F489064

General Info

Members Datasets Scaffolds Average Seq Length
1050 349 1032 341

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0000469|Ga0500578_0000469_8423_9850
Length 395
Sequence LQLVACGWLSVFAYGFQLSALSCILYLYLPSAFGLKPLAVFSYFWRNKNYMQLGILGSGSWATALAKICTDNKQSINWCVRSEEIVNHIQQRHHNPGYLSSVYFDTNLVNLSTDIAGTIAASDCILIATPSAYVTATLNNLPANAFDGKKVLSAVKGILPDTNLLLNDHLKQAFNLPLSDYFTVMGPCHAEEVASEKLSYLTFSGIDVAMAEKIAALFTTPYLNTIVNPDVYGVQYAAVLKNIYALGAGIAHGLEYGDNFLSVLIANCADEMAGFLKKVGIQHMEVGVHDGEDPVTHRKTPNYAASVYLGDLLVTCYSLYSRNRTFGNMIGKGYSVRATQLEMNMVAEGYNASKCIYLVNQQIGADMPIAETVYRILWENVKPRKGFNLVEKTLV

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
6 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
12 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
13 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
14 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
15 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
16 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
17 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
226 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
270 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
287 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
288 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
289 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
290 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
291 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
292 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
293 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
294 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
295 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
296 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
297 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
298 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
299 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
300 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
301 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
302 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
303 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
304 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
305 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
306 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
307 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
312 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
313 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
314 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
315 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
319 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
325 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
326 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
327 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
331 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
337 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
338 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
341 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
342 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.67
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001374 3300001979 Bacteria 11112
2 JGI24740J21852_10014041 3300001979 Bacteria 2968
3 JGI24739J22299_10000023 3300001989 Bacteria 44535
4 JGI24751J29686_10000655 3300002459 Bacteria 8686
5 JGI25154J39366_1000003 3300002738 Bacteria 397627
6 JGI25406J46586_10004435 3300003203 Bacteria 6531
7 JGI25153J46596_10000403 3300003215 Bacteria 28759
8 rootH1_10143070 3300003316 Bacteria 2488
9 rootH1_10156821 3300003316 Bacteria 1756
10 rootH2_10006582 3300003320 Bacteria 17739
11 rootH2_10013765 3300003320 Bacteria 12637
12 rootH2_10022930 3300003320 Bacteria 32910
13 rootL2_10017734 3300003322 Bacteria 7561
14 rootL2_10030107 3300003322 Unclassified 4518
15 rootL2_10031071 3300003322 Bacteria 5300
16 rootL2_10136943 3300003322 Bacteria 2790
17 rootL2_10140353 3300003322 Bacteria 7821
18 rootL2_10210810 3300003322 Unclassified 2045
19 rootH1_10014197 3300003323 Bacteria 13041
20 rootH1_10159681 3300003323 Bacteria 9126
21 JGI25160J50197_1002148 3300003354 Bacteria 9337
22 JGI25160J50197_1010623 3300003354 Bacteria 3315
23 JGI25160J50197_1015108 3300003354 Bacteria 2549
24 Ga0055535_1001304 3300003761 Bacteria 13346
25 Ga0055528_1000539 3300003790 Bacteria 28875
26 Ga0055530_10000620 3300003791 Bacteria 30853
27 Ga0055531_10000059 3300003794 Bacteria 121487
28 Ga0055543_1008738 3300004625 Bacteria 2222
29 Ga0065165_1001718 3300005262 Bacteria 21974
30 Ga0065165_1004314 3300005262 Bacteria 8941
31 Ga0065712_10000981 3300005290 Bacteria 7537
32 Ga0065712_10008215 3300005290 Bacteria 3954
33 Ga0065712_10119802 3300005290 Bacteria 1687
34 Ga0065715_10092426 3300005293 Bacteria 5130
35 Ga0070658_10000832 3300005327 Bacteria 26408
36 Ga0070658_10018168 3300005327 Bacteria 5625
37 Ga0070658_10035739 3300005327 Bacteria 4003
38 Ga0070658_10036722 3300005327 Bacteria 3949
39 Ga0070658_10140561 3300005327 Bacteria 2017
40 Ga0070658_10197762 3300005327 Bacteria 1695
41 Ga0070676_10001192 3300005328 Bacteria 13022
42 Ga0070676_10014551 3300005328 Bacteria 4326
43 Ga0070676_10020608 3300005328 Bacteria 3684
44 Ga0070683_100002583 3300005329 Bacteria 14483
45 Ga0070683_100006473 3300005329 Bacteria 9832
46 Ga0070683_100014557 3300005329 Bacteria 6886
47 Ga0070683_100063547 3300005329 Bacteria 3434
48 Ga0070683_100081819 3300005329 Bacteria 3024
49 Ga0070683_100135703 3300005329 Bacteria 2330
50 Ga0070683_100141336 3300005329 Bacteria 2281
51 Ga0070683_100245519 3300005329 Bacteria 1703
52 Ga0070670_100019919 3300005331 Bacteria 5759
53 Ga0070670_100040716 3300005331 Bacteria 3993
54 Ga0070670_100048124 3300005331 Bacteria 3669
55 Ga0070670_100065603 3300005331 Bacteria 3115
56 Ga0070670_100303798 3300005331 Unclassified 1396
57 Ga0068869_100002227 3300005334 Bacteria 11658
58 Ga0068869_100002467 3300005334 Bacteria 11156
59 Ga0068869_100018710 3300005334 Bacteria 4721
60 Ga0068869_100020876 3300005334 Bacteria 4499
61 Ga0068869_100028959 3300005334 Bacteria 3875
62 Ga0068869_100030116 3300005334 Unclassified 3807
63 Ga0068869_100061749 3300005334 Bacteria 2749
64 Ga0068869_100140058 3300005334 Bacteria 1867
65 Ga0068869_100145070 3300005334 Unclassified 1836
66 Ga0070666_10000227 3300005335 Bacteria 38376
67 Ga0070666_10000694 3300005335 Bacteria 20427
68 Ga0070666_10013725 3300005335 Bacteria 5143
69 Ga0070666_10027886 3300005335 Bacteria 3702
70 Ga0070666_10138650 3300005335 Bacteria 1694
71 Ga0070680_100000268 3300005336 Bacteria 34613
72 Ga0070680_100004897 3300005336 Bacteria 10085
73 Ga0070680_100009953 3300005336 Bacteria 7322
74 Ga0070680_100063728 3300005336 Bacteria 3020
75 Ga0070680_100075888 3300005336 Bacteria 2767
76 Ga0070682_100002103 3300005337 Bacteria 11066
77 Ga0070682_100038484 3300005337 Bacteria 2934
78 Ga0070682_100047897 3300005337 Bacteria 2659
79 Ga0068868_100000022 3300005338 Bacteria 85904
80 Ga0068868_100003164 3300005338 Bacteria 11456
81 Ga0068868_100017935 3300005338 Bacteria 5281
82 Ga0068868_100047437 3300005338 Unclassified 3367
83 Ga0068868_100098971 3300005338 Bacteria 2358
84 Ga0068868_100135613 3300005338 Bacteria 2017
85 Ga0070660_100000242 3300005339 Bacteria 36371
86 Ga0070660_100008803 3300005339 Bacteria 7071
87 Ga0070660_100107303 3300005339 Bacteria 2219
88 Ga0070660_100134960 3300005339 Bacteria 1977
89 Ga0070660_100212691 3300005339 Bacteria 1570
90 Ga0070689_100004351 3300005340 Bacteria 9558
91 Ga0070689_100065434 3300005340 Unclassified 2831
92 Ga0070689_100091265 3300005340 Bacteria 2401
93 Ga0070689_100125780 3300005340 Unclassified 2051
94 Ga0070689_100187974 3300005340 Bacteria 1681
95 Ga0070689_100348523 3300005340 Bacteria 1241
96 Ga0070691_10000271 3300005341 Bacteria 18096
97 Ga0070691_10044554 3300005341 Unclassified 2104
98 Ga0070687_100007090 3300005343 Bacteria 4641
99 Ga0070661_100000111 3300005344 Bacteria 68066
100 Ga0070661_100004089 3300005344 Bacteria 10051
101 Ga0070661_100020641 3300005344 Bacteria 4698
102 Ga0070661_100023047 3300005344 Bacteria 4461
103 Ga0070668_100000016 3300005347 Bacteria 104092
104 Ga0070668_100045177 3300005347 Unclassified 3380
105 Ga0070668_100062465 3300005347 Unclassified 2886
106 Ga0070668_100063538 3300005347 Bacteria 2862
107 Ga0070668_100351620 3300005347 Bacteria 1247
108 Ga0070668_100409751 3300005347 Bacteria 1159
109 Ga0070669_100022311 3300005353 Bacteria 4527
110 Ga0070669_100065523 3300005353 Bacteria 2676
111 Ga0070675_100005753 3300005354 Bacteria 9483
112 Ga0070675_100059203 3300005354 Bacteria 3159
113 Ga0070675_100073229 3300005354 Bacteria 2844
114 Ga0070675_100075650 3300005354 Bacteria 2799
115 Ga0070671_100001071 3300005355 Bacteria 20211
116 Ga0070671_100028175 3300005355 Bacteria 4625
117 Ga0070671_100123973 3300005355 Bacteria 2175
118 Ga0070671_100141853 3300005355 Bacteria 2027
119 Ga0070671_100169224 3300005355 Bacteria 1848
120 Ga0070674_100005491 3300005356 Bacteria 7329
121 Ga0070673_100001320 3300005364 Bacteria 14462
122 Ga0070673_100006098 3300005364 Bacteria 7810
123 Ga0070673_100010627 3300005364 Bacteria 6239
124 Ga0070673_100012671 3300005364 Bacteria 5798
125 Ga0070673_100039851 3300005364 Bacteria 3599
126 Ga0070673_100085000 3300005364 Bacteria 2575
127 Ga0070673_100096802 3300005364 Bacteria 2422
128 Ga0070673_100137603 3300005364 Bacteria 2057
129 Ga0070673_100145854 3300005364 Bacteria 2001
130 Ga0070673_100182317 3300005364 Bacteria 1798
131 Ga0070673_100203564 3300005364 Bacteria 1706
132 Ga0070688_100008316 3300005365 Bacteria 5629
133 Ga0070688_100011264 3300005365 Bacteria 4965
134 Ga0070688_100013987 3300005365 Bacteria 4539
135 Ga0070688_100024308 3300005365 Bacteria 3573
136 Ga0070688_100182867 3300005365 Bacteria 1455
137 Ga0070688_100229087 3300005365 Unclassified 1313
138 Ga0070659_100003782 3300005366 Bacteria 10802
139 Ga0070659_100040579 3300005366 Bacteria 3637
140 Ga0070659_100042015 3300005366 Bacteria 3575
141 Ga0070659_100066917 3300005366 Bacteria 2848
142 Ga0070659_100102391 3300005366 Bacteria 2305
143 Ga0070667_100000031 3300005367 Bacteria 177447
144 Ga0070667_100002868 3300005367 Bacteria 14864
145 Ga0070667_100006052 3300005367 Bacteria 10050
146 Ga0070667_100031584 3300005367 Bacteria 4415
147 Ga0070667_100053044 3300005367 Bacteria 3422
148 Ga0070667_100126075 3300005367 Unclassified 2231
149 Ga0070667_100278089 3300005367 Bacteria 1503
150 Ga0070667_100352654 3300005367 Bacteria 1332
151 Ga0070700_100194936 3300005441 Bacteria 1419
152 Ga0070700_100236087 3300005441 Unclassified 1304
153 Ga0070663_100035851 3300005455 Bacteria 3444
154 Ga0070663_100111797 3300005455 Bacteria 2053
155 Ga0070663_100117806 3300005455 Bacteria 2003
156 Ga0070663_100121269 3300005455 Bacteria 1975
157 Ga0070663_100194980 3300005455 Unclassified 1578
158 Ga0070678_100010645 3300005456 Bacteria 5632
159 Ga0070678_100014076 3300005456 Bacteria 5034
160 Ga0070678_100020255 3300005456 Bacteria 4360
161 Ga0070678_100095149 3300005456 Unclassified 2295
162 Ga0070662_100002529 3300005457 Bacteria 11273
163 Ga0070662_100005807 3300005457 Bacteria 7913
164 Ga0070662_100044335 3300005457 Bacteria 3185
165 Ga0070662_100048534 3300005457 Bacteria 3059
166 Ga0070681_10035895 3300005458 Bacteria 4979
167 Ga0070681_10069975 3300005458 Bacteria 3475
168 Ga0070681_10122987 3300005458 Bacteria 2528
169 Ga0068867_100015222 3300005459 Bacteria 5454
170 Ga0068867_100016665 3300005459 Bacteria 5219
171 Ga0068867_100150717 3300005459 Bacteria 1826
172 Ga0070685_10016650 3300005466 Unclassified 3921
173 Ga0070685_10018581 3300005466 Bacteria 3740
174 Ga0070685_10027573 3300005466 Bacteria 3141
175 Ga0070685_10032207 3300005466 Bacteria 2935
176 Ga0070685_10126557 3300005466 Bacteria 1592
177 Ga0070698_100006358 3300005471 Bacteria 12830
178 Ga0070698_100017780 3300005471 Bacteria 7488
179 Ga0070698_100027882 3300005471 Bacteria 5867
180 Ga0070679_100000216 3300005530 Bacteria 46886
181 Ga0070679_100002882 3300005530 Bacteria 15627
182 Ga0070679_100026094 3300005530 Bacteria 5736
183 Ga0070679_100038338 3300005530 Bacteria 4763
184 Ga0070679_100056098 3300005530 Bacteria 3924
185 Ga0070679_100163284 3300005530 Bacteria 2201
186 Ga0070679_100171712 3300005530 Bacteria 2141
187 Ga0070679_100233018 3300005530 Bacteria 1801
188 Ga0070679_100354035 3300005530 Bacteria 1416
189 Ga0070684_100000105 3300005535 Bacteria 54272
190 Ga0070684_100004644 3300005535 Bacteria 10480
191 Ga0070684_100010934 3300005535 Bacteria 7213
192 Ga0070684_100031540 3300005535 Unclassified 4512
193 Ga0068853_100003177 3300005539 Bacteria 12555
194 Ga0068853_100003898 3300005539 Bacteria 11435
195 Ga0068853_100025442 3300005539 Bacteria 4967
196 Ga0068853_100079728 3300005539 Bacteria 2863
197 Ga0068853_100109535 3300005539 Bacteria 2451
198 Ga0068853_100117561 3300005539 Unclassified 2368
199 Ga0068853_100184767 3300005539 Bacteria 1892
200 Ga0068853_100313543 3300005539 Bacteria 1453
201 Ga0070672_100000002 3300005543 Bacteria 159809
202 Ga0070672_100022551 3300005543 Bacteria 4627
203 Ga0070672_100059364 3300005543 Bacteria 3009
204 Ga0070672_100218899 3300005543 Unclassified 1596
205 Ga0070672_100287476 3300005543 Bacteria 1391
206 Ga0070686_100011399 3300005544 Bacteria 5042
207 Ga0070693_100117870 3300005547 Unclassified 1643
208 Ga0070665_100000014 3300005548 Bacteria 484881
209 Ga0070665_100002900 3300005548 Bacteria 18521
210 Ga0070665_100005140 3300005548 Bacteria 13552
211 Ga0070665_100233197 3300005548 Bacteria 1841
212 Ga0070665_100443516 3300005548 Bacteria 1307
213 Ga0068855_100000189 3300005563 Bacteria 79227
214 Ga0068855_100006230 3300005563 Bacteria 14539
215 Ga0068855_100006503 3300005563 Bacteria 14208
216 Ga0068855_100011315 3300005563 Bacteria 10775
217 Ga0068855_100026647 3300005563 Bacteria 6916
218 Ga0068855_100036601 3300005563 Bacteria 5840
219 Ga0068855_100064228 3300005563 Bacteria 4281
220 Ga0068855_100084962 3300005563 Bacteria 3663
221 Ga0068855_100122489 3300005563 Bacteria 2975
222 Ga0068855_100417914 3300005563 Bacteria 1467
223 Ga0070664_100000838 3300005564 Bacteria 23738
224 Ga0070664_100019311 3300005564 Bacteria 5607
225 Ga0070664_100053101 3300005564 Bacteria 3434
226 Ga0070664_100095816 3300005564 Bacteria 2574
227 Ga0070664_100245787 3300005564 Unclassified 1607
228 Ga0068857_100005990 3300005577 Bacteria 10383
229 Ga0068857_100010255 3300005577 Bacteria 8144
230 Ga0068857_100076991 3300005577 Bacteria 2975
231 Ga0068854_100035375 3300005578 Bacteria 3495
232 Ga0068854_100178680 3300005578 Bacteria 1657
233 Ga0068854_100224069 3300005578 Unclassified 1489
234 Ga0068856_100005092 3300005614 Bacteria 12994
235 Ga0068856_100053633 3300005614 Bacteria 3976
236 Ga0068856_100080993 3300005614 Bacteria 3221
237 Ga0068856_100087124 3300005614 Bacteria 3104
238 Ga0068852_100000460 3300005616 Bacteria 26906
239 Ga0068852_100000633 3300005616 Bacteria 22982
240 Ga0068852_100001918 3300005616 Bacteria 14168
241 Ga0068852_100018543 3300005616 Bacteria 5485
242 Ga0068852_100023625 3300005616 Unclassified 4951
243 Ga0068852_100108980 3300005616 Bacteria 2514
244 Ga0068852_100141541 3300005616 Bacteria 2227
245 Ga0068852_100461213 3300005616 Bacteria 1260
246 Ga0068859_100000025 3300005617 Bacteria 191679
247 Ga0068859_100000620 3300005617 Bacteria 35497
248 Ga0068859_100007242 3300005617 Bacteria 11253
249 Ga0068859_100022623 3300005617 Bacteria 6303
250 Ga0068859_100044096 3300005617 Unclassified 4482
251 Ga0068859_100061860 3300005617 Bacteria 3773
252 Ga0068859_100085924 3300005617 Unclassified 3191
253 Ga0068859_100174716 3300005617 Bacteria 2230
254 Ga0068859_100517289 3300005617 Unclassified 1288
255 Ga0068859_100522180 3300005617 Bacteria 1282
256 Ga0068859_100702117 3300005617 Bacteria 1102
257 Ga0068864_100008996 3300005618 Bacteria 8236
258 Ga0068864_100034999 3300005618 Bacteria 4274
259 Ga0068864_100135926 3300005618 Bacteria 2213
260 Ga0068864_100170277 3300005618 Bacteria 1985
261 Ga0068864_100256941 3300005618 Bacteria 1624
262 Ga0068866_10005900 3300005718 Bacteria 5090
263 Ga0068861_100003363 3300005719 Bacteria 10599
264 Ga0068861_100012731 3300005719 Bacteria 5871
265 Ga0068861_100021936 3300005719 Bacteria 4594
266 Ga0068861_100044425 3300005719 Unclassified 3341
267 Ga0068861_100267172 3300005719 Unclassified 1467
268 Ga0068861_100378531 3300005719 Bacteria 1250
269 Ga0068851_10002711 3300005834 Bacteria 7805
270 Ga0068851_10006509 3300005834 Bacteria 5333
271 Ga0068870_10006813 3300005840 Bacteria 5065
272 Ga0068870_10008538 3300005840 Bacteria 4613
273 Ga0068870_10112569 3300005840 Bacteria 1556
274 Ga0068863_100000828 3300005841 Bacteria 31036
275 Ga0068863_100003289 3300005841 Bacteria 15952
276 Ga0068863_100022535 3300005841 Bacteria 6014
277 Ga0068863_100040932 3300005841 Bacteria 4405
278 Ga0068863_100045188 3300005841 Bacteria 4180
279 Ga0068863_100046509 3300005841 Bacteria 4118
280 Ga0068863_100105018 3300005841 Bacteria 2687
281 Ga0068863_100114161 3300005841 Unclassified 2573
282 Ga0068863_100344777 3300005841 Unclassified 1450
283 Ga0068858_100000083 3300005842 Bacteria 98991
284 Ga0068858_100131898 3300005842 Bacteria 2343
285 Ga0068858_100175183 3300005842 Bacteria 2024
286 Ga0068858_100453753 3300005842 Unclassified 1235
287 Ga0068860_100000394 3300005843 Bacteria 57127
288 Ga0068860_100000759 3300005843 Bacteria 36404
289 Ga0068860_100002803 3300005843 Bacteria 18140
290 Ga0068860_100004639 3300005843 Bacteria 14035
291 Ga0068860_100004908 3300005843 Bacteria 13628
292 Ga0068860_100014242 3300005843 Bacteria 7797
293 Ga0068860_100014820 3300005843 Bacteria 7626
294 Ga0068860_100031932 3300005843 Bacteria 5062
295 Ga0068860_100169845 3300005843 Unclassified 2106
296 Ga0068860_100180768 3300005843 Bacteria 2038
297 Ga0068862_100003608 3300005844 Bacteria 13253
298 Ga0068862_100086852 3300005844 Bacteria 2720
299 Ga0068862_100208129 3300005844 Bacteria 1766
300 Ga0068862_100246178 3300005844 Bacteria 1628
301 Ga0068862_100452038 3300005844 Bacteria 1211
302 Ga0081540_1004387 3300005983 Bacteria 10781
303 Ga0081539_10000910 3300005985 Bacteria 55996
304 Ga0075366_10001639 3300006195 Bacteria 11231
305 Ga0075366_10050762 3300006195 Bacteria 2464
306 Ga0097621_100000359 3300006237 Bacteria 31567
307 Ga0097621_100005579 3300006237 Bacteria 8871
308 Ga0097621_100015918 3300006237 Bacteria 5672
309 Ga0097621_100019163 3300006237 Bacteria 5246
310 Ga0097621_100021087 3300006237 Bacteria 5032
311 Ga0097621_100033861 3300006237 Bacteria 4072
312 Ga0097621_100092867 3300006237 Unclassified 2528
313 Ga0097621_100143433 3300006237 Bacteria 2043
314 Ga0097621_100212062 3300006237 Bacteria 1685
315 Ga0068871_100000201 3300006358 Bacteria 41079
316 Ga0068871_100001167 3300006358 Bacteria 17651
317 Ga0068871_100004905 3300006358 Bacteria 9345
318 Ga0068871_100018659 3300006358 Bacteria 5279
319 Ga0068871_100054631 3300006358 Bacteria 3241
320 Ga0068871_100059310 3300006358 Bacteria 3118
321 Ga0068871_100138726 3300006358 Bacteria 2066
322 Ga0068871_100139452 3300006358 Bacteria 2061
323 Ga0068871_100183573 3300006358 Unclassified 1799
324 Ga0068871_100273614 3300006358 Bacteria 1476
325 Ga0075428_100013338 3300006844 Bacteria 9143
326 Ga0075428_100066083 3300006844 Unclassified 3960
327 Ga0075428_100279654 3300006844 Unclassified 1796
328 Ga0075434_100037661 3300006871 Bacteria 4788
329 Ga0075429_100000723 3300006880 Bacteria 25874
330 Ga0075429_100283270 3300006880 Bacteria 1451
331 Ga0068865_100012266 3300006881 Bacteria 5390
332 Ga0068865_100032670 3300006881 Bacteria 3479
333 Ga0097620_100000025 3300006931 Bacteria 191679
334 Ga0097620_100000620 3300006931 Bacteria 35497
335 Ga0097620_100007242 3300006931 Bacteria 11253
336 Ga0097620_100022623 3300006931 Bacteria 6303
337 Ga0097620_100044097 3300006931 Unclassified 4482
338 Ga0097620_100061856 3300006931 Bacteria 3773
339 Ga0097620_100085931 3300006931 Unclassified 3191
340 Ga0097620_100174708 3300006931 Bacteria 2230
341 Ga0097620_100355959 3300006931 Bacteria 1559
342 Ga0097620_100517284 3300006931 Unclassified 1288
343 Ga0097620_100522142 3300006931 Bacteria 1282
344 Ga0097620_100702122 3300006931 Bacteria 1102
345 Ga0105240_10001601 3300009093 Bacteria 38423
346 Ga0105240_10001632 3300009093 Bacteria 38064
347 Ga0105240_10012477 3300009093 Bacteria 11725
348 Ga0105240_10020065 3300009093 Bacteria 8922
349 Ga0105240_10025004 3300009093 Bacteria 7860
350 Ga0105240_10046229 3300009093 Bacteria 5517
351 Ga0105240_10049773 3300009093 Bacteria 5286
352 Ga0105240_10053431 3300009093 Bacteria 5070
353 Ga0105240_10104603 3300009093 Bacteria 3438
354 Ga0105240_10118854 3300009093 Bacteria 3185
355 Ga0111539_10013194 3300009094 Bacteria 10332
356 Ga0111539_10155954 3300009094 Bacteria 2672
357 Ga0111539_10250768 3300009094 Bacteria 2061
358 Ga0105245_10010477 3300009098 Bacteria 8070
359 Ga0105247_10000619 3300009101 Bacteria 28588
360 Ga0105247_10015174 3300009101 Unclassified 4619
361 Ga0105247_10053989 3300009101 Bacteria 2479
362 Ga0114129_10041957 3300009147 Bacteria 6442
363 Ga0105243_10133536 3300009148 Bacteria 2109
364 Ga0105241_10000252 3300009174 Bacteria 40539
365 Ga0105241_10001151 3300009174 Bacteria 20122
366 Ga0105241_10002136 3300009174 Bacteria 14943
367 Ga0105241_10019869 3300009174 Bacteria 4958
368 Ga0105241_10130995 3300009174 Bacteria 2030
369 Ga0105241_10226981 3300009174 Bacteria 1573
370 Ga0105241_10267408 3300009174 Unclassified 1455
371 Ga0105242_10041827 3300009176 Bacteria 3698
372 Ga0105242_10053818 3300009176 Bacteria 3288
373 Ga0105242_10106325 3300009176 Unclassified 2385
374 Ga0105242_10169223 3300009176 Bacteria 1919
375 Ga0105242_10229661 3300009176 Unclassified 1663
376 Ga0105248_10067765 3300009177 Unclassified 4007
377 Ga0105237_10000191 3300009545 Bacteria 87065
378 Ga0105237_10000938 3300009545 Bacteria 39240
379 Ga0105237_10002013 3300009545 Bacteria 25878
380 Ga0105237_10006188 3300009545 Bacteria 13363
381 Ga0105237_10019671 3300009545 Bacteria 6971
382 Ga0105237_10031026 3300009545 Bacteria 5421
383 Ga0105237_10095240 3300009545 Bacteria 2966
384 Ga0105238_10004065 3300009551 Bacteria 14503
385 Ga0105238_10023581 3300009551 Bacteria 6270
386 Ga0105238_10063610 3300009551 Bacteria 3690
387 Ga0105238_10606925 3300009551 Bacteria 1102
388 Ga0105249_10001096 3300009553 Bacteria 24070
389 Ga0105249_10001117 3300009553 Bacteria 23873
390 Ga0105249_10001306 3300009553 Bacteria 21852
391 Ga0105249_10001445 3300009553 Bacteria 20795
392 Ga0105249_10003110 3300009553 Bacteria 14341
393 Ga0105249_10028284 3300009553 Bacteria 5060
394 Ga0105249_10060768 3300009553 Bacteria 3467
395 Ga0105249_10224511 3300009553 Bacteria 1850
396 Ga0105249_10492864 3300009553 Bacteria 1269
397 Ga0105239_10000019 3300010375 Bacteria 273836
398 Ga0105239_10006447 3300010375 Bacteria 13611
399 Ga0105239_10006468 3300010375 Bacteria 13590
400 Ga0105239_10009941 3300010375 Bacteria 10682
401 Ga0105239_10012772 3300010375 Bacteria 9343
402 Ga0105239_10013262 3300010375 Bacteria 9159
403 Ga0105239_10018690 3300010375 Bacteria 7656
404 Ga0105239_10095385 3300010375 Bacteria 3286
405 Ga0105239_10116749 3300010375 Unclassified 2962
406 Ga0105239_10441177 3300010375 Unclassified 1476
407 Ga0105246_10027988 3300011119 Bacteria 3700
408 Ga0105246_10175641 3300011119 Bacteria 1644
409 Ga0105246_10229745 3300011119 Bacteria 1460
410 Ga0157373_10028054 3300013100 Bacteria 4062
411 Ga0157373_10031265 3300013100 Unclassified 3832
412 Ga0157373_10037348 3300013100 Bacteria 3482
413 Ga0157373_10040205 3300013100 Bacteria 3347
414 Ga0157373_10058618 3300013100 Unclassified 2729
415 Ga0157373_10110478 3300013100 Bacteria 1933
416 Ga0157371_10000518 3300013102 Bacteria 46197
417 Ga0157371_10000650 3300013102 Bacteria 41165
418 Ga0157371_10000898 3300013102 Bacteria 33500
419 Ga0157371_10001280 3300013102 Bacteria 26535
420 Ga0157371_10008105 3300013102 Bacteria 8395
421 Ga0157371_10076478 3300013102 Bacteria 2370
422 Ga0157370_10000313 3300013104 Bacteria 60838
423 Ga0157370_10000478 3300013104 Bacteria 49942
424 Ga0157370_10006366 3300013104 Bacteria 13032
425 Ga0157370_10010610 3300013104 Bacteria 9697
426 Ga0157370_10013171 3300013104 Bacteria 8529
427 Ga0157370_10077626 3300013104 Bacteria 3128
428 Ga0157370_10082916 3300013104 Bacteria 3015
429 Ga0157369_10015979 3300013105 Bacteria 8446
430 Ga0157369_10018825 3300013105 Bacteria 7738
431 Ga0157369_10032914 3300013105 Bacteria 5697
432 Ga0157369_10058404 3300013105 Bacteria 4162
433 Ga0157369_10064658 3300013105 Bacteria 3939
434 Ga0157369_10117277 3300013105 Bacteria 2826
435 Ga0157369_10159290 3300013105 Unclassified 2383
436 Ga0157369_10208073 3300013105 Unclassified 2051
437 Ga0157374_10000011 3300013296 Bacteria 466749
438 Ga0157374_10004455 3300013296 Bacteria 11760
439 Ga0157374_10009692 3300013296 Bacteria 8270
440 Ga0157374_10027330 3300013296 Bacteria 5144
441 Ga0157374_10050543 3300013296 Bacteria 3865
442 Ga0157374_10203631 3300013296 Bacteria 1938
443 Ga0157378_10001083 3300013297 Bacteria 24880
444 Ga0157378_10003875 3300013297 Bacteria 13240
445 Ga0157378_10030526 3300013297 Bacteria 4763
446 Ga0157378_10061615 3300013297 Bacteria 3349
447 Ga0157378_10066657 3300013297 Unclassified 3225
448 Ga0157378_10068698 3300013297 Unclassified 3178
449 Ga0157378_10123419 3300013297 Bacteria 2390
450 Ga0163162_10000029 3300013306 Bacteria 168510
451 Ga0163162_10000424 3300013306 Bacteria 38989
452 Ga0163162_10000672 3300013306 Bacteria 31760
453 Ga0163162_10001000 3300013306 Bacteria 26251
454 Ga0163162_10007147 3300013306 Bacteria 10837
455 Ga0163162_10026603 3300013306 Bacteria 5719
456 Ga0163162_10029016 3300013306 Bacteria 5475
457 Ga0163162_10075172 3300013306 Bacteria 3438
458 Ga0163162_10126262 3300013306 Bacteria 2664
459 Ga0163162_10133118 3300013306 Bacteria 2596
460 Ga0163162_10157845 3300013306 Bacteria 2389
461 Ga0163162_10168474 3300013306 Bacteria 2314
462 Ga0163162_10271550 3300013306 Unclassified 1827
463 Ga0163162_10342106 3300013306 Bacteria 1628
464 Ga0163162_10412930 3300013306 Unclassified 1482
465 Ga0163162_10413788 3300013306 Bacteria 1480
466 Ga0163162_10426492 3300013306 Bacteria 1458
467 Ga0163162_10465489 3300013306 Bacteria 1396
468 Ga0157372_10001585 3300013307 Bacteria 24755
469 Ga0157372_10012413 3300013307 Bacteria 9079
470 Ga0157372_10017506 3300013307 Bacteria 7690
471 Ga0157372_10021759 3300013307 Bacteria 6931
472 Ga0157372_10023200 3300013307 Bacteria 6724
473 Ga0157372_10052578 3300013307 Bacteria 4537
474 Ga0157372_10054702 3300013307 Bacteria 4454
475 Ga0157372_10092224 3300013307 Bacteria 3446
476 Ga0157372_10107026 3300013307 Bacteria 3199
477 Ga0157372_10137536 3300013307 Bacteria 2814
478 Ga0157372_10167152 3300013307 Bacteria 2544
479 Ga0157372_10303899 3300013307 Bacteria 1856
480 Ga0157372_10304701 3300013307 Bacteria 1853
481 Ga0157372_10652283 3300013307 Bacteria 1226
482 Ga0157372_10691182 3300013307 Bacteria 1187
483 Ga0157375_10000042 3300013308 Bacteria 160008
484 Ga0157375_10002200 3300013308 Bacteria 16851
485 Ga0157375_10011363 3300013308 Bacteria 7860
486 Ga0157375_10012413 3300013308 Bacteria 7557
487 Ga0157375_10038591 3300013308 Bacteria 4586
488 Ga0157375_10043524 3300013308 Bacteria 4355
489 Ga0157375_10100779 3300013308 Bacteria 2969
490 Ga0157375_10117350 3300013308 Unclassified 2766
491 Ga0157375_10147379 3300013308 Bacteria 2485
492 Ga0157375_10157851 3300013308 Bacteria 2408
493 Ga0157375_10454185 3300013308 Bacteria 1447
494 Ga0163163_10000076 3300014325 Bacteria 108784
495 Ga0163163_10000831 3300014325 Bacteria 26270
496 Ga0163163_10001057 3300014325 Bacteria 23356
497 Ga0163163_10015513 3300014325 Bacteria 7045
498 Ga0163163_10076823 3300014325 Bacteria 3335
499 Ga0163163_10099343 3300014325 Bacteria 2932
500 Ga0163163_10109623 3300014325 Bacteria 2788
501 Ga0163163_10160777 3300014325 Unclassified 2291
502 Ga0163163_10197237 3300014325 Bacteria 2061
503 Ga0163163_10220755 3300014325 Bacteria 1944
504 Ga0163163_10284532 3300014325 Bacteria 1705
505 Ga0163163_10432213 3300014325 Bacteria 1376
506 Ga0163163_10609346 3300014325 Unclassified 1155
507 Ga0157380_10001454 3300014326 Bacteria 15501
508 Ga0157380_10003690 3300014326 Bacteria 10535
509 Ga0157380_10007843 3300014326 Bacteria 7600
510 Ga0157380_10040123 3300014326 Bacteria 3644
511 Ga0157380_10126199 3300014326 Bacteria 2175
512 Ga0157377_10022605 3300014745 Bacteria 3323
513 Ga0157377_10023737 3300014745 Bacteria 3254
514 Ga0157377_10031442 3300014745 Bacteria 2884
515 Ga0157377_10118187 3300014745 Unclassified 1603
516 Ga0157377_10163313 3300014745 Bacteria 1387
517 Ga0157379_10000016 3300014968 Bacteria 103230
518 Ga0157379_10016392 3300014968 Bacteria 6517
519 Ga0157379_10037080 3300014968 Bacteria 4347
520 Ga0157379_10077651 3300014968 Unclassified 2973
521 Ga0157379_10087394 3300014968 Bacteria 2795
522 Ga0157379_10421162 3300014968 Bacteria 1230
523 Ga0157376_10000558 3300014969 Bacteria 23999
524 Ga0157376_10000938 3300014969 Bacteria 18935
525 Ga0157376_10002924 3300014969 Bacteria 11719
526 Ga0157376_10010684 3300014969 Bacteria 6730
527 Ga0157376_10011063 3300014969 Bacteria 6635
528 Ga0157376_10035769 3300014969 Bacteria 4018
529 Ga0157376_10256115 3300014969 Bacteria 1637
530 Ga0182005_1000161 3300015265 Bacteria 46308
531 Ga0163161_10003336 3300017792 Bacteria 11258
532 Ga0163161_10024726 3300017792 Bacteria 4245
533 Ga0163161_10040821 3300017792 Unclassified 3333
534 Ga0213876_10005918 3300021384 Bacteria 6681
535 Ga0213876_10010752 3300021384 Bacteria 4904
536 Ga0209436_100742 3300025208 Bacteria 13611
537 Ga0209258_100032 3300025242 Bacteria 452764
538 Ga0209646_1000004 3300025246 Bacteria 786587
539 Ga0209026_1000156 3300025250 Bacteria 107193
540 Ga0209148_1000339 3300025254 Bacteria 62786
541 Ga0209673_1000258 3300025273 Bacteria 100207
542 Ga0209130_1001880 3300025284 Bacteria 11950
543 Ga0209758_1007402 3300025297 Bacteria 7492
544 Ga0209050_1000097 3300025298 Bacteria 239919
545 Ga0207426_1000033 3300025302 Bacteria 455976
546 Ga0207426_1000059 3300025302 Bacteria 363842
547 Ga0207426_1000321 3300025302 Bacteria 92019
548 Ga0207426_1000472 3300025302 Bacteria 61715
549 Ga0209257_1000070 3300025304 Bacteria 336454
550 Ga0209257_1005191 3300025304 Bacteria 9366
551 Ga0207656_10000821 3300025321 Bacteria 10125
552 Ga0207656_10022275 3300025321 Bacteria 2540
553 Ga0207656_10027719 3300025321 Bacteria 2319
554 Ga0207682_10030613 3300025893 Bacteria 2156
555 Ga0207642_10081862 3300025899 Bacteria 1570
556 Ga0207710_10004843 3300025900 Bacteria 5838
557 Ga0207680_10000086 3300025903 Bacteria 42622
558 Ga0207680_10014877 3300025903 Unclassified 4044
559 Ga0207680_10053067 3300025903 Unclassified 2432
560 Ga0207680_10093486 3300025903 Bacteria 1918
561 Ga0207680_10166621 3300025903 Bacteria 1481
562 Ga0207647_10000096 3300025904 Bacteria 67468
563 Ga0207647_10009352 3300025904 Bacteria 6965
564 Ga0207647_10028428 3300025904 Bacteria 3631
565 Ga0207645_10002123 3300025907 Bacteria 15868
566 Ga0207645_10012288 3300025907 Bacteria 5814
567 Ga0207645_10014367 3300025907 Bacteria 5299
568 Ga0207645_10033610 3300025907 Bacteria 3295
569 Ga0207645_10045869 3300025907 Unclassified 2792
570 Ga0207645_10064822 3300025907 Bacteria 2334
571 Ga0207643_10009004 3300025908 Bacteria 5360
572 Ga0207643_10013248 3300025908 Bacteria 4463
573 Ga0207705_10002045 3300025909 Bacteria 15697
574 Ga0207705_10006383 3300025909 Bacteria 8744
575 Ga0207705_10033756 3300025909 Bacteria 3656
576 Ga0207654_10006725 3300025911 Bacteria 5780
577 Ga0207654_10018640 3300025911 Bacteria 3646
578 Ga0207654_10038316 3300025911 Bacteria 2689
579 Ga0207654_10046622 3300025911 Bacteria 2472
580 Ga0207654_10123445 3300025911 Unclassified 1629
581 Ga0207707_10126078 3300025912 Unclassified 2239
582 Ga0207707_10135962 3300025912 Unclassified 2149
583 Ga0207707_10143837 3300025912 Bacteria 2084
584 Ga0207695_10000212 3300025913 Bacteria 156450
585 Ga0207695_10001109 3300025913 Bacteria 46822
586 Ga0207695_10001387 3300025913 Bacteria 40927
587 Ga0207695_10001527 3300025913 Bacteria 38268
588 Ga0207695_10011310 3300025913 Bacteria 10819
589 Ga0207695_10075830 3300025913 Bacteria 3420
590 Ga0207695_10113737 3300025913 Bacteria 2682
591 Ga0207695_10140779 3300025913 Unclassified 2361
592 Ga0207695_10144647 3300025913 Bacteria 2323
593 Ga0207695_10165680 3300025913 Bacteria 2138
594 Ga0207671_10001331 3300025914 Bacteria 28876
595 Ga0207671_10001357 3300025914 Bacteria 28586
596 Ga0207671_10003705 3300025914 Bacteria 15062
597 Ga0207671_10011884 3300025914 Bacteria 7042
598 Ga0207660_10002218 3300025917 Bacteria 12857
599 Ga0207660_10002449 3300025917 Bacteria 12187
600 Ga0207660_10153271 3300025917 Bacteria 1772
601 Ga0207660_10287939 3300025917 Bacteria 1305
602 Ga0207662_10005744 3300025918 Bacteria 6640
603 Ga0207657_10000893 3300025919 Bacteria 31577
604 Ga0207657_10113061 3300025919 Unclassified 2240
605 Ga0207657_10148949 3300025919 Unclassified 1907
606 Ga0207657_10244120 3300025919 Bacteria 1433
607 Ga0207657_10274909 3300025919 Bacteria 1338
608 Ga0207649_10000517 3300025920 Bacteria 27099
609 Ga0207649_10075233 3300025920 Bacteria 2170
610 Ga0207649_10128467 3300025920 Bacteria 1718
611 Ga0207652_10000090 3300025921 Bacteria 99245
612 Ga0207652_10000999 3300025921 Bacteria 26089
613 Ga0207652_10001591 3300025921 Bacteria 19987
614 Ga0207652_10008720 3300025921 Bacteria 8161
615 Ga0207652_10011840 3300025921 Bacteria 7036
616 Ga0207652_10038291 3300025921 Bacteria 4064
617 Ga0207652_10059552 3300025921 Bacteria 3292
618 Ga0207652_10097104 3300025921 Bacteria 2596
619 Ga0207652_10193882 3300025921 Bacteria 1827
620 Ga0207694_10254215 3300025924 Bacteria 1438
621 Ga0207694_10268334 3300025924 Unclassified 1399
622 Ga0207650_10001946 3300025925 Bacteria 14530
623 Ga0207650_10049132 3300025925 Bacteria 3113
624 Ga0207650_10054046 3300025925 Bacteria 2978
625 Ga0207650_10089489 3300025925 Bacteria 2349
626 Ga0207650_10115912 3300025925 Bacteria 2080
627 Ga0207650_10175068 3300025925 Bacteria 1707
628 Ga0207650_10197267 3300025925 Unclassified 1611
629 Ga0207659_10020402 3300025926 Bacteria 4380
630 Ga0207659_10022314 3300025926 Bacteria 4213
631 Ga0207659_10056682 3300025926 Bacteria 2807
632 Ga0207659_10069850 3300025926 Bacteria 2560
633 Ga0207659_10101043 3300025926 Bacteria 2174
634 Ga0207659_10115225 3300025926 Unclassified 2050
635 Ga0207659_10346531 3300025926 Bacteria 1231
636 Ga0207687_10077510 3300025927 Bacteria 2390
637 Ga0207644_10014077 3300025931 Bacteria 5349
638 Ga0207644_10066397 3300025931 Bacteria 2627
639 Ga0207644_10234941 3300025931 Bacteria 1458
640 Ga0207644_10288278 3300025931 Unclassified 1320
641 Ga0207644_10382775 3300025931 Bacteria 1148
642 Ga0207690_10010864 3300025932 Bacteria 5425
643 Ga0207690_10024157 3300025932 Bacteria 3803
644 Ga0207690_10029625 3300025932 Bacteria 3483
645 Ga0207690_10032465 3300025932 Bacteria 3350
646 Ga0207690_10100317 3300025932 Bacteria 2066
647 Ga0207706_10000957 3300025933 Bacteria 29536
648 Ga0207706_10008919 3300025933 Bacteria 9232
649 Ga0207706_10086069 3300025933 Bacteria 2763
650 Ga0207686_10011437 3300025934 Bacteria 4860
651 Ga0207686_10058469 3300025934 Bacteria 2431
652 Ga0207686_10130358 3300025934 Bacteria 1724
653 Ga0207686_10198984 3300025934 Unclassified 1434
654 Ga0207670_10146506 3300025936 Bacteria 1747
655 Ga0207670_10177418 3300025936 Bacteria 1602
656 Ga0207670_10315732 3300025936 Unclassified 1228
657 Ga0207669_10008011 3300025937 Bacteria 4936
658 Ga0207704_10053403 3300025938 Unclassified 2456
659 Ga0207704_10106756 3300025938 Bacteria 1882
660 Ga0207704_10111584 3300025938 Bacteria 1850
661 Ga0207704_10116052 3300025938 Bacteria 1821
662 Ga0207704_10229414 3300025938 Bacteria 1380
663 Ga0207691_10000004 3300025940 Bacteria 168729
664 Ga0207691_10026490 3300025940 Bacteria 5439
665 Ga0207691_10045858 3300025940 Bacteria 4018
666 Ga0207691_10094120 3300025940 Bacteria 2681
667 Ga0207691_10129252 3300025940 Bacteria 2232
668 Ga0207691_10133024 3300025940 Unclassified 2196
669 Ga0207691_10140802 3300025940 Bacteria 2126
670 Ga0207711_10224042 3300025941 Unclassified 1721
671 Ga0207689_10000208 3300025942 Bacteria 51706
672 Ga0207689_10002065 3300025942 Bacteria 18954
673 Ga0207689_10002750 3300025942 Bacteria 16259
674 Ga0207689_10008548 3300025942 Bacteria 8924
675 Ga0207689_10029255 3300025942 Bacteria 4602
676 Ga0207689_10032175 3300025942 Bacteria 4363
677 Ga0207689_10053043 3300025942 Bacteria 3340
678 Ga0207689_10062503 3300025942 Bacteria 3062
679 Ga0207689_10275819 3300025942 Bacteria 1392
680 Ga0207661_10001812 3300025944 Bacteria 14604
681 Ga0207661_10049528 3300025944 Bacteria 3344
682 Ga0207661_10051748 3300025944 Bacteria 3278
683 Ga0207679_10000091 3300025945 Bacteria 78725
684 Ga0207679_10038824 3300025945 Bacteria 3396
685 Ga0207667_10000414 3300025949 Bacteria 57815
686 Ga0207667_10000492 3300025949 Bacteria 52207
687 Ga0207667_10002948 3300025949 Bacteria 21118
688 Ga0207667_10003621 3300025949 Bacteria 19066
689 Ga0207667_10008497 3300025949 Bacteria 12190
690 Ga0207667_10013252 3300025949 Bacteria 9449
691 Ga0207667_10024439 3300025949 Bacteria 6634
692 Ga0207651_10004794 3300025960 Bacteria 6880
693 Ga0207651_10009976 3300025960 Bacteria 5235
694 Ga0207651_10024166 3300025960 Unclassified 3754
695 Ga0207651_10053609 3300025960 Bacteria 2758
696 Ga0207651_10063786 3300025960 Unclassified 2575
697 Ga0207651_10072179 3300025960 Bacteria 2450
698 Ga0207651_10092415 3300025960 Bacteria 2219
699 Ga0207651_10106291 3300025960 Unclassified 2095
700 Ga0207651_10200560 3300025960 Unclassified 1599
701 Ga0207712_10000725 3300025961 Bacteria 25158
702 Ga0207712_10000915 3300025961 Bacteria 21389
703 Ga0207712_10001923 3300025961 Bacteria 13655
704 Ga0207712_10005612 3300025961 Bacteria 7913
705 Ga0207712_10016389 3300025961 Bacteria 4797
706 Ga0207712_10040250 3300025961 Bacteria 3206
707 Ga0207712_10102517 3300025961 Bacteria 2130
708 Ga0207668_10001031 3300025972 Bacteria 16624
709 Ga0207640_10026559 3300025981 Bacteria 3517
710 Ga0207640_10097792 3300025981 Bacteria 2050
711 Ga0207640_10188072 3300025981 Bacteria 1554
712 Ga0207658_10001793 3300025986 Bacteria 16085
713 Ga0207658_10023217 3300025986 Bacteria 4327
714 Ga0207658_10049019 3300025986 Bacteria 3101
715 Ga0207677_10071596 3300026023 Bacteria 2447
716 Ga0207677_10104052 3300026023 Bacteria 2097
717 Ga0207677_10209907 3300026023 Bacteria 1554
718 Ga0207677_10224246 3300026023 Bacteria 1509
719 Ga0207703_10002453 3300026035 Bacteria 16080
720 Ga0207703_10003536 3300026035 Bacteria 13074
721 Ga0207703_10496832 3300026035 Unclassified 1145
722 Ga0207703_10524140 3300026035 Unclassified 1115
723 Ga0207639_10004779 3300026041 Bacteria 9134
724 Ga0207639_10017252 3300026041 Bacteria 5118
725 Ga0207639_10017338 3300026041 Bacteria 5105
726 Ga0207639_10018922 3300026041 Unclassified 4903
727 Ga0207639_10074162 3300026041 Bacteria 2671
728 Ga0207678_10004101 3300026067 Bacteria 13100
729 Ga0207678_10143913 3300026067 Bacteria 2035
730 Ga0207678_10164869 3300026067 Bacteria 1892
731 Ga0207708_10211128 3300026075 Bacteria 1552
732 Ga0207702_10093485 3300026078 Bacteria 2637
733 Ga0207702_10174654 3300026078 Bacteria 1973
734 Ga0207641_10000132 3300026088 Bacteria 109247
735 Ga0207641_10002004 3300026088 Bacteria 19426
736 Ga0207641_10005148 3300026088 Bacteria 11192
737 Ga0207641_10030371 3300026088 Bacteria 4476
738 Ga0207641_10039756 3300026088 Bacteria 3935
739 Ga0207641_10114190 3300026088 Bacteria 2399
740 Ga0207641_10125353 3300026088 Bacteria 2298
741 Ga0207648_10001340 3300026089 Bacteria 27318
742 Ga0207648_10001507 3300026089 Bacteria 25668
743 Ga0207648_10003198 3300026089 Bacteria 17248
744 Ga0207648_10023065 3300026089 Bacteria 5582
745 Ga0207648_10028580 3300026089 Bacteria 4943
746 Ga0207648_10059000 3300026089 Bacteria 3346
747 Ga0207648_10175954 3300026089 Bacteria 1893
748 Ga0207648_10227889 3300026089 Bacteria 1657
749 Ga0207676_10006520 3300026095 Bacteria 8251
750 Ga0207676_10021806 3300026095 Bacteria 4704
751 Ga0207676_10050031 3300026095 Bacteria 3255
752 Ga0207676_10270325 3300026095 Unclassified 1539
753 Ga0207676_10271133 3300026095 Bacteria 1537
754 Ga0207676_10521696 3300026095 Bacteria 1131
755 Ga0207674_10006827 3300026116 Bacteria 13386
756 Ga0207674_10006954 3300026116 Bacteria 13246
757 Ga0207674_10011869 3300026116 Bacteria 9767
758 Ga0207674_10020844 3300026116 Bacteria 7074
759 Ga0207674_10037247 3300026116 Bacteria 5061
760 Ga0207674_10081190 3300026116 Bacteria 3244
761 Ga0207674_10084698 3300026116 Bacteria 3167
762 Ga0207674_10096318 3300026116 Unclassified 2944
763 Ga0207674_10201198 3300026116 Bacteria 1941
764 Ga0207674_10211388 3300026116 Bacteria 1889
765 Ga0207675_100003521 3300026118 Bacteria 15283
766 Ga0207675_100012750 3300026118 Bacteria 7853
767 Ga0207675_100013899 3300026118 Bacteria 7505
768 Ga0207675_100020709 3300026118 Bacteria 6132
769 Ga0207675_100022252 3300026118 Bacteria 5903
770 Ga0207675_100048083 3300026118 Bacteria 3982
771 Ga0207675_100055083 3300026118 Bacteria 3710
772 Ga0207675_100330590 3300026118 Unclassified 1490
773 Ga0207683_10002163 3300026121 Bacteria 17263
774 Ga0207683_10045450 3300026121 Bacteria 3840
775 Ga0207683_10049536 3300026121 Unclassified 3678
776 Ga0207683_10067112 3300026121 Unclassified 3164
777 Ga0207683_10204356 3300026121 Unclassified 1796
778 Ga0207683_10207800 3300026121 Bacteria 1781
779 Ga0207698_10000539 3300026142 Bacteria 21930
780 Ga0207698_10004422 3300026142 Bacteria 8564
781 Ga0207698_10013262 3300026142 Bacteria 5430
782 Ga0207698_10026361 3300026142 Bacteria 4111
783 Ga0207698_10045981 3300026142 Bacteria 3292
784 Ga0207698_10088594 3300026142 Unclassified 2525
785 Ga0207698_10200495 3300026142 Unclassified 1786
786 Ga0207698_10413125 3300026142 Bacteria 1293
787 Ga0268266_10000068 3300028379 Bacteria 241100
788 Ga0268266_10006637 3300028379 Bacteria 10558
789 Ga0268266_10103748 3300028379 Bacteria 2510
790 Ga0268265_10009330 3300028380 Bacteria 6631
791 Ga0268265_10066428 3300028380 Bacteria 2788
792 Ga0268265_10300965 3300028380 Bacteria 1444
793 Ga0268264_10000559 3300028381 Bacteria 45910
794 Ga0268264_10001420 3300028381 Bacteria 22404
795 Ga0268264_10006807 3300028381 Bacteria 9600
796 Ga0268264_10007210 3300028381 Bacteria 9313
797 Ga0268264_10012189 3300028381 Bacteria 7074
798 Ga0268264_10017234 3300028381 Bacteria 5917
799 Ga0268264_10024105 3300028381 Bacteria 4966
800 Ga0268264_10046883 3300028381 Bacteria 3592
801 Ga0268264_10337992 3300028381 Unclassified 1429
802 Ga0307515_10000001 3300028794 Bacteria 4259510
803 Ga0307515_10000437 3300028794 Bacteria 100047
804 Ga0265338_10175130 3300028800 Bacteria 1641
805 Ga0307511_10000211 3300030521 Bacteria 59246
806 Ga0265327_10000618 3300031251 Bacteria 58585
807 Ga0265327_10000948 3300031251 Bacteria 42114
808 Ga0307513_10043985 3300031456 Bacteria 4897
809 Ga0307509_10221350 3300031507 Bacteria 1705
810 Ga0307509_10256855 3300031507 Bacteria 1526
811 Ga0265313_10047862 3300031595 Bacteria 2067
812 Ga0307508_10014167 3300031616 Bacteria 7275
813 Ga0307410_10083320 3300031852 Bacteria 2252
814 Ga0307411_10086575 3300032005 Bacteria 2174
815 Ga0307510_10012921 3300033180 Bacteria 9910
816 Ga0373955_0072914 3300035172 Bacteria 1924
817 Ga0373933_0097376 3300035724 Bacteria 1822
818 Ga0373937_0269587 3300036401 Bacteria 1606
819 Ga0373925_0275674 3300037068 Bacteria 1354
820 Ga0395899_0034830 3300037312 Bacteria 3781
821 Ga0395900_0000927 3300037418 Bacteria 38470
822 Ga0395900_0032022 3300037418 Bacteria 5405
823 Ga0395898_0009829 3300037466 Bacteria 10028
824 Ga0395898_0313565 3300037466 Unclassified 1496
825 Ga0395905_0006214 3300037471 Bacteria 12056
826 Ga0395905_0095772 3300037471 Bacteria 2786
827 Ga0395901_0001347 3300038443 Bacteria 25756
828 Ga0395901_0010081 3300038443 Bacteria 9575
829 Ga0436365_0955601 3300039437 Bacteria 10627
830 Ga0436365_1743396 3300039437 Bacteria 55864
831 Ga0439436_0000350 3300041404 Bacteria 11404
832 Ga0439465_0031831 3300041413 Bacteria 1682
833 Ga0439431_0001588 3300041997 Bacteria 5033
834 Ga0439445_0024350 3300042004 Bacteria 1538
835 Ga0439445_0044106 3300042004 Bacteria 1191
836 Ga0439449_0011188 3300042007 Unclassified 3379
837 Ga0439449_0017050 3300042007 Bacteria 2726
838 Ga0439449_0041243 3300042007 Bacteria 1716
839 Ga0439457_000130 3300042014 Bacteria 18863
840 Ga0439457_003289 3300042014 Bacteria 4428
841 Ga0439462_0003152 3300042015 Bacteria 3929
842 Ga0451577_0005816 3300042876 Bacteria 12485
843 Ga0451577_0101352 3300042876 Unclassified 2573
844 Ga0466969_0000356 3300044656 Bacteria 25182
845 Ga0466969_0181316 3300044656 Bacteria 964
846 Ga0466972_0000047 3300044658 Bacteria 122901
847 Ga0466972_0029484 3300044658 Bacteria 2701
848 Ga0466966_0000038 3300044684 Bacteria 97255
849 Ga0466966_0087507 3300044684 Unclassified 1936
850 Ga0453684_0062022 3300044712 Bacteria 4793
851 Ga0453684_0157438 3300044712 Unclassified 2691
852 Ga0453684_0366909 3300044712 Bacteria 1620
853 Ga0466968_0016485 3300044735 Bacteria 2943
854 Ga0466968_0109329 3300044735 Bacteria 1242
855 Ga0466970_0029085 3300044765 Bacteria 2907
856 Ga0466957_0000329 3300044842 Bacteria 23093
857 Ga0466957_0000739 3300044842 Bacteria 16704
858 Ga0466960_0066308 3300044901 Bacteria 1785
859 Ga0466959_0000289 3300045049 Bacteria 30468
860 Ga0466959_0005476 3300045049 Bacteria 8699
861 Ga0466958_0017362 3300045836 Bacteria 4158
862 Ga0466967_0345757 3300045976 Bacteria 1439
863 Ga0495627_019616 3300046453 Bacteria 2264
864 Ga0495592_0036614 3300046454 Bacteria 3695
865 Ga0495629_0013899 3300046459 Bacteria 5805
866 Ga0495638_0016015 3300046460 Bacteria 5025
867 Ga0495638_0184904 3300046460 Bacteria 1186
868 Ga0495580_0107056 3300046472 Unclassified 1942
869 Ga0495606_0012540 3300046507 Bacteria 6789
870 Ga0495608_0064405 3300046511 Bacteria 2403
871 Ga0495628_0112500 3300046516 Bacteria 2093
872 Ga0495630_0140484 3300046517 Bacteria 1836
873 Ga0495630_0261146 3300046517 Bacteria 1323
874 Ga0495648_0002523 3300046524 Bacteria 16787
875 Ga0495648_0085913 3300046524 Bacteria 1776
876 Ga0495640_0092171 3300046533 Unclassified 1999
877 Ga0495633_0000089 3300046558 Bacteria 123616
878 Ga0495668_0000257 3300046616 Bacteria 75166
879 Ga0495668_0000440 3300046616 Bacteria 53231
880 Ga0495611_0000174 3300046648 Bacteria 46643
881 Ga0495611_0008231 3300046648 Bacteria 4426
882 Ga0495658_0003870 3300046683 Bacteria 7410
883 Ga0495670_0113298 3300046691 Unclassified 1405
884 Ga0495670_0120811 3300046691 Bacteria 1361
885 Ga0495581_0071884 3300047315 Unclassified 2002
886 Ga0495604_0155900 3300047317 Unclassified 1618
887 Ga0495672_0008699 3300047320 Bacteria 7450
888 Ga0495687_000058 3300047443 Bacteria 185830
889 Ga0495675_0191494 3300047444 Bacteria 1248
890 Ga0495684_0156852 3300047471 Bacteria 1700
891 Ga0495686_0000005 3300047472 Bacteria 827143
892 Ga0495686_0051544 3300047472 Bacteria 2582
893 Ga0496100_0107490 3300048903 Bacteria 1933
894 Ga0496101_0009191 3300048904 Bacteria 6487
895 Ga0496106_0056974 3300048909 Bacteria 2955
896 Ga0496110_0132971 3300048913 Bacteria 2247
897 Ga0496111_0201891 3300048914 Bacteria 1478
898 Ga0496114_0000318 3300048917 Bacteria 35272
899 Ga0496114_0038907 3300048917 Unclassified 3936
900 Ga0496121_0000086 3300048924 Bacteria 223703
901 Ga0501297_005192 3300049520 Bacteria 1353
902 Ga0501298_000085 3300049521 Bacteria 10588
903 Ga0501031_0003151 3300049568 Bacteria 10580
904 Ga0501032_0188764 3300049569 Unclassified 1347
905 Ga0501033_0167316 3300049570 Bacteria 1580
906 Ga0501034_0000002 3300049571 Bacteria 565510
907 Ga0501034_0015223 3300049571 Bacteria 7905
908 Ga0501034_0019755 3300049571 Bacteria 6886
909 Ga0501034_0024144 3300049571 Bacteria 6184
910 Ga0501034_0024924 3300049571 Bacteria 6086
911 Ga0501034_0074987 3300049571 Bacteria 3390
912 Ga0501034_0198498 3300049571 Bacteria 1965
913 Ga0501034_0388457 3300049571 Bacteria 1320
914 Ga0501036_0046476 3300049572 Bacteria 3676
915 Ga0501036_0145405 3300049572 Bacteria 2000
916 Ga0501037_0007495 3300049573 Bacteria 7987
917 Ga0501038_0047620 3300049574 Bacteria 3713
918 Ga0501038_0057989 3300049574 Bacteria 3321
919 Ga0501038_0110638 3300049574 Bacteria 2276
920 Ga0501039_0042051 3300049575 Bacteria 3531
921 Ga0501039_0151510 3300049575 Unclassified 1821
922 Ga0501043_0001798 3300049579 Bacteria 18427
923 Ga0501043_0002152 3300049579 Bacteria 16797
924 Ga0501043_0016289 3300049579 Bacteria 5829
925 Ga0501043_0056650 3300049579 Bacteria 3079
926 Ga0501046_0041840 3300049580 Bacteria 3654
927 Ga0501046_0151332 3300049580 Unclassified 1750
928 Ga0501047_0032624 3300049581 Bacteria 5028
929 Ga0501047_0037183 3300049581 Bacteria 4707
930 Ga0501047_0041518 3300049581 Bacteria 4445
931 Ga0501047_0049748 3300049581 Bacteria 4047
932 Ga0501047_0109568 3300049581 Bacteria 2644
933 Ga0501047_0143303 3300049581 Bacteria 2267
934 Ga0501067_0015790 3300049583 Bacteria 4178
935 Ga0501070_0179530 3300049586 Bacteria 1743
936 Ga0501070_0248247 3300049586 Bacteria 1456
937 Ga0501070_0259217 3300049586 Bacteria 1421
938 Ga0501073_0035482 3300049589 Bacteria 3544
939 Ga0501074_0021945 3300049590 Bacteria 4636
940 Ga0501198_003936 3300049649 Bacteria 2051
941 Ga0501201_000236 3300049651 Bacteria 4954
942 Ga0501202_000452 3300049652 Bacteria 5817
943 Ga0501206_000782 3300049653 Bacteria 3896
944 Ga0501207_000054 3300049654 Bacteria 8472
945 Ga0501217_000181 3300049661 Bacteria 9260
946 Ga0501222_004155 3300049662 Bacteria 1965
947 Ga0501223_003113 3300049663 Bacteria 3625
948 Ga0501224_002202 3300049664 Bacteria 2646
949 Ga0501233_006861 3300049668 Bacteria 2152
950 Ga0501238_002085 3300049671 Bacteria 2357
951 Ga0501240_000840 3300049673 Bacteria 2753
952 Ga0501243_000876 3300049675 Bacteria 4203
953 Ga0501243_001810 3300049675 Unclassified 3096
954 Ga0501251_000740 3300049681 Bacteria 2952
955 Ga0501252_000530 3300049682 Bacteria 2976
956 Ga0501257_001703 3300049686 Bacteria 4584
957 Ga0501257_010256 3300049686 Bacteria 2124
958 Ga0501257_057999 3300049686 Bacteria 975
959 Ga0501259_000287 3300049688 Bacteria 7949
960 Ga0501259_001154 3300049688 Bacteria 4397
961 Ga0501261_000774 3300049690 Bacteria 3982
962 Ga0501219_000020 3300049703 Bacteria 25032
963 Ga0501221_000607 3300049704 Bacteria 5722
964 Ga0501225_0000285 3300049705 Bacteria 15805
965 Ga0501245_000238 3300049708 Bacteria 6264
966 Ga0501245_004007 3300049708 Unclassified 2014
967 Ga0501079_0008887 3300049741 Bacteria 7607
968 Ga0501079_0034323 3300049741 Bacteria 3904
969 Ga0501080_0039205 3300049742 Bacteria 4421
970 Ga0501080_0109537 3300049742 Unclassified 2560
971 Ga0501080_0276056 3300049742 Bacteria 1529
972 Ga0501083_0015447 3300049744 Bacteria 5347
973 Ga0501241_000145 3300049758 Bacteria 15844
974 Ga0501263_007663 3300049760 Bacteria 1274
975 Ga0501266_000837 3300049763 Bacteria 4023
976 Ga0501268_007668 3300049765 Bacteria 1615
977 Ga0501283_004516 3300049779 Bacteria 1885
978 Ga0501035_0023552 3300049822 Bacteria 5649
979 Ga0501035_0102713 3300049822 Bacteria 2508
980 Ga0501035_0132391 3300049822 Bacteria 2173
981 Ga0501044_0005008 3300049823 Bacteria 14790
982 Ga0501044_0016455 3300049823 Bacteria 7938
983 Ga0501044_0028917 3300049823 Bacteria 5846
984 Ga0501044_0031459 3300049823 Bacteria 5586
985 Ga0501044_0041171 3300049823 Bacteria 4810
986 Ga0501044_0124769 3300049823 Bacteria 2573
987 Ga0501044_0143970 3300049823 Bacteria 2370
988 Ga0501044_0149703 3300049823 Bacteria 2317
989 Ga0501044_0174341 3300049823 Bacteria 2120
990 Ga0501044_0472302 3300049823 Unclassified 1158
991 Ga0501284_00030 3300050005 Bacteria 71858
992 nmdc:mga0k408_103955_c1 3300050493 Bacteria 1676
993 nmdc:mga0k408_26438_c1 3300050493 Bacteria 2982
994 nmdc:mga0k408_9076_c1 3300050493 Bacteria 5352
995 nmdc:mga05p37_32575_c1 3300050507 Bacteria 6374
996 nmdc:mga09592_998_c1 3300050508 Bacteria 22420
997 nmdc:mga08y16_464500_c1 3300050511 Bacteria 1289
998 nmdc:mga08y16_5081_c1 3300050511 Bacteria 13754
999 nmdc:mga0n895_35785_c1 3300050512 Bacteria 4790
1000 Ga0500578_0000469 3300053086 Bacteria 49263
1001 Ga0500578_0123206 3300053086 Bacteria 1629
1002 Ga0500644_0000545 3300053088 Bacteria 15501
1003 Ga0500646_0003186 3300053090 Bacteria 4210
1004 Ga0500583_0000182 3300053092 Bacteria 25516
1005 Ga0500583_0000288 3300053092 Bacteria 17461
1006 Ga0500651_0093030 3300053093 Bacteria 1854
1007 Ga0500556_0002529 3300053104 Bacteria 5807
1008 Ga0500562_000005 3300053108 Bacteria 266746
1009 Ga0500569_001719 3300053109 Bacteria 4185
1010 Ga0500642_0002877 3300053130 Bacteria 5114
1011 Ga0500658_0001867 3300053134 Bacteria 8271
1012 Ga0500559_0044762 3300053136 Bacteria 1937
1013 Ga0500568_0000155 3300053139 Bacteria 59396
1014 Ga0500577_0001666 3300053142 Bacteria 5689
1015 Ga0500588_0002305 3300053146 Bacteria 3854
1016 Ga0500589_003476 3300053147 Bacteria 5674
1017 Ga0500616_0006051 3300053153 Bacteria 8028
1018 Ga0500616_0030216 3300053153 Bacteria 2977
1019 Ga0500616_0038528 3300053153 Bacteria 2581
1020 Ga0500622_0000150 3300053156 Bacteria 73468
1021 Ga0500622_0001399 3300053156 Bacteria 19440
1022 Ga0500622_0001705 3300053156 Bacteria 17048
1023 Ga0500622_0024966 3300053156 Bacteria 3159
1024 Ga0500627_0001050 3300053158 Bacteria 7524
1025 Ga0500633_0000426 3300053160 Bacteria 6600
1026 Ga0500636_0029952 3300053177 Bacteria 3217
1027 Ga0500636_0102165 3300053177 Bacteria 1629
1028 Ga0500637_0101020 3300053178 Unclassified 1673
1029 Ga0500611_000039 3300053727 Bacteria 68825
1030 Ga0501084_0019472 3300054114 Bacteria 5654
1031 Ga0500661_011461 3300055283 Bacteria 1603
1032 Ga0466962_0004394 3300061719 Bacteria 6761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049686 Ga0501257_057999 Ga0501257_057999_46_900 253
2 3300044656 Ga0466969_0181316 Ga0466969_0181316_48_911 254
3 3300009551 Ga0105238_10606925 Ga0105238_106069251 257
4 3300009093 Ga0105240_10104603 Ga0105240_101046033 263
5 3300013104 Ga0157370_10010610 Ga0157370_100106107 263
6 3300013105 Ga0157369_10058404 Ga0157369_100584044 263
7 3300013307 Ga0157372_10001585 Ga0157372_1000158512 263
8 3300013306 Ga0163162_10413788 Ga0163162_104137881 287
9 3300005471 Ga0070698_100006358 Ga0070698_1000063588 289
10 3300006844 Ga0075428_100066083 Ga0075428_1000660833 289
11 3300003761 Ga0055535_1001304 Ga0055535_10013044 290
12 3300025242 Ga0209258_100032 Ga0209258_100032290 290
13 3300025254 Ga0209148_1000339 Ga0209148_100033924 290
14 3300053153 Ga0500616_0038528 Ga0500616_0038528_1522_2496 291
15 3300005338 Ga0068868_100047437 Ga0068868_1000474372 296
16 3300005364 Ga0070673_100182317 Ga0070673_1001823172 296
17 3300005543 Ga0070672_100218899 Ga0070672_1002188992 296
18 3300014745 Ga0157377_10118187 Ga0157377_101181872 296
19 3300025926 Ga0207659_10115225 Ga0207659_101152252 296
20 3300025940 Ga0207691_10133024 Ga0207691_101330242 296
21 3300025960 Ga0207651_10200560 Ga0207651_102005602 296
22 3300049675 Ga0501243_001810 Ga0501243_001810_1734_2717 296
23 3300049682 Ga0501252_000530 Ga0501252_000530_1021_2004 296
24 3300049686 Ga0501257_010256 Ga0501257_010256_1037_2020 296
25 3300049688 Ga0501259_001154 Ga0501259_001154_3276_4259 296
26 3300049708 Ga0501245_004007 Ga0501245_004007_86_1069 296
27 3300049760 Ga0501263_007663 Ga0501263_007663_217_1200 296
28 3300049763 Ga0501266_000837 Ga0501266_000837_3015_3998 296
29 3300013102 Ga0157371_10008105 Ga0157371_100081056 297
30 3300013306 Ga0163162_10412930 Ga0163162_104129302 298
31 3300042876 Ga0451577_0005816 Ga0451577_0005816_853_1890 299
32 3300005366 Ga0070659_100040579 Ga0070659_1000405792 300
33 3300005530 Ga0070679_100171712 Ga0070679_1001717123 300
34 3300013100 Ga0157373_10028054 Ga0157373_100280542 300
35 3300013307 Ga0157372_10107026 Ga0157372_101070265 300
36 3300025919 Ga0207657_10274909 Ga0207657_102749091 300
37 3300025921 Ga0207652_10038291 Ga0207652_100382912 300
38 3300025932 Ga0207690_10024157 Ga0207690_100241572 300
39 3300026041 Ga0207639_10074162 Ga0207639_100741623 300
40 3300049649 Ga0501198_003936 Ga0501198_003936_1045_2040 300
41 3300049823 Ga0501044_0143970 Ga0501044_0143970_357_1379 300
42 3300050511 nmdc:mga08y16_464500_c1 nmdc:mga08y16_464500_c1_283_1278 300
43 3300005616 Ga0068852_100461213 Ga0068852_1004612131 303
44 iso_pu_bacteria 2818991444 2819589803 303
45 iso_pu_bacteria 2881955468 2881957943 303
46 iso_pu_bacteria 2929154850 2929160005 303
47 3300033180 Ga0307510_10012921 Ga0307510_100129211 304
48 3300042876 Ga0451577_0101352 Ga0451577_0101352_55_1143 305
49 3300044712 Ga0453684_0157438 Ga0453684_0157438_575_1663 305
50 3300001979 JGI24740J21852_10014041 JGI24740J21852_100140412 306
51 3300003203 JGI25406J46586_10004435 JGI25406J46586_100044351 306
52 3300003316 rootH1_10156821 rootH1_101568212 306
53 3300003322 rootL2_10030107 rootL2_100301073 306
54 3300003354 JGI25160J50197_1002148 JGI25160J50197_10021484 306
55 3300005327 Ga0070658_10140561 Ga0070658_101405612 306
56 3300005329 Ga0070683_100081819 Ga0070683_1000818192 306
57 3300005329 Ga0070683_100135703 Ga0070683_1001357032 306
58 3300005335 Ga0070666_10138650 Ga0070666_101386501 306
59 3300005336 Ga0070680_100063728 Ga0070680_1000637283 306
60 3300005337 Ga0070682_100047897 Ga0070682_1000478973 306
61 3300005339 Ga0070660_100008803 Ga0070660_1000088032 306
62 3300005344 Ga0070661_100004089 Ga0070661_1000040898 306
63 3300005354 Ga0070675_100059203 Ga0070675_1000592032 306
64 3300005355 Ga0070671_100169224 Ga0070671_1001692242 306
65 3300005364 Ga0070673_100085000 Ga0070673_1000850002 306
66 3300005366 Ga0070659_100102391 Ga0070659_1001023913 306
67 3300005457 Ga0070662_100048534 Ga0070662_1000485341 306
68 3300005458 Ga0070681_10122987 Ga0070681_101229872 306
69 3300005530 Ga0070679_100038338 Ga0070679_1000383382 306
70 3300005530 Ga0070679_100233018 Ga0070679_1002330181 306
71 3300005530 Ga0070679_100354035 Ga0070679_1003540351 306
72 3300005539 Ga0068853_100109535 Ga0068853_1001095353 306
73 3300005563 Ga0068855_100122489 Ga0068855_1001224894 306
74 3300005564 Ga0070664_100095816 Ga0070664_1000958162 306
75 3300005577 Ga0068857_100076991 Ga0068857_1000769914 306
76 3300005578 Ga0068854_100178680 Ga0068854_1001786802 306
77 3300005578 Ga0068854_100224069 Ga0068854_1002240692 306
78 3300005614 Ga0068856_100053633 Ga0068856_1000536335 306
79 3300005618 Ga0068864_100256941 Ga0068864_1002569412 306
80 3300005985 Ga0081539_10000910 Ga0081539_1000091012 306
81 3300006358 Ga0068871_100018659 Ga0068871_1000186596 306
82 3300006358 Ga0068871_100273614 Ga0068871_1002736143 306
83 3300010375 Ga0105239_10006468 Ga0105239_100064686 306
84 3300013100 Ga0157373_10110478 Ga0157373_101104782 306
85 3300013105 Ga0157369_10064658 Ga0157369_100646582 306
86 3300013105 Ga0157369_10117277 Ga0157369_101172773 306
87 3300013296 Ga0157374_10027330 Ga0157374_100273304 306
88 3300013297 Ga0157378_10030526 Ga0157378_100305262 306
89 3300013306 Ga0163162_10075172 Ga0163162_100751722 306
90 3300013306 Ga0163162_10271550 Ga0163162_102715502 306
91 3300013306 Ga0163162_10342106 Ga0163162_103421062 306
92 3300013307 Ga0157372_10017506 Ga0157372_100175063 306
93 3300013308 Ga0157375_10454185 Ga0157375_104541852 306
94 3300021384 Ga0213876_10010752 Ga0213876_100107522 306
95 3300025302 Ga0207426_1000059 Ga0207426_1000059113 306
96 3300025903 Ga0207680_10166621 Ga0207680_101666212 306
97 3300025912 Ga0207707_10143837 Ga0207707_101438372 306
98 3300025917 Ga0207660_10153271 Ga0207660_101532712 306
99 3300025919 Ga0207657_10000893 Ga0207657_1000089333 306
100 3300025921 Ga0207652_10097104 Ga0207652_100971042 306
101 3300025931 Ga0207644_10288278 Ga0207644_102882782 306
102 3300025932 Ga0207690_10032465 Ga0207690_100324652 306
103 3300025933 Ga0207706_10000957 Ga0207706_100009571 306
104 3300025938 Ga0207704_10229414 Ga0207704_102294141 306
105 3300025944 Ga0207661_10049528 Ga0207661_100495282 306
106 3300025981 Ga0207640_10188072 Ga0207640_101880721 306
107 3300026067 Ga0207678_10164869 Ga0207678_101648692 306
108 3300026078 Ga0207702_10174654 Ga0207702_101746542 306
109 3300026095 Ga0207676_10521696 Ga0207676_105216961 306
110 3300026116 Ga0207674_10081190 Ga0207674_100811901 306
111 3300026116 Ga0207674_10201198 Ga0207674_102011982 306
112 3300028800 Ga0265338_10175130 Ga0265338_101751302 306
113 3300031251 Ga0265327_10000618 Ga0265327_1000061852 306
114 3300039437 Ga0436365_0955601 Ga0436365_0955601_2609_3607 306
115 3300045976 Ga0466967_0345757 Ga0466967_0345757_326_1333 306
116 3300046524 Ga0495648_0085913 Ga0495648_0085913_665_1648 306
117 3300046648 Ga0495611_0000174 Ga0495611_0000174_32932_33915 306
118 3300049571 Ga0501034_0019755 Ga0501034_0019755_1091_2089 306
119 3300049581 Ga0501047_0109568 Ga0501047_0109568_878_1849 306
120 3300049586 Ga0501070_0248247 Ga0501070_0248247_77_1075 306
121 3300049823 Ga0501044_0124769 Ga0501044_0124769_437_1408 306
122 3300053108 Ga0500562_000005 Ga0500562_000005_200268_201278 306
123 3300053156 Ga0500622_0001705 Ga0500622_0001705_15502_16512 306
124 3300055283 Ga0500661_011461 Ga0500661_011461_458_1468 306
125 3300003316 rootH1_10143070 rootH1_101430703 307
126 3300003322 rootL2_10140353 rootL2_101403533 307
127 3300003323 rootH1_10159681 rootH1_101596812 307
128 3300014325 Ga0163163_10109623 Ga0163163_101096232 307
129 3300021384 Ga0213876_10005918 Ga0213876_100059183 307
130 3300039437 Ga0436365_1743396 Ga0436365_1743396_47290_48285 307
131 3300046507 Ga0495606_0012540 Ga0495606_0012540_2769_3755 307
132 3300046616 Ga0495668_0000440 Ga0495668_0000440_51930_52931 307
133 3300049571 Ga0501034_0015223 Ga0501034_0015223_6754_7752 307
134 3300049742 Ga0501080_0276056 Ga0501080_0276056_180_1178 307
135 3300049823 Ga0501044_0016455 Ga0501044_0016455_2890_3888 307
136 3300053104 Ga0500556_0002529 Ga0500556_0002529_1164_2165 307
137 3300053130 Ga0500642_0002877 Ga0500642_0002877_692_1693 307
138 3300053153 Ga0500616_0006051 Ga0500616_0006051_3904_4905 307
139 3300053158 Ga0500627_0001050 Ga0500627_0001050_5129_6130 307
140 3300013297 Ga0157378_10123419 Ga0157378_101234191 308
141 3300031251 Ga0265327_10000948 Ga0265327_100009483 308
142 3300048917 Ga0496114_0000318 Ga0496114_0000318_23193_24212 308
143 3300010375 Ga0105239_10095385 Ga0105239_100953852 309
144 3300053156 Ga0500622_0000150 Ga0500622_0000150_50194_51195 309
145 3300005329 Ga0070683_100002583 Ga0070683_1000025839 310
146 3300005535 Ga0070684_100031540 Ga0070684_1000315404 310
147 3300005563 Ga0068855_100006230 Ga0068855_1000062306 310
148 3300010375 Ga0105239_10018690 Ga0105239_100186904 310
149 3300013104 Ga0157370_10082916 Ga0157370_100829164 310
150 3300013105 Ga0157369_10159290 Ga0157369_101592902 310
151 3300013307 Ga0157372_10092224 Ga0157372_100922243 310
152 3300025904 Ga0207647_10028428 Ga0207647_100284282 310
153 3300025913 Ga0207695_10000212 Ga0207695_10000212119 310
154 3300025944 Ga0207661_10001812 Ga0207661_100018129 310
155 3300025949 Ga0207667_10000414 Ga0207667_1000041446 310
156 3300049520 Ga0501297_005192 Ga0501297_005192_112_1146 310
157 3300053109 Ga0500569_001719 Ga0500569_001719_2009_3013 310
158 3300053134 Ga0500658_0001867 Ga0500658_0001867_5813_6817 310
159 3300053142 Ga0500577_0001666 Ga0500577_0001666_1506_2510 310
160 3300053153 Ga0500616_0030216 Ga0500616_0030216_1357_2361 310
161 iso_pu_bacteria 2738541278 2738725858 310
162 3300013105 Ga0157369_10208073 Ga0157369_102080733 312
163 3300042007 Ga0439449_0011188 Ga0439449_0011188_458_1498 312
164 3300042014 Ga0439457_003289 Ga0439457_003289_416_1456 312
165 3300044735 Ga0466968_0109329 Ga0466968_0109329_54_1067 312
166 3300046459 Ga0495629_0013899 Ga0495629_0013899_3511_4560 312
167 3300046472 Ga0495580_0107056 Ga0495580_0107056_826_1875 312
168 3300046533 Ga0495640_0092171 Ga0495640_0092171_231_1280 312
169 3300046683 Ga0495658_0003870 Ga0495658_0003870_2772_3821 312
170 3300047315 Ga0495581_0071884 Ga0495581_0071884_600_1649 312
171 3300047317 Ga0495604_0155900 Ga0495604_0155900_72_1121 312
172 3300053727 Ga0500611_000039 Ga0500611_000039_51460_52497 312
173 iso_pu_bacteria 2821136567 2821140837 312
174 iso_pu_bacteria 2904467357 2904471339 312
175 iso_pu_bacteria 2929239360 2929240303 312
176 3300002459 JGI24751J29686_10000655 JGI24751J29686_100006555 313
177 3300003320 rootH2_10006582 rootH2_100065825 313
178 3300003320 rootH2_10022930 rootH2_1002293019 313
179 3300003322 rootL2_10031071 rootL2_100310714 313
180 3300003322 rootL2_10136943 rootL2_101369433 313
181 3300003322 rootL2_10210810 rootL2_102108102 313
182 3300005290 Ga0065712_10000981 Ga0065712_100009815 313
183 3300005290 Ga0065712_10008215 Ga0065712_100082153 313
184 3300005290 Ga0065712_10119802 Ga0065712_101198022 313
185 3300005293 Ga0065715_10092426 Ga0065715_100924265 313
186 3300005327 Ga0070658_10000832 Ga0070658_100008328 313
187 3300005328 Ga0070676_10001192 Ga0070676_100011924 313
188 3300005328 Ga0070676_10014551 Ga0070676_100145513 313
189 3300005328 Ga0070676_10020608 Ga0070676_100206082 313
190 3300005329 Ga0070683_100006473 Ga0070683_1000064736 313
191 3300005329 Ga0070683_100014557 Ga0070683_1000145573 313
192 3300005329 Ga0070683_100063547 Ga0070683_1000635473 313
193 3300005331 Ga0070670_100019919 Ga0070670_1000199194 313
194 3300005331 Ga0070670_100040716 Ga0070670_1000407163 313
195 3300005331 Ga0070670_100048124 Ga0070670_1000481242 313
196 3300005331 Ga0070670_100065603 Ga0070670_1000656033 313
197 3300005331 Ga0070670_100303798 Ga0070670_1003037982 313
198 3300005334 Ga0068869_100002227 Ga0068869_1000022278 313
199 3300005334 Ga0068869_100002467 Ga0068869_1000024675 313
200 3300005334 Ga0068869_100018710 Ga0068869_1000187102 313
201 3300005334 Ga0068869_100020876 Ga0068869_1000208761 313
202 3300005334 Ga0068869_100028959 Ga0068869_1000289593 313
203 3300005334 Ga0068869_100030116 Ga0068869_1000301163 313
204 3300005334 Ga0068869_100061749 Ga0068869_1000617492 313
205 3300005334 Ga0068869_100140058 Ga0068869_1001400582 313
206 3300005334 Ga0068869_100145070 Ga0068869_1001450702 313
207 3300005335 Ga0070666_10000227 Ga0070666_1000022711 313
208 3300005335 Ga0070666_10000694 Ga0070666_100006943 313
209 3300005335 Ga0070666_10013725 Ga0070666_100137254 313
210 3300005335 Ga0070666_10027886 Ga0070666_100278863 313
211 3300005336 Ga0070680_100000268 Ga0070680_10000026819 313
212 3300005337 Ga0070682_100002103 Ga0070682_1000021034 313
213 3300005338 Ga0068868_100000022 Ga0068868_1000000225 313
214 3300005338 Ga0068868_100003164 Ga0068868_1000031642 313
215 3300005338 Ga0068868_100017935 Ga0068868_1000179353 313
216 3300005338 Ga0068868_100098971 Ga0068868_1000989712 313
217 3300005338 Ga0068868_100135613 Ga0068868_1001356132 313
218 3300005339 Ga0070660_100134960 Ga0070660_1001349602 313
219 3300005339 Ga0070660_100212691 Ga0070660_1002126912 313
220 3300005340 Ga0070689_100004351 Ga0070689_1000043514 313
221 3300005340 Ga0070689_100065434 Ga0070689_1000654342 313
222 3300005340 Ga0070689_100091265 Ga0070689_1000912651 313
223 3300005340 Ga0070689_100125780 Ga0070689_1001257801 313
224 3300005340 Ga0070689_100187974 Ga0070689_1001879741 313
225 3300005340 Ga0070689_100348523 Ga0070689_1003485231 313
226 3300005341 Ga0070691_10000271 Ga0070691_1000027110 313
227 3300005341 Ga0070691_10044554 Ga0070691_100445542 313
228 3300005343 Ga0070687_100007090 Ga0070687_1000070903 313
229 3300005344 Ga0070661_100000111 Ga0070661_10000011148 313
230 3300005344 Ga0070661_100020641 Ga0070661_1000206414 313
231 3300005344 Ga0070661_100023047 Ga0070661_1000230474 313
232 3300005347 Ga0070668_100000016 Ga0070668_10000001680 313
233 3300005347 Ga0070668_100045177 Ga0070668_1000451772 313
234 3300005347 Ga0070668_100062465 Ga0070668_1000624652 313
235 3300005347 Ga0070668_100063538 Ga0070668_1000635382 313
236 3300005347 Ga0070668_100351620 Ga0070668_1003516201 313
237 3300005353 Ga0070669_100022311 Ga0070669_1000223112 313
238 3300005353 Ga0070669_100065523 Ga0070669_1000655233 313
239 3300005354 Ga0070675_100005753 Ga0070675_1000057536 313
240 3300005354 Ga0070675_100073229 Ga0070675_1000732292 313
241 3300005354 Ga0070675_100075650 Ga0070675_1000756503 313
242 3300005355 Ga0070671_100001071 Ga0070671_1000010719 313
243 3300005355 Ga0070671_100028175 Ga0070671_1000281753 313
244 3300005355 Ga0070671_100123973 Ga0070671_1001239733 313
245 3300005355 Ga0070671_100141853 Ga0070671_1001418532 313
246 3300005356 Ga0070674_100005491 Ga0070674_1000054915 313
247 3300005364 Ga0070673_100001320 Ga0070673_1000013203 313
248 3300005364 Ga0070673_100006098 Ga0070673_1000060985 313
249 3300005364 Ga0070673_100010627 Ga0070673_1000106272 313
250 3300005364 Ga0070673_100012671 Ga0070673_1000126714 313
251 3300005364 Ga0070673_100039851 Ga0070673_1000398512 313
252 3300005364 Ga0070673_100096802 Ga0070673_1000968022 313
253 3300005364 Ga0070673_100137603 Ga0070673_1001376032 313
254 3300005364 Ga0070673_100145854 Ga0070673_1001458542 313
255 3300005364 Ga0070673_100203564 Ga0070673_1002035642 313
256 3300005365 Ga0070688_100008316 Ga0070688_1000083163 313
257 3300005365 Ga0070688_100011264 Ga0070688_1000112642 313
258 3300005365 Ga0070688_100013987 Ga0070688_1000139875 313
259 3300005365 Ga0070688_100024308 Ga0070688_1000243082 313
260 3300005365 Ga0070688_100182867 Ga0070688_1001828671 313
261 3300005365 Ga0070688_100229087 Ga0070688_1002290871 313
262 3300005366 Ga0070659_100003782 Ga0070659_1000037825 313
263 3300005366 Ga0070659_100042015 Ga0070659_1000420151 313
264 3300005367 Ga0070667_100000031 Ga0070667_100000031153 313
265 3300005367 Ga0070667_100002868 Ga0070667_1000028687 313
266 3300005367 Ga0070667_100006052 Ga0070667_1000060527 313
267 3300005367 Ga0070667_100031584 Ga0070667_1000315841 313
268 3300005367 Ga0070667_100053044 Ga0070667_1000530441 313
269 3300005367 Ga0070667_100126075 Ga0070667_1001260752 313
270 3300005367 Ga0070667_100278089 Ga0070667_1002780891 313
271 3300005367 Ga0070667_100352654 Ga0070667_1003526541 313
272 3300005441 Ga0070700_100194936 Ga0070700_1001949361 313
273 3300005441 Ga0070700_100236087 Ga0070700_1002360871 313
274 3300005455 Ga0070663_100117806 Ga0070663_1001178062 313
275 3300005455 Ga0070663_100194980 Ga0070663_1001949801 313
276 3300005456 Ga0070678_100010645 Ga0070678_1000106453 313
277 3300005456 Ga0070678_100014076 Ga0070678_1000140763 313
278 3300005456 Ga0070678_100020255 Ga0070678_1000202552 313
279 3300005456 Ga0070678_100095149 Ga0070678_1000951492 313
280 3300005457 Ga0070662_100002529 Ga0070662_1000025294 313
281 3300005457 Ga0070662_100005807 Ga0070662_1000058076 313
282 3300005457 Ga0070662_100044335 Ga0070662_1000443352 313
283 3300005458 Ga0070681_10035895 Ga0070681_100358954 313
284 3300005459 Ga0068867_100015222 Ga0068867_1000152224 313
285 3300005459 Ga0068867_100016665 Ga0068867_1000166653 313
286 3300005459 Ga0068867_100150717 Ga0068867_1001507172 313
287 3300005466 Ga0070685_10016650 Ga0070685_100166503 313
288 3300005466 Ga0070685_10018581 Ga0070685_100185812 313
289 3300005466 Ga0070685_10027573 Ga0070685_100275732 313
290 3300005466 Ga0070685_10032207 Ga0070685_100322072 313
291 3300005466 Ga0070685_10126557 Ga0070685_101265571 313
292 3300005471 Ga0070698_100017780 Ga0070698_1000177806 313
293 3300005471 Ga0070698_100027882 Ga0070698_1000278826 313
294 3300005535 Ga0070684_100000105 Ga0070684_10000010514 313
295 3300005535 Ga0070684_100004644 Ga0070684_1000046444 313
296 3300005535 Ga0070684_100010934 Ga0070684_1000109344 313
297 3300005539 Ga0068853_100003177 Ga0068853_1000031774 313
298 3300005539 Ga0068853_100003898 Ga0068853_1000038985 313
299 3300005539 Ga0068853_100025442 Ga0068853_1000254423 313
300 3300005539 Ga0068853_100079728 Ga0068853_1000797282 313
301 3300005539 Ga0068853_100117561 Ga0068853_1001175612 313
302 3300005539 Ga0068853_100184767 Ga0068853_1001847673 313
303 3300005543 Ga0070672_100000002 Ga0070672_100000002135 313
304 3300005543 Ga0070672_100022551 Ga0070672_1000225512 313
305 3300005543 Ga0070672_100059364 Ga0070672_1000593642 313
306 3300005543 Ga0070672_100287476 Ga0070672_1002874761 313
307 3300005544 Ga0070686_100011399 Ga0070686_1000113993 313
308 3300005547 Ga0070693_100117870 Ga0070693_1001178702 313
309 3300005548 Ga0070665_100000014 Ga0070665_100000014417 313
310 3300005548 Ga0070665_100002900 Ga0070665_10000290012 313
311 3300005548 Ga0070665_100005140 Ga0070665_10000514010 313
312 3300005548 Ga0070665_100233197 Ga0070665_1002331972 313
313 3300005563 Ga0068855_100011315 Ga0068855_1000113152 313
314 3300005563 Ga0068855_100026647 Ga0068855_1000266472 313
315 3300005563 Ga0068855_100036601 Ga0068855_1000366012 313
316 3300005563 Ga0068855_100084962 Ga0068855_1000849623 313
317 3300005564 Ga0070664_100000838 Ga0070664_1000008384 313
318 3300005564 Ga0070664_100019311 Ga0070664_1000193113 313
319 3300005564 Ga0070664_100053101 Ga0070664_1000531012 313
320 3300005564 Ga0070664_100245787 Ga0070664_1002457872 313
321 3300005577 Ga0068857_100005990 Ga0068857_1000059903 313
322 3300005577 Ga0068857_100010255 Ga0068857_1000102554 313
323 3300005578 Ga0068854_100035375 Ga0068854_1000353753 313
324 3300005614 Ga0068856_100080993 Ga0068856_1000809932 313
325 3300005614 Ga0068856_100087124 Ga0068856_1000871243 313
326 3300005616 Ga0068852_100000460 Ga0068852_1000004608 313
327 3300005616 Ga0068852_100001918 Ga0068852_1000019181 313
328 3300005616 Ga0068852_100018543 Ga0068852_1000185432 313
329 3300005616 Ga0068852_100023625 Ga0068852_1000236254 313
330 3300005616 Ga0068852_100141541 Ga0068852_1001415412 313
331 3300005617 Ga0068859_100000025 Ga0068859_10000002540 313
332 3300005617 Ga0068859_100000620 Ga0068859_10000062016 313
333 3300005617 Ga0068859_100007242 Ga0068859_1000072425 313
334 3300005617 Ga0068859_100022623 Ga0068859_1000226234 313
335 3300005617 Ga0068859_100044096 Ga0068859_1000440963 313
336 3300005617 Ga0068859_100061860 Ga0068859_1000618602 313
337 3300005617 Ga0068859_100085924 Ga0068859_1000859243 313
338 3300005617 Ga0068859_100174716 Ga0068859_1001747162 313
339 3300005617 Ga0068859_100517289 Ga0068859_1005172892 313
340 3300005617 Ga0068859_100522180 Ga0068859_1005221802 313
341 3300005617 Ga0068859_100702117 Ga0068859_1007021171 313
342 3300005618 Ga0068864_100008996 Ga0068864_1000089963 313
343 3300005618 Ga0068864_100034999 Ga0068864_1000349994 313
344 3300005618 Ga0068864_100135926 Ga0068864_1001359262 313
345 3300005618 Ga0068864_100170277 Ga0068864_1001702772 313
346 3300005718 Ga0068866_10005900 Ga0068866_100059004 313
347 3300005719 Ga0068861_100003363 Ga0068861_1000033636 313
348 3300005719 Ga0068861_100012731 Ga0068861_1000127315 313
349 3300005719 Ga0068861_100021936 Ga0068861_1000219363 313
350 3300005719 Ga0068861_100044425 Ga0068861_1000444253 313
351 3300005719 Ga0068861_100267172 Ga0068861_1002671722 313
352 3300005719 Ga0068861_100378531 Ga0068861_1003785311 313
353 3300005834 Ga0068851_10002711 Ga0068851_100027116 313
354 3300005834 Ga0068851_10006509 Ga0068851_100065093 313
355 3300005840 Ga0068870_10006813 Ga0068870_100068132 313
356 3300005840 Ga0068870_10008538 Ga0068870_100085383 313
357 3300005840 Ga0068870_10112569 Ga0068870_101125691 313
358 3300005841 Ga0068863_100000828 Ga0068863_10000082812 313
359 3300005841 Ga0068863_100003289 Ga0068863_10000328913 313
360 3300005841 Ga0068863_100022535 Ga0068863_1000225353 313
361 3300005841 Ga0068863_100040932 Ga0068863_1000409323 313
362 3300005841 Ga0068863_100045188 Ga0068863_1000451883 313
363 3300005841 Ga0068863_100046509 Ga0068863_1000465092 313
364 3300005841 Ga0068863_100105018 Ga0068863_1001050182 313
365 3300005841 Ga0068863_100114161 Ga0068863_1001141612 313
366 3300005841 Ga0068863_100344777 Ga0068863_1003447772 313
367 3300005842 Ga0068858_100000083 Ga0068858_10000008376 313
368 3300005842 Ga0068858_100131898 Ga0068858_1001318982 313
369 3300005842 Ga0068858_100175183 Ga0068858_1001751834 313
370 3300005842 Ga0068858_100453753 Ga0068858_1004537532 313
371 3300005843 Ga0068860_100000394 Ga0068860_10000039430 313
372 3300005843 Ga0068860_100002803 Ga0068860_1000028037 313
373 3300005843 Ga0068860_100004639 Ga0068860_1000046393 313
374 3300005843 Ga0068860_100004908 Ga0068860_1000049083 313
375 3300005843 Ga0068860_100014242 Ga0068860_1000142423 313
376 3300005843 Ga0068860_100014820 Ga0068860_1000148205 313
377 3300005843 Ga0068860_100031932 Ga0068860_1000319322 313
378 3300005843 Ga0068860_100169845 Ga0068860_1001698452 313
379 3300005843 Ga0068860_100180768 Ga0068860_1001807682 313
380 3300005844 Ga0068862_100086852 Ga0068862_1000868523 313
381 3300005844 Ga0068862_100208129 Ga0068862_1002081292 313
382 3300005844 Ga0068862_100246178 Ga0068862_1002461782 313
383 3300005844 Ga0068862_100452038 Ga0068862_1004520381 313
384 3300005983 Ga0081540_1004387 Ga0081540_10043876 313
385 3300006195 Ga0075366_10001639 Ga0075366_100016393 313
386 3300006195 Ga0075366_10050762 Ga0075366_100507623 313
387 3300006237 Ga0097621_100000359 Ga0097621_10000035921 313
388 3300006237 Ga0097621_100005579 Ga0097621_1000055793 313
389 3300006237 Ga0097621_100015918 Ga0097621_1000159182 313
390 3300006237 Ga0097621_100019163 Ga0097621_1000191633 313
391 3300006237 Ga0097621_100021087 Ga0097621_1000210874 313
392 3300006237 Ga0097621_100033861 Ga0097621_1000338613 313
393 3300006237 Ga0097621_100092867 Ga0097621_1000928672 313
394 3300006237 Ga0097621_100143433 Ga0097621_1001434332 313
395 3300006237 Ga0097621_100212062 Ga0097621_1002120622 313
396 3300006358 Ga0068871_100000201 Ga0068871_10000020123 313
397 3300006358 Ga0068871_100001167 Ga0068871_1000011677 313
398 3300006358 Ga0068871_100004905 Ga0068871_1000049058 313
399 3300006358 Ga0068871_100054631 Ga0068871_1000546313 313
400 3300006358 Ga0068871_100059310 Ga0068871_1000593102 313
401 3300006358 Ga0068871_100138726 Ga0068871_1001387262 313
402 3300006358 Ga0068871_100139452 Ga0068871_1001394522 313
403 3300006358 Ga0068871_100183573 Ga0068871_1001835733 313
404 3300006844 Ga0075428_100013338 Ga0075428_1000133383 313
405 3300006844 Ga0075428_100279654 Ga0075428_1002796542 313
406 3300006871 Ga0075434_100037661 Ga0075434_1000376613 313
407 3300006880 Ga0075429_100000723 Ga0075429_1000007238 313
408 3300006880 Ga0075429_100283270 Ga0075429_1002832701 313
409 3300006881 Ga0068865_100012266 Ga0068865_1000122664 313
410 3300006881 Ga0068865_100032670 Ga0068865_1000326702 313
411 3300006931 Ga0097620_100000025 Ga0097620_10000002540 313
412 3300006931 Ga0097620_100000620 Ga0097620_10000062016 313
413 3300006931 Ga0097620_100007242 Ga0097620_1000072425 313
414 3300006931 Ga0097620_100022623 Ga0097620_1000226234 313
415 3300006931 Ga0097620_100044097 Ga0097620_1000440973 313
416 3300006931 Ga0097620_100061856 Ga0097620_1000618562 313
417 3300006931 Ga0097620_100085931 Ga0097620_1000859312 313
418 3300006931 Ga0097620_100174708 Ga0097620_1001747082 313
419 3300006931 Ga0097620_100355959 Ga0097620_1003559591 313
420 3300006931 Ga0097620_100517284 Ga0097620_1005172842 313
421 3300006931 Ga0097620_100522142 Ga0097620_1005221421 313
422 3300006931 Ga0097620_100702122 Ga0097620_1007021221 313
423 3300009093 Ga0105240_10001601 Ga0105240_100016013 313
424 3300009093 Ga0105240_10001632 Ga0105240_100016322 313
425 3300009093 Ga0105240_10012477 Ga0105240_1001247711 313
426 3300009093 Ga0105240_10020065 Ga0105240_100200653 313
427 3300009093 Ga0105240_10046229 Ga0105240_100462292 313
428 3300009093 Ga0105240_10049773 Ga0105240_100497732 313
429 3300009093 Ga0105240_10053431 Ga0105240_100534312 313
430 3300009093 Ga0105240_10118854 Ga0105240_101188543 313
431 3300009094 Ga0111539_10013194 Ga0111539_100131944 313
432 3300009094 Ga0111539_10155954 Ga0111539_101559542 313
433 3300009094 Ga0111539_10250768 Ga0111539_102507681 313
434 3300009098 Ga0105245_10010477 Ga0105245_100104774 313
435 3300009101 Ga0105247_10000619 Ga0105247_100006194 313
436 3300009101 Ga0105247_10015174 Ga0105247_100151743 313
437 3300009101 Ga0105247_10053989 Ga0105247_100539892 313
438 3300009147 Ga0114129_10041957 Ga0114129_100419575 313
439 3300009148 Ga0105243_10133536 Ga0105243_101335362 313
440 3300009174 Ga0105241_10000252 Ga0105241_1000025212 313
441 3300009174 Ga0105241_10001151 Ga0105241_100011518 313
442 3300009174 Ga0105241_10002136 Ga0105241_1000213612 313
443 3300009174 Ga0105241_10019869 Ga0105241_100198693 313
444 3300009174 Ga0105241_10226981 Ga0105241_102269812 313
445 3300009174 Ga0105241_10267408 Ga0105241_102674082 313
446 3300009176 Ga0105242_10041827 Ga0105242_100418272 313
447 3300009176 Ga0105242_10053818 Ga0105242_100538183 313
448 3300009176 Ga0105242_10106325 Ga0105242_101063252 313
449 3300009176 Ga0105242_10169223 Ga0105242_101692232 313
450 3300009176 Ga0105242_10229661 Ga0105242_102296612 313
451 3300009177 Ga0105248_10067765 Ga0105248_100677652 313
452 3300009545 Ga0105237_10000191 Ga0105237_1000019116 313
453 3300009545 Ga0105237_10000938 Ga0105237_1000093831 313
454 3300009545 Ga0105237_10002013 Ga0105237_1000201315 313
455 3300009545 Ga0105237_10006188 Ga0105237_100061882 313
456 3300009545 Ga0105237_10019671 Ga0105237_100196711 313
457 3300009545 Ga0105237_10095240 Ga0105237_100952403 313
458 3300009551 Ga0105238_10004065 Ga0105238_100040659 313
459 3300009551 Ga0105238_10023581 Ga0105238_100235815 313
460 3300009551 Ga0105238_10063610 Ga0105238_100636102 313
461 3300009553 Ga0105249_10001096 Ga0105249_100010964 313
462 3300009553 Ga0105249_10001117 Ga0105249_100011179 313
463 3300009553 Ga0105249_10001306 Ga0105249_100013064 313
464 3300009553 Ga0105249_10001445 Ga0105249_100014454 313
465 3300009553 Ga0105249_10003110 Ga0105249_100031104 313
466 3300009553 Ga0105249_10028284 Ga0105249_100282844 313
467 3300009553 Ga0105249_10060768 Ga0105249_100607682 313
468 3300009553 Ga0105249_10224511 Ga0105249_102245112 313
469 3300010375 Ga0105239_10000019 Ga0105239_10000019249 313
470 3300010375 Ga0105239_10006447 Ga0105239_100064476 313
471 3300010375 Ga0105239_10009941 Ga0105239_100099417 313
472 3300010375 Ga0105239_10012772 Ga0105239_100127726 313
473 3300010375 Ga0105239_10013262 Ga0105239_100132628 313
474 3300010375 Ga0105239_10116749 Ga0105239_101167492 313
475 3300011119 Ga0105246_10027988 Ga0105246_100279883 313
476 3300011119 Ga0105246_10175641 Ga0105246_101756412 313
477 3300011119 Ga0105246_10229745 Ga0105246_102297451 313
478 3300013100 Ga0157373_10031265 Ga0157373_100312654 313
479 3300013100 Ga0157373_10040205 Ga0157373_100402052 313
480 3300013100 Ga0157373_10058618 Ga0157373_100586183 313
481 3300013104 Ga0157370_10013171 Ga0157370_100131713 313
482 3300013296 Ga0157374_10000011 Ga0157374_10000011121 313
483 3300013296 Ga0157374_10004455 Ga0157374_100044559 313
484 3300013296 Ga0157374_10009692 Ga0157374_100096923 313
485 3300013296 Ga0157374_10050543 Ga0157374_100505433 313
486 3300013297 Ga0157378_10001083 Ga0157378_1000108319 313
487 3300013297 Ga0157378_10003875 Ga0157378_100038756 313
488 3300013297 Ga0157378_10061615 Ga0157378_100616152 313
489 3300013297 Ga0157378_10066657 Ga0157378_100666573 313
490 3300013297 Ga0157378_10068698 Ga0157378_100686982 313
491 3300013306 Ga0163162_10000029 Ga0163162_10000029145 313
492 3300013306 Ga0163162_10000424 Ga0163162_1000042428 313
493 3300013306 Ga0163162_10000672 Ga0163162_100006727 313
494 3300013306 Ga0163162_10001000 Ga0163162_1000100022 313
495 3300013306 Ga0163162_10007147 Ga0163162_100071475 313
496 3300013306 Ga0163162_10026603 Ga0163162_100266033 313
497 3300013306 Ga0163162_10029016 Ga0163162_100290164 313
498 3300013306 Ga0163162_10126262 Ga0163162_101262624 313
499 3300013306 Ga0163162_10133118 Ga0163162_101331183 313
500 3300013306 Ga0163162_10168474 Ga0163162_101684742 313
501 3300013306 Ga0163162_10426492 Ga0163162_104264921 313
502 3300013306 Ga0163162_10465489 Ga0163162_104654892 313
503 3300013307 Ga0157372_10012413 Ga0157372_100124138 313
504 3300013307 Ga0157372_10054702 Ga0157372_100547023 313
505 3300013307 Ga0157372_10303899 Ga0157372_103038992 313
506 3300013307 Ga0157372_10304701 Ga0157372_103047012 313
507 3300013307 Ga0157372_10652283 Ga0157372_106522832 313
508 3300013307 Ga0157372_10691182 Ga0157372_106911821 313
509 3300013308 Ga0157375_10000042 Ga0157375_1000004216 313
510 3300013308 Ga0157375_10002200 Ga0157375_100022006 313
511 3300013308 Ga0157375_10011363 Ga0157375_100113632 313
512 3300013308 Ga0157375_10012413 Ga0157375_100124132 313
513 3300013308 Ga0157375_10038591 Ga0157375_100385913 313
514 3300013308 Ga0157375_10043524 Ga0157375_100435243 313
515 3300013308 Ga0157375_10100779 Ga0157375_101007792 313
516 3300013308 Ga0157375_10117350 Ga0157375_101173502 313
517 3300013308 Ga0157375_10147379 Ga0157375_101473791 313
518 3300013308 Ga0157375_10157851 Ga0157375_101578512 313
519 3300014325 Ga0163163_10000076 Ga0163163_1000007685 313
520 3300014325 Ga0163163_10000831 Ga0163163_1000083113 313
521 3300014325 Ga0163163_10001057 Ga0163163_1000105718 313
522 3300014325 Ga0163163_10015513 Ga0163163_100155133 313
523 3300014325 Ga0163163_10076823 Ga0163163_100768232 313
524 3300014325 Ga0163163_10099343 Ga0163163_100993432 313
525 3300014325 Ga0163163_10197237 Ga0163163_101972372 313
526 3300014325 Ga0163163_10220755 Ga0163163_102207551 313
527 3300014325 Ga0163163_10284532 Ga0163163_102845321 313
528 3300014325 Ga0163163_10432213 Ga0163163_104322131 313
529 3300014325 Ga0163163_10609346 Ga0163163_106093461 313
530 3300014326 Ga0157380_10001454 Ga0157380_100014549 313
531 3300014326 Ga0157380_10003690 Ga0157380_100036906 313
532 3300014326 Ga0157380_10007843 Ga0157380_100078434 313
533 3300014326 Ga0157380_10040123 Ga0157380_100401233 313
534 3300014326 Ga0157380_10126199 Ga0157380_101261992 313
535 3300014745 Ga0157377_10022605 Ga0157377_100226052 313
536 3300014745 Ga0157377_10023737 Ga0157377_100237372 313
537 3300014745 Ga0157377_10031442 Ga0157377_100314422 313
538 3300014745 Ga0157377_10163313 Ga0157377_101633131 313
539 3300014968 Ga0157379_10000016 Ga0157379_1000001679 313
540 3300014968 Ga0157379_10016392 Ga0157379_100163927 313
541 3300014968 Ga0157379_10037080 Ga0157379_100370804 313
542 3300014968 Ga0157379_10077651 Ga0157379_100776513 313
543 3300014968 Ga0157379_10087394 Ga0157379_100873942 313
544 3300014968 Ga0157379_10421162 Ga0157379_104211622 313
545 3300014969 Ga0157376_10000558 Ga0157376_1000055816 313
546 3300014969 Ga0157376_10000938 Ga0157376_100009382 313
547 3300014969 Ga0157376_10002924 Ga0157376_100029247 313
548 3300014969 Ga0157376_10010684 Ga0157376_100106844 313
549 3300014969 Ga0157376_10011063 Ga0157376_100110632 313
550 3300014969 Ga0157376_10035769 Ga0157376_100357692 313
551 3300014969 Ga0157376_10256115 Ga0157376_102561152 313
552 3300017792 Ga0163161_10003336 Ga0163161_100033367 313
553 3300017792 Ga0163161_10024726 Ga0163161_100247263 313
554 3300017792 Ga0163161_10040821 Ga0163161_100408212 313
555 3300025321 Ga0207656_10000821 Ga0207656_100008214 313
556 3300025321 Ga0207656_10022275 Ga0207656_100222752 313
557 3300025321 Ga0207656_10027719 Ga0207656_100277192 313
558 3300025893 Ga0207682_10030613 Ga0207682_100306132 313
559 3300025899 Ga0207642_10081862 Ga0207642_100818622 313
560 3300025900 Ga0207710_10004843 Ga0207710_100048434 313
561 3300025903 Ga0207680_10000086 Ga0207680_1000008641 313
562 3300025903 Ga0207680_10014877 Ga0207680_100148772 313
563 3300025903 Ga0207680_10053067 Ga0207680_100530672 313
564 3300025903 Ga0207680_10093486 Ga0207680_100934861 313
565 3300025904 Ga0207647_10000096 Ga0207647_1000009635 313
566 3300025907 Ga0207645_10002123 Ga0207645_1000212311 313
567 3300025907 Ga0207645_10012288 Ga0207645_100122882 313
568 3300025907 Ga0207645_10014367 Ga0207645_100143673 313
569 3300025907 Ga0207645_10033610 Ga0207645_100336102 313
570 3300025907 Ga0207645_10045869 Ga0207645_100458692 313
571 3300025907 Ga0207645_10064822 Ga0207645_100648222 313
572 3300025908 Ga0207643_10009004 Ga0207643_100090042 313
573 3300025908 Ga0207643_10013248 Ga0207643_100132483 313
574 3300025909 Ga0207705_10002045 Ga0207705_1000204512 313
575 3300025911 Ga0207654_10006725 Ga0207654_100067252 313
576 3300025911 Ga0207654_10018640 Ga0207654_100186402 313
577 3300025911 Ga0207654_10038316 Ga0207654_100383161 313
578 3300025911 Ga0207654_10123445 Ga0207654_101234451 313
579 3300025912 Ga0207707_10135962 Ga0207707_101359622 313
580 3300025913 Ga0207695_10001109 Ga0207695_100011098 313
581 3300025913 Ga0207695_10001387 Ga0207695_100013876 313
582 3300025913 Ga0207695_10001527 Ga0207695_100015273 313
583 3300025913 Ga0207695_10075830 Ga0207695_100758303 313
584 3300025913 Ga0207695_10113737 Ga0207695_101137372 313
585 3300025913 Ga0207695_10140779 Ga0207695_101407792 313
586 3300025913 Ga0207695_10144647 Ga0207695_101446472 313
587 3300025913 Ga0207695_10165680 Ga0207695_101656802 313
588 3300025914 Ga0207671_10001331 Ga0207671_1000133113 313
589 3300025914 Ga0207671_10001357 Ga0207671_100013579 313
590 3300025914 Ga0207671_10003705 Ga0207671_100037059 313
591 3300025914 Ga0207671_10011884 Ga0207671_100118842 313
592 3300025917 Ga0207660_10002449 Ga0207660_100024492 313
593 3300025918 Ga0207662_10005744 Ga0207662_100057444 313
594 3300025919 Ga0207657_10113061 Ga0207657_101130612 313
595 3300025919 Ga0207657_10244120 Ga0207657_102441201 313
596 3300025920 Ga0207649_10000517 Ga0207649_100005177 313
597 3300025920 Ga0207649_10075233 Ga0207649_100752332 313
598 3300025920 Ga0207649_10128467 Ga0207649_101284672 313
599 3300025921 Ga0207652_10008720 Ga0207652_100087201 313
600 3300025924 Ga0207694_10254215 Ga0207694_102542151 313
601 3300025924 Ga0207694_10268334 Ga0207694_102683341 313
602 3300025925 Ga0207650_10001946 Ga0207650_1000194614 313
603 3300025925 Ga0207650_10049132 Ga0207650_100491322 313
604 3300025925 Ga0207650_10054046 Ga0207650_100540462 313
605 3300025925 Ga0207650_10089489 Ga0207650_100894891 313
606 3300025925 Ga0207650_10115912 Ga0207650_101159122 313
607 3300025925 Ga0207650_10175068 Ga0207650_101750682 313
608 3300025926 Ga0207659_10020402 Ga0207659_100204023 313
609 3300025926 Ga0207659_10022314 Ga0207659_100223142 313
610 3300025926 Ga0207659_10056682 Ga0207659_100566822 313
611 3300025926 Ga0207659_10069850 Ga0207659_100698502 313
612 3300025926 Ga0207659_10101043 Ga0207659_101010431 313
613 3300025926 Ga0207659_10346531 Ga0207659_103465311 313
614 3300025927 Ga0207687_10077510 Ga0207687_100775103 313
615 3300025931 Ga0207644_10014077 Ga0207644_100140773 313
616 3300025931 Ga0207644_10066397 Ga0207644_100663972 313
617 3300025931 Ga0207644_10234941 Ga0207644_102349412 313
618 3300025931 Ga0207644_10382775 Ga0207644_103827751 313
619 3300025932 Ga0207690_10010864 Ga0207690_100108642 313
620 3300025932 Ga0207690_10029625 Ga0207690_100296253 313
621 3300025933 Ga0207706_10008919 Ga0207706_100089192 313
622 3300025933 Ga0207706_10086069 Ga0207706_100860692 313
623 3300025934 Ga0207686_10011437 Ga0207686_100114372 313
624 3300025934 Ga0207686_10058469 Ga0207686_100584692 313
625 3300025934 Ga0207686_10130358 Ga0207686_101303582 313
626 3300025934 Ga0207686_10198984 Ga0207686_101989841 313
627 3300025936 Ga0207670_10146506 Ga0207670_101465061 313
628 3300025936 Ga0207670_10177418 Ga0207670_101774181 313
629 3300025936 Ga0207670_10315732 Ga0207670_103157321 313
630 3300025937 Ga0207669_10008011 Ga0207669_100080113 313
631 3300025938 Ga0207704_10053403 Ga0207704_100534032 313
632 3300025938 Ga0207704_10106756 Ga0207704_101067562 313
633 3300025938 Ga0207704_10111584 Ga0207704_101115842 313
634 3300025938 Ga0207704_10116052 Ga0207704_101160521 313
635 3300025940 Ga0207691_10000004 Ga0207691_10000004145 313
636 3300025940 Ga0207691_10026490 Ga0207691_100264902 313
637 3300025940 Ga0207691_10045858 Ga0207691_100458584 313
638 3300025940 Ga0207691_10129252 Ga0207691_101292522 313
639 3300025940 Ga0207691_10140802 Ga0207691_101408022 313
640 3300025942 Ga0207689_10000208 Ga0207689_100002083 313
641 3300025942 Ga0207689_10002065 Ga0207689_100020655 313
642 3300025942 Ga0207689_10002750 Ga0207689_100027506 313
643 3300025942 Ga0207689_10008548 Ga0207689_100085482 313
644 3300025942 Ga0207689_10029255 Ga0207689_100292552 313
645 3300025942 Ga0207689_10032175 Ga0207689_100321751 313
646 3300025942 Ga0207689_10053043 Ga0207689_100530434 313
647 3300025942 Ga0207689_10062503 Ga0207689_100625032 313
648 3300025942 Ga0207689_10275819 Ga0207689_102758191 313
649 3300025945 Ga0207679_10000091 Ga0207679_1000009136 313
650 3300025945 Ga0207679_10038824 Ga0207679_100388241 313
651 3300025949 Ga0207667_10003621 Ga0207667_100036211 313
652 3300025949 Ga0207667_10008497 Ga0207667_100084978 313
653 3300025949 Ga0207667_10024439 Ga0207667_100244393 313
654 3300025960 Ga0207651_10004794 Ga0207651_100047943 313
655 3300025960 Ga0207651_10009976 Ga0207651_100099763 313
656 3300025960 Ga0207651_10024166 Ga0207651_100241664 313
657 3300025960 Ga0207651_10053609 Ga0207651_100536093 313
658 3300025960 Ga0207651_10063786 Ga0207651_100637863 313
659 3300025960 Ga0207651_10072179 Ga0207651_100721792 313
660 3300025960 Ga0207651_10092415 Ga0207651_100924151 313
661 3300025960 Ga0207651_10106291 Ga0207651_101062912 313
662 3300025961 Ga0207712_10000725 Ga0207712_100007257 313
663 3300025961 Ga0207712_10000915 Ga0207712_100009157 313
664 3300025961 Ga0207712_10001923 Ga0207712_100019235 313
665 3300025961 Ga0207712_10005612 Ga0207712_100056121 313
666 3300025961 Ga0207712_10016389 Ga0207712_100163893 313
667 3300025961 Ga0207712_10040250 Ga0207712_100402502 313
668 3300025961 Ga0207712_10102517 Ga0207712_101025172 313
669 3300025972 Ga0207668_10001031 Ga0207668_1000103115 313
670 3300025981 Ga0207640_10026559 Ga0207640_100265592 313
671 3300025981 Ga0207640_10097792 Ga0207640_100977922 313
672 3300025986 Ga0207658_10001793 Ga0207658_1000179314 313
673 3300025986 Ga0207658_10023217 Ga0207658_100232173 313
674 3300025986 Ga0207658_10049019 Ga0207658_100490191 313
675 3300026023 Ga0207677_10071596 Ga0207677_100715961 313
676 3300026023 Ga0207677_10104052 Ga0207677_101040521 313
677 3300026023 Ga0207677_10209907 Ga0207677_102099072 313
678 3300026023 Ga0207677_10224246 Ga0207677_102242461 313
679 3300026035 Ga0207703_10002453 Ga0207703_100024532 313
680 3300026035 Ga0207703_10003536 Ga0207703_100035361 313
681 3300026035 Ga0207703_10496832 Ga0207703_104968322 313
682 3300026035 Ga0207703_10524140 Ga0207703_105241401 313
683 3300026041 Ga0207639_10004779 Ga0207639_100047797 313
684 3300026041 Ga0207639_10017252 Ga0207639_100172523 313
685 3300026041 Ga0207639_10017338 Ga0207639_100173382 313
686 3300026041 Ga0207639_10018922 Ga0207639_100189223 313
687 3300026067 Ga0207678_10143913 Ga0207678_101439132 313
688 3300026075 Ga0207708_10211128 Ga0207708_102111282 313
689 3300026078 Ga0207702_10093485 Ga0207702_100934852 313
690 3300026088 Ga0207641_10000132 Ga0207641_1000013243 313
691 3300026088 Ga0207641_10002004 Ga0207641_1000200415 313
692 3300026088 Ga0207641_10005148 Ga0207641_100051482 313
693 3300026088 Ga0207641_10030371 Ga0207641_100303714 313
694 3300026088 Ga0207641_10039756 Ga0207641_100397563 313
695 3300026088 Ga0207641_10114190 Ga0207641_101141902 313
696 3300026088 Ga0207641_10125353 Ga0207641_101253532 313
697 3300026089 Ga0207648_10001340 Ga0207648_100013405 313
698 3300026089 Ga0207648_10001507 Ga0207648_1000150722 313
699 3300026089 Ga0207648_10003198 Ga0207648_1000319811 313
700 3300026089 Ga0207648_10023065 Ga0207648_100230653 313
701 3300026089 Ga0207648_10028580 Ga0207648_100285803 313
702 3300026089 Ga0207648_10059000 Ga0207648_100590002 313
703 3300026089 Ga0207648_10175954 Ga0207648_101759542 313
704 3300026089 Ga0207648_10227889 Ga0207648_102278892 313
705 3300026095 Ga0207676_10006520 Ga0207676_100065203 313
706 3300026095 Ga0207676_10021806 Ga0207676_100218063 313
707 3300026095 Ga0207676_10050031 Ga0207676_100500312 313
708 3300026095 Ga0207676_10270325 Ga0207676_102703251 313
709 3300026095 Ga0207676_10271133 Ga0207676_102711331 313
710 3300026116 Ga0207674_10006827 Ga0207674_100068273 313
711 3300026116 Ga0207674_10006954 Ga0207674_1000695410 313
712 3300026116 Ga0207674_10011869 Ga0207674_100118696 313
713 3300026116 Ga0207674_10020844 Ga0207674_100208444 313
714 3300026116 Ga0207674_10037247 Ga0207674_100372471 313
715 3300026116 Ga0207674_10084698 Ga0207674_100846982 313
716 3300026116 Ga0207674_10096318 Ga0207674_100963182 313
717 3300026118 Ga0207675_100003521 Ga0207675_1000035213 313
718 3300026118 Ga0207675_100012750 Ga0207675_1000127503 313
719 3300026118 Ga0207675_100013899 Ga0207675_1000138995 313
720 3300026118 Ga0207675_100020709 Ga0207675_1000207096 313
721 3300026118 Ga0207675_100022252 Ga0207675_1000222523 313
722 3300026118 Ga0207675_100048083 Ga0207675_1000480834 313
723 3300026118 Ga0207675_100055083 Ga0207675_1000550832 313
724 3300026118 Ga0207675_100330590 Ga0207675_1003305902 313
725 3300026121 Ga0207683_10002163 Ga0207683_1000216313 313
726 3300026121 Ga0207683_10045450 Ga0207683_100454502 313
727 3300026121 Ga0207683_10049536 Ga0207683_100495363 313
728 3300026121 Ga0207683_10067112 Ga0207683_100671123 313
729 3300026121 Ga0207683_10204356 Ga0207683_102043562 313
730 3300026121 Ga0207683_10207800 Ga0207683_102078001 313
731 3300026142 Ga0207698_10000539 Ga0207698_1000053911 313
732 3300026142 Ga0207698_10004422 Ga0207698_100044225 313
733 3300026142 Ga0207698_10013262 Ga0207698_100132624 313
734 3300026142 Ga0207698_10088594 Ga0207698_100885943 313
735 3300026142 Ga0207698_10200495 Ga0207698_102004952 313
736 3300026142 Ga0207698_10413125 Ga0207698_104131251 313
737 3300028379 Ga0268266_10000068 Ga0268266_1000006818 313
738 3300028379 Ga0268266_10006637 Ga0268266_100066372 313
739 3300028379 Ga0268266_10103748 Ga0268266_101037482 313
740 3300028380 Ga0268265_10009330 Ga0268265_100093301 313
741 3300028380 Ga0268265_10066428 Ga0268265_100664283 313
742 3300028380 Ga0268265_10300965 Ga0268265_103009652 313
743 3300028381 Ga0268264_10000559 Ga0268264_1000055927 313
744 3300028381 Ga0268264_10001420 Ga0268264_100014206 313
745 3300028381 Ga0268264_10006807 Ga0268264_100068073 313
746 3300028381 Ga0268264_10012189 Ga0268264_100121892 313
747 3300028381 Ga0268264_10017234 Ga0268264_100172344 313
748 3300028381 Ga0268264_10024105 Ga0268264_100241052 313
749 3300028381 Ga0268264_10046883 Ga0268264_100468832 313
750 3300028381 Ga0268264_10337992 Ga0268264_103379921 313
751 3300028794 Ga0307515_10000001 Ga0307515_100000012032 313
752 3300028794 Ga0307515_10000437 Ga0307515_100004376 313
753 3300030521 Ga0307511_10000211 Ga0307511_1000021142 313
754 3300031456 Ga0307513_10043985 Ga0307513_100439852 313
755 3300031507 Ga0307509_10221350 Ga0307509_102213502 313
756 3300031507 Ga0307509_10256855 Ga0307509_102568551 313
757 3300031595 Ga0265313_10047862 Ga0265313_100478622 313
758 3300031616 Ga0307508_10014167 Ga0307508_100141671 313
759 3300031852 Ga0307410_10083320 Ga0307410_100833202 313
760 3300032005 Ga0307411_10086575 Ga0307411_100865752 313
761 3300035172 Ga0373955_0072914 Ga0373955_0072914_706_1740 313
762 3300035724 Ga0373933_0097376 Ga0373933_0097376_150_1184 313
763 3300036401 Ga0373937_0269587 Ga0373937_0269587_258_1292 313
764 3300037068 Ga0373925_0275674 Ga0373925_0275674_35_1072 313
765 3300037471 Ga0395905_0006214 Ga0395905_0006214_6971_8020 313
766 3300041404 Ga0439436_0000350 Ga0439436_0000350_5006_6043 313
767 3300041413 Ga0439465_0031831 Ga0439465_0031831_487_1533 313
768 3300042004 Ga0439445_0044106 Ga0439445_0044106_96_1130 313
769 3300042007 Ga0439449_0017050 Ga0439449_0017050_527_1564 313
770 3300042007 Ga0439449_0041243 Ga0439449_0041243_639_1706 313
771 3300042014 Ga0439457_000130 Ga0439457_000130_10230_11267 313
772 3300042015 Ga0439462_0003152 Ga0439462_0003152_1809_2846 313
773 3300044656 Ga0466969_0000356 Ga0466969_0000356_10290_11327 313
774 3300044658 Ga0466972_0000047 Ga0466972_0000047_8198_9235 313
775 3300044658 Ga0466972_0029484 Ga0466972_0029484_1068_2105 313
776 3300044684 Ga0466966_0000038 Ga0466966_0000038_64698_65735 313
777 3300044684 Ga0466966_0087507 Ga0466966_0087507_343_1392 313
778 3300044712 Ga0453684_0062022 Ga0453684_0062022_546_1583 313
779 3300044712 Ga0453684_0366909 Ga0453684_0366909_305_1345 313
780 3300044735 Ga0466968_0016485 Ga0466968_0016485_1734_2771 313
781 3300044765 Ga0466970_0029085 Ga0466970_0029085_909_1958 313
782 3300044842 Ga0466957_0000329 Ga0466957_0000329_20455_21522 313
783 3300044842 Ga0466957_0000739 Ga0466957_0000739_1905_2984 313
784 3300044901 Ga0466960_0066308 Ga0466960_0066308_73_1110 313
785 3300045049 Ga0466959_0000289 Ga0466959_0000289_22489_23526 313
786 3300045049 Ga0466959_0005476 Ga0466959_0005476_6182_7231 313
787 3300045836 Ga0466958_0017362 Ga0466958_0017362_2467_3516 313
788 3300046454 Ga0495592_0036614 Ga0495592_0036614_2553_3587 313
789 3300046460 Ga0495638_0016015 Ga0495638_0016015_161_1198 313
790 3300046460 Ga0495638_0184904 Ga0495638_0184904_97_1137 313
791 3300046511 Ga0495608_0064405 Ga0495608_0064405_464_1498 313
792 3300046516 Ga0495628_0112500 Ga0495628_0112500_1041_2075 313
793 3300046517 Ga0495630_0140484 Ga0495630_0140484_495_1529 313
794 3300046517 Ga0495630_0261146 Ga0495630_0261146_71_1108 313
795 3300046524 Ga0495648_0002523 Ga0495648_0002523_4792_5829 313
796 3300046648 Ga0495611_0008231 Ga0495611_0008231_2981_4042 313
797 3300046691 Ga0495670_0113298 Ga0495670_0113298_58_1107 313
798 3300046691 Ga0495670_0120811 Ga0495670_0120811_121_1155 313
799 3300047320 Ga0495672_0008699 Ga0495672_0008699_2249_3286 313
800 3300047443 Ga0495687_000058 Ga0495687_000058_61772_62809 313
801 3300047444 Ga0495675_0191494 Ga0495675_0191494_161_1195 313
802 3300047471 Ga0495684_0156852 Ga0495684_0156852_166_1200 313
803 3300047472 Ga0495686_0000005 Ga0495686_0000005_325272_326297 313
804 3300047472 Ga0495686_0051544 Ga0495686_0051544_868_1905 313
805 3300048903 Ga0496100_0107490 Ga0496100_0107490_176_1204 313
806 3300048904 Ga0496101_0009191 Ga0496101_0009191_1125_2153 313
807 3300048909 Ga0496106_0056974 Ga0496106_0056974_1604_2632 313
808 3300048913 Ga0496110_0132971 Ga0496110_0132971_628_1662 313
809 3300048914 Ga0496111_0201891 Ga0496111_0201891_119_1153 313
810 3300048917 Ga0496114_0038907 Ga0496114_0038907_1668_2696 313
811 3300049521 Ga0501298_000085 Ga0501298_000085_1315_2358 313
812 3300049568 Ga0501031_0003151 Ga0501031_0003151_2197_3237 313
813 3300049569 Ga0501032_0188764 Ga0501032_0188764_195_1235 313
814 3300049570 Ga0501033_0167316 Ga0501033_0167316_443_1471 313
815 3300049571 Ga0501034_0024144 Ga0501034_0024144_207_1244 313
816 3300049571 Ga0501034_0024924 Ga0501034_0024924_901_1929 313
817 3300049571 Ga0501034_0074987 Ga0501034_0074987_1842_2885 313
818 3300049571 Ga0501034_0198498 Ga0501034_0198498_873_1910 313
819 3300049571 Ga0501034_0388457 Ga0501034_0388457_54_1091 313
820 3300049572 Ga0501036_0046476 Ga0501036_0046476_2004_3047 313
821 3300049572 Ga0501036_0145405 Ga0501036_0145405_673_1701 313
822 3300049573 Ga0501037_0007495 Ga0501037_0007495_6584_7624 313
823 3300049574 Ga0501038_0047620 Ga0501038_0047620_318_1361 313
824 3300049574 Ga0501038_0057989 Ga0501038_0057989_574_1614 313
825 3300049574 Ga0501038_0110638 Ga0501038_0110638_657_1685 313
826 3300049575 Ga0501039_0042051 Ga0501039_0042051_1863_2906 313
827 3300049575 Ga0501039_0151510 Ga0501039_0151510_575_1615 313
828 3300049579 Ga0501043_0001798 Ga0501043_0001798_2365_3405 313
829 3300049579 Ga0501043_0002152 Ga0501043_0002152_6947_7975 313
830 3300049579 Ga0501043_0016289 Ga0501043_0016289_2138_3181 313
831 3300049579 Ga0501043_0056650 Ga0501043_0056650_991_2067 313
832 3300049580 Ga0501046_0041840 Ga0501046_0041840_326_1369 313
833 3300049580 Ga0501046_0151332 Ga0501046_0151332_107_1147 313
834 3300049581 Ga0501047_0032624 Ga0501047_0032624_1498_2535 313
835 3300049581 Ga0501047_0037183 Ga0501047_0037183_1214_2257 313
836 3300049581 Ga0501047_0041518 Ga0501047_0041518_225_1265 313
837 3300049581 Ga0501047_0049748 Ga0501047_0049748_362_1438 313
838 3300049581 Ga0501047_0143303 Ga0501047_0143303_720_1757 313
839 3300049583 Ga0501067_0015790 Ga0501067_0015790_2835_3878 313
840 3300049586 Ga0501070_0179530 Ga0501070_0179530_230_1267 313
841 3300049589 Ga0501073_0035482 Ga0501073_0035482_1288_2331 313
842 3300049590 Ga0501074_0021945 Ga0501074_0021945_1601_2644 313
843 3300049651 Ga0501201_000236 Ga0501201_000236_2242_3285 313
844 3300049652 Ga0501202_000452 Ga0501202_000452_3853_4896 313
845 3300049653 Ga0501206_000782 Ga0501206_000782_2122_3165 313
846 3300049654 Ga0501207_000054 Ga0501207_000054_5289_6332 313
847 3300049661 Ga0501217_000181 Ga0501217_000181_807_1850 313
848 3300049662 Ga0501222_004155 Ga0501222_004155_93_1136 313
849 3300049663 Ga0501223_003113 Ga0501223_003113_2394_3437 313
850 3300049664 Ga0501224_002202 Ga0501224_002202_814_1857 313
851 3300049668 Ga0501233_006861 Ga0501233_006861_689_1732 313
852 3300049673 Ga0501240_000840 Ga0501240_000840_790_1833 313
853 3300049675 Ga0501243_000876 Ga0501243_000876_2962_4005 313
854 3300049681 Ga0501251_000740 Ga0501251_000740_1130_2173 313
855 3300049686 Ga0501257_001703 Ga0501257_001703_409_1452 313
856 3300049688 Ga0501259_000287 Ga0501259_000287_6357_7400 313
857 3300049690 Ga0501261_000774 Ga0501261_000774_2470_3513 313
858 3300049703 Ga0501219_000020 Ga0501219_000020_19965_21002 313
859 3300049704 Ga0501221_000607 Ga0501221_000607_31_1074 313
860 3300049705 Ga0501225_0000285 Ga0501225_0000285_14207_15244 313
861 3300049708 Ga0501245_000238 Ga0501245_000238_4284_5327 313
862 3300049741 Ga0501079_0008887 Ga0501079_0008887_5380_6417 313
863 3300049741 Ga0501079_0034323 Ga0501079_0034323_1988_3031 313
864 3300049742 Ga0501080_0039205 Ga0501080_0039205_2293_3336 313
865 3300049742 Ga0501080_0109537 Ga0501080_0109537_577_1614 313
866 3300049744 Ga0501083_0015447 Ga0501083_0015447_4085_5122 313
867 3300049765 Ga0501268_007668 Ga0501268_007668_177_1220 313
868 3300049779 Ga0501283_004516 Ga0501283_004516_172_1215 313
869 3300049822 Ga0501035_0023552 Ga0501035_0023552_1833_2876 313
870 3300049822 Ga0501035_0132391 Ga0501035_0132391_95_1123 313
871 3300049823 Ga0501044_0005008 Ga0501044_0005008_2911_3948 313
872 3300049823 Ga0501044_0028917 Ga0501044_0028917_1938_2981 313
873 3300049823 Ga0501044_0031459 Ga0501044_0031459_3465_4502 313
874 3300049823 Ga0501044_0041171 Ga0501044_0041171_1187_2224 313
875 3300049823 Ga0501044_0149703 Ga0501044_0149703_885_1961 313
876 3300049823 Ga0501044_0174341 Ga0501044_0174341_657_1685 313
877 3300050005 Ga0501284_00030 Ga0501284_00030_22994_24031 313
878 3300050493 nmdc:mga0k408_103955_c1 nmdc:mga0k408_103955_c1_593_1630 313
879 3300050493 nmdc:mga0k408_26438_c1 nmdc:mga0k408_26438_c1_1455_2492 313
880 3300050493 nmdc:mga0k408_9076_c1 nmdc:mga0k408_9076_c1_495_1532 313
881 3300050507 nmdc:mga05p37_32575_c1 nmdc:mga05p37_32575_c1_1654_2787 313
882 3300050508 nmdc:mga09592_998_c1 nmdc:mga09592_998_c1_18075_19109 313
883 3300050511 nmdc:mga08y16_5081_c1 nmdc:mga08y16_5081_c1_10634_11677 313
884 3300050512 nmdc:mga0n895_35785_c1 nmdc:mga0n895_35785_c1_3196_4239 313
885 3300053086 Ga0500578_0000469 Ga0500578_0000469_8423_9850 313
886 3300053086 Ga0500578_0123206 Ga0500578_0123206_93_1130 313
887 3300053090 Ga0500646_0003186 Ga0500646_0003186_922_1959 313
888 3300053092 Ga0500583_0000182 Ga0500583_0000182_4727_5764 313
889 3300053092 Ga0500583_0000288 Ga0500583_0000288_2770_3948 313
890 3300053139 Ga0500568_0000155 Ga0500568_0000155_33979_35007 313
891 3300053146 Ga0500588_0002305 Ga0500588_0002305_2051_3091 313
892 3300053147 Ga0500589_003476 Ga0500589_003476_386_1423 313
893 3300053156 Ga0500622_0001399 Ga0500622_0001399_392_1429 313
894 3300053156 Ga0500622_0024966 Ga0500622_0024966_394_1431 313
895 3300053177 Ga0500636_0102165 Ga0500636_0102165_141_1178 313
896 3300053178 Ga0500637_0101020 Ga0500637_0101020_433_1470 313
897 3300054114 Ga0501084_0019472 Ga0501084_0019472_3935_4972 313
898 3300061719 Ga0466962_0004394 Ga0466962_0004394_651_1700 313
899 3300005327 Ga0070658_10018168 Ga0070658_100181688 314
900 3300005327 Ga0070658_10035739 Ga0070658_100357392 314
901 3300005327 Ga0070658_10036722 Ga0070658_100367221 314
902 3300005327 Ga0070658_10197762 Ga0070658_101977622 314
903 3300005329 Ga0070683_100141336 Ga0070683_1001413362 314
904 3300005329 Ga0070683_100245519 Ga0070683_1002455192 314
905 3300005336 Ga0070680_100004897 Ga0070680_1000048978 314
906 3300005336 Ga0070680_100009953 Ga0070680_1000099533 314
907 3300005336 Ga0070680_100075888 Ga0070680_1000758883 314
908 3300005337 Ga0070682_100038484 Ga0070682_1000384843 314
909 3300005339 Ga0070660_100000242 Ga0070660_1000002428 314
910 3300005339 Ga0070660_100107303 Ga0070660_1001073032 314
911 3300005347 Ga0070668_100409751 Ga0070668_1004097511 314
912 3300005366 Ga0070659_100066917 Ga0070659_1000669173 314
913 3300005455 Ga0070663_100035851 Ga0070663_1000358512 314
914 3300005455 Ga0070663_100111797 Ga0070663_1001117972 314
915 3300005455 Ga0070663_100121269 Ga0070663_1001212692 314
916 3300005458 Ga0070681_10069975 Ga0070681_100699752 314
917 3300005530 Ga0070679_100000216 Ga0070679_10000021625 314
918 3300005530 Ga0070679_100002882 Ga0070679_1000028829 314
919 3300005530 Ga0070679_100026094 Ga0070679_1000260945 314
920 3300005530 Ga0070679_100056098 Ga0070679_1000560982 314
921 3300005530 Ga0070679_100163284 Ga0070679_1001632842 314
922 3300005539 Ga0068853_100313543 Ga0068853_1003135431 314
923 3300005548 Ga0070665_100443516 Ga0070665_1004435162 314
924 3300005563 Ga0068855_100000189 Ga0068855_10000018938 314
925 3300005563 Ga0068855_100006503 Ga0068855_10000650315 314
926 3300005563 Ga0068855_100064228 Ga0068855_1000642284 314
927 3300005563 Ga0068855_100417914 Ga0068855_1004179141 314
928 3300005614 Ga0068856_100005092 Ga0068856_1000050927 314
929 3300005616 Ga0068852_100000633 Ga0068852_1000006339 314
930 3300005616 Ga0068852_100108980 Ga0068852_1001089802 314
931 3300005843 Ga0068860_100000759 Ga0068860_10000075933 314
932 3300005844 Ga0068862_100003608 Ga0068862_10000360812 314
933 3300009093 Ga0105240_10025004 Ga0105240_100250046 314
934 3300009174 Ga0105241_10130995 Ga0105241_101309951 314
935 3300009545 Ga0105237_10031026 Ga0105237_100310262 314
936 3300009553 Ga0105249_10492864 Ga0105249_104928642 314
937 3300010375 Ga0105239_10441177 Ga0105239_104411771 314
938 3300013100 Ga0157373_10037348 Ga0157373_100373483 314
939 3300013102 Ga0157371_10000518 Ga0157371_1000051828 314
940 3300013102 Ga0157371_10000650 Ga0157371_1000065028 314
941 3300013102 Ga0157371_10000898 Ga0157371_1000089835 314
942 3300013102 Ga0157371_10001280 Ga0157371_1000128021 314
943 3300013102 Ga0157371_10076478 Ga0157371_100764782 314
944 3300013104 Ga0157370_10000313 Ga0157370_100003133 314
945 3300013104 Ga0157370_10000478 Ga0157370_100004785 314
946 3300013104 Ga0157370_10006366 Ga0157370_100063667 314
947 3300013104 Ga0157370_10077626 Ga0157370_100776262 314
948 3300013105 Ga0157369_10015979 Ga0157369_100159792 314
949 3300013105 Ga0157369_10018825 Ga0157369_100188253 314
950 3300013105 Ga0157369_10032914 Ga0157369_100329147 314
951 3300013296 Ga0157374_10203631 Ga0157374_102036312 314
952 3300013306 Ga0163162_10157845 Ga0163162_101578451 314
953 3300013307 Ga0157372_10021759 Ga0157372_100217596 314
954 3300013307 Ga0157372_10023200 Ga0157372_100232009 314
955 3300013307 Ga0157372_10052578 Ga0157372_100525782 314
956 3300013307 Ga0157372_10137536 Ga0157372_101375361 314
957 3300013307 Ga0157372_10167152 Ga0157372_101671522 314
958 3300025904 Ga0207647_10009352 Ga0207647_100093526 314
959 3300025909 Ga0207705_10006383 Ga0207705_100063835 314
960 3300025909 Ga0207705_10033756 Ga0207705_100337564 314
961 3300025911 Ga0207654_10046622 Ga0207654_100466223 314
962 3300025912 Ga0207707_10126078 Ga0207707_101260781 314
963 3300025913 Ga0207695_10011310 Ga0207695_100113109 314
964 3300025917 Ga0207660_10002218 Ga0207660_100022185 314
965 3300025917 Ga0207660_10287939 Ga0207660_102879392 314
966 3300025919 Ga0207657_10148949 Ga0207657_101489492 314
967 3300025921 Ga0207652_10000090 Ga0207652_1000009056 314
968 3300025921 Ga0207652_10000999 Ga0207652_1000099919 314
969 3300025921 Ga0207652_10001591 Ga0207652_1000159116 314
970 3300025921 Ga0207652_10011840 Ga0207652_100118405 314
971 3300025921 Ga0207652_10059552 Ga0207652_100595522 314
972 3300025921 Ga0207652_10193882 Ga0207652_101938822 314
973 3300025925 Ga0207650_10197267 Ga0207650_101972672 314
974 3300025932 Ga0207690_10100317 Ga0207690_101003172 314
975 3300025940 Ga0207691_10094120 Ga0207691_100941203 314
976 3300025944 Ga0207661_10051748 Ga0207661_100517482 314
977 3300025949 Ga0207667_10000492 Ga0207667_1000049254 314
978 3300025949 Ga0207667_10002948 Ga0207667_1000294823 314
979 3300025949 Ga0207667_10013252 Ga0207667_100132523 314
980 3300026067 Ga0207678_10004101 Ga0207678_1000410114 314
981 3300026116 Ga0207674_10211388 Ga0207674_102113882 314
982 3300026142 Ga0207698_10026361 Ga0207698_100263612 314
983 3300026142 Ga0207698_10045981 Ga0207698_100459812 314
984 3300028381 Ga0268264_10007210 Ga0268264_100072107 314
985 3300037312 Ga0395899_0034830 Ga0395899_0034830_2178_3221 314
986 3300037418 Ga0395900_0000927 Ga0395900_0000927_9779_10819 314
987 3300037418 Ga0395900_0032022 Ga0395900_0032022_3427_4464 314
988 3300037466 Ga0395898_0009829 Ga0395898_0009829_6512_7552 314
989 3300037466 Ga0395898_0313565 Ga0395898_0313565_441_1478 314
990 3300037471 Ga0395905_0095772 Ga0395905_0095772_136_1173 314
991 3300038443 Ga0395901_0001347 Ga0395901_0001347_22981_24021 314
992 3300038443 Ga0395901_0010081 Ga0395901_0010081_1342_2382 314
993 3300046616 Ga0495668_0000257 Ga0495668_0000257_961_1998 314
994 3300048924 Ga0496121_0000086 Ga0496121_0000086_95545_96549 314
995 3300049571 Ga0501034_0000002 Ga0501034_0000002_81749_82795 314
996 3300049586 Ga0501070_0259217 Ga0501070_0259217_232_1272 314
997 3300049822 Ga0501035_0102713 Ga0501035_0102713_962_2002 314
998 3300049823 Ga0501044_0472302 Ga0501044_0472302_78_1115 314
999 iso_pu_bacteria 2840677318 2840679021 314
1000 iso_pu_bacteria 2883068021 2883070302 314
1001 iso_pu_bacteria 2896085136 2896086834 314
1002 3300003794 Ga0055531_10000059 Ga0055531_1000005947 315
1003 3300025304 Ga0209257_1000070 Ga0209257_1000070226 315
1004 3300041997 Ga0439431_0001588 Ga0439431_0001588_2418_3437 315
1005 3300042004 Ga0439445_0024350 Ga0439445_0024350_191_1210 315
1006 3300046453 Ga0495627_019616 Ga0495627_019616_876_1895 315
1007 3300046558 Ga0495633_0000089 Ga0495633_0000089_7788_8807 315
1008 3300049758 Ga0501241_000145 Ga0501241_000145_2540_3562 315
1009 3300053093 Ga0500651_0093030 Ga0500651_0093030_139_1158 315
1010 iso_pu_bacteria 2929177148 2929177974 315
1011 iso_pu_bacteria 2945977869 2945980328 315
1012 iso_pu_bacteria 2946013367 2946013808 315
1013 3300003320 rootH2_10013765 rootH2_100137656 316
1014 3300005262 Ga0065165_1004314 Ga0065165_100431410 316
1015 3300025208 Ga0209436_100742 Ga0209436_1007425 316
1016 3300025284 Ga0209130_1001880 Ga0209130_100188010 316
1017 3300025302 Ga0207426_1000033 Ga0207426_1000033214 316
1018 3300053088 Ga0500644_0000545 Ga0500644_0000545_13514_14518 316
1019 3300053160 Ga0500633_0000426 Ga0500633_0000426_630_1634 316
1020 iso_pu_bacteria 2896109856 2896112822 316
1021 iso_pu_bacteria 2929921140 2929922046 316
1022 iso_pu_bacteria 8003151029 8003155735 316
1023 3300049671 Ga0501238_002085 Ga0501238_002085_441_1454 317
1024 iso_pu_bacteria 2884791551 2884796512 317
1025 3300002738 JGI25154J39366_1000003 JGI25154J39366_100000361 320
1026 3300025246 Ga0209646_1000004 Ga0209646_1000004276 320
1027 3300025250 Ga0209026_1000156 Ga0209026_100015666 320
1028 3300003322 rootL2_10017734 rootL2_100177344 322
1029 3300001989 JGI24739J22299_10000023 JGI24739J22299_1000002340 324
1030 3300003354 JGI25160J50197_1015108 JGI25160J50197_10151082 324
1031 3300003790 Ga0055528_1000539 Ga0055528_10005396 324
1032 3300003791 Ga0055530_10000620 Ga0055530_1000062023 324
1033 3300004625 Ga0055543_1008738 Ga0055543_10087383 324
1034 3300005262 Ga0065165_1001718 Ga0065165_100171817 324
1035 3300025273 Ga0209673_1000258 Ga0209673_10002582 324
1036 3300025298 Ga0209050_1000097 Ga0209050_100009714 324
1037 3300025302 Ga0207426_1000472 Ga0207426_100047250 324
1038 3300025304 Ga0209257_1005191 Ga0209257_10051915 324
1039 3300003323 rootH1_10014197 rootH1_100141974 326
1040 3300014325 Ga0163163_10160777 Ga0163163_101607772 328
1041 3300025941 Ga0207711_10224042 Ga0207711_102240422 328
1042 3300053136 Ga0500559_0044762 Ga0500559_0044762_575_1645 329
1043 3300053177 Ga0500636_0029952 Ga0500636_0029952_1712_2782 329
1044 3300015265 Ga0182005_1000161 Ga0182005_100016115 337
1045 iso_pu_bacteria 2818991442 2819574743 337
1046 3300001979 JGI24740J21852_10001374 JGI24740J21852_100013743 341
1047 3300003215 JGI25153J46596_10000403 JGI25153J46596_100004036 341
1048 3300003354 JGI25160J50197_1010623 JGI25160J50197_10106232 341
1049 3300025297 Ga0209758_1007402 Ga0209758_10074027 341
1050 3300025302 Ga0207426_1000321 Ga0207426_100032120 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01210

NAD_Gly3P_dh_N

NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

52

211

0.95

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

52

157

0.95

PF07479

NAD_Gly3P_dh_C

NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus

230

388

0.95

PF20618

GPD_NAD_C_bact

Bacterial GPD, NAD-dependent C-terminal

307

373

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k4j-assembly1.cif.gz_A pyranose 2-oxidase h450q mutant 0.9355 23 50
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.9336 22 50
7kho-assembly2.cif.gz_B nica2 variant n462v in complex with (s)-nicotine 0.9323 23 50
4up3-assembly1.cif.gz_B crystal structure of the mutant c140s,c286q thioredoxin reductase from entamoeba histolytica 0.9309 22 50
4moi-assembly1.cif.gz_A pyranose 2-oxidase h450g/v546c double mutant with 3-fluorinated glucose 0.9307 23 50
ID Description Score Start End Superfamily
af_P9WN77_2_187_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9452 21 203 3.40.50.720
af_P9WN77_2_187_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9209 21 203 3.40.50.720
1z82B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9191 24 206 3.40.50.720
3k96B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.919 22 207 3.40.50.720
2q7vB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9167 24 53 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A388Q292-F1-model_v4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] 0.9896 21 212 GO:0005829
GO:0046168
GO:0047952
GO:0051287
AF-A0A838TRA3-F1-model_v4 NAD(P)-binding domain-containing protein 0.9859 19 107 GO:0005829
GO:0046168
GO:0047952
GO:0051287
AF-A0A353RBC3-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.9836 22 213 GO:0005829
GO:0046168
GO:0047952
GO:0051287
AF-A0A357Z8I8-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.9804 16 192 GO:0005829
GO:0046168
GO:0047952
GO:0051287
AF-A0A4Q3UNA3-F1-model_v4 Glycerol-3-phosphate dehydrogenase NAD-dependent N-terminal domain-containing protein 0.9699 21 166 GO:0005829
GO:0046168
GO:0047952
GO:0051287

Feature Viewer

pLDDT pTM Quality
84.24 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map