404 Ga0111539_10204953
1405 Ga0111539_10318443
1406 Ga0111539_10390908
1407 Ga0111539_10683220
1408 Ga0111539_10813561
1409 Ga0105245_10037421
1410 Ga0105245_10419112
1411 Ga0105245_10478930
1412 Ga0105245_10588771
1413 Ga0105247_10062558
1414 Ga0114129_10001294
1415 Ga0114129_10002457
1416 Ga0114129_10006209
1417 Ga0114129_10008621
1418 Ga0114129_10013305
1419 Ga0114129_10022844
1420 Ga0114129_10027092
1421 Ga0114129_10028182
1422 Ga0114129_10055196
1423 Ga0114129_10062679
1424 Ga0114129_10096224
1425 Ga0114129_10101489
1426 Ga0114129_10116915
1427 Ga0114129_10121320
1428 Ga0114129_10129796
1429 Ga0114129_10221239
1430 Ga0114129_10240049
1431 Ga0114129_10329959
1432 Ga0114129_10412042
1433 Ga0114129_10415252
1434 Ga0114129_10629028
1435 Ga0114129_10712688
1436 Ga0114129_10863037
1437 Ga0114129_11227867
1438 Ga0105243_10255676
1439 Ga0105243_10781472
1440 Ga0105241_10038324
1441 Ga0105241_10053004
1442 Ga0105241_10628713
1443 Ga0105242_10016080
1444 Ga0105242_10016312
1445 Ga0105242_10018000
1446 Ga0105242_10460910
1447 Ga0105242_10585001
1448 Ga0105242_10645287
1449 Ga0105248_10031306
1450 Ga0105248_10093562
1451 Ga0105248_10139977
1452 Ga0105248_10148033
1453 Ga0105248_10243788
1454 Ga0105248_10398371
1455 Ga0105248_10412292
1456 Ga0105248_10548766
1457 Ga0105238_10736138
1458 Ga0105249_10003036
1459 Ga0105249_10022901
1460 Ga0105249_10049361
1461 Ga0105249_10131718
1462 Ga0105249_10222121
1463 Ga0105249_10314628
1464 Ga0105249_10321939
1465 Ga0105249_10524618
1466 Ga0157374_10030945
1467 Ga0157374_10225484
1468 Ga0157374_10324324
1469 Ga0157378_10058289
1470 Ga0157378_10080042
1471 Ga0157378_10411257
1472 Ga0163162_10133984
1473 Ga0163162_10152375
1474 Ga0163162_10225525
1475 Ga0157375_10084503
1476 Ga0157375_10394347
1477 Ga0157375_10404597
1478 Ga0157375_10490619
1479 Ga0157375_10551188
1480 Ga0157375_10907241
1481 Ga0163163_10004353
1482 Ga0163163_10149794
1483 Ga0157380_10008295
1484 Ga0157380_10019709
1485 Ga0157380_10071434
1486 Ga0157380_10076260
1487 Ga0157380_10241933
1488 Ga0157379_10026173
1489 Ga0157376_10048399
1490 Ga0157376_10420505
1491 Ga0157376_10521425
1492 Ga0207697_10102455
1493 Ga0207656_10077204
1494 Ga0207682_10039732
1495 Ga0207682_10136217
1496 Ga0207642_10040535
1497 Ga0207680_10126590
1498 Ga0207699_10141209
1499 Ga0207699_10175738
1500 Ga0207645_10032234
1501 Ga0207645_10049279
1502 Ga0207645_10087849
1503 Ga0207645_10155466
1504 Ga0207645_10215451
1505 Ga0207645_10289435
1506 Ga0207643_10021437
1507 Ga0207643_10059667
1508 Ga0207684_10002898
1509 Ga0207684_10018006
1510 Ga0207684_10107159
1511 Ga0207684_10192771
1512 Ga0207684_10293250
1513 Ga0207684_10646670
1514 Ga0207654_10041097
1515 Ga0207695_10235075
1516 Ga0207660_10117351
1517 Ga0207660_10178651
1518 Ga0207660_10351067
1519 Ga0207662_10034224
1520 Ga0207662_10080037
1521 Ga0207662_10168725
1522 Ga0207649_10017165
1523 Ga0207646_10004695
1524 Ga0207646_10017592
1525 Ga0207646_10090244
1526 Ga0207646_10112625
1527 Ga0207646_10126651
1528 Ga0207646_10229372
1529 Ga0207646_10306821
1530 Ga0207646_10327475
1531 Ga0207681_10005037
1532 Ga0207681_10017604
1533 Ga0207681_10104669
1534 Ga0207681_10201533
1535 Ga0207650_10036705
1536 Ga0207650_10110255
1537 Ga0207650_10218717
1538 Ga0207659_10000188
1539 Ga0207659_10014321
1540 Ga0207659_10018680
1541 Ga0207659_10134331
1542 Ga0207659_10269349
1543 Ga0207659_10355032
1544 Ga0207659_10464624
1545 Ga0207687_10022568
1546 Ga0207687_10367888
1547 Ga0207700_10008063
1548 Ga0207700_10034985
1549 Ga0207644_10106522
1550 Ga0207690_10027586
1551 Ga0207706_10045956
1552 Ga0207706_10087817
1553 Ga0207706_10100969
1554 Ga0207706_10203135
1555 Ga0207686_10006180
1556 Ga0207686_10091048
1557 Ga0207686_10376889
1558 Ga0207709_10130829
1559 Ga0207709_10313972
1560 Ga0207670_10003997
1561 Ga0207670_10009084
1562 Ga0207670_10201744
1563 Ga0207669_10006704
1564 Ga0207669_10010515
1565 Ga0207669_10013007
1566 Ga0207669_10024631
1567 Ga0207704_10135832
1568 Ga0207704_10143235
1569 Ga0207691_10006107
1570 Ga0207691_10022906
1571 Ga0207691_10063906
1572 Ga0207691_10092316
1573 Ga0207691_10113871
1574 Ga0207711_10051889
1575 Ga0207711_10188431
1576 Ga0207711_10255968
1577 Ga0207711_10576602
1578 Ga0207689_10017760
1579 Ga0207689_10079510
1580 Ga0207689_10083757
1581 Ga0207689_10115149
1582 Ga0207661_10011215
1583 Ga0207661_10156657
1584 Ga0207679_10002659
1585 Ga0207679_10124202
1586 Ga0207679_10126194
1587 Ga0207679_10363460
1588 Ga0207667_10278442
1589 Ga0207651_10023379
1590 Ga0207651_10025902
1591 Ga0207651_10052833
1592 Ga0207651_10111975
1593 Ga0207651_10195355
1594 Ga0207651_10204382
1595 Ga0207651_10268256
1596 Ga0207712_10018953
1597 Ga0207712_10088448
1598 Ga0207712_10155321
1599 Ga0207712_10453719
1600 Ga0207712_10474054
1601 Ga0207668_10063637
1602 Ga0207668_10150746
1603 Ga0207668_10185652
1604 Ga0207640_10030010
1605 Ga0207640_10037127
1606 Ga0207658_10181141
1607 Ga0207658_10226951
1608 Ga0207658_10530718
1609 Ga0207677_10017072
1610 Ga0207677_10017810
1611 Ga0207677_10249195
1612 Ga0207703_10004262
1613 Ga0207703_10138768
1614 Ga0207703_10230660
1615 Ga0207703_10351998
1616 Ga0207678_10015984
1617 Ga0207708_10011404
1618 Ga0207708_10016816
1619 Ga0207708_10026800
1620 Ga0207708_10033011
1621 Ga0207708_10033034
1622 Ga0207708_10050529
1623 Ga0207708_10067724
1624 Ga0207708_10091051
1625 Ga0207708_10149787
1626 Ga0207641_10207438
1627 Ga0207641_10493090
1628 Ga0207648_10001860
1629 Ga0207648_10031489
1630 Ga0207648_10050958
1631 Ga0207648_10102995
1632 Ga0207676_10024049
1633 Ga0207676_10027327
1634 Ga0207676_10042656
1635 Ga0207676_10069868
1636 Ga0207676_10223604
1637 Ga0207674_10023655
1638 Ga0207674_10044046
1639 Ga0207674_10052540
1640 Ga0207674_10122262
1641 Ga0207674_10161279
1642 Ga0207675_100006022
1643 Ga0207675_100022659
1644 Ga0207675_100048529
1645 Ga0207675_100050645
1646 Ga0207675_100051051
1647 Ga0207675_100061364
1648 Ga0207675_100339845
1649 Ga0207675_100427718
1650 Ga0207683_10039938
1651 Ga0207683_10053529
1652 Ga0207683_10078856
1653 Ga0207683_10461497
1654 Ga0207698_10360865
1655 Ga0209813_10007956
1656 Ga0209974_10086695
1657 Ga0207428_10000005
1658 Ga0207428_10000963
1659 Ga0207428_10001556
1660 Ga0207428_10001740
1661 Ga0207428_10019076
1662 Ga0207428_10061765
1663 Ga0207428_10217213
1664 Ga0207428_10428309
1665 Ga0268265_10000183
1666 Ga0268265_10038688
1667 Ga0268265_10095582
1668 Ga0268265_10223540
1669 Ga0268265_10399988
1670 Ga0268265_10712833
1671 Ga0268264_10006097
1672 Ga0268264_10309429
1673 Ga0265323_10004413
1674 Ga0265338_10021154
1675 Ga0265324_10012498
1676 Ga0316579_10027907
1677 Ga0316579_10037408
1678 Ga0265314_10037448
1679 Ga0316576_10002816
1680 Ga0316576_10276245
1681 Ga0316576_10358649
1682 Ga0307410_10304204
1683 Ga0307406_10133876
1684 Ga0307407_10215608
1685 Ga0307412_10497176
1686 Ga0307409_100056429
1687 Ga0307409_100142266
1688 Ga0307409_100149029
1689 Ga0307416_100025487
1690 Ga0307416_100102786
1691 Ga0307411_10110595
1692 Ga0307411_10325373
1693 Ga0307415_100222295
1694 Ga0373930_0011111
1695 Ga0373958_0012953
1696 Ga0373958_0021785
1697 Ga0373929_0001104
1698 Ga0373940_0000039
1699 Ga0373940_0069588
1700 Ga0373949_0001162
1701 Ga0373951_0002100
1702 Ga0373932_0002751
1703 Ga0373932_0061243
1704 Ga0373936_0118575
1705 Ga0373939_0000940
1706 Ga0373941_0001349
1707 Ga0373945_0037248
1708 Ga0373954_0088662
1709 Ga0373956_0084511
1710 Ga0373960_0001226
1711 Ga0373943_0003982
1712 Ga0373943_0186533
1713 Ga0373943_0220576
1714 Ga0373946_0008520
1715 Ga0373946_0251858
1716 Ga0373955_0074212
1717 Ga0373955_0075377
1718 Ga0373942_0000750
1719 Ga0373961_0002991
1720 Ga0373961_0064211
1721 Ga0373962_0000766
1722 Ga0316574_0049704
1723 Ga0316574_0165455
1724 Ga0316574_0267273
1725 Ga0373924_0010419
1726 Ga0373924_0121792
1727 Ga0373931_0001453
1728 Ga0373931_0065359
1729 Ga0373935_0026673
1730 Ga0373935_0261811
1731 Ga0373927_0031710
1732 Ga0373933_0024873
1733 Ga0373933_0132775
1734 Ga0373937_0003122
1735 Ga0373937_0031300
1736 Ga0373937_0279887
1737 Ga0373937_0300272
1738 Ga0373937_0361320
1739 Ga0316582_0033596
1740 Ga0316582_0094238
1741 Ga0373925_0005452
1742 Ga0373925_0196828
1743 Ga0373925_0455971
1744 Ga0436365_0993952
1745 Ga0439461_0008604
1746 Ga0439433_0007182
1747 Ga0439441_048546
1748 Ga0439445_0041035
1749 Ga0439457_107273
1750 Ga0450920_041037
1751 Ga0450923_003766
1752 Ga0450896_027603
1753 Ga0439446_0006628
1754 Ga0439446_0009351
1755 Ga0439434_0020742
1756 Ga0439434_0024883
1757 Ga0439435_0005134
1758 Ga0451577_0001014
1759 Ga0451577_0028596
1760 Ga0451577_0092147
1761 Ga0439440_0100124
1762 Ga0453684_0000004
1763 Ga0453684_0066994
1764 Ga0453684_0168852
1765 Ga0453684_0547163
1766 Ga0451576_0002751
1767 Ga0451576_0004039
1768 Ga0451576_0011011
1769 Ga0451576_0035312
1770 Ga0451576_0093800
1771 Ga0451576_0289303
1772 Ga0451576_0388698
1773 Ga0495592_0147312
1774 Ga0495603_0006665
1775 Ga0495629_0001864
1776 Ga0495638_0020091
1777 Ga0495651_0124323
1778 Ga0495651_0188806
1779 Ga0495580_0154759
1780 Ga0495639_0095330
1781 Ga0495639_0232697
1782 Ga0495664_0129466
1783 Ga0495664_0206431
1784 Ga0495584_0029632
1785 Ga0495584_0164844
1786 Ga0495594_0050120
1787 Ga0495608_0001856
1788 Ga0495628_0053229
1789 Ga0495630_0003013
1790 Ga0495644_0039341
1791 Ga0495663_0090808
1792 Ga0495642_0004422
1793 Ga0495642_0098933
1794 Ga0495652_0354473
1795 Ga0495586_0265383
1796 Ga0495587_0085683
1797 Ga0495598_0003522
1798 Ga0495598_0012767
1799 Ga0495609_0049776
1800 Ga0495609_0196663
1801 Ga0495621_0067618
1802 Ga0495621_0136917
1803 Ga0495621_0162226
1804 Ga0495645_0003630
1805 Ga0495645_0011692
1806 Ga0495645_0206925
1807 Ga0495633_0018672
1808 Ga0495667_0023699
1809 Ga0495656_0017840
1810 Ga0495656_0058075
1811 Ga0495635_0062022
1812 Ga0495635_0150703
1813 Ga0495659_0010701
1814 Ga0495659_0013333
1815 Ga0495659_0042079
1816 Ga0495659_0049722
1817 Ga0495659_0104522
1818 Ga0495588_0024900
1819 Ga0495599_0039434
1820 Ga0495599_0100107
1821 Ga0495658_0015799
1822 Ga0495658_0150951
1823 Ga0495658_0151640
1824 Ga0495669_0013753
1825 Ga0495669_0019300
1826 Ga0495669_0037536
1827 Ga0495669_0096286
1828 Ga0495613_0000599
1829 Ga0495613_0161684
1830 Ga0495613_0267061
1831 Ga0495600_0003980
1832 Ga0495600_0063933
1833 Ga0495604_0014504
1834 Ga0495636_0100582
1835 Ga0495674_0050049
1836 Ga0495674_0074426
1837 Ga0495672_0001565
1838 Ga0495677_0026679
1839 Ga0495685_018711
1840 Ga0495684_0000310
1841 Ga0495684_0112833
1842 Ga0495684_0146073
1843 Ga0495684_0352374
1844 Ga0496100_0214982
1845 Ga0496101_0001671
1846 Ga0496102_0032144
1847 Ga0496104_0003276
1848 Ga0496104_0088057
1849 Ga0496104_0179311
1850 Ga0496105_0045285
1851 Ga0496105_0124553
1852 Ga0496105_0156700
1853 Ga0496106_0037860
1854 Ga0496106_0157814
1855 Ga0496107_0258932
1856 Ga0496108_0004502
1857 Ga0496109_0001333
1858 Ga0496109_0304142
1859 Ga0496110_0001226
1860 Ga0496112_0033138
1861 Ga0496112_0414005
1862 Ga0496113_0133691
1863 Ga0496114_0001180
1864 Ga0496114_0233106
1865 Ga0496115_0228113
1866 Ga0501298_006448
1867 Ga0501031_0128708
1868 Ga0501031_0335599
1869 Ga0501032_0395640
1870 Ga0501033_0060564
1871 Ga0501034_0004031
1872 Ga0501036_0013404
1873 Ga0501036_0063161
1874 Ga0501036_0075501
1875 Ga0501036_0096531
1876 Ga0501036_0205940
1877 Ga0501037_0075725
1878 Ga0501038_0043999
1879 Ga0501038_0063821
1880 Ga0501038_0160861
1881 Ga0501039_0111878
1882 Ga0501039_0158973
1883 Ga0501039_0170020
1884 Ga0501040_0004377
1885 Ga0501040_0006548
1886 Ga0501040_0033622
1887 Ga0501040_0111652
1888 Ga0501040_0130769
1889 Ga0501041_0047271
1890 Ga0501041_0162432
1891 Ga0501041_0196082
1892 Ga0501041_0218489
1893 Ga0501042_0022598
1894 Ga0501042_0315804
1895 Ga0501042_0469976
1896 Ga0501042_0481416
1897 Ga0501043_0112868
1898 Ga0501048_0021740
1899 Ga0501048_0025224
1900 Ga0501048_0031371
1901 Ga0501048_0071723
1902 Ga0501048_0212123
1903 Ga0501048_0401835
1904 Ga0501067_0285894
1905 Ga0501068_0149337
1906 Ga0501071_0022159
1907 Ga0501071_0026347
1908 Ga0501071_0037102
1909 Ga0501071_0037251
1910 Ga0501071_0192236
1911 Ga0501071_0361244
1912 Ga0501071_0521535
1913 Ga0501071_0632167
1914 Ga0501072_0007310
1915 Ga0501072_0022930
1916 Ga0501072_0025475
1917 Ga0501072_0264862
1918 Ga0501072_0270104
1919 Ga0501073_0004289
1920 Ga0501073_0045987
1921 Ga0501074_0061265
1922 Ga0501074_0061528
1923 Ga0501074_0149674
1924 Ga0501074_0178990
1925 Ga0501075_0010372
1926 Ga0501075_0014416
1927 Ga0501075_0015936
1928 Ga0501075_0026624
1929 Ga0501075_0027486
1930 Ga0501075_0339000
1931 Ga0501075_0430463
1932 Ga0501076_0008303
1933 Ga0501076_0014435
1934 Ga0501076_0018379
1935 Ga0501076_0024644
1936 Ga0501076_0033580
1937 Ga0501076_0112103
1938 Ga0501076_0277677
1939 Ga0501076_0558450
1940 Ga0501077_0114031
1941 Ga0501077_0120443
1942 Ga0501077_0304536
1943 Ga0501077_0484655
1944 Ga0501079_0039777
1945 Ga0501079_0041256
1946 Ga0501079_0080999
1947 Ga0501079_0117863
1948 Ga0501079_0309187
1949 Ga0501079_0401812
1950 Ga0501080_0047614
1951 Ga0501080_0568157
1952 Ga0501080_0753648
1953 Ga0501081_0008536
1954 Ga0501081_0009062
1955 Ga0501081_0038621
1956 Ga0501081_0059835
1957 Ga0501081_0062692
1958 Ga0501081_0223625
1959 Ga0501081_0415026
1960 Ga0501081_0554685
1961 Ga0501045_0011826
1962 Ga0501045_0018556
1963 Ga0501045_0065071
1964 Ga0501045_0164990
1965 Ga0501045_0430481
1966 Ga0501045_0477941
1967 nmdc:mga03683_3241_c1
1968 nmdc:mga03683_66316_c1
1969 nmdc:mga03n38_220435_c1
1970 nmdc:mga00v17_16883_c1
1971 nmdc:mga00v17_171208_c1
1972 nmdc:mga00v17_34078_c1
1973 nmdc:mga0yw44_2299_c1
1974 nmdc:mga0yw44_497700_c1
1975 nmdc:mga0k408_28290_c2
1976 nmdc:mga0k408_4177_c1
1977 nmdc:mga06z11_17737_c1
1978 nmdc:mga06z11_3555_c1
1979 nmdc:mga06z11_50315_c1
1980 nmdc:mga06z11_5154_c1
1981 nmdc:mga06z11_9088_c1
1982 nmdc:mga04h51_126451_c1
1983 nmdc:mga04h51_9279_c1
1984 nmdc:mga05p37_100630_c1
1985 nmdc:mga05p37_130274_c1
1986 nmdc:mga05p37_134259_c1
1987 nmdc:mga05p37_135291_c1
1988 nmdc:mga05p37_145751_c1
1989 nmdc:mga05p37_165753_c1
1990 nmdc:mga05p37_1682_c1
1991 nmdc:mga05p37_188854_c1
1992 nmdc:mga05p37_200646_c1
1993 nmdc:mga05p37_228487_c1
1994 nmdc:mga05p37_22858_c1
1995 nmdc:mga05p37_240985_c1
1996 nmdc:mga05p37_28735_c1
1997 nmdc:mga05p37_367296_c1
1998 nmdc:mga05p37_40463_c1
1999 nmdc:mga05p37_423797_c1
2000 nmdc:mga05p37_478081_c1
2001 nmdc:mga05p37_566944_c1
2002 nmdc:mga05p37_567032_c1
2003 nmdc:mga05p37_644_c1
2004 nmdc:mga05p37_69333_c1
2005 nmdc:mga05p37_78073_c1
2006 nmdc:mga05p37_81281_c1
2007 nmdc:mga05p37_855548_c1
2008 nmdc:mga05p37_86311_c1
2009 nmdc:mga09592_113139_c1
2010 nmdc:mga09592_304352_c1
2011 nmdc:mga09592_314878_c1
2012 nmdc:mga09592_40921_c1
2013 nmdc:mga09592_423364_c1
2014 nmdc:mga09592_4298_c1
2015 nmdc:mga09592_547400_c1
2016 nmdc:mga09592_7328_c1
2017 nmdc:mga09592_99751_c1
2018 nmdc:mga0qj67_144750_c1
2019 nmdc:mga0qj67_165467_c1
2020 nmdc:mga0qj67_3318_c1
2021 nmdc:mga06r32_107564_c1
2022 nmdc:mga06r32_15924_c1
2023 nmdc:mga06r32_49931_c1
2024 nmdc:mga06r32_603924_c1
2025 nmdc:mga06r32_63212_c1
2026 nmdc:mga06r32_8083_c1
2027 nmdc:mga06r32_95924_c1
2028 nmdc:mga08y16_10460_c1
2029 nmdc:mga08y16_104809_c1
2030 nmdc:mga08y16_10929_c1
2031 nmdc:mga08y16_155249_c1
2032 nmdc:mga08y16_198729_c1
2033 nmdc:mga08y16_243215_c1
2034 nmdc:mga08y16_244777_c1
2035 nmdc:mga08y16_373840_c1
2036 nmdc:mga08y16_39988_c1
2037 nmdc:mga08y16_48405_c1
2038 nmdc:mga08y16_6292_c1
2039 nmdc:mga08y16_86790_c1
2040 nmdc:mga08y16_932_c1
2041 nmdc:mga08y16_9_c1
2042 nmdc:mga0n895_102951_c1
2043 nmdc:mga0n895_112926_c1
2044 nmdc:mga0n895_138646_c1
2045 nmdc:mga0n895_139651_c1
2046 nmdc:mga0n895_151826_c1
2047 nmdc:mga0n895_168218_c1
2048 nmdc:mga0n895_182632_c1
2049 nmdc:mga0n895_20798_c1
2050 nmdc:mga0n895_4406_c1
2051 nmdc:mga0n895_52553_c1
2052 nmdc:mga0n895_691527_c1
2053 nmdc:mga0n895_700432_c1
2054 nmdc:mga0n895_81_c1
2055 nmdc:mga0rr50_1_c1
2056 nmdc:mga0rr50_28641_c1
2057 nmdc:mga0rr50_4248_c1
2058 nmdc:mga0rr50_557328_c1
2059 nmdc:mga0rr50_83187_c1
2060 nmdc:mga0rr50_8895_c1
2061 nmdc:mga08x19_181099_c1
2062 nmdc:mga08x19_265_c1
2063 nmdc:mga08x19_310417_c1
2064 nmdc:mga08x19_59349_c1
2065 nmdc:mga08x19_96849_c1
2066 nmdc:mga0a205_115510_c1
2067 nmdc:mga0a205_116830_c1
2068 nmdc:mga0a205_179962_c1
2069 nmdc:mga0a205_3136_c1
2070 nmdc:mga0a205_326970_c1
2071 nmdc:mga0a205_391940_c1
2072 nmdc:mga0a205_456663_c1
2073 nmdc:mga0a205_45943_c1
2074 nmdc:mga0a205_46215_c1
2075 nmdc:mga0a205_47513_c2
2076 nmdc:mga0a205_49528_c1
2077 nmdc:mga0a205_61542_c1
2078 nmdc:mga0sz30_68326_c1
2079 Ga0495601_0058386
2080 Ga0495595_0043128
2081 Ga0495619_0008204
2082 Ga0495619_0071124
2083 Ga0500646_0081212
2084 Ga0500555_006197
2085 Ga0501084_0008116
2086 Ga0501084_0130496
2087 Ga0501084_0161438
2088 Ga0501084_0216963
2089 Ga0501084_0383980
2090 Ga0501082_0015946
2091 Ga0501082_0024231
2092 Ga0501082_0030564
2093 Ga0501082_0089298
2094 Ga0501082_0291148
2095 Ga0501082_0317908
2096 Ga0501082_0538040
2097 Ga0530510_0006006
2098 Ga0530510_0011471
2099 Ga0530510_0092624
2100 Ga0530510_0157749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

176

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

113

211

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9368 1 226
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9353 2 211
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9334 2 210
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9281 1 204
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.927 2 210
ID Description Score Start End Superfamily
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9434 2 216 3.40.50.300
4rvcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9368 1 226 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9357 2 199 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9348 2 215 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9344 2 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A523UXE7-F1-model_v4 ABC transporter ATP-binding protein 0.9743 1 229 GO:0005524
GO:0016887
AF-A0A351RT97-F1-model_v4 ABC transporter 0.9721 1 228 GO:0005524
GO:0016887
AF-Q2YZP3-F1-model_v4 Cytochrome c biogenesis ATP-binding export protein ccmA 0.9716 1 228 GO:0005524
GO:0016887
AF-A0A3E0NKL7-F1-model_v4 ABC transporter ATP-binding protein 0.9685 2 226 GO:0005524
GO:0016887
AF-A0A5C5YM13-F1-model_v4 Putative ABC transporter ATP-binding protein YbhF 0.9662 1 226 GO:0005524
GO:0016887

Map