F489064
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1050 | 349 | 1032 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300053086|Ga0500578_0000469|Ga0500578_0000469_8423_9850 |
| Length | 395 |
| Sequence | LQLVACGWLSVFAYGFQLSALSCILYLYLPSAFGLKPLAVFSYFWRNKNYMQLGILGSGSWATALAKICTDNKQSINWCVRSEEIVNHIQQRHHNPGYLSSVYFDTNLVNLSTDIAGTIAASDCILIATPSAYVTATLNNLPANAFDGKKVLSAVKGILPDTNLLLNDHLKQAFNLPLSDYFTVMGPCHAEEVASEKLSYLTFSGIDVAMAEKIAALFTTPYLNTIVNPDVYGVQYAAVLKNIYALGAGIAHGLEYGDNFLSVLIANCADEMAGFLKKVGIQHMEVGVHDGEDPVTHRKTPNYAASVYLGDLLVTCYSLYSRNRTFGNMIGKGYSVRATQLEMNMVAEGYNASKCIYLVNQQIGADMPIAETVYRILWENVKPRKGFNLVEKTLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 4 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 5 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 6 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 7 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 8 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 9 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 10 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 11 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 12 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 13 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 14 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 15 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 16 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 17 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 36 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 225 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 236 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 270 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 271 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 287 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 290 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 291 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 292 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 293 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 299 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 302 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 304 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 305 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 306 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 308 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 313 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 319 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 327 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 328 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 329 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 332 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 337 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 338 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 341 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 343 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 345 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 348 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 349 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.29 |
| Metatranscriptomes | 0 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.71 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 89.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001374 | 3300001979 | Bacteria | 11112 |
| 2 | JGI24740J21852_10014041 | 3300001979 | Bacteria | 2968 |
| 3 | JGI24739J22299_10000023 | 3300001989 | Bacteria | 44535 |
| 4 | JGI24751J29686_10000655 | 3300002459 | Bacteria | 8686 |
| 5 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 6 | JGI25406J46586_10004435 | 3300003203 | Bacteria | 6531 |
| 7 | JGI25153J46596_10000403 | 3300003215 | Bacteria | 28759 |
| 8 | rootH1_10143070 | 3300003316 | Bacteria | 2488 |
| 9 | rootH1_10156821 | 3300003316 | Bacteria | 1756 |
| 10 | rootH2_10006582 | 3300003320 | Bacteria | 17739 |
| 11 | rootH2_10013765 | 3300003320 | Bacteria | 12637 |
| 12 | rootH2_10022930 | 3300003320 | Bacteria | 32910 |
| 13 | rootL2_10017734 | 3300003322 | Bacteria | 7561 |
| 14 | rootL2_10030107 | 3300003322 | Unclassified | 4518 |
| 15 | rootL2_10031071 | 3300003322 | Bacteria | 5300 |
| 16 | rootL2_10136943 | 3300003322 | Bacteria | 2790 |
| 17 | rootL2_10140353 | 3300003322 | Bacteria | 7821 |
| 18 | rootL2_10210810 | 3300003322 | Unclassified | 2045 |
| 19 | rootH1_10014197 | 3300003323 | Bacteria | 13041 |
| 20 | rootH1_10159681 | 3300003323 | Bacteria | 9126 |
| 21 | JGI25160J50197_1002148 | 3300003354 | Bacteria | 9337 |
| 22 | JGI25160J50197_1010623 | 3300003354 | Bacteria | 3315 |
| 23 | JGI25160J50197_1015108 | 3300003354 | Bacteria | 2549 |
| 24 | Ga0055535_1001304 | 3300003761 | Bacteria | 13346 |
| 25 | Ga0055528_1000539 | 3300003790 | Bacteria | 28875 |
| 26 | Ga0055530_10000620 | 3300003791 | Bacteria | 30853 |
| 27 | Ga0055531_10000059 | 3300003794 | Bacteria | 121487 |
| 28 | Ga0055543_1008738 | 3300004625 | Bacteria | 2222 |
| 29 | Ga0065165_1001718 | 3300005262 | Bacteria | 21974 |
| 30 | Ga0065165_1004314 | 3300005262 | Bacteria | 8941 |
| 31 | Ga0065712_10000981 | 3300005290 | Bacteria | 7537 |
| 32 | Ga0065712_10008215 | 3300005290 | Bacteria | 3954 |
| 33 | Ga0065712_10119802 | 3300005290 | Bacteria | 1687 |
| 34 | Ga0065715_10092426 | 3300005293 | Bacteria | 5130 |
| 35 | Ga0070658_10000832 | 3300005327 | Bacteria | 26408 |
| 36 | Ga0070658_10018168 | 3300005327 | Bacteria | 5625 |
| 37 | Ga0070658_10035739 | 3300005327 | Bacteria | 4003 |
| 38 | Ga0070658_10036722 | 3300005327 | Bacteria | 3949 |
| 39 | Ga0070658_10140561 | 3300005327 | Bacteria | 2017 |
| 40 | Ga0070658_10197762 | 3300005327 | Bacteria | 1695 |
| 41 | Ga0070676_10001192 | 3300005328 | Bacteria | 13022 |
| 42 | Ga0070676_10014551 | 3300005328 | Bacteria | 4326 |
| 43 | Ga0070676_10020608 | 3300005328 | Bacteria | 3684 |
| 44 | Ga0070683_100002583 | 3300005329 | Bacteria | 14483 |
| 45 | Ga0070683_100006473 | 3300005329 | Bacteria | 9832 |
| 46 | Ga0070683_100014557 | 3300005329 | Bacteria | 6886 |
| 47 | Ga0070683_100063547 | 3300005329 | Bacteria | 3434 |
| 48 | Ga0070683_100081819 | 3300005329 | Bacteria | 3024 |
| 49 | Ga0070683_100135703 | 3300005329 | Bacteria | 2330 |
| 50 | Ga0070683_100141336 | 3300005329 | Bacteria | 2281 |
| 51 | Ga0070683_100245519 | 3300005329 | Bacteria | 1703 |
| 52 | Ga0070670_100019919 | 3300005331 | Bacteria | 5759 |
| 53 | Ga0070670_100040716 | 3300005331 | Bacteria | 3993 |
| 54 | Ga0070670_100048124 | 3300005331 | Bacteria | 3669 |
| 55 | Ga0070670_100065603 | 3300005331 | Bacteria | 3115 |
| 56 | Ga0070670_100303798 | 3300005331 | Unclassified | 1396 |
| 57 | Ga0068869_100002227 | 3300005334 | Bacteria | 11658 |
| 58 | Ga0068869_100002467 | 3300005334 | Bacteria | 11156 |
| 59 | Ga0068869_100018710 | 3300005334 | Bacteria | 4721 |
| 60 | Ga0068869_100020876 | 3300005334 | Bacteria | 4499 |
| 61 | Ga0068869_100028959 | 3300005334 | Bacteria | 3875 |
| 62 | Ga0068869_100030116 | 3300005334 | Unclassified | 3807 |
| 63 | Ga0068869_100061749 | 3300005334 | Bacteria | 2749 |
| 64 | Ga0068869_100140058 | 3300005334 | Bacteria | 1867 |
| 65 | Ga0068869_100145070 | 3300005334 | Unclassified | 1836 |
| 66 | Ga0070666_10000227 | 3300005335 | Bacteria | 38376 |
| 67 | Ga0070666_10000694 | 3300005335 | Bacteria | 20427 |
| 68 | Ga0070666_10013725 | 3300005335 | Bacteria | 5143 |
| 69 | Ga0070666_10027886 | 3300005335 | Bacteria | 3702 |
| 70 | Ga0070666_10138650 | 3300005335 | Bacteria | 1694 |
| 71 | Ga0070680_100000268 | 3300005336 | Bacteria | 34613 |
| 72 | Ga0070680_100004897 | 3300005336 | Bacteria | 10085 |
| 73 | Ga0070680_100009953 | 3300005336 | Bacteria | 7322 |
| 74 | Ga0070680_100063728 | 3300005336 | Bacteria | 3020 |
| 75 | Ga0070680_100075888 | 3300005336 | Bacteria | 2767 |
| 76 | Ga0070682_100002103 | 3300005337 | Bacteria | 11066 |
| 77 | Ga0070682_100038484 | 3300005337 | Bacteria | 2934 |
| 78 | Ga0070682_100047897 | 3300005337 | Bacteria | 2659 |
| 79 | Ga0068868_100000022 | 3300005338 | Bacteria | 85904 |
| 80 | Ga0068868_100003164 | 3300005338 | Bacteria | 11456 |
| 81 | Ga0068868_100017935 | 3300005338 | Bacteria | 5281 |
| 82 | Ga0068868_100047437 | 3300005338 | Unclassified | 3367 |
| 83 | Ga0068868_100098971 | 3300005338 | Bacteria | 2358 |
| 84 | Ga0068868_100135613 | 3300005338 | Bacteria | 2017 |
| 85 | Ga0070660_100000242 | 3300005339 | Bacteria | 36371 |
| 86 | Ga0070660_100008803 | 3300005339 | Bacteria | 7071 |
| 87 | Ga0070660_100107303 | 3300005339 | Bacteria | 2219 |
| 88 | Ga0070660_100134960 | 3300005339 | Bacteria | 1977 |
| 89 | Ga0070660_100212691 | 3300005339 | Bacteria | 1570 |
| 90 | Ga0070689_100004351 | 3300005340 | Bacteria | 9558 |
| 91 | Ga0070689_100065434 | 3300005340 | Unclassified | 2831 |
| 92 | Ga0070689_100091265 | 3300005340 | Bacteria | 2401 |
| 93 | Ga0070689_100125780 | 3300005340 | Unclassified | 2051 |
| 94 | Ga0070689_100187974 | 3300005340 | Bacteria | 1681 |
| 95 | Ga0070689_100348523 | 3300005340 | Bacteria | 1241 |
| 96 | Ga0070691_10000271 | 3300005341 | Bacteria | 18096 |
| 97 | Ga0070691_10044554 | 3300005341 | Unclassified | 2104 |
| 98 | Ga0070687_100007090 | 3300005343 | Bacteria | 4641 |
| 99 | Ga0070661_100000111 | 3300005344 | Bacteria | 68066 |
| 100 | Ga0070661_100004089 | 3300005344 | Bacteria | 10051 |
| 101 | Ga0070661_100020641 | 3300005344 | Bacteria | 4698 |
| 102 | Ga0070661_100023047 | 3300005344 | Bacteria | 4461 |
| 103 | Ga0070668_100000016 | 3300005347 | Bacteria | 104092 |
| 104 | Ga0070668_100045177 | 3300005347 | Unclassified | 3380 |
| 105 | Ga0070668_100062465 | 3300005347 | Unclassified | 2886 |
| 106 | Ga0070668_100063538 | 3300005347 | Bacteria | 2862 |
| 107 | Ga0070668_100351620 | 3300005347 | Bacteria | 1247 |
| 108 | Ga0070668_100409751 | 3300005347 | Bacteria | 1159 |
| 109 | Ga0070669_100022311 | 3300005353 | Bacteria | 4527 |
| 110 | Ga0070669_100065523 | 3300005353 | Bacteria | 2676 |
| 111 | Ga0070675_100005753 | 3300005354 | Bacteria | 9483 |
| 112 | Ga0070675_100059203 | 3300005354 | Bacteria | 3159 |
| 113 | Ga0070675_100073229 | 3300005354 | Bacteria | 2844 |
| 114 | Ga0070675_100075650 | 3300005354 | Bacteria | 2799 |
| 115 | Ga0070671_100001071 | 3300005355 | Bacteria | 20211 |
| 116 | Ga0070671_100028175 | 3300005355 | Bacteria | 4625 |
| 117 | Ga0070671_100123973 | 3300005355 | Bacteria | 2175 |
| 118 | Ga0070671_100141853 | 3300005355 | Bacteria | 2027 |
| 119 | Ga0070671_100169224 | 3300005355 | Bacteria | 1848 |
| 120 | Ga0070674_100005491 | 3300005356 | Bacteria | 7329 |
| 121 | Ga0070673_100001320 | 3300005364 | Bacteria | 14462 |
| 122 | Ga0070673_100006098 | 3300005364 | Bacteria | 7810 |
| 123 | Ga0070673_100010627 | 3300005364 | Bacteria | 6239 |
| 124 | Ga0070673_100012671 | 3300005364 | Bacteria | 5798 |
| 125 | Ga0070673_100039851 | 3300005364 | Bacteria | 3599 |
| 126 | Ga0070673_100085000 | 3300005364 | Bacteria | 2575 |
| 127 | Ga0070673_100096802 | 3300005364 | Bacteria | 2422 |
| 128 | Ga0070673_100137603 | 3300005364 | Bacteria | 2057 |
| 129 | Ga0070673_100145854 | 3300005364 | Bacteria | 2001 |
| 130 | Ga0070673_100182317 | 3300005364 | Bacteria | 1798 |
| 131 | Ga0070673_100203564 | 3300005364 | Bacteria | 1706 |
| 132 | Ga0070688_100008316 | 3300005365 | Bacteria | 5629 |
| 133 | Ga0070688_100011264 | 3300005365 | Bacteria | 4965 |
| 134 | Ga0070688_100013987 | 3300005365 | Bacteria | 4539 |
| 135 | Ga0070688_100024308 | 3300005365 | Bacteria | 3573 |
| 136 | Ga0070688_100182867 | 3300005365 | Bacteria | 1455 |
| 137 | Ga0070688_100229087 | 3300005365 | Unclassified | 1313 |
| 138 | Ga0070659_100003782 | 3300005366 | Bacteria | 10802 |
| 139 | Ga0070659_100040579 | 3300005366 | Bacteria | 3637 |
| 140 | Ga0070659_100042015 | 3300005366 | Bacteria | 3575 |
| 141 | Ga0070659_100066917 | 3300005366 | Bacteria | 2848 |
| 142 | Ga0070659_100102391 | 3300005366 | Bacteria | 2305 |
| 143 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 144 | Ga0070667_100002868 | 3300005367 | Bacteria | 14864 |
| 145 | Ga0070667_100006052 | 3300005367 | Bacteria | 10050 |
| 146 | Ga0070667_100031584 | 3300005367 | Bacteria | 4415 |
| 147 | Ga0070667_100053044 | 3300005367 | Bacteria | 3422 |
| 148 | Ga0070667_100126075 | 3300005367 | Unclassified | 2231 |
| 149 | Ga0070667_100278089 | 3300005367 | Bacteria | 1503 |
| 150 | Ga0070667_100352654 | 3300005367 | Bacteria | 1332 |
| 151 | Ga0070700_100194936 | 3300005441 | Bacteria | 1419 |
| 152 | Ga0070700_100236087 | 3300005441 | Unclassified | 1304 |
| 153 | Ga0070663_100035851 | 3300005455 | Bacteria | 3444 |
| 154 | Ga0070663_100111797 | 3300005455 | Bacteria | 2053 |
| 155 | Ga0070663_100117806 | 3300005455 | Bacteria | 2003 |
| 156 | Ga0070663_100121269 | 3300005455 | Bacteria | 1975 |
| 157 | Ga0070663_100194980 | 3300005455 | Unclassified | 1578 |
| 158 | Ga0070678_100010645 | 3300005456 | Bacteria | 5632 |
| 159 | Ga0070678_100014076 | 3300005456 | Bacteria | 5034 |
| 160 | Ga0070678_100020255 | 3300005456 | Bacteria | 4360 |
| 161 | Ga0070678_100095149 | 3300005456 | Unclassified | 2295 |
| 162 | Ga0070662_100002529 | 3300005457 | Bacteria | 11273 |
| 163 | Ga0070662_100005807 | 3300005457 | Bacteria | 7913 |
| 164 | Ga0070662_100044335 | 3300005457 | Bacteria | 3185 |
| 165 | Ga0070662_100048534 | 3300005457 | Bacteria | 3059 |
| 166 | Ga0070681_10035895 | 3300005458 | Bacteria | 4979 |
| 167 | Ga0070681_10069975 | 3300005458 | Bacteria | 3475 |
| 168 | Ga0070681_10122987 | 3300005458 | Bacteria | 2528 |
| 169 | Ga0068867_100015222 | 3300005459 | Bacteria | 5454 |
| 170 | Ga0068867_100016665 | 3300005459 | Bacteria | 5219 |
| 171 | Ga0068867_100150717 | 3300005459 | Bacteria | 1826 |
| 172 | Ga0070685_10016650 | 3300005466 | Unclassified | 3921 |
| 173 | Ga0070685_10018581 | 3300005466 | Bacteria | 3740 |
| 174 | Ga0070685_10027573 | 3300005466 | Bacteria | 3141 |
| 175 | Ga0070685_10032207 | 3300005466 | Bacteria | 2935 |
| 176 | Ga0070685_10126557 | 3300005466 | Bacteria | 1592 |
| 177 | Ga0070698_100006358 | 3300005471 | Bacteria | 12830 |
| 178 | Ga0070698_100017780 | 3300005471 | Bacteria | 7488 |
| 179 | Ga0070698_100027882 | 3300005471 | Bacteria | 5867 |
| 180 | Ga0070679_100000216 | 3300005530 | Bacteria | 46886 |
| 181 | Ga0070679_100002882 | 3300005530 | Bacteria | 15627 |
| 182 | Ga0070679_100026094 | 3300005530 | Bacteria | 5736 |
| 183 | Ga0070679_100038338 | 3300005530 | Bacteria | 4763 |
| 184 | Ga0070679_100056098 | 3300005530 | Bacteria | 3924 |
| 185 | Ga0070679_100163284 | 3300005530 | Bacteria | 2201 |
| 186 | Ga0070679_100171712 | 3300005530 | Bacteria | 2141 |
| 187 | Ga0070679_100233018 | 3300005530 | Bacteria | 1801 |
| 188 | Ga0070679_100354035 | 3300005530 | Bacteria | 1416 |
| 189 | Ga0070684_100000105 | 3300005535 | Bacteria | 54272 |
| 190 | Ga0070684_100004644 | 3300005535 | Bacteria | 10480 |
| 191 | Ga0070684_100010934 | 3300005535 | Bacteria | 7213 |
| 192 | Ga0070684_100031540 | 3300005535 | Unclassified | 4512 |
| 193 | Ga0068853_100003177 | 3300005539 | Bacteria | 12555 |
| 194 | Ga0068853_100003898 | 3300005539 | Bacteria | 11435 |
| 195 | Ga0068853_100025442 | 3300005539 | Bacteria | 4967 |
| 196 | Ga0068853_100079728 | 3300005539 | Bacteria | 2863 |
| 197 | Ga0068853_100109535 | 3300005539 | Bacteria | 2451 |
| 198 | Ga0068853_100117561 | 3300005539 | Unclassified | 2368 |
| 199 | Ga0068853_100184767 | 3300005539 | Bacteria | 1892 |
| 200 | Ga0068853_100313543 | 3300005539 | Bacteria | 1453 |
| 201 | Ga0070672_100000002 | 3300005543 | Bacteria | 159809 |
| 202 | Ga0070672_100022551 | 3300005543 | Bacteria | 4627 |
| 203 | Ga0070672_100059364 | 3300005543 | Bacteria | 3009 |
| 204 | Ga0070672_100218899 | 3300005543 | Unclassified | 1596 |
| 205 | Ga0070672_100287476 | 3300005543 | Bacteria | 1391 |
| 206 | Ga0070686_100011399 | 3300005544 | Bacteria | 5042 |
| 207 | Ga0070693_100117870 | 3300005547 | Unclassified | 1643 |
| 208 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 209 | Ga0070665_100002900 | 3300005548 | Bacteria | 18521 |
| 210 | Ga0070665_100005140 | 3300005548 | Bacteria | 13552 |
| 211 | Ga0070665_100233197 | 3300005548 | Bacteria | 1841 |
| 212 | Ga0070665_100443516 | 3300005548 | Bacteria | 1307 |
| 213 | Ga0068855_100000189 | 3300005563 | Bacteria | 79227 |
| 214 | Ga0068855_100006230 | 3300005563 | Bacteria | 14539 |
| 215 | Ga0068855_100006503 | 3300005563 | Bacteria | 14208 |
| 216 | Ga0068855_100011315 | 3300005563 | Bacteria | 10775 |
| 217 | Ga0068855_100026647 | 3300005563 | Bacteria | 6916 |
| 218 | Ga0068855_100036601 | 3300005563 | Bacteria | 5840 |
| 219 | Ga0068855_100064228 | 3300005563 | Bacteria | 4281 |
| 220 | Ga0068855_100084962 | 3300005563 | Bacteria | 3663 |
| 221 | Ga0068855_100122489 | 3300005563 | Bacteria | 2975 |
| 222 | Ga0068855_100417914 | 3300005563 | Bacteria | 1467 |
| 223 | Ga0070664_100000838 | 3300005564 | Bacteria | 23738 |
| 224 | Ga0070664_100019311 | 3300005564 | Bacteria | 5607 |
| 225 | Ga0070664_100053101 | 3300005564 | Bacteria | 3434 |
| 226 | Ga0070664_100095816 | 3300005564 | Bacteria | 2574 |
| 227 | Ga0070664_100245787 | 3300005564 | Unclassified | 1607 |
| 228 | Ga0068857_100005990 | 3300005577 | Bacteria | 10383 |
| 229 | Ga0068857_100010255 | 3300005577 | Bacteria | 8144 |
| 230 | Ga0068857_100076991 | 3300005577 | Bacteria | 2975 |
| 231 | Ga0068854_100035375 | 3300005578 | Bacteria | 3495 |
| 232 | Ga0068854_100178680 | 3300005578 | Bacteria | 1657 |
| 233 | Ga0068854_100224069 | 3300005578 | Unclassified | 1489 |
| 234 | Ga0068856_100005092 | 3300005614 | Bacteria | 12994 |
| 235 | Ga0068856_100053633 | 3300005614 | Bacteria | 3976 |
| 236 | Ga0068856_100080993 | 3300005614 | Bacteria | 3221 |
| 237 | Ga0068856_100087124 | 3300005614 | Bacteria | 3104 |
| 238 | Ga0068852_100000460 | 3300005616 | Bacteria | 26906 |
| 239 | Ga0068852_100000633 | 3300005616 | Bacteria | 22982 |
| 240 | Ga0068852_100001918 | 3300005616 | Bacteria | 14168 |
| 241 | Ga0068852_100018543 | 3300005616 | Bacteria | 5485 |
| 242 | Ga0068852_100023625 | 3300005616 | Unclassified | 4951 |
| 243 | Ga0068852_100108980 | 3300005616 | Bacteria | 2514 |
| 244 | Ga0068852_100141541 | 3300005616 | Bacteria | 2227 |
| 245 | Ga0068852_100461213 | 3300005616 | Bacteria | 1260 |
| 246 | Ga0068859_100000025 | 3300005617 | Bacteria | 191679 |
| 247 | Ga0068859_100000620 | 3300005617 | Bacteria | 35497 |
| 248 | Ga0068859_100007242 | 3300005617 | Bacteria | 11253 |
| 249 | Ga0068859_100022623 | 3300005617 | Bacteria | 6303 |
| 250 | Ga0068859_100044096 | 3300005617 | Unclassified | 4482 |
| 251 | Ga0068859_100061860 | 3300005617 | Bacteria | 3773 |
| 252 | Ga0068859_100085924 | 3300005617 | Unclassified | 3191 |
| 253 | Ga0068859_100174716 | 3300005617 | Bacteria | 2230 |
| 254 | Ga0068859_100517289 | 3300005617 | Unclassified | 1288 |
| 255 | Ga0068859_100522180 | 3300005617 | Bacteria | 1282 |
| 256 | Ga0068859_100702117 | 3300005617 | Bacteria | 1102 |
| 257 | Ga0068864_100008996 | 3300005618 | Bacteria | 8236 |
| 258 | Ga0068864_100034999 | 3300005618 | Bacteria | 4274 |
| 259 | Ga0068864_100135926 | 3300005618 | Bacteria | 2213 |
| 260 | Ga0068864_100170277 | 3300005618 | Bacteria | 1985 |
| 261 | Ga0068864_100256941 | 3300005618 | Bacteria | 1624 |
| 262 | Ga0068866_10005900 | 3300005718 | Bacteria | 5090 |
| 263 | Ga0068861_100003363 | 3300005719 | Bacteria | 10599 |
| 264 | Ga0068861_100012731 | 3300005719 | Bacteria | 5871 |
| 265 | Ga0068861_100021936 | 3300005719 | Bacteria | 4594 |
| 266 | Ga0068861_100044425 | 3300005719 | Unclassified | 3341 |
| 267 | Ga0068861_100267172 | 3300005719 | Unclassified | 1467 |
| 268 | Ga0068861_100378531 | 3300005719 | Bacteria | 1250 |
| 269 | Ga0068851_10002711 | 3300005834 | Bacteria | 7805 |
| 270 | Ga0068851_10006509 | 3300005834 | Bacteria | 5333 |
| 271 | Ga0068870_10006813 | 3300005840 | Bacteria | 5065 |
| 272 | Ga0068870_10008538 | 3300005840 | Bacteria | 4613 |
| 273 | Ga0068870_10112569 | 3300005840 | Bacteria | 1556 |
| 274 | Ga0068863_100000828 | 3300005841 | Bacteria | 31036 |
| 275 | Ga0068863_100003289 | 3300005841 | Bacteria | 15952 |
| 276 | Ga0068863_100022535 | 3300005841 | Bacteria | 6014 |
| 277 | Ga0068863_100040932 | 3300005841 | Bacteria | 4405 |
| 278 | Ga0068863_100045188 | 3300005841 | Bacteria | 4180 |
| 279 | Ga0068863_100046509 | 3300005841 | Bacteria | 4118 |
| 280 | Ga0068863_100105018 | 3300005841 | Bacteria | 2687 |
| 281 | Ga0068863_100114161 | 3300005841 | Unclassified | 2573 |
| 282 | Ga0068863_100344777 | 3300005841 | Unclassified | 1450 |
| 283 | Ga0068858_100000083 | 3300005842 | Bacteria | 98991 |
| 284 | Ga0068858_100131898 | 3300005842 | Bacteria | 2343 |
| 285 | Ga0068858_100175183 | 3300005842 | Bacteria | 2024 |
| 286 | Ga0068858_100453753 | 3300005842 | Unclassified | 1235 |
| 287 | Ga0068860_100000394 | 3300005843 | Bacteria | 57127 |
| 288 | Ga0068860_100000759 | 3300005843 | Bacteria | 36404 |
| 289 | Ga0068860_100002803 | 3300005843 | Bacteria | 18140 |
| 290 | Ga0068860_100004639 | 3300005843 | Bacteria | 14035 |
| 291 | Ga0068860_100004908 | 3300005843 | Bacteria | 13628 |
| 292 | Ga0068860_100014242 | 3300005843 | Bacteria | 7797 |
| 293 | Ga0068860_100014820 | 3300005843 | Bacteria | 7626 |
| 294 | Ga0068860_100031932 | 3300005843 | Bacteria | 5062 |
| 295 | Ga0068860_100169845 | 3300005843 | Unclassified | 2106 |
| 296 | Ga0068860_100180768 | 3300005843 | Bacteria | 2038 |
| 297 | Ga0068862_100003608 | 3300005844 | Bacteria | 13253 |
| 298 | Ga0068862_100086852 | 3300005844 | Bacteria | 2720 |
| 299 | Ga0068862_100208129 | 3300005844 | Bacteria | 1766 |
| 300 | Ga0068862_100246178 | 3300005844 | Bacteria | 1628 |
| 301 | Ga0068862_100452038 | 3300005844 | Bacteria | 1211 |
| 302 | Ga0081540_1004387 | 3300005983 | Bacteria | 10781 |
| 303 | Ga0081539_10000910 | 3300005985 | Bacteria | 55996 |
| 304 | Ga0075366_10001639 | 3300006195 | Bacteria | 11231 |
| 305 | Ga0075366_10050762 | 3300006195 | Bacteria | 2464 |
| 306 | Ga0097621_100000359 | 3300006237 | Bacteria | 31567 |
| 307 | Ga0097621_100005579 | 3300006237 | Bacteria | 8871 |
| 308 | Ga0097621_100015918 | 3300006237 | Bacteria | 5672 |
| 309 | Ga0097621_100019163 | 3300006237 | Bacteria | 5246 |
| 310 | Ga0097621_100021087 | 3300006237 | Bacteria | 5032 |
| 311 | Ga0097621_100033861 | 3300006237 | Bacteria | 4072 |
| 312 | Ga0097621_100092867 | 3300006237 | Unclassified | 2528 |
| 313 | Ga0097621_100143433 | 3300006237 | Bacteria | 2043 |
| 314 | Ga0097621_100212062 | 3300006237 | Bacteria | 1685 |
| 315 | Ga0068871_100000201 | 3300006358 | Bacteria | 41079 |
| 316 | Ga0068871_100001167 | 3300006358 | Bacteria | 17651 |
| 317 | Ga0068871_100004905 | 3300006358 | Bacteria | 9345 |
| 318 | Ga0068871_100018659 | 3300006358 | Bacteria | 5279 |
| 319 | Ga0068871_100054631 | 3300006358 | Bacteria | 3241 |
| 320 | Ga0068871_100059310 | 3300006358 | Bacteria | 3118 |
| 321 | Ga0068871_100138726 | 3300006358 | Bacteria | 2066 |
| 322 | Ga0068871_100139452 | 3300006358 | Bacteria | 2061 |
| 323 | Ga0068871_100183573 | 3300006358 | Unclassified | 1799 |
| 324 | Ga0068871_100273614 | 3300006358 | Bacteria | 1476 |
| 325 | Ga0075428_100013338 | 3300006844 | Bacteria | 9143 |
| 326 | Ga0075428_100066083 | 3300006844 | Unclassified | 3960 |
| 327 | Ga0075428_100279654 | 3300006844 | Unclassified | 1796 |
| 328 | Ga0075434_100037661 | 3300006871 | Bacteria | 4788 |
| 329 | Ga0075429_100000723 | 3300006880 | Bacteria | 25874 |
| 330 | Ga0075429_100283270 | 3300006880 | Bacteria | 1451 |
| 331 | Ga0068865_100012266 | 3300006881 | Bacteria | 5390 |
| 332 | Ga0068865_100032670 | 3300006881 | Bacteria | 3479 |
| 333 | Ga0097620_100000025 | 3300006931 | Bacteria | 191679 |
| 334 | Ga0097620_100000620 | 3300006931 | Bacteria | 35497 |
| 335 | Ga0097620_100007242 | 3300006931 | Bacteria | 11253 |
| 336 | Ga0097620_100022623 | 3300006931 | Bacteria | 6303 |
| 337 | Ga0097620_100044097 | 3300006931 | Unclassified | 4482 |
| 338 | Ga0097620_100061856 | 3300006931 | Bacteria | 3773 |
| 339 | Ga0097620_100085931 | 3300006931 | Unclassified | 3191 |
| 340 | Ga0097620_100174708 | 3300006931 | Bacteria | 2230 |
| 341 | Ga0097620_100355959 | 3300006931 | Bacteria | 1559 |
| 342 | Ga0097620_100517284 | 3300006931 | Unclassified | 1288 |
| 343 | Ga0097620_100522142 | 3300006931 | Bacteria | 1282 |
| 344 | Ga0097620_100702122 | 3300006931 | Bacteria | 1102 |
| 345 | Ga0105240_10001601 | 3300009093 | Bacteria | 38423 |
| 346 | Ga0105240_10001632 | 3300009093 | Bacteria | 38064 |
| 347 | Ga0105240_10012477 | 3300009093 | Bacteria | 11725 |
| 348 | Ga0105240_10020065 | 3300009093 | Bacteria | 8922 |
| 349 | Ga0105240_10025004 | 3300009093 | Bacteria | 7860 |
| 350 | Ga0105240_10046229 | 3300009093 | Bacteria | 5517 |
| 351 | Ga0105240_10049773 | 3300009093 | Bacteria | 5286 |
| 352 | Ga0105240_10053431 | 3300009093 | Bacteria | 5070 |
| 353 | Ga0105240_10104603 | 3300009093 | Bacteria | 3438 |
| 354 | Ga0105240_10118854 | 3300009093 | Bacteria | 3185 |
| 355 | Ga0111539_10013194 | 3300009094 | Bacteria | 10332 |
| 356 | Ga0111539_10155954 | 3300009094 | Bacteria | 2672 |
| 357 | Ga0111539_10250768 | 3300009094 | Bacteria | 2061 |
| 358 | Ga0105245_10010477 | 3300009098 | Bacteria | 8070 |
| 359 | Ga0105247_10000619 | 3300009101 | Bacteria | 28588 |
| 360 | Ga0105247_10015174 | 3300009101 | Unclassified | 4619 |
| 361 | Ga0105247_10053989 | 3300009101 | Bacteria | 2479 |
| 362 | Ga0114129_10041957 | 3300009147 | Bacteria | 6442 |
| 363 | Ga0105243_10133536 | 3300009148 | Bacteria | 2109 |
| 364 | Ga0105241_10000252 | 3300009174 | Bacteria | 40539 |
| 365 | Ga0105241_10001151 | 3300009174 | Bacteria | 20122 |
| 366 | Ga0105241_10002136 | 3300009174 | Bacteria | 14943 |
| 367 | Ga0105241_10019869 | 3300009174 | Bacteria | 4958 |
| 368 | Ga0105241_10130995 | 3300009174 | Bacteria | 2030 |
| 369 | Ga0105241_10226981 | 3300009174 | Bacteria | 1573 |
| 370 | Ga0105241_10267408 | 3300009174 | Unclassified | 1455 |
| 371 | Ga0105242_10041827 | 3300009176 | Bacteria | 3698 |
| 372 | Ga0105242_10053818 | 3300009176 | Bacteria | 3288 |
| 373 | Ga0105242_10106325 | 3300009176 | Unclassified | 2385 |
| 374 | Ga0105242_10169223 | 3300009176 | Bacteria | 1919 |
| 375 | Ga0105242_10229661 | 3300009176 | Unclassified | 1663 |
| 376 | Ga0105248_10067765 | 3300009177 | Unclassified | 4007 |
| 377 | Ga0105237_10000191 | 3300009545 | Bacteria | 87065 |
| 378 | Ga0105237_10000938 | 3300009545 | Bacteria | 39240 |
| 379 | Ga0105237_10002013 | 3300009545 | Bacteria | 25878 |
| 380 | Ga0105237_10006188 | 3300009545 | Bacteria | 13363 |
| 381 | Ga0105237_10019671 | 3300009545 | Bacteria | 6971 |
| 382 | Ga0105237_10031026 | 3300009545 | Bacteria | 5421 |
| 383 | Ga0105237_10095240 | 3300009545 | Bacteria | 2966 |
| 384 | Ga0105238_10004065 | 3300009551 | Bacteria | 14503 |
| 385 | Ga0105238_10023581 | 3300009551 | Bacteria | 6270 |
| 386 | Ga0105238_10063610 | 3300009551 | Bacteria | 3690 |
| 387 | Ga0105238_10606925 | 3300009551 | Bacteria | 1102 |
| 388 | Ga0105249_10001096 | 3300009553 | Bacteria | 24070 |
| 389 | Ga0105249_10001117 | 3300009553 | Bacteria | 23873 |
| 390 | Ga0105249_10001306 | 3300009553 | Bacteria | 21852 |
| 391 | Ga0105249_10001445 | 3300009553 | Bacteria | 20795 |
| 392 | Ga0105249_10003110 | 3300009553 | Bacteria | 14341 |
| 393 | Ga0105249_10028284 | 3300009553 | Bacteria | 5060 |
| 394 | Ga0105249_10060768 | 3300009553 | Bacteria | 3467 |
| 395 | Ga0105249_10224511 | 3300009553 | Bacteria | 1850 |
| 396 | Ga0105249_10492864 | 3300009553 | Bacteria | 1269 |
| 397 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 398 | Ga0105239_10006447 | 3300010375 | Bacteria | 13611 |
| 399 | Ga0105239_10006468 | 3300010375 | Bacteria | 13590 |
| 400 | Ga0105239_10009941 | 3300010375 | Bacteria | 10682 |
| 401 | Ga0105239_10012772 | 3300010375 | Bacteria | 9343 |
| 402 | Ga0105239_10013262 | 3300010375 | Bacteria | 9159 |
| 403 | Ga0105239_10018690 | 3300010375 | Bacteria | 7656 |
| 404 | Ga0105239_10095385 | 3300010375 | Bacteria | 3286 |
| 405 | Ga0105239_10116749 | 3300010375 | Unclassified | 2962 |
| 406 | Ga0105239_10441177 | 3300010375 | Unclassified | 1476 |
| 407 | Ga0105246_10027988 | 3300011119 | Bacteria | 3700 |
| 408 | Ga0105246_10175641 | 3300011119 | Bacteria | 1644 |
| 409 | Ga0105246_10229745 | 3300011119 | Bacteria | 1460 |
| 410 | Ga0157373_10028054 | 3300013100 | Bacteria | 4062 |
| 411 | Ga0157373_10031265 | 3300013100 | Unclassified | 3832 |
| 412 | Ga0157373_10037348 | 3300013100 | Bacteria | 3482 |
| 413 | Ga0157373_10040205 | 3300013100 | Bacteria | 3347 |
| 414 | Ga0157373_10058618 | 3300013100 | Unclassified | 2729 |
| 415 | Ga0157373_10110478 | 3300013100 | Bacteria | 1933 |
| 416 | Ga0157371_10000518 | 3300013102 | Bacteria | 46197 |
| 417 | Ga0157371_10000650 | 3300013102 | Bacteria | 41165 |
| 418 | Ga0157371_10000898 | 3300013102 | Bacteria | 33500 |
| 419 | Ga0157371_10001280 | 3300013102 | Bacteria | 26535 |
| 420 | Ga0157371_10008105 | 3300013102 | Bacteria | 8395 |
| 421 | Ga0157371_10076478 | 3300013102 | Bacteria | 2370 |
| 422 | Ga0157370_10000313 | 3300013104 | Bacteria | 60838 |
| 423 | Ga0157370_10000478 | 3300013104 | Bacteria | 49942 |
| 424 | Ga0157370_10006366 | 3300013104 | Bacteria | 13032 |
| 425 | Ga0157370_10010610 | 3300013104 | Bacteria | 9697 |
| 426 | Ga0157370_10013171 | 3300013104 | Bacteria | 8529 |
| 427 | Ga0157370_10077626 | 3300013104 | Bacteria | 3128 |
| 428 | Ga0157370_10082916 | 3300013104 | Bacteria | 3015 |
| 429 | Ga0157369_10015979 | 3300013105 | Bacteria | 8446 |
| 430 | Ga0157369_10018825 | 3300013105 | Bacteria | 7738 |
| 431 | Ga0157369_10032914 | 3300013105 | Bacteria | 5697 |
| 432 | Ga0157369_10058404 | 3300013105 | Bacteria | 4162 |
| 433 | Ga0157369_10064658 | 3300013105 | Bacteria | 3939 |
| 434 | Ga0157369_10117277 | 3300013105 | Bacteria | 2826 |
| 435 | Ga0157369_10159290 | 3300013105 | Unclassified | 2383 |
| 436 | Ga0157369_10208073 | 3300013105 | Unclassified | 2051 |
| 437 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 438 | Ga0157374_10004455 | 3300013296 | Bacteria | 11760 |
| 439 | Ga0157374_10009692 | 3300013296 | Bacteria | 8270 |
| 440 | Ga0157374_10027330 | 3300013296 | Bacteria | 5144 |
| 441 | Ga0157374_10050543 | 3300013296 | Bacteria | 3865 |
| 442 | Ga0157374_10203631 | 3300013296 | Bacteria | 1938 |
| 443 | Ga0157378_10001083 | 3300013297 | Bacteria | 24880 |
| 444 | Ga0157378_10003875 | 3300013297 | Bacteria | 13240 |
| 445 | Ga0157378_10030526 | 3300013297 | Bacteria | 4763 |
| 446 | Ga0157378_10061615 | 3300013297 | Bacteria | 3349 |
| 447 | Ga0157378_10066657 | 3300013297 | Unclassified | 3225 |
| 448 | Ga0157378_10068698 | 3300013297 | Unclassified | 3178 |
| 449 | Ga0157378_10123419 | 3300013297 | Bacteria | 2390 |
| 450 | Ga0163162_10000029 | 3300013306 | Bacteria | 168510 |
| 451 | Ga0163162_10000424 | 3300013306 | Bacteria | 38989 |
| 452 | Ga0163162_10000672 | 3300013306 | Bacteria | 31760 |
| 453 | Ga0163162_10001000 | 3300013306 | Bacteria | 26251 |
| 454 | Ga0163162_10007147 | 3300013306 | Bacteria | 10837 |
| 455 | Ga0163162_10026603 | 3300013306 | Bacteria | 5719 |
| 456 | Ga0163162_10029016 | 3300013306 | Bacteria | 5475 |
| 457 | Ga0163162_10075172 | 3300013306 | Bacteria | 3438 |
| 458 | Ga0163162_10126262 | 3300013306 | Bacteria | 2664 |
| 459 | Ga0163162_10133118 | 3300013306 | Bacteria | 2596 |
| 460 | Ga0163162_10157845 | 3300013306 | Bacteria | 2389 |
| 461 | Ga0163162_10168474 | 3300013306 | Bacteria | 2314 |
| 462 | Ga0163162_10271550 | 3300013306 | Unclassified | 1827 |
| 463 | Ga0163162_10342106 | 3300013306 | Bacteria | 1628 |
| 464 | Ga0163162_10412930 | 3300013306 | Unclassified | 1482 |
| 465 | Ga0163162_10413788 | 3300013306 | Bacteria | 1480 |
| 466 | Ga0163162_10426492 | 3300013306 | Bacteria | 1458 |
| 467 | Ga0163162_10465489 | 3300013306 | Bacteria | 1396 |
| 468 | Ga0157372_10001585 | 3300013307 | Bacteria | 24755 |
| 469 | Ga0157372_10012413 | 3300013307 | Bacteria | 9079 |
| 470 | Ga0157372_10017506 | 3300013307 | Bacteria | 7690 |
| 471 | Ga0157372_10021759 | 3300013307 | Bacteria | 6931 |
| 472 | Ga0157372_10023200 | 3300013307 | Bacteria | 6724 |
| 473 | Ga0157372_10052578 | 3300013307 | Bacteria | 4537 |
| 474 | Ga0157372_10054702 | 3300013307 | Bacteria | 4454 |
| 475 | Ga0157372_10092224 | 3300013307 | Bacteria | 3446 |
| 476 | Ga0157372_10107026 | 3300013307 | Bacteria | 3199 |
| 477 | Ga0157372_10137536 | 3300013307 | Bacteria | 2814 |
| 478 | Ga0157372_10167152 | 3300013307 | Bacteria | 2544 |
| 479 | Ga0157372_10303899 | 3300013307 | Bacteria | 1856 |
| 480 | Ga0157372_10304701 | 3300013307 | Bacteria | 1853 |
| 481 | Ga0157372_10652283 | 3300013307 | Bacteria | 1226 |
| 482 | Ga0157372_10691182 | 3300013307 | Bacteria | 1187 |
| 483 | Ga0157375_10000042 | 3300013308 | Bacteria | 160008 |
| 484 | Ga0157375_10002200 | 3300013308 | Bacteria | 16851 |
| 485 | Ga0157375_10011363 | 3300013308 | Bacteria | 7860 |
| 486 | Ga0157375_10012413 | 3300013308 | Bacteria | 7557 |
| 487 | Ga0157375_10038591 | 3300013308 | Bacteria | 4586 |
| 488 | Ga0157375_10043524 | 3300013308 | Bacteria | 4355 |
| 489 | Ga0157375_10100779 | 3300013308 | Bacteria | 2969 |
| 490 | Ga0157375_10117350 | 3300013308 | Unclassified | 2766 |
| 491 | Ga0157375_10147379 | 3300013308 | Bacteria | 2485 |
| 492 | Ga0157375_10157851 | 3300013308 | Bacteria | 2408 |
| 493 | Ga0157375_10454185 | 3300013308 | Bacteria | 1447 |
| 494 | Ga0163163_10000076 | 3300014325 | Bacteria | 108784 |
| 495 | Ga0163163_10000831 | 3300014325 | Bacteria | 26270 |
| 496 | Ga0163163_10001057 | 3300014325 | Bacteria | 23356 |
| 497 | Ga0163163_10015513 | 3300014325 | Bacteria | 7045 |
| 498 | Ga0163163_10076823 | 3300014325 | Bacteria | 3335 |
| 499 | Ga0163163_10099343 | 3300014325 | Bacteria | 2932 |
| 500 | Ga0163163_10109623 | 3300014325 | Bacteria | 2788 |
| 501 | Ga0163163_10160777 | 3300014325 | Unclassified | 2291 |
| 502 | Ga0163163_10197237 | 3300014325 | Bacteria | 2061 |
| 503 | Ga0163163_10220755 | 3300014325 | Bacteria | 1944 |
| 504 | Ga0163163_10284532 | 3300014325 | Bacteria | 1705 |
| 505 | Ga0163163_10432213 | 3300014325 | Bacteria | 1376 |
| 506 | Ga0163163_10609346 | 3300014325 | Unclassified | 1155 |
| 507 | Ga0157380_10001454 | 3300014326 | Bacteria | 15501 |
| 508 | Ga0157380_10003690 | 3300014326 | Bacteria | 10535 |
| 509 | Ga0157380_10007843 | 3300014326 | Bacteria | 7600 |
| 510 | Ga0157380_10040123 | 3300014326 | Bacteria | 3644 |
| 511 | Ga0157380_10126199 | 3300014326 | Bacteria | 2175 |
| 512 | Ga0157377_10022605 | 3300014745 | Bacteria | 3323 |
| 513 | Ga0157377_10023737 | 3300014745 | Bacteria | 3254 |
| 514 | Ga0157377_10031442 | 3300014745 | Bacteria | 2884 |
| 515 | Ga0157377_10118187 | 3300014745 | Unclassified | 1603 |
| 516 | Ga0157377_10163313 | 3300014745 | Bacteria | 1387 |
| 517 | Ga0157379_10000016 | 3300014968 | Bacteria | 103230 |
| 518 | Ga0157379_10016392 | 3300014968 | Bacteria | 6517 |
| 519 | Ga0157379_10037080 | 3300014968 | Bacteria | 4347 |
| 520 | Ga0157379_10077651 | 3300014968 | Unclassified | 2973 |
| 521 | Ga0157379_10087394 | 3300014968 | Bacteria | 2795 |
| 522 | Ga0157379_10421162 | 3300014968 | Bacteria | 1230 |
| 523 | Ga0157376_10000558 | 3300014969 | Bacteria | 23999 |
| 524 | Ga0157376_10000938 | 3300014969 | Bacteria | 18935 |
| 525 | Ga0157376_10002924 | 3300014969 | Bacteria | 11719 |
| 526 | Ga0157376_10010684 | 3300014969 | Bacteria | 6730 |
| 527 | Ga0157376_10011063 | 3300014969 | Bacteria | 6635 |
| 528 | Ga0157376_10035769 | 3300014969 | Bacteria | 4018 |
| 529 | Ga0157376_10256115 | 3300014969 | Bacteria | 1637 |
| 530 | Ga0182005_1000161 | 3300015265 | Bacteria | 46308 |
| 531 | Ga0163161_10003336 | 3300017792 | Bacteria | 11258 |
| 532 | Ga0163161_10024726 | 3300017792 | Bacteria | 4245 |
| 533 | Ga0163161_10040821 | 3300017792 | Unclassified | 3333 |
| 534 | Ga0213876_10005918 | 3300021384 | Bacteria | 6681 |
| 535 | Ga0213876_10010752 | 3300021384 | Bacteria | 4904 |
| 536 | Ga0209436_100742 | 3300025208 | Bacteria | 13611 |
| 537 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 538 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 539 | Ga0209026_1000156 | 3300025250 | Bacteria | 107193 |
| 540 | Ga0209148_1000339 | 3300025254 | Bacteria | 62786 |
| 541 | Ga0209673_1000258 | 3300025273 | Bacteria | 100207 |
| 542 | Ga0209130_1001880 | 3300025284 | Bacteria | 11950 |
| 543 | Ga0209758_1007402 | 3300025297 | Bacteria | 7492 |
| 544 | Ga0209050_1000097 | 3300025298 | Bacteria | 239919 |
| 545 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 546 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 547 | Ga0207426_1000321 | 3300025302 | Bacteria | 92019 |
| 548 | Ga0207426_1000472 | 3300025302 | Bacteria | 61715 |
| 549 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 550 | Ga0209257_1005191 | 3300025304 | Bacteria | 9366 |
| 551 | Ga0207656_10000821 | 3300025321 | Bacteria | 10125 |
| 552 | Ga0207656_10022275 | 3300025321 | Bacteria | 2540 |
| 553 | Ga0207656_10027719 | 3300025321 | Bacteria | 2319 |
| 554 | Ga0207682_10030613 | 3300025893 | Bacteria | 2156 |
| 555 | Ga0207642_10081862 | 3300025899 | Bacteria | 1570 |
| 556 | Ga0207710_10004843 | 3300025900 | Bacteria | 5838 |
| 557 | Ga0207680_10000086 | 3300025903 | Bacteria | 42622 |
| 558 | Ga0207680_10014877 | 3300025903 | Unclassified | 4044 |
| 559 | Ga0207680_10053067 | 3300025903 | Unclassified | 2432 |
| 560 | Ga0207680_10093486 | 3300025903 | Bacteria | 1918 |
| 561 | Ga0207680_10166621 | 3300025903 | Bacteria | 1481 |
| 562 | Ga0207647_10000096 | 3300025904 | Bacteria | 67468 |
| 563 | Ga0207647_10009352 | 3300025904 | Bacteria | 6965 |
| 564 | Ga0207647_10028428 | 3300025904 | Bacteria | 3631 |
| 565 | Ga0207645_10002123 | 3300025907 | Bacteria | 15868 |
| 566 | Ga0207645_10012288 | 3300025907 | Bacteria | 5814 |
| 567 | Ga0207645_10014367 | 3300025907 | Bacteria | 5299 |
| 568 | Ga0207645_10033610 | 3300025907 | Bacteria | 3295 |
| 569 | Ga0207645_10045869 | 3300025907 | Unclassified | 2792 |
| 570 | Ga0207645_10064822 | 3300025907 | Bacteria | 2334 |
| 571 | Ga0207643_10009004 | 3300025908 | Bacteria | 5360 |
| 572 | Ga0207643_10013248 | 3300025908 | Bacteria | 4463 |
| 573 | Ga0207705_10002045 | 3300025909 | Bacteria | 15697 |
| 574 | Ga0207705_10006383 | 3300025909 | Bacteria | 8744 |
| 575 | Ga0207705_10033756 | 3300025909 | Bacteria | 3656 |
| 576 | Ga0207654_10006725 | 3300025911 | Bacteria | 5780 |
| 577 | Ga0207654_10018640 | 3300025911 | Bacteria | 3646 |
| 578 | Ga0207654_10038316 | 3300025911 | Bacteria | 2689 |
| 579 | Ga0207654_10046622 | 3300025911 | Bacteria | 2472 |
| 580 | Ga0207654_10123445 | 3300025911 | Unclassified | 1629 |
| 581 | Ga0207707_10126078 | 3300025912 | Unclassified | 2239 |
| 582 | Ga0207707_10135962 | 3300025912 | Unclassified | 2149 |
| 583 | Ga0207707_10143837 | 3300025912 | Bacteria | 2084 |
| 584 | Ga0207695_10000212 | 3300025913 | Bacteria | 156450 |
| 585 | Ga0207695_10001109 | 3300025913 | Bacteria | 46822 |
| 586 | Ga0207695_10001387 | 3300025913 | Bacteria | 40927 |
| 587 | Ga0207695_10001527 | 3300025913 | Bacteria | 38268 |
| 588 | Ga0207695_10011310 | 3300025913 | Bacteria | 10819 |
| 589 | Ga0207695_10075830 | 3300025913 | Bacteria | 3420 |
| 590 | Ga0207695_10113737 | 3300025913 | Bacteria | 2682 |
| 591 | Ga0207695_10140779 | 3300025913 | Unclassified | 2361 |
| 592 | Ga0207695_10144647 | 3300025913 | Bacteria | 2323 |
| 593 | Ga0207695_10165680 | 3300025913 | Bacteria | 2138 |
| 594 | Ga0207671_10001331 | 3300025914 | Bacteria | 28876 |
| 595 | Ga0207671_10001357 | 3300025914 | Bacteria | 28586 |
| 596 | Ga0207671_10003705 | 3300025914 | Bacteria | 15062 |
| 597 | Ga0207671_10011884 | 3300025914 | Bacteria | 7042 |
| 598 | Ga0207660_10002218 | 3300025917 | Bacteria | 12857 |
| 599 | Ga0207660_10002449 | 3300025917 | Bacteria | 12187 |
| 600 | Ga0207660_10153271 | 3300025917 | Bacteria | 1772 |
| 601 | Ga0207660_10287939 | 3300025917 | Bacteria | 1305 |
| 602 | Ga0207662_10005744 | 3300025918 | Bacteria | 6640 |
| 603 | Ga0207657_10000893 | 3300025919 | Bacteria | 31577 |
| 604 | Ga0207657_10113061 | 3300025919 | Unclassified | 2240 |
| 605 | Ga0207657_10148949 | 3300025919 | Unclassified | 1907 |
| 606 | Ga0207657_10244120 | 3300025919 | Bacteria | 1433 |
| 607 | Ga0207657_10274909 | 3300025919 | Bacteria | 1338 |
| 608 | Ga0207649_10000517 | 3300025920 | Bacteria | 27099 |
| 609 | Ga0207649_10075233 | 3300025920 | Bacteria | 2170 |
| 610 | Ga0207649_10128467 | 3300025920 | Bacteria | 1718 |
| 611 | Ga0207652_10000090 | 3300025921 | Bacteria | 99245 |
| 612 | Ga0207652_10000999 | 3300025921 | Bacteria | 26089 |
| 613 | Ga0207652_10001591 | 3300025921 | Bacteria | 19987 |
| 614 | Ga0207652_10008720 | 3300025921 | Bacteria | 8161 |
| 615 | Ga0207652_10011840 | 3300025921 | Bacteria | 7036 |
| 616 | Ga0207652_10038291 | 3300025921 | Bacteria | 4064 |
| 617 | Ga0207652_10059552 | 3300025921 | Bacteria | 3292 |
| 618 | Ga0207652_10097104 | 3300025921 | Bacteria | 2596 |
| 619 | Ga0207652_10193882 | 3300025921 | Bacteria | 1827 |
| 620 | Ga0207694_10254215 | 3300025924 | Bacteria | 1438 |
| 621 | Ga0207694_10268334 | 3300025924 | Unclassified | 1399 |
| 622 | Ga0207650_10001946 | 3300025925 | Bacteria | 14530 |
| 623 | Ga0207650_10049132 | 3300025925 | Bacteria | 3113 |
| 624 | Ga0207650_10054046 | 3300025925 | Bacteria | 2978 |
| 625 | Ga0207650_10089489 | 3300025925 | Bacteria | 2349 |
| 626 | Ga0207650_10115912 | 3300025925 | Bacteria | 2080 |
| 627 | Ga0207650_10175068 | 3300025925 | Bacteria | 1707 |
| 628 | Ga0207650_10197267 | 3300025925 | Unclassified | 1611 |
| 629 | Ga0207659_10020402 | 3300025926 | Bacteria | 4380 |
| 630 | Ga0207659_10022314 | 3300025926 | Bacteria | 4213 |
| 631 | Ga0207659_10056682 | 3300025926 | Bacteria | 2807 |
| 632 | Ga0207659_10069850 | 3300025926 | Bacteria | 2560 |
| 633 | Ga0207659_10101043 | 3300025926 | Bacteria | 2174 |
| 634 | Ga0207659_10115225 | 3300025926 | Unclassified | 2050 |
| 635 | Ga0207659_10346531 | 3300025926 | Bacteria | 1231 |
| 636 | Ga0207687_10077510 | 3300025927 | Bacteria | 2390 |
| 637 | Ga0207644_10014077 | 3300025931 | Bacteria | 5349 |
| 638 | Ga0207644_10066397 | 3300025931 | Bacteria | 2627 |
| 639 | Ga0207644_10234941 | 3300025931 | Bacteria | 1458 |
| 640 | Ga0207644_10288278 | 3300025931 | Unclassified | 1320 |
| 641 | Ga0207644_10382775 | 3300025931 | Bacteria | 1148 |
| 642 | Ga0207690_10010864 | 3300025932 | Bacteria | 5425 |
| 643 | Ga0207690_10024157 | 3300025932 | Bacteria | 3803 |
| 644 | Ga0207690_10029625 | 3300025932 | Bacteria | 3483 |
| 645 | Ga0207690_10032465 | 3300025932 | Bacteria | 3350 |
| 646 | Ga0207690_10100317 | 3300025932 | Bacteria | 2066 |
| 647 | Ga0207706_10000957 | 3300025933 | Bacteria | 29536 |
| 648 | Ga0207706_10008919 | 3300025933 | Bacteria | 9232 |
| 649 | Ga0207706_10086069 | 3300025933 | Bacteria | 2763 |
| 650 | Ga0207686_10011437 | 3300025934 | Bacteria | 4860 |
| 651 | Ga0207686_10058469 | 3300025934 | Bacteria | 2431 |
| 652 | Ga0207686_10130358 | 3300025934 | Bacteria | 1724 |
| 653 | Ga0207686_10198984 | 3300025934 | Unclassified | 1434 |
| 654 | Ga0207670_10146506 | 3300025936 | Bacteria | 1747 |
| 655 | Ga0207670_10177418 | 3300025936 | Bacteria | 1602 |
| 656 | Ga0207670_10315732 | 3300025936 | Unclassified | 1228 |
| 657 | Ga0207669_10008011 | 3300025937 | Bacteria | 4936 |
| 658 | Ga0207704_10053403 | 3300025938 | Unclassified | 2456 |
| 659 | Ga0207704_10106756 | 3300025938 | Bacteria | 1882 |
| 660 | Ga0207704_10111584 | 3300025938 | Bacteria | 1850 |
| 661 | Ga0207704_10116052 | 3300025938 | Bacteria | 1821 |
| 662 | Ga0207704_10229414 | 3300025938 | Bacteria | 1380 |
| 663 | Ga0207691_10000004 | 3300025940 | Bacteria | 168729 |
| 664 | Ga0207691_10026490 | 3300025940 | Bacteria | 5439 |
| 665 | Ga0207691_10045858 | 3300025940 | Bacteria | 4018 |
| 666 | Ga0207691_10094120 | 3300025940 | Bacteria | 2681 |
| 667 | Ga0207691_10129252 | 3300025940 | Bacteria | 2232 |
| 668 | Ga0207691_10133024 | 3300025940 | Unclassified | 2196 |
| 669 | Ga0207691_10140802 | 3300025940 | Bacteria | 2126 |
| 670 | Ga0207711_10224042 | 3300025941 | Unclassified | 1721 |
| 671 | Ga0207689_10000208 | 3300025942 | Bacteria | 51706 |
| 672 | Ga0207689_10002065 | 3300025942 | Bacteria | 18954 |
| 673 | Ga0207689_10002750 | 3300025942 | Bacteria | 16259 |
| 674 | Ga0207689_10008548 | 3300025942 | Bacteria | 8924 |
| 675 | Ga0207689_10029255 | 3300025942 | Bacteria | 4602 |
| 676 | Ga0207689_10032175 | 3300025942 | Bacteria | 4363 |
| 677 | Ga0207689_10053043 | 3300025942 | Bacteria | 3340 |
| 678 | Ga0207689_10062503 | 3300025942 | Bacteria | 3062 |
| 679 | Ga0207689_10275819 | 3300025942 | Bacteria | 1392 |
| 680 | Ga0207661_10001812 | 3300025944 | Bacteria | 14604 |
| 681 | Ga0207661_10049528 | 3300025944 | Bacteria | 3344 |
| 682 | Ga0207661_10051748 | 3300025944 | Bacteria | 3278 |
| 683 | Ga0207679_10000091 | 3300025945 | Bacteria | 78725 |
| 684 | Ga0207679_10038824 | 3300025945 | Bacteria | 3396 |
| 685 | Ga0207667_10000414 | 3300025949 | Bacteria | 57815 |
| 686 | Ga0207667_10000492 | 3300025949 | Bacteria | 52207 |
| 687 | Ga0207667_10002948 | 3300025949 | Bacteria | 21118 |
| 688 | Ga0207667_10003621 | 3300025949 | Bacteria | 19066 |
| 689 | Ga0207667_10008497 | 3300025949 | Bacteria | 12190 |
| 690 | Ga0207667_10013252 | 3300025949 | Bacteria | 9449 |
| 691 | Ga0207667_10024439 | 3300025949 | Bacteria | 6634 |
| 692 | Ga0207651_10004794 | 3300025960 | Bacteria | 6880 |
| 693 | Ga0207651_10009976 | 3300025960 | Bacteria | 5235 |
| 694 | Ga0207651_10024166 | 3300025960 | Unclassified | 3754 |
| 695 | Ga0207651_10053609 | 3300025960 | Bacteria | 2758 |
| 696 | Ga0207651_10063786 | 3300025960 | Unclassified | 2575 |
| 697 | Ga0207651_10072179 | 3300025960 | Bacteria | 2450 |
| 698 | Ga0207651_10092415 | 3300025960 | Bacteria | 2219 |
| 699 | Ga0207651_10106291 | 3300025960 | Unclassified | 2095 |
| 700 | Ga0207651_10200560 | 3300025960 | Unclassified | 1599 |
| 701 | Ga0207712_10000725 | 3300025961 | Bacteria | 25158 |
| 702 | Ga0207712_10000915 | 3300025961 | Bacteria | 21389 |
| 703 | Ga0207712_10001923 | 3300025961 | Bacteria | 13655 |
| 704 | Ga0207712_10005612 | 3300025961 | Bacteria | 7913 |
| 705 | Ga0207712_10016389 | 3300025961 | Bacteria | 4797 |
| 706 | Ga0207712_10040250 | 3300025961 | Bacteria | 3206 |
| 707 | Ga0207712_10102517 | 3300025961 | Bacteria | 2130 |
| 708 | Ga0207668_10001031 | 3300025972 | Bacteria | 16624 |
| 709 | Ga0207640_10026559 | 3300025981 | Bacteria | 3517 |
| 710 | Ga0207640_10097792 | 3300025981 | Bacteria | 2050 |
| 711 | Ga0207640_10188072 | 3300025981 | Bacteria | 1554 |
| 712 | Ga0207658_10001793 | 3300025986 | Bacteria | 16085 |
| 713 | Ga0207658_10023217 | 3300025986 | Bacteria | 4327 |
| 714 | Ga0207658_10049019 | 3300025986 | Bacteria | 3101 |
| 715 | Ga0207677_10071596 | 3300026023 | Bacteria | 2447 |
| 716 | Ga0207677_10104052 | 3300026023 | Bacteria | 2097 |
| 717 | Ga0207677_10209907 | 3300026023 | Bacteria | 1554 |
| 718 | Ga0207677_10224246 | 3300026023 | Bacteria | 1509 |
| 719 | Ga0207703_10002453 | 3300026035 | Bacteria | 16080 |
| 720 | Ga0207703_10003536 | 3300026035 | Bacteria | 13074 |
| 721 | Ga0207703_10496832 | 3300026035 | Unclassified | 1145 |
| 722 | Ga0207703_10524140 | 3300026035 | Unclassified | 1115 |
| 723 | Ga0207639_10004779 | 3300026041 | Bacteria | 9134 |
| 724 | Ga0207639_10017252 | 3300026041 | Bacteria | 5118 |
| 725 | Ga0207639_10017338 | 3300026041 | Bacteria | 5105 |
| 726 | Ga0207639_10018922 | 3300026041 | Unclassified | 4903 |
| 727 | Ga0207639_10074162 | 3300026041 | Bacteria | 2671 |
| 728 | Ga0207678_10004101 | 3300026067 | Bacteria | 13100 |
| 729 | Ga0207678_10143913 | 3300026067 | Bacteria | 2035 |
| 730 | Ga0207678_10164869 | 3300026067 | Bacteria | 1892 |
| 731 | Ga0207708_10211128 | 3300026075 | Bacteria | 1552 |
| 732 | Ga0207702_10093485 | 3300026078 | Bacteria | 2637 |
| 733 | Ga0207702_10174654 | 3300026078 | Bacteria | 1973 |
| 734 | Ga0207641_10000132 | 3300026088 | Bacteria | 109247 |
| 735 | Ga0207641_10002004 | 3300026088 | Bacteria | 19426 |
| 736 | Ga0207641_10005148 | 3300026088 | Bacteria | 11192 |
| 737 | Ga0207641_10030371 | 3300026088 | Bacteria | 4476 |
| 738 | Ga0207641_10039756 | 3300026088 | Bacteria | 3935 |
| 739 | Ga0207641_10114190 | 3300026088 | Bacteria | 2399 |
| 740 | Ga0207641_10125353 | 3300026088 | Bacteria | 2298 |
| 741 | Ga0207648_10001340 | 3300026089 | Bacteria | 27318 |
| 742 | Ga0207648_10001507 | 3300026089 | Bacteria | 25668 |
| 743 | Ga0207648_10003198 | 3300026089 | Bacteria | 17248 |
| 744 | Ga0207648_10023065 | 3300026089 | Bacteria | 5582 |
| 745 | Ga0207648_10028580 | 3300026089 | Bacteria | 4943 |
| 746 | Ga0207648_10059000 | 3300026089 | Bacteria | 3346 |
| 747 | Ga0207648_10175954 | 3300026089 | Bacteria | 1893 |
| 748 | Ga0207648_10227889 | 3300026089 | Bacteria | 1657 |
| 749 | Ga0207676_10006520 | 3300026095 | Bacteria | 8251 |
| 750 | Ga0207676_10021806 | 3300026095 | Bacteria | 4704 |
| 751 | Ga0207676_10050031 | 3300026095 | Bacteria | 3255 |
| 752 | Ga0207676_10270325 | 3300026095 | Unclassified | 1539 |
| 753 | Ga0207676_10271133 | 3300026095 | Bacteria | 1537 |
| 754 | Ga0207676_10521696 | 3300026095 | Bacteria | 1131 |
| 755 | Ga0207674_10006827 | 3300026116 | Bacteria | 13386 |
| 756 | Ga0207674_10006954 | 3300026116 | Bacteria | 13246 |
| 757 | Ga0207674_10011869 | 3300026116 | Bacteria | 9767 |
| 758 | Ga0207674_10020844 | 3300026116 | Bacteria | 7074 |
| 759 | Ga0207674_10037247 | 3300026116 | Bacteria | 5061 |
| 760 | Ga0207674_10081190 | 3300026116 | Bacteria | 3244 |
| 761 | Ga0207674_10084698 | 3300026116 | Bacteria | 3167 |
| 762 | Ga0207674_10096318 | 3300026116 | Unclassified | 2944 |
| 763 | Ga0207674_10201198 | 3300026116 | Bacteria | 1941 |
| 764 | Ga0207674_10211388 | 3300026116 | Bacteria | 1889 |
| 765 | Ga0207675_100003521 | 3300026118 | Bacteria | 15283 |
| 766 | Ga0207675_100012750 | 3300026118 | Bacteria | 7853 |
| 767 | Ga0207675_100013899 | 3300026118 | Bacteria | 7505 |
| 768 | Ga0207675_100020709 | 3300026118 | Bacteria | 6132 |
| 769 | Ga0207675_100022252 | 3300026118 | Bacteria | 5903 |
| 770 | Ga0207675_100048083 | 3300026118 | Bacteria | 3982 |
| 771 | Ga0207675_100055083 | 3300026118 | Bacteria | 3710 |
| 772 | Ga0207675_100330590 | 3300026118 | Unclassified | 1490 |
| 773 | Ga0207683_10002163 | 3300026121 | Bacteria | 17263 |
| 774 | Ga0207683_10045450 | 3300026121 | Bacteria | 3840 |
| 775 | Ga0207683_10049536 | 3300026121 | Unclassified | 3678 |
| 776 | Ga0207683_10067112 | 3300026121 | Unclassified | 3164 |
| 777 | Ga0207683_10204356 | 3300026121 | Unclassified | 1796 |
| 778 | Ga0207683_10207800 | 3300026121 | Bacteria | 1781 |
| 779 | Ga0207698_10000539 | 3300026142 | Bacteria | 21930 |
| 780 | Ga0207698_10004422 | 3300026142 | Bacteria | 8564 |
| 781 | Ga0207698_10013262 | 3300026142 | Bacteria | 5430 |
| 782 | Ga0207698_10026361 | 3300026142 | Bacteria | 4111 |
| 783 | Ga0207698_10045981 | 3300026142 | Bacteria | 3292 |
| 784 | Ga0207698_10088594 | 3300026142 | Unclassified | 2525 |
| 785 | Ga0207698_10200495 | 3300026142 | Unclassified | 1786 |
| 786 | Ga0207698_10413125 | 3300026142 | Bacteria | 1293 |
| 787 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 788 | Ga0268266_10006637 | 3300028379 | Bacteria | 10558 |
| 789 | Ga0268266_10103748 | 3300028379 | Bacteria | 2510 |
| 790 | Ga0268265_10009330 | 3300028380 | Bacteria | 6631 |
| 791 | Ga0268265_10066428 | 3300028380 | Bacteria | 2788 |
| 792 | Ga0268265_10300965 | 3300028380 | Bacteria | 1444 |
| 793 | Ga0268264_10000559 | 3300028381 | Bacteria | 45910 |
| 794 | Ga0268264_10001420 | 3300028381 | Bacteria | 22404 |
| 795 | Ga0268264_10006807 | 3300028381 | Bacteria | 9600 |
| 796 | Ga0268264_10007210 | 3300028381 | Bacteria | 9313 |
| 797 | Ga0268264_10012189 | 3300028381 | Bacteria | 7074 |
| 798 | Ga0268264_10017234 | 3300028381 | Bacteria | 5917 |
| 799 | Ga0268264_10024105 | 3300028381 | Bacteria | 4966 |
| 800 | Ga0268264_10046883 | 3300028381 | Bacteria | 3592 |
| 801 | Ga0268264_10337992 | 3300028381 | Unclassified | 1429 |
| 802 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 803 | Ga0307515_10000437 | 3300028794 | Bacteria | 100047 |
| 804 | Ga0265338_10175130 | 3300028800 | Bacteria | 1641 |
| 805 | Ga0307511_10000211 | 3300030521 | Bacteria | 59246 |
| 806 | Ga0265327_10000618 | 3300031251 | Bacteria | 58585 |
| 807 | Ga0265327_10000948 | 3300031251 | Bacteria | 42114 |
| 808 | Ga0307513_10043985 | 3300031456 | Bacteria | 4897 |
| 809 | Ga0307509_10221350 | 3300031507 | Bacteria | 1705 |
| 810 | Ga0307509_10256855 | 3300031507 | Bacteria | 1526 |
| 811 | Ga0265313_10047862 | 3300031595 | Bacteria | 2067 |
| 812 | Ga0307508_10014167 | 3300031616 | Bacteria | 7275 |
| 813 | Ga0307410_10083320 | 3300031852 | Bacteria | 2252 |
| 814 | Ga0307411_10086575 | 3300032005 | Bacteria | 2174 |
| 815 | Ga0307510_10012921 | 3300033180 | Bacteria | 9910 |
| 816 | Ga0373955_0072914 | 3300035172 | Bacteria | 1924 |
| 817 | Ga0373933_0097376 | 3300035724 | Bacteria | 1822 |
| 818 | Ga0373937_0269587 | 3300036401 | Bacteria | 1606 |
| 819 | Ga0373925_0275674 | 3300037068 | Bacteria | 1354 |
| 820 | Ga0395899_0034830 | 3300037312 | Bacteria | 3781 |
| 821 | Ga0395900_0000927 | 3300037418 | Bacteria | 38470 |
| 822 | Ga0395900_0032022 | 3300037418 | Bacteria | 5405 |
| 823 | Ga0395898_0009829 | 3300037466 | Bacteria | 10028 |
| 824 | Ga0395898_0313565 | 3300037466 | Unclassified | 1496 |
| 825 | Ga0395905_0006214 | 3300037471 | Bacteria | 12056 |
| 826 | Ga0395905_0095772 | 3300037471 | Bacteria | 2786 |
| 827 | Ga0395901_0001347 | 3300038443 | Bacteria | 25756 |
| 828 | Ga0395901_0010081 | 3300038443 | Bacteria | 9575 |
| 829 | Ga0436365_0955601 | 3300039437 | Bacteria | 10627 |
| 830 | Ga0436365_1743396 | 3300039437 | Bacteria | 55864 |
| 831 | Ga0439436_0000350 | 3300041404 | Bacteria | 11404 |
| 832 | Ga0439465_0031831 | 3300041413 | Bacteria | 1682 |
| 833 | Ga0439431_0001588 | 3300041997 | Bacteria | 5033 |
| 834 | Ga0439445_0024350 | 3300042004 | Bacteria | 1538 |
| 835 | Ga0439445_0044106 | 3300042004 | Bacteria | 1191 |
| 836 | Ga0439449_0011188 | 3300042007 | Unclassified | 3379 |
| 837 | Ga0439449_0017050 | 3300042007 | Bacteria | 2726 |
| 838 | Ga0439449_0041243 | 3300042007 | Bacteria | 1716 |
| 839 | Ga0439457_000130 | 3300042014 | Bacteria | 18863 |
| 840 | Ga0439457_003289 | 3300042014 | Bacteria | 4428 |
| 841 | Ga0439462_0003152 | 3300042015 | Bacteria | 3929 |
| 842 | Ga0451577_0005816 | 3300042876 | Bacteria | 12485 |
| 843 | Ga0451577_0101352 | 3300042876 | Unclassified | 2573 |
| 844 | Ga0466969_0000356 | 3300044656 | Bacteria | 25182 |
| 845 | Ga0466969_0181316 | 3300044656 | Bacteria | 964 |
| 846 | Ga0466972_0000047 | 3300044658 | Bacteria | 122901 |
| 847 | Ga0466972_0029484 | 3300044658 | Bacteria | 2701 |
| 848 | Ga0466966_0000038 | 3300044684 | Bacteria | 97255 |
| 849 | Ga0466966_0087507 | 3300044684 | Unclassified | 1936 |
| 850 | Ga0453684_0062022 | 3300044712 | Bacteria | 4793 |
| 851 | Ga0453684_0157438 | 3300044712 | Unclassified | 2691 |
| 852 | Ga0453684_0366909 | 3300044712 | Bacteria | 1620 |
| 853 | Ga0466968_0016485 | 3300044735 | Bacteria | 2943 |
| 854 | Ga0466968_0109329 | 3300044735 | Bacteria | 1242 |
| 855 | Ga0466970_0029085 | 3300044765 | Bacteria | 2907 |
| 856 | Ga0466957_0000329 | 3300044842 | Bacteria | 23093 |
| 857 | Ga0466957_0000739 | 3300044842 | Bacteria | 16704 |
| 858 | Ga0466960_0066308 | 3300044901 | Bacteria | 1785 |
| 859 | Ga0466959_0000289 | 3300045049 | Bacteria | 30468 |
| 860 | Ga0466959_0005476 | 3300045049 | Bacteria | 8699 |
| 861 | Ga0466958_0017362 | 3300045836 | Bacteria | 4158 |
| 862 | Ga0466967_0345757 | 3300045976 | Bacteria | 1439 |
| 863 | Ga0495627_019616 | 3300046453 | Bacteria | 2264 |
| 864 | Ga0495592_0036614 | 3300046454 | Bacteria | 3695 |
| 865 | Ga0495629_0013899 | 3300046459 | Bacteria | 5805 |
| 866 | Ga0495638_0016015 | 3300046460 | Bacteria | 5025 |
| 867 | Ga0495638_0184904 | 3300046460 | Bacteria | 1186 |
| 868 | Ga0495580_0107056 | 3300046472 | Unclassified | 1942 |
| 869 | Ga0495606_0012540 | 3300046507 | Bacteria | 6789 |
| 870 | Ga0495608_0064405 | 3300046511 | Bacteria | 2403 |
| 871 | Ga0495628_0112500 | 3300046516 | Bacteria | 2093 |
| 872 | Ga0495630_0140484 | 3300046517 | Bacteria | 1836 |
| 873 | Ga0495630_0261146 | 3300046517 | Bacteria | 1323 |
| 874 | Ga0495648_0002523 | 3300046524 | Bacteria | 16787 |
| 875 | Ga0495648_0085913 | 3300046524 | Bacteria | 1776 |
| 876 | Ga0495640_0092171 | 3300046533 | Unclassified | 1999 |
| 877 | Ga0495633_0000089 | 3300046558 | Bacteria | 123616 |
| 878 | Ga0495668_0000257 | 3300046616 | Bacteria | 75166 |
| 879 | Ga0495668_0000440 | 3300046616 | Bacteria | 53231 |
| 880 | Ga0495611_0000174 | 3300046648 | Bacteria | 46643 |
| 881 | Ga0495611_0008231 | 3300046648 | Bacteria | 4426 |
| 882 | Ga0495658_0003870 | 3300046683 | Bacteria | 7410 |
| 883 | Ga0495670_0113298 | 3300046691 | Unclassified | 1405 |
| 884 | Ga0495670_0120811 | 3300046691 | Bacteria | 1361 |
| 885 | Ga0495581_0071884 | 3300047315 | Unclassified | 2002 |
| 886 | Ga0495604_0155900 | 3300047317 | Unclassified | 1618 |
| 887 | Ga0495672_0008699 | 3300047320 | Bacteria | 7450 |
| 888 | Ga0495687_000058 | 3300047443 | Bacteria | 185830 |
| 889 | Ga0495675_0191494 | 3300047444 | Bacteria | 1248 |
| 890 | Ga0495684_0156852 | 3300047471 | Bacteria | 1700 |
| 891 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 892 | Ga0495686_0051544 | 3300047472 | Bacteria | 2582 |
| 893 | Ga0496100_0107490 | 3300048903 | Bacteria | 1933 |
| 894 | Ga0496101_0009191 | 3300048904 | Bacteria | 6487 |
| 895 | Ga0496106_0056974 | 3300048909 | Bacteria | 2955 |
| 896 | Ga0496110_0132971 | 3300048913 | Bacteria | 2247 |
| 897 | Ga0496111_0201891 | 3300048914 | Bacteria | 1478 |
| 898 | Ga0496114_0000318 | 3300048917 | Bacteria | 35272 |
| 899 | Ga0496114_0038907 | 3300048917 | Unclassified | 3936 |
| 900 | Ga0496121_0000086 | 3300048924 | Bacteria | 223703 |
| 901 | Ga0501297_005192 | 3300049520 | Bacteria | 1353 |
| 902 | Ga0501298_000085 | 3300049521 | Bacteria | 10588 |
| 903 | Ga0501031_0003151 | 3300049568 | Bacteria | 10580 |
| 904 | Ga0501032_0188764 | 3300049569 | Unclassified | 1347 |
| 905 | Ga0501033_0167316 | 3300049570 | Bacteria | 1580 |
| 906 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 907 | Ga0501034_0015223 | 3300049571 | Bacteria | 7905 |
| 908 | Ga0501034_0019755 | 3300049571 | Bacteria | 6886 |
| 909 | Ga0501034_0024144 | 3300049571 | Bacteria | 6184 |
| 910 | Ga0501034_0024924 | 3300049571 | Bacteria | 6086 |
| 911 | Ga0501034_0074987 | 3300049571 | Bacteria | 3390 |
| 912 | Ga0501034_0198498 | 3300049571 | Bacteria | 1965 |
| 913 | Ga0501034_0388457 | 3300049571 | Bacteria | 1320 |
| 914 | Ga0501036_0046476 | 3300049572 | Bacteria | 3676 |
| 915 | Ga0501036_0145405 | 3300049572 | Bacteria | 2000 |
| 916 | Ga0501037_0007495 | 3300049573 | Bacteria | 7987 |
| 917 | Ga0501038_0047620 | 3300049574 | Bacteria | 3713 |
| 918 | Ga0501038_0057989 | 3300049574 | Bacteria | 3321 |
| 919 | Ga0501038_0110638 | 3300049574 | Bacteria | 2276 |
| 920 | Ga0501039_0042051 | 3300049575 | Bacteria | 3531 |
| 921 | Ga0501039_0151510 | 3300049575 | Unclassified | 1821 |
| 922 | Ga0501043_0001798 | 3300049579 | Bacteria | 18427 |
| 923 | Ga0501043_0002152 | 3300049579 | Bacteria | 16797 |
| 924 | Ga0501043_0016289 | 3300049579 | Bacteria | 5829 |
| 925 | Ga0501043_0056650 | 3300049579 | Bacteria | 3079 |
| 926 | Ga0501046_0041840 | 3300049580 | Bacteria | 3654 |
| 927 | Ga0501046_0151332 | 3300049580 | Unclassified | 1750 |
| 928 | Ga0501047_0032624 | 3300049581 | Bacteria | 5028 |
| 929 | Ga0501047_0037183 | 3300049581 | Bacteria | 4707 |
| 930 | Ga0501047_0041518 | 3300049581 | Bacteria | 4445 |
| 931 | Ga0501047_0049748 | 3300049581 | Bacteria | 4047 |
| 932 | Ga0501047_0109568 | 3300049581 | Bacteria | 2644 |
| 933 | Ga0501047_0143303 | 3300049581 | Bacteria | 2267 |
| 934 | Ga0501067_0015790 | 3300049583 | Bacteria | 4178 |
| 935 | Ga0501070_0179530 | 3300049586 | Bacteria | 1743 |
| 936 | Ga0501070_0248247 | 3300049586 | Bacteria | 1456 |
| 937 | Ga0501070_0259217 | 3300049586 | Bacteria | 1421 |
| 938 | Ga0501073_0035482 | 3300049589 | Bacteria | 3544 |
| 939 | Ga0501074_0021945 | 3300049590 | Bacteria | 4636 |
| 940 | Ga0501198_003936 | 3300049649 | Bacteria | 2051 |
| 941 | Ga0501201_000236 | 3300049651 | Bacteria | 4954 |
| 942 | Ga0501202_000452 | 3300049652 | Bacteria | 5817 |
| 943 | Ga0501206_000782 | 3300049653 | Bacteria | 3896 |
| 944 | Ga0501207_000054 | 3300049654 | Bacteria | 8472 |
| 945 | Ga0501217_000181 | 3300049661 | Bacteria | 9260 |
| 946 | Ga0501222_004155 | 3300049662 | Bacteria | 1965 |
| 947 | Ga0501223_003113 | 3300049663 | Bacteria | 3625 |
| 948 | Ga0501224_002202 | 3300049664 | Bacteria | 2646 |
| 949 | Ga0501233_006861 | 3300049668 | Bacteria | 2152 |
| 950 | Ga0501238_002085 | 3300049671 | Bacteria | 2357 |
| 951 | Ga0501240_000840 | 3300049673 | Bacteria | 2753 |
| 952 | Ga0501243_000876 | 3300049675 | Bacteria | 4203 |
| 953 | Ga0501243_001810 | 3300049675 | Unclassified | 3096 |
| 954 | Ga0501251_000740 | 3300049681 | Bacteria | 2952 |
| 955 | Ga0501252_000530 | 3300049682 | Bacteria | 2976 |
| 956 | Ga0501257_001703 | 3300049686 | Bacteria | 4584 |
| 957 | Ga0501257_010256 | 3300049686 | Bacteria | 2124 |
| 958 | Ga0501257_057999 | 3300049686 | Bacteria | 975 |
| 959 | Ga0501259_000287 | 3300049688 | Bacteria | 7949 |
| 960 | Ga0501259_001154 | 3300049688 | Bacteria | 4397 |
| 961 | Ga0501261_000774 | 3300049690 | Bacteria | 3982 |
| 962 | Ga0501219_000020 | 3300049703 | Bacteria | 25032 |
| 963 | Ga0501221_000607 | 3300049704 | Bacteria | 5722 |
| 964 | Ga0501225_0000285 | 3300049705 | Bacteria | 15805 |
| 965 | Ga0501245_000238 | 3300049708 | Bacteria | 6264 |
| 966 | Ga0501245_004007 | 3300049708 | Unclassified | 2014 |
| 967 | Ga0501079_0008887 | 3300049741 | Bacteria | 7607 |
| 968 | Ga0501079_0034323 | 3300049741 | Bacteria | 3904 |
| 969 | Ga0501080_0039205 | 3300049742 | Bacteria | 4421 |
| 970 | Ga0501080_0109537 | 3300049742 | Unclassified | 2560 |
| 971 | Ga0501080_0276056 | 3300049742 | Bacteria | 1529 |
| 972 | Ga0501083_0015447 | 3300049744 | Bacteria | 5347 |
| 973 | Ga0501241_000145 | 3300049758 | Bacteria | 15844 |
| 974 | Ga0501263_007663 | 3300049760 | Bacteria | 1274 |
| 975 | Ga0501266_000837 | 3300049763 | Bacteria | 4023 |
| 976 | Ga0501268_007668 | 3300049765 | Bacteria | 1615 |
| 977 | Ga0501283_004516 | 3300049779 | Bacteria | 1885 |
| 978 | Ga0501035_0023552 | 3300049822 | Bacteria | 5649 |
| 979 | Ga0501035_0102713 | 3300049822 | Bacteria | 2508 |
| 980 | Ga0501035_0132391 | 3300049822 | Bacteria | 2173 |
| 981 | Ga0501044_0005008 | 3300049823 | Bacteria | 14790 |
| 982 | Ga0501044_0016455 | 3300049823 | Bacteria | 7938 |
| 983 | Ga0501044_0028917 | 3300049823 | Bacteria | 5846 |
| 984 | Ga0501044_0031459 | 3300049823 | Bacteria | 5586 |
| 985 | Ga0501044_0041171 | 3300049823 | Bacteria | 4810 |
| 986 | Ga0501044_0124769 | 3300049823 | Bacteria | 2573 |
| 987 | Ga0501044_0143970 | 3300049823 | Bacteria | 2370 |
| 988 | Ga0501044_0149703 | 3300049823 | Bacteria | 2317 |
| 989 | Ga0501044_0174341 | 3300049823 | Bacteria | 2120 |
| 990 | Ga0501044_0472302 | 3300049823 | Unclassified | 1158 |
| 991 | Ga0501284_00030 | 3300050005 | Bacteria | 71858 |
| 992 | nmdc:mga0k408_103955_c1 | 3300050493 | Bacteria | 1676 |
| 993 | nmdc:mga0k408_26438_c1 | 3300050493 | Bacteria | 2982 |
| 994 | nmdc:mga0k408_9076_c1 | 3300050493 | Bacteria | 5352 |
| 995 | nmdc:mga05p37_32575_c1 | 3300050507 | Bacteria | 6374 |
| 996 | nmdc:mga09592_998_c1 | 3300050508 | Bacteria | 22420 |
| 997 | nmdc:mga08y16_464500_c1 | 3300050511 | Bacteria | 1289 |
| 998 | nmdc:mga08y16_5081_c1 | 3300050511 | Bacteria | 13754 |
| 999 | nmdc:mga0n895_35785_c1 | 3300050512 | Bacteria | 4790 |
| 1000 | Ga0500578_0000469 | 3300053086 | Bacteria | 49263 |
| 1001 | Ga0500578_0123206 | 3300053086 | Bacteria | 1629 |
| 1002 | Ga0500644_0000545 | 3300053088 | Bacteria | 15501 |
| 1003 | Ga0500646_0003186 | 3300053090 | Bacteria | 4210 |
| 1004 | Ga0500583_0000182 | 3300053092 | Bacteria | 25516 |
| 1005 | Ga0500583_0000288 | 3300053092 | Bacteria | 17461 |
| 1006 | Ga0500651_0093030 | 3300053093 | Bacteria | 1854 |
| 1007 | Ga0500556_0002529 | 3300053104 | Bacteria | 5807 |
| 1008 | Ga0500562_000005 | 3300053108 | Bacteria | 266746 |
| 1009 | Ga0500569_001719 | 3300053109 | Bacteria | 4185 |
| 1010 | Ga0500642_0002877 | 3300053130 | Bacteria | 5114 |
| 1011 | Ga0500658_0001867 | 3300053134 | Bacteria | 8271 |
| 1012 | Ga0500559_0044762 | 3300053136 | Bacteria | 1937 |
| 1013 | Ga0500568_0000155 | 3300053139 | Bacteria | 59396 |
| 1014 | Ga0500577_0001666 | 3300053142 | Bacteria | 5689 |
| 1015 | Ga0500588_0002305 | 3300053146 | Bacteria | 3854 |
| 1016 | Ga0500589_003476 | 3300053147 | Bacteria | 5674 |
| 1017 | Ga0500616_0006051 | 3300053153 | Bacteria | 8028 |
| 1018 | Ga0500616_0030216 | 3300053153 | Bacteria | 2977 |
| 1019 | Ga0500616_0038528 | 3300053153 | Bacteria | 2581 |
| 1020 | Ga0500622_0000150 | 3300053156 | Bacteria | 73468 |
| 1021 | Ga0500622_0001399 | 3300053156 | Bacteria | 19440 |
| 1022 | Ga0500622_0001705 | 3300053156 | Bacteria | 17048 |
| 1023 | Ga0500622_0024966 | 3300053156 | Bacteria | 3159 |
| 1024 | Ga0500627_0001050 | 3300053158 | Bacteria | 7524 |
| 1025 | Ga0500633_0000426 | 3300053160 | Bacteria | 6600 |
| 1026 | Ga0500636_0029952 | 3300053177 | Bacteria | 3217 |
| 1027 | Ga0500636_0102165 | 3300053177 | Bacteria | 1629 |
| 1028 | Ga0500637_0101020 | 3300053178 | Unclassified | 1673 |
| 1029 | Ga0500611_000039 | 3300053727 | Bacteria | 68825 |
| 1030 | Ga0501084_0019472 | 3300054114 | Bacteria | 5654 |
| 1031 | Ga0500661_011461 | 3300055283 | Bacteria | 1603 |
| 1032 | Ga0466962_0004394 | 3300061719 | Bacteria | 6761 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049686 | Ga0501257_057999 | Ga0501257_057999_46_900 | 253 |
| 2 | 3300044656 | Ga0466969_0181316 | Ga0466969_0181316_48_911 | 254 |
| 3 | 3300009551 | Ga0105238_10606925 | Ga0105238_106069251 | 257 |
| 4 | 3300009093 | Ga0105240_10104603 | Ga0105240_101046033 | 263 |
| 5 | 3300013104 | Ga0157370_10010610 | Ga0157370_100106107 | 263 |
| 6 | 3300013105 | Ga0157369_10058404 | Ga0157369_100584044 | 263 |
| 7 | 3300013307 | Ga0157372_10001585 | Ga0157372_1000158512 | 263 |
| 8 | 3300013306 | Ga0163162_10413788 | Ga0163162_104137881 | 287 |
| 9 | 3300005471 | Ga0070698_100006358 | Ga0070698_1000063588 | 289 |
| 10 | 3300006844 | Ga0075428_100066083 | Ga0075428_1000660833 | 289 |
| 11 | 3300003761 | Ga0055535_1001304 | Ga0055535_10013044 | 290 |
| 12 | 3300025242 | Ga0209258_100032 | Ga0209258_100032290 | 290 |
| 13 | 3300025254 | Ga0209148_1000339 | Ga0209148_100033924 | 290 |
| 14 | 3300053153 | Ga0500616_0038528 | Ga0500616_0038528_1522_2496 | 291 |
| 15 | 3300005338 | Ga0068868_100047437 | Ga0068868_1000474372 | 296 |
| 16 | 3300005364 | Ga0070673_100182317 | Ga0070673_1001823172 | 296 |
| 17 | 3300005543 | Ga0070672_100218899 | Ga0070672_1002188992 | 296 |
| 18 | 3300014745 | Ga0157377_10118187 | Ga0157377_101181872 | 296 |
| 19 | 3300025926 | Ga0207659_10115225 | Ga0207659_101152252 | 296 |
| 20 | 3300025940 | Ga0207691_10133024 | Ga0207691_101330242 | 296 |
| 21 | 3300025960 | Ga0207651_10200560 | Ga0207651_102005602 | 296 |
| 22 | 3300049675 | Ga0501243_001810 | Ga0501243_001810_1734_2717 | 296 |
| 23 | 3300049682 | Ga0501252_000530 | Ga0501252_000530_1021_2004 | 296 |
| 24 | 3300049686 | Ga0501257_010256 | Ga0501257_010256_1037_2020 | 296 |
| 25 | 3300049688 | Ga0501259_001154 | Ga0501259_001154_3276_4259 | 296 |
| 26 | 3300049708 | Ga0501245_004007 | Ga0501245_004007_86_1069 | 296 |
| 27 | 3300049760 | Ga0501263_007663 | Ga0501263_007663_217_1200 | 296 |
| 28 | 3300049763 | Ga0501266_000837 | Ga0501266_000837_3015_3998 | 296 |
| 29 | 3300013102 | Ga0157371_10008105 | Ga0157371_100081056 | 297 |
| 30 | 3300013306 | Ga0163162_10412930 | Ga0163162_104129302 | 298 |
| 31 | 3300042876 | Ga0451577_0005816 | Ga0451577_0005816_853_1890 | 299 |
| 32 | 3300005366 | Ga0070659_100040579 | Ga0070659_1000405792 | 300 |
| 33 | 3300005530 | Ga0070679_100171712 | Ga0070679_1001717123 | 300 |
| 34 | 3300013100 | Ga0157373_10028054 | Ga0157373_100280542 | 300 |
| 35 | 3300013307 | Ga0157372_10107026 | Ga0157372_101070265 | 300 |
| 36 | 3300025919 | Ga0207657_10274909 | Ga0207657_102749091 | 300 |
| 37 | 3300025921 | Ga0207652_10038291 | Ga0207652_100382912 | 300 |
| 38 | 3300025932 | Ga0207690_10024157 | Ga0207690_100241572 | 300 |
| 39 | 3300026041 | Ga0207639_10074162 | Ga0207639_100741623 | 300 |
| 40 | 3300049649 | Ga0501198_003936 | Ga0501198_003936_1045_2040 | 300 |
| 41 | 3300049823 | Ga0501044_0143970 | Ga0501044_0143970_357_1379 | 300 |
| 42 | 3300050511 | nmdc:mga08y16_464500_c1 | nmdc:mga08y16_464500_c1_283_1278 | 300 |
| 43 | 3300005616 | Ga0068852_100461213 | Ga0068852_1004612131 | 303 |
| 44 | iso_pu_bacteria | 2818991444 | 2819589803 | 303 |
| 45 | iso_pu_bacteria | 2881955468 | 2881957943 | 303 |
| 46 | iso_pu_bacteria | 2929154850 | 2929160005 | 303 |
| 47 | 3300033180 | Ga0307510_10012921 | Ga0307510_100129211 | 304 |
| 48 | 3300042876 | Ga0451577_0101352 | Ga0451577_0101352_55_1143 | 305 |
| 49 | 3300044712 | Ga0453684_0157438 | Ga0453684_0157438_575_1663 | 305 |
| 50 | 3300001979 | JGI24740J21852_10014041 | JGI24740J21852_100140412 | 306 |
| 51 | 3300003203 | JGI25406J46586_10004435 | JGI25406J46586_100044351 | 306 |
| 52 | 3300003316 | rootH1_10156821 | rootH1_101568212 | 306 |
| 53 | 3300003322 | rootL2_10030107 | rootL2_100301073 | 306 |
| 54 | 3300003354 | JGI25160J50197_1002148 | JGI25160J50197_10021484 | 306 |
| 55 | 3300005327 | Ga0070658_10140561 | Ga0070658_101405612 | 306 |
| 56 | 3300005329 | Ga0070683_100081819 | Ga0070683_1000818192 | 306 |
| 57 | 3300005329 | Ga0070683_100135703 | Ga0070683_1001357032 | 306 |
| 58 | 3300005335 | Ga0070666_10138650 | Ga0070666_101386501 | 306 |
| 59 | 3300005336 | Ga0070680_100063728 | Ga0070680_1000637283 | 306 |
| 60 | 3300005337 | Ga0070682_100047897 | Ga0070682_1000478973 | 306 |
| 61 | 3300005339 | Ga0070660_100008803 | Ga0070660_1000088032 | 306 |
| 62 | 3300005344 | Ga0070661_100004089 | Ga0070661_1000040898 | 306 |
| 63 | 3300005354 | Ga0070675_100059203 | Ga0070675_1000592032 | 306 |
| 64 | 3300005355 | Ga0070671_100169224 | Ga0070671_1001692242 | 306 |
| 65 | 3300005364 | Ga0070673_100085000 | Ga0070673_1000850002 | 306 |
| 66 | 3300005366 | Ga0070659_100102391 | Ga0070659_1001023913 | 306 |
| 67 | 3300005457 | Ga0070662_100048534 | Ga0070662_1000485341 | 306 |
| 68 | 3300005458 | Ga0070681_10122987 | Ga0070681_101229872 | 306 |
| 69 | 3300005530 | Ga0070679_100038338 | Ga0070679_1000383382 | 306 |
| 70 | 3300005530 | Ga0070679_100233018 | Ga0070679_1002330181 | 306 |
| 71 | 3300005530 | Ga0070679_100354035 | Ga0070679_1003540351 | 306 |
| 72 | 3300005539 | Ga0068853_100109535 | Ga0068853_1001095353 | 306 |
| 73 | 3300005563 | Ga0068855_100122489 | Ga0068855_1001224894 | 306 |
| 74 | 3300005564 | Ga0070664_100095816 | Ga0070664_1000958162 | 306 |
| 75 | 3300005577 | Ga0068857_100076991 | Ga0068857_1000769914 | 306 |
| 76 | 3300005578 | Ga0068854_100178680 | Ga0068854_1001786802 | 306 |
| 77 | 3300005578 | Ga0068854_100224069 | Ga0068854_1002240692 | 306 |
| 78 | 3300005614 | Ga0068856_100053633 | Ga0068856_1000536335 | 306 |
| 79 | 3300005618 | Ga0068864_100256941 | Ga0068864_1002569412 | 306 |
| 80 | 3300005985 | Ga0081539_10000910 | Ga0081539_1000091012 | 306 |
| 81 | 3300006358 | Ga0068871_100018659 | Ga0068871_1000186596 | 306 |
| 82 | 3300006358 | Ga0068871_100273614 | Ga0068871_1002736143 | 306 |
| 83 | 3300010375 | Ga0105239_10006468 | Ga0105239_100064686 | 306 |
| 84 | 3300013100 | Ga0157373_10110478 | Ga0157373_101104782 | 306 |
| 85 | 3300013105 | Ga0157369_10064658 | Ga0157369_100646582 | 306 |
| 86 | 3300013105 | Ga0157369_10117277 | Ga0157369_101172773 | 306 |
| 87 | 3300013296 | Ga0157374_10027330 | Ga0157374_100273304 | 306 |
| 88 | 3300013297 | Ga0157378_10030526 | Ga0157378_100305262 | 306 |
| 89 | 3300013306 | Ga0163162_10075172 | Ga0163162_100751722 | 306 |
| 90 | 3300013306 | Ga0163162_10271550 | Ga0163162_102715502 | 306 |
| 91 | 3300013306 | Ga0163162_10342106 | Ga0163162_103421062 | 306 |
| 92 | 3300013307 | Ga0157372_10017506 | Ga0157372_100175063 | 306 |
| 93 | 3300013308 | Ga0157375_10454185 | Ga0157375_104541852 | 306 |
| 94 | 3300021384 | Ga0213876_10010752 | Ga0213876_100107522 | 306 |
| 95 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059113 | 306 |
| 96 | 3300025903 | Ga0207680_10166621 | Ga0207680_101666212 | 306 |
| 97 | 3300025912 | Ga0207707_10143837 | Ga0207707_101438372 | 306 |
| 98 | 3300025917 | Ga0207660_10153271 | Ga0207660_101532712 | 306 |
| 99 | 3300025919 | Ga0207657_10000893 | Ga0207657_1000089333 | 306 |
| 100 | 3300025921 | Ga0207652_10097104 | Ga0207652_100971042 | 306 |
| 101 | 3300025931 | Ga0207644_10288278 | Ga0207644_102882782 | 306 |
| 102 | 3300025932 | Ga0207690_10032465 | Ga0207690_100324652 | 306 |
| 103 | 3300025933 | Ga0207706_10000957 | Ga0207706_100009571 | 306 |
| 104 | 3300025938 | Ga0207704_10229414 | Ga0207704_102294141 | 306 |
| 105 | 3300025944 | Ga0207661_10049528 | Ga0207661_100495282 | 306 |
| 106 | 3300025981 | Ga0207640_10188072 | Ga0207640_101880721 | 306 |
| 107 | 3300026067 | Ga0207678_10164869 | Ga0207678_101648692 | 306 |
| 108 | 3300026078 | Ga0207702_10174654 | Ga0207702_101746542 | 306 |
| 109 | 3300026095 | Ga0207676_10521696 | Ga0207676_105216961 | 306 |
| 110 | 3300026116 | Ga0207674_10081190 | Ga0207674_100811901 | 306 |
| 111 | 3300026116 | Ga0207674_10201198 | Ga0207674_102011982 | 306 |
| 112 | 3300028800 | Ga0265338_10175130 | Ga0265338_101751302 | 306 |
| 113 | 3300031251 | Ga0265327_10000618 | Ga0265327_1000061852 | 306 |
| 114 | 3300039437 | Ga0436365_0955601 | Ga0436365_0955601_2609_3607 | 306 |
| 115 | 3300045976 | Ga0466967_0345757 | Ga0466967_0345757_326_1333 | 306 |
| 116 | 3300046524 | Ga0495648_0085913 | Ga0495648_0085913_665_1648 | 306 |
| 117 | 3300046648 | Ga0495611_0000174 | Ga0495611_0000174_32932_33915 | 306 |
| 118 | 3300049571 | Ga0501034_0019755 | Ga0501034_0019755_1091_2089 | 306 |
| 119 | 3300049581 | Ga0501047_0109568 | Ga0501047_0109568_878_1849 | 306 |
| 120 | 3300049586 | Ga0501070_0248247 | Ga0501070_0248247_77_1075 | 306 |
| 121 | 3300049823 | Ga0501044_0124769 | Ga0501044_0124769_437_1408 | 306 |
| 122 | 3300053108 | Ga0500562_000005 | Ga0500562_000005_200268_201278 | 306 |
| 123 | 3300053156 | Ga0500622_0001705 | Ga0500622_0001705_15502_16512 | 306 |
| 124 | 3300055283 | Ga0500661_011461 | Ga0500661_011461_458_1468 | 306 |
| 125 | 3300003316 | rootH1_10143070 | rootH1_101430703 | 307 |
| 126 | 3300003322 | rootL2_10140353 | rootL2_101403533 | 307 |
| 127 | 3300003323 | rootH1_10159681 | rootH1_101596812 | 307 |
| 128 | 3300014325 | Ga0163163_10109623 | Ga0163163_101096232 | 307 |
| 129 | 3300021384 | Ga0213876_10005918 | Ga0213876_100059183 | 307 |
| 130 | 3300039437 | Ga0436365_1743396 | Ga0436365_1743396_47290_48285 | 307 |
| 131 | 3300046507 | Ga0495606_0012540 | Ga0495606_0012540_2769_3755 | 307 |
| 132 | 3300046616 | Ga0495668_0000440 | Ga0495668_0000440_51930_52931 | 307 |
| 133 | 3300049571 | Ga0501034_0015223 | Ga0501034_0015223_6754_7752 | 307 |
| 134 | 3300049742 | Ga0501080_0276056 | Ga0501080_0276056_180_1178 | 307 |
| 135 | 3300049823 | Ga0501044_0016455 | Ga0501044_0016455_2890_3888 | 307 |
| 136 | 3300053104 | Ga0500556_0002529 | Ga0500556_0002529_1164_2165 | 307 |
| 137 | 3300053130 | Ga0500642_0002877 | Ga0500642_0002877_692_1693 | 307 |
| 138 | 3300053153 | Ga0500616_0006051 | Ga0500616_0006051_3904_4905 | 307 |
| 139 | 3300053158 | Ga0500627_0001050 | Ga0500627_0001050_5129_6130 | 307 |
| 140 | 3300013297 | Ga0157378_10123419 | Ga0157378_101234191 | 308 |
| 141 | 3300031251 | Ga0265327_10000948 | Ga0265327_100009483 | 308 |
| 142 | 3300048917 | Ga0496114_0000318 | Ga0496114_0000318_23193_24212 | 308 |
| 143 | 3300010375 | Ga0105239_10095385 | Ga0105239_100953852 | 309 |
| 144 | 3300053156 | Ga0500622_0000150 | Ga0500622_0000150_50194_51195 | 309 |
| 145 | 3300005329 | Ga0070683_100002583 | Ga0070683_1000025839 | 310 |
| 146 | 3300005535 | Ga0070684_100031540 | Ga0070684_1000315404 | 310 |
| 147 | 3300005563 | Ga0068855_100006230 | Ga0068855_1000062306 | 310 |
| 148 | 3300010375 | Ga0105239_10018690 | Ga0105239_100186904 | 310 |
| 149 | 3300013104 | Ga0157370_10082916 | Ga0157370_100829164 | 310 |
| 150 | 3300013105 | Ga0157369_10159290 | Ga0157369_101592902 | 310 |
| 151 | 3300013307 | Ga0157372_10092224 | Ga0157372_100922243 | 310 |
| 152 | 3300025904 | Ga0207647_10028428 | Ga0207647_100284282 | 310 |
| 153 | 3300025913 | Ga0207695_10000212 | Ga0207695_10000212119 | 310 |
| 154 | 3300025944 | Ga0207661_10001812 | Ga0207661_100018129 | 310 |
| 155 | 3300025949 | Ga0207667_10000414 | Ga0207667_1000041446 | 310 |
| 156 | 3300049520 | Ga0501297_005192 | Ga0501297_005192_112_1146 | 310 |
| 157 | 3300053109 | Ga0500569_001719 | Ga0500569_001719_2009_3013 | 310 |
| 158 | 3300053134 | Ga0500658_0001867 | Ga0500658_0001867_5813_6817 | 310 |
| 159 | 3300053142 | Ga0500577_0001666 | Ga0500577_0001666_1506_2510 | 310 |
| 160 | 3300053153 | Ga0500616_0030216 | Ga0500616_0030216_1357_2361 | 310 |
| 161 | iso_pu_bacteria | 2738541278 | 2738725858 | 310 |
| 162 | 3300013105 | Ga0157369_10208073 | Ga0157369_102080733 | 312 |
| 163 | 3300042007 | Ga0439449_0011188 | Ga0439449_0011188_458_1498 | 312 |
| 164 | 3300042014 | Ga0439457_003289 | Ga0439457_003289_416_1456 | 312 |
| 165 | 3300044735 | Ga0466968_0109329 | Ga0466968_0109329_54_1067 | 312 |
| 166 | 3300046459 | Ga0495629_0013899 | Ga0495629_0013899_3511_4560 | 312 |
| 167 | 3300046472 | Ga0495580_0107056 | Ga0495580_0107056_826_1875 | 312 |
| 168 | 3300046533 | Ga0495640_0092171 | Ga0495640_0092171_231_1280 | 312 |
| 169 | 3300046683 | Ga0495658_0003870 | Ga0495658_0003870_2772_3821 | 312 |
| 170 | 3300047315 | Ga0495581_0071884 | Ga0495581_0071884_600_1649 | 312 |
| 171 | 3300047317 | Ga0495604_0155900 | Ga0495604_0155900_72_1121 | 312 |
| 172 | 3300053727 | Ga0500611_000039 | Ga0500611_000039_51460_52497 | 312 |
| 173 | iso_pu_bacteria | 2821136567 | 2821140837 | 312 |
| 174 | iso_pu_bacteria | 2904467357 | 2904471339 | 312 |
| 175 | iso_pu_bacteria | 2929239360 | 2929240303 | 312 |
| 176 | 3300002459 | JGI24751J29686_10000655 | JGI24751J29686_100006555 | 313 |
| 177 | 3300003320 | rootH2_10006582 | rootH2_100065825 | 313 |
| 178 | 3300003320 | rootH2_10022930 | rootH2_1002293019 | 313 |
| 179 | 3300003322 | rootL2_10031071 | rootL2_100310714 | 313 |
| 180 | 3300003322 | rootL2_10136943 | rootL2_101369433 | 313 |
| 181 | 3300003322 | rootL2_10210810 | rootL2_102108102 | 313 |
| 182 | 3300005290 | Ga0065712_10000981 | Ga0065712_100009815 | 313 |
| 183 | 3300005290 | Ga0065712_10008215 | Ga0065712_100082153 | 313 |
| 184 | 3300005290 | Ga0065712_10119802 | Ga0065712_101198022 | 313 |
| 185 | 3300005293 | Ga0065715_10092426 | Ga0065715_100924265 | 313 |
| 186 | 3300005327 | Ga0070658_10000832 | Ga0070658_100008328 | 313 |
| 187 | 3300005328 | Ga0070676_10001192 | Ga0070676_100011924 | 313 |
| 188 | 3300005328 | Ga0070676_10014551 | Ga0070676_100145513 | 313 |
| 189 | 3300005328 | Ga0070676_10020608 | Ga0070676_100206082 | 313 |
| 190 | 3300005329 | Ga0070683_100006473 | Ga0070683_1000064736 | 313 |
| 191 | 3300005329 | Ga0070683_100014557 | Ga0070683_1000145573 | 313 |
| 192 | 3300005329 | Ga0070683_100063547 | Ga0070683_1000635473 | 313 |
| 193 | 3300005331 | Ga0070670_100019919 | Ga0070670_1000199194 | 313 |
| 194 | 3300005331 | Ga0070670_100040716 | Ga0070670_1000407163 | 313 |
| 195 | 3300005331 | Ga0070670_100048124 | Ga0070670_1000481242 | 313 |
| 196 | 3300005331 | Ga0070670_100065603 | Ga0070670_1000656033 | 313 |
| 197 | 3300005331 | Ga0070670_100303798 | Ga0070670_1003037982 | 313 |
| 198 | 3300005334 | Ga0068869_100002227 | Ga0068869_1000022278 | 313 |
| 199 | 3300005334 | Ga0068869_100002467 | Ga0068869_1000024675 | 313 |
| 200 | 3300005334 | Ga0068869_100018710 | Ga0068869_1000187102 | 313 |
| 201 | 3300005334 | Ga0068869_100020876 | Ga0068869_1000208761 | 313 |
| 202 | 3300005334 | Ga0068869_100028959 | Ga0068869_1000289593 | 313 |
| 203 | 3300005334 | Ga0068869_100030116 | Ga0068869_1000301163 | 313 |
| 204 | 3300005334 | Ga0068869_100061749 | Ga0068869_1000617492 | 313 |
| 205 | 3300005334 | Ga0068869_100140058 | Ga0068869_1001400582 | 313 |
| 206 | 3300005334 | Ga0068869_100145070 | Ga0068869_1001450702 | 313 |
| 207 | 3300005335 | Ga0070666_10000227 | Ga0070666_1000022711 | 313 |
| 208 | 3300005335 | Ga0070666_10000694 | Ga0070666_100006943 | 313 |
| 209 | 3300005335 | Ga0070666_10013725 | Ga0070666_100137254 | 313 |
| 210 | 3300005335 | Ga0070666_10027886 | Ga0070666_100278863 | 313 |
| 211 | 3300005336 | Ga0070680_100000268 | Ga0070680_10000026819 | 313 |
| 212 | 3300005337 | Ga0070682_100002103 | Ga0070682_1000021034 | 313 |
| 213 | 3300005338 | Ga0068868_100000022 | Ga0068868_1000000225 | 313 |
| 214 | 3300005338 | Ga0068868_100003164 | Ga0068868_1000031642 | 313 |
| 215 | 3300005338 | Ga0068868_100017935 | Ga0068868_1000179353 | 313 |
| 216 | 3300005338 | Ga0068868_100098971 | Ga0068868_1000989712 | 313 |
| 217 | 3300005338 | Ga0068868_100135613 | Ga0068868_1001356132 | 313 |
| 218 | 3300005339 | Ga0070660_100134960 | Ga0070660_1001349602 | 313 |
| 219 | 3300005339 | Ga0070660_100212691 | Ga0070660_1002126912 | 313 |
| 220 | 3300005340 | Ga0070689_100004351 | Ga0070689_1000043514 | 313 |
| 221 | 3300005340 | Ga0070689_100065434 | Ga0070689_1000654342 | 313 |
| 222 | 3300005340 | Ga0070689_100091265 | Ga0070689_1000912651 | 313 |
| 223 | 3300005340 | Ga0070689_100125780 | Ga0070689_1001257801 | 313 |
| 224 | 3300005340 | Ga0070689_100187974 | Ga0070689_1001879741 | 313 |
| 225 | 3300005340 | Ga0070689_100348523 | Ga0070689_1003485231 | 313 |
| 226 | 3300005341 | Ga0070691_10000271 | Ga0070691_1000027110 | 313 |
| 227 | 3300005341 | Ga0070691_10044554 | Ga0070691_100445542 | 313 |
| 228 | 3300005343 | Ga0070687_100007090 | Ga0070687_1000070903 | 313 |
| 229 | 3300005344 | Ga0070661_100000111 | Ga0070661_10000011148 | 313 |
| 230 | 3300005344 | Ga0070661_100020641 | Ga0070661_1000206414 | 313 |
| 231 | 3300005344 | Ga0070661_100023047 | Ga0070661_1000230474 | 313 |
| 232 | 3300005347 | Ga0070668_100000016 | Ga0070668_10000001680 | 313 |
| 233 | 3300005347 | Ga0070668_100045177 | Ga0070668_1000451772 | 313 |
| 234 | 3300005347 | Ga0070668_100062465 | Ga0070668_1000624652 | 313 |
| 235 | 3300005347 | Ga0070668_100063538 | Ga0070668_1000635382 | 313 |
| 236 | 3300005347 | Ga0070668_100351620 | Ga0070668_1003516201 | 313 |
| 237 | 3300005353 | Ga0070669_100022311 | Ga0070669_1000223112 | 313 |
| 238 | 3300005353 | Ga0070669_100065523 | Ga0070669_1000655233 | 313 |
| 239 | 3300005354 | Ga0070675_100005753 | Ga0070675_1000057536 | 313 |
| 240 | 3300005354 | Ga0070675_100073229 | Ga0070675_1000732292 | 313 |
| 241 | 3300005354 | Ga0070675_100075650 | Ga0070675_1000756503 | 313 |
| 242 | 3300005355 | Ga0070671_100001071 | Ga0070671_1000010719 | 313 |
| 243 | 3300005355 | Ga0070671_100028175 | Ga0070671_1000281753 | 313 |
| 244 | 3300005355 | Ga0070671_100123973 | Ga0070671_1001239733 | 313 |
| 245 | 3300005355 | Ga0070671_100141853 | Ga0070671_1001418532 | 313 |
| 246 | 3300005356 | Ga0070674_100005491 | Ga0070674_1000054915 | 313 |
| 247 | 3300005364 | Ga0070673_100001320 | Ga0070673_1000013203 | 313 |
| 248 | 3300005364 | Ga0070673_100006098 | Ga0070673_1000060985 | 313 |
| 249 | 3300005364 | Ga0070673_100010627 | Ga0070673_1000106272 | 313 |
| 250 | 3300005364 | Ga0070673_100012671 | Ga0070673_1000126714 | 313 |
| 251 | 3300005364 | Ga0070673_100039851 | Ga0070673_1000398512 | 313 |
| 252 | 3300005364 | Ga0070673_100096802 | Ga0070673_1000968022 | 313 |
| 253 | 3300005364 | Ga0070673_100137603 | Ga0070673_1001376032 | 313 |
| 254 | 3300005364 | Ga0070673_100145854 | Ga0070673_1001458542 | 313 |
| 255 | 3300005364 | Ga0070673_100203564 | Ga0070673_1002035642 | 313 |
| 256 | 3300005365 | Ga0070688_100008316 | Ga0070688_1000083163 | 313 |
| 257 | 3300005365 | Ga0070688_100011264 | Ga0070688_1000112642 | 313 |
| 258 | 3300005365 | Ga0070688_100013987 | Ga0070688_1000139875 | 313 |
| 259 | 3300005365 | Ga0070688_100024308 | Ga0070688_1000243082 | 313 |
| 260 | 3300005365 | Ga0070688_100182867 | Ga0070688_1001828671 | 313 |
| 261 | 3300005365 | Ga0070688_100229087 | Ga0070688_1002290871 | 313 |
| 262 | 3300005366 | Ga0070659_100003782 | Ga0070659_1000037825 | 313 |
| 263 | 3300005366 | Ga0070659_100042015 | Ga0070659_1000420151 | 313 |
| 264 | 3300005367 | Ga0070667_100000031 | Ga0070667_100000031153 | 313 |
| 265 | 3300005367 | Ga0070667_100002868 | Ga0070667_1000028687 | 313 |
| 266 | 3300005367 | Ga0070667_100006052 | Ga0070667_1000060527 | 313 |
| 267 | 3300005367 | Ga0070667_100031584 | Ga0070667_1000315841 | 313 |
| 268 | 3300005367 | Ga0070667_100053044 | Ga0070667_1000530441 | 313 |
| 269 | 3300005367 | Ga0070667_100126075 | Ga0070667_1001260752 | 313 |
| 270 | 3300005367 | Ga0070667_100278089 | Ga0070667_1002780891 | 313 |
| 271 | 3300005367 | Ga0070667_100352654 | Ga0070667_1003526541 | 313 |
| 272 | 3300005441 | Ga0070700_100194936 | Ga0070700_1001949361 | 313 |
| 273 | 3300005441 | Ga0070700_100236087 | Ga0070700_1002360871 | 313 |
| 274 | 3300005455 | Ga0070663_100117806 | Ga0070663_1001178062 | 313 |
| 275 | 3300005455 | Ga0070663_100194980 | Ga0070663_1001949801 | 313 |
| 276 | 3300005456 | Ga0070678_100010645 | Ga0070678_1000106453 | 313 |
| 277 | 3300005456 | Ga0070678_100014076 | Ga0070678_1000140763 | 313 |
| 278 | 3300005456 | Ga0070678_100020255 | Ga0070678_1000202552 | 313 |
| 279 | 3300005456 | Ga0070678_100095149 | Ga0070678_1000951492 | 313 |
| 280 | 3300005457 | Ga0070662_100002529 | Ga0070662_1000025294 | 313 |
| 281 | 3300005457 | Ga0070662_100005807 | Ga0070662_1000058076 | 313 |
| 282 | 3300005457 | Ga0070662_100044335 | Ga0070662_1000443352 | 313 |
| 283 | 3300005458 | Ga0070681_10035895 | Ga0070681_100358954 | 313 |
| 284 | 3300005459 | Ga0068867_100015222 | Ga0068867_1000152224 | 313 |
| 285 | 3300005459 | Ga0068867_100016665 | Ga0068867_1000166653 | 313 |
| 286 | 3300005459 | Ga0068867_100150717 | Ga0068867_1001507172 | 313 |
| 287 | 3300005466 | Ga0070685_10016650 | Ga0070685_100166503 | 313 |
| 288 | 3300005466 | Ga0070685_10018581 | Ga0070685_100185812 | 313 |
| 289 | 3300005466 | Ga0070685_10027573 | Ga0070685_100275732 | 313 |
| 290 | 3300005466 | Ga0070685_10032207 | Ga0070685_100322072 | 313 |
| 291 | 3300005466 | Ga0070685_10126557 | Ga0070685_101265571 | 313 |
| 292 | 3300005471 | Ga0070698_100017780 | Ga0070698_1000177806 | 313 |
| 293 | 3300005471 | Ga0070698_100027882 | Ga0070698_1000278826 | 313 |
| 294 | 3300005535 | Ga0070684_100000105 | Ga0070684_10000010514 | 313 |
| 295 | 3300005535 | Ga0070684_100004644 | Ga0070684_1000046444 | 313 |
| 296 | 3300005535 | Ga0070684_100010934 | Ga0070684_1000109344 | 313 |
| 297 | 3300005539 | Ga0068853_100003177 | Ga0068853_1000031774 | 313 |
| 298 | 3300005539 | Ga0068853_100003898 | Ga0068853_1000038985 | 313 |
| 299 | 3300005539 | Ga0068853_100025442 | Ga0068853_1000254423 | 313 |
| 300 | 3300005539 | Ga0068853_100079728 | Ga0068853_1000797282 | 313 |
| 301 | 3300005539 | Ga0068853_100117561 | Ga0068853_1001175612 | 313 |
| 302 | 3300005539 | Ga0068853_100184767 | Ga0068853_1001847673 | 313 |
| 303 | 3300005543 | Ga0070672_100000002 | Ga0070672_100000002135 | 313 |
| 304 | 3300005543 | Ga0070672_100022551 | Ga0070672_1000225512 | 313 |
| 305 | 3300005543 | Ga0070672_100059364 | Ga0070672_1000593642 | 313 |
| 306 | 3300005543 | Ga0070672_100287476 | Ga0070672_1002874761 | 313 |
| 307 | 3300005544 | Ga0070686_100011399 | Ga0070686_1000113993 | 313 |
| 308 | 3300005547 | Ga0070693_100117870 | Ga0070693_1001178702 | 313 |
| 309 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014417 | 313 |
| 310 | 3300005548 | Ga0070665_100002900 | Ga0070665_10000290012 | 313 |
| 311 | 3300005548 | Ga0070665_100005140 | Ga0070665_10000514010 | 313 |
| 312 | 3300005548 | Ga0070665_100233197 | Ga0070665_1002331972 | 313 |
| 313 | 3300005563 | Ga0068855_100011315 | Ga0068855_1000113152 | 313 |
| 314 | 3300005563 | Ga0068855_100026647 | Ga0068855_1000266472 | 313 |
| 315 | 3300005563 | Ga0068855_100036601 | Ga0068855_1000366012 | 313 |
| 316 | 3300005563 | Ga0068855_100084962 | Ga0068855_1000849623 | 313 |
| 317 | 3300005564 | Ga0070664_100000838 | Ga0070664_1000008384 | 313 |
| 318 | 3300005564 | Ga0070664_100019311 | Ga0070664_1000193113 | 313 |
| 319 | 3300005564 | Ga0070664_100053101 | Ga0070664_1000531012 | 313 |
| 320 | 3300005564 | Ga0070664_100245787 | Ga0070664_1002457872 | 313 |
| 321 | 3300005577 | Ga0068857_100005990 | Ga0068857_1000059903 | 313 |
| 322 | 3300005577 | Ga0068857_100010255 | Ga0068857_1000102554 | 313 |
| 323 | 3300005578 | Ga0068854_100035375 | Ga0068854_1000353753 | 313 |
| 324 | 3300005614 | Ga0068856_100080993 | Ga0068856_1000809932 | 313 |
| 325 | 3300005614 | Ga0068856_100087124 | Ga0068856_1000871243 | 313 |
| 326 | 3300005616 | Ga0068852_100000460 | Ga0068852_1000004608 | 313 |
| 327 | 3300005616 | Ga0068852_100001918 | Ga0068852_1000019181 | 313 |
| 328 | 3300005616 | Ga0068852_100018543 | Ga0068852_1000185432 | 313 |
| 329 | 3300005616 | Ga0068852_100023625 | Ga0068852_1000236254 | 313 |
| 330 | 3300005616 | Ga0068852_100141541 | Ga0068852_1001415412 | 313 |
| 331 | 3300005617 | Ga0068859_100000025 | Ga0068859_10000002540 | 313 |
| 332 | 3300005617 | Ga0068859_100000620 | Ga0068859_10000062016 | 313 |
| 333 | 3300005617 | Ga0068859_100007242 | Ga0068859_1000072425 | 313 |
| 334 | 3300005617 | Ga0068859_100022623 | Ga0068859_1000226234 | 313 |
| 335 | 3300005617 | Ga0068859_100044096 | Ga0068859_1000440963 | 313 |
| 336 | 3300005617 | Ga0068859_100061860 | Ga0068859_1000618602 | 313 |
| 337 | 3300005617 | Ga0068859_100085924 | Ga0068859_1000859243 | 313 |
| 338 | 3300005617 | Ga0068859_100174716 | Ga0068859_1001747162 | 313 |
| 339 | 3300005617 | Ga0068859_100517289 | Ga0068859_1005172892 | 313 |
| 340 | 3300005617 | Ga0068859_100522180 | Ga0068859_1005221802 | 313 |
| 341 | 3300005617 | Ga0068859_100702117 | Ga0068859_1007021171 | 313 |
| 342 | 3300005618 | Ga0068864_100008996 | Ga0068864_1000089963 | 313 |
| 343 | 3300005618 | Ga0068864_100034999 | Ga0068864_1000349994 | 313 |
| 344 | 3300005618 | Ga0068864_100135926 | Ga0068864_1001359262 | 313 |
| 345 | 3300005618 | Ga0068864_100170277 | Ga0068864_1001702772 | 313 |
| 346 | 3300005718 | Ga0068866_10005900 | Ga0068866_100059004 | 313 |
| 347 | 3300005719 | Ga0068861_100003363 | Ga0068861_1000033636 | 313 |
| 348 | 3300005719 | Ga0068861_100012731 | Ga0068861_1000127315 | 313 |
| 349 | 3300005719 | Ga0068861_100021936 | Ga0068861_1000219363 | 313 |
| 350 | 3300005719 | Ga0068861_100044425 | Ga0068861_1000444253 | 313 |
| 351 | 3300005719 | Ga0068861_100267172 | Ga0068861_1002671722 | 313 |
| 352 | 3300005719 | Ga0068861_100378531 | Ga0068861_1003785311 | 313 |
| 353 | 3300005834 | Ga0068851_10002711 | Ga0068851_100027116 | 313 |
| 354 | 3300005834 | Ga0068851_10006509 | Ga0068851_100065093 | 313 |
| 355 | 3300005840 | Ga0068870_10006813 | Ga0068870_100068132 | 313 |
| 356 | 3300005840 | Ga0068870_10008538 | Ga0068870_100085383 | 313 |
| 357 | 3300005840 | Ga0068870_10112569 | Ga0068870_101125691 | 313 |
| 358 | 3300005841 | Ga0068863_100000828 | Ga0068863_10000082812 | 313 |
| 359 | 3300005841 | Ga0068863_100003289 | Ga0068863_10000328913 | 313 |
| 360 | 3300005841 | Ga0068863_100022535 | Ga0068863_1000225353 | 313 |
| 361 | 3300005841 | Ga0068863_100040932 | Ga0068863_1000409323 | 313 |
| 362 | 3300005841 | Ga0068863_100045188 | Ga0068863_1000451883 | 313 |
| 363 | 3300005841 | Ga0068863_100046509 | Ga0068863_1000465092 | 313 |
| 364 | 3300005841 | Ga0068863_100105018 | Ga0068863_1001050182 | 313 |
| 365 | 3300005841 | Ga0068863_100114161 | Ga0068863_1001141612 | 313 |
| 366 | 3300005841 | Ga0068863_100344777 | Ga0068863_1003447772 | 313 |
| 367 | 3300005842 | Ga0068858_100000083 | Ga0068858_10000008376 | 313 |
| 368 | 3300005842 | Ga0068858_100131898 | Ga0068858_1001318982 | 313 |
| 369 | 3300005842 | Ga0068858_100175183 | Ga0068858_1001751834 | 313 |
| 370 | 3300005842 | Ga0068858_100453753 | Ga0068858_1004537532 | 313 |
| 371 | 3300005843 | Ga0068860_100000394 | Ga0068860_10000039430 | 313 |
| 372 | 3300005843 | Ga0068860_100002803 | Ga0068860_1000028037 | 313 |
| 373 | 3300005843 | Ga0068860_100004639 | Ga0068860_1000046393 | 313 |
| 374 | 3300005843 | Ga0068860_100004908 | Ga0068860_1000049083 | 313 |
| 375 | 3300005843 | Ga0068860_100014242 | Ga0068860_1000142423 | 313 |
| 376 | 3300005843 | Ga0068860_100014820 | Ga0068860_1000148205 | 313 |
| 377 | 3300005843 | Ga0068860_100031932 | Ga0068860_1000319322 | 313 |
| 378 | 3300005843 | Ga0068860_100169845 | Ga0068860_1001698452 | 313 |
| 379 | 3300005843 | Ga0068860_100180768 | Ga0068860_1001807682 | 313 |
| 380 | 3300005844 | Ga0068862_100086852 | Ga0068862_1000868523 | 313 |
| 381 | 3300005844 | Ga0068862_100208129 | Ga0068862_1002081292 | 313 |
| 382 | 3300005844 | Ga0068862_100246178 | Ga0068862_1002461782 | 313 |
| 383 | 3300005844 | Ga0068862_100452038 | Ga0068862_1004520381 | 313 |
| 384 | 3300005983 | Ga0081540_1004387 | Ga0081540_10043876 | 313 |
| 385 | 3300006195 | Ga0075366_10001639 | Ga0075366_100016393 | 313 |
| 386 | 3300006195 | Ga0075366_10050762 | Ga0075366_100507623 | 313 |
| 387 | 3300006237 | Ga0097621_100000359 | Ga0097621_10000035921 | 313 |
| 388 | 3300006237 | Ga0097621_100005579 | Ga0097621_1000055793 | 313 |
| 389 | 3300006237 | Ga0097621_100015918 | Ga0097621_1000159182 | 313 |
| 390 | 3300006237 | Ga0097621_100019163 | Ga0097621_1000191633 | 313 |
| 391 | 3300006237 | Ga0097621_100021087 | Ga0097621_1000210874 | 313 |
| 392 | 3300006237 | Ga0097621_100033861 | Ga0097621_1000338613 | 313 |
| 393 | 3300006237 | Ga0097621_100092867 | Ga0097621_1000928672 | 313 |
| 394 | 3300006237 | Ga0097621_100143433 | Ga0097621_1001434332 | 313 |
| 395 | 3300006237 | Ga0097621_100212062 | Ga0097621_1002120622 | 313 |
| 396 | 3300006358 | Ga0068871_100000201 | Ga0068871_10000020123 | 313 |
| 397 | 3300006358 | Ga0068871_100001167 | Ga0068871_1000011677 | 313 |
| 398 | 3300006358 | Ga0068871_100004905 | Ga0068871_1000049058 | 313 |
| 399 | 3300006358 | Ga0068871_100054631 | Ga0068871_1000546313 | 313 |
| 400 | 3300006358 | Ga0068871_100059310 | Ga0068871_1000593102 | 313 |
| 401 | 3300006358 | Ga0068871_100138726 | Ga0068871_1001387262 | 313 |
| 402 | 3300006358 | Ga0068871_100139452 | Ga0068871_1001394522 | 313 |
| 403 | 3300006358 | Ga0068871_100183573 | Ga0068871_1001835733 | 313 |
| 404 | 3300006844 | Ga0075428_100013338 | Ga0075428_1000133383 | 313 |
| 405 | 3300006844 | Ga0075428_100279654 | Ga0075428_1002796542 | 313 |
| 406 | 3300006871 | Ga0075434_100037661 | Ga0075434_1000376613 | 313 |
| 407 | 3300006880 | Ga0075429_100000723 | Ga0075429_1000007238 | 313 |
| 408 | 3300006880 | Ga0075429_100283270 | Ga0075429_1002832701 | 313 |
| 409 | 3300006881 | Ga0068865_100012266 | Ga0068865_1000122664 | 313 |
| 410 | 3300006881 | Ga0068865_100032670 | Ga0068865_1000326702 | 313 |
| 411 | 3300006931 | Ga0097620_100000025 | Ga0097620_10000002540 | 313 |
| 412 | 3300006931 | Ga0097620_100000620 | Ga0097620_10000062016 | 313 |
| 413 | 3300006931 | Ga0097620_100007242 | Ga0097620_1000072425 | 313 |
| 414 | 3300006931 | Ga0097620_100022623 | Ga0097620_1000226234 | 313 |
| 415 | 3300006931 | Ga0097620_100044097 | Ga0097620_1000440973 | 313 |
| 416 | 3300006931 | Ga0097620_100061856 | Ga0097620_1000618562 | 313 |
| 417 | 3300006931 | Ga0097620_100085931 | Ga0097620_1000859312 | 313 |
| 418 | 3300006931 | Ga0097620_100174708 | Ga0097620_1001747082 | 313 |
| 419 | 3300006931 | Ga0097620_100355959 | Ga0097620_1003559591 | 313 |
| 420 | 3300006931 | Ga0097620_100517284 | Ga0097620_1005172842 | 313 |
| 421 | 3300006931 | Ga0097620_100522142 | Ga0097620_1005221421 | 313 |
| 422 | 3300006931 | Ga0097620_100702122 | Ga0097620_1007021221 | 313 |
| 423 | 3300009093 | Ga0105240_10001601 | Ga0105240_100016013 | 313 |
| 424 | 3300009093 | Ga0105240_10001632 | Ga0105240_100016322 | 313 |
| 425 | 3300009093 | Ga0105240_10012477 | Ga0105240_1001247711 | 313 |
| 426 | 3300009093 | Ga0105240_10020065 | Ga0105240_100200653 | 313 |
| 427 | 3300009093 | Ga0105240_10046229 | Ga0105240_100462292 | 313 |
| 428 | 3300009093 | Ga0105240_10049773 | Ga0105240_100497732 | 313 |
| 429 | 3300009093 | Ga0105240_10053431 | Ga0105240_100534312 | 313 |
| 430 | 3300009093 | Ga0105240_10118854 | Ga0105240_101188543 | 313 |
| 431 | 3300009094 | Ga0111539_10013194 | Ga0111539_100131944 | 313 |
| 432 | 3300009094 | Ga0111539_10155954 | Ga0111539_101559542 | 313 |
| 433 | 3300009094 | Ga0111539_10250768 | Ga0111539_102507681 | 313 |
| 434 | 3300009098 | Ga0105245_10010477 | Ga0105245_100104774 | 313 |
| 435 | 3300009101 | Ga0105247_10000619 | Ga0105247_100006194 | 313 |
| 436 | 3300009101 | Ga0105247_10015174 | Ga0105247_100151743 | 313 |
| 437 | 3300009101 | Ga0105247_10053989 | Ga0105247_100539892 | 313 |
| 438 | 3300009147 | Ga0114129_10041957 | Ga0114129_100419575 | 313 |
| 439 | 3300009148 | Ga0105243_10133536 | Ga0105243_101335362 | 313 |
| 440 | 3300009174 | Ga0105241_10000252 | Ga0105241_1000025212 | 313 |
| 441 | 3300009174 | Ga0105241_10001151 | Ga0105241_100011518 | 313 |
| 442 | 3300009174 | Ga0105241_10002136 | Ga0105241_1000213612 | 313 |
| 443 | 3300009174 | Ga0105241_10019869 | Ga0105241_100198693 | 313 |
| 444 | 3300009174 | Ga0105241_10226981 | Ga0105241_102269812 | 313 |
| 445 | 3300009174 | Ga0105241_10267408 | Ga0105241_102674082 | 313 |
| 446 | 3300009176 | Ga0105242_10041827 | Ga0105242_100418272 | 313 |
| 447 | 3300009176 | Ga0105242_10053818 | Ga0105242_100538183 | 313 |
| 448 | 3300009176 | Ga0105242_10106325 | Ga0105242_101063252 | 313 |
| 449 | 3300009176 | Ga0105242_10169223 | Ga0105242_101692232 | 313 |
| 450 | 3300009176 | Ga0105242_10229661 | Ga0105242_102296612 | 313 |
| 451 | 3300009177 | Ga0105248_10067765 | Ga0105248_100677652 | 313 |
| 452 | 3300009545 | Ga0105237_10000191 | Ga0105237_1000019116 | 313 |
| 453 | 3300009545 | Ga0105237_10000938 | Ga0105237_1000093831 | 313 |
| 454 | 3300009545 | Ga0105237_10002013 | Ga0105237_1000201315 | 313 |
| 455 | 3300009545 | Ga0105237_10006188 | Ga0105237_100061882 | 313 |
| 456 | 3300009545 | Ga0105237_10019671 | Ga0105237_100196711 | 313 |
| 457 | 3300009545 | Ga0105237_10095240 | Ga0105237_100952403 | 313 |
| 458 | 3300009551 | Ga0105238_10004065 | Ga0105238_100040659 | 313 |
| 459 | 3300009551 | Ga0105238_10023581 | Ga0105238_100235815 | 313 |
| 460 | 3300009551 | Ga0105238_10063610 | Ga0105238_100636102 | 313 |
| 461 | 3300009553 | Ga0105249_10001096 | Ga0105249_100010964 | 313 |
| 462 | 3300009553 | Ga0105249_10001117 | Ga0105249_100011179 | 313 |
| 463 | 3300009553 | Ga0105249_10001306 | Ga0105249_100013064 | 313 |
| 464 | 3300009553 | Ga0105249_10001445 | Ga0105249_100014454 | 313 |
| 465 | 3300009553 | Ga0105249_10003110 | Ga0105249_100031104 | 313 |
| 466 | 3300009553 | Ga0105249_10028284 | Ga0105249_100282844 | 313 |
| 467 | 3300009553 | Ga0105249_10060768 | Ga0105249_100607682 | 313 |
| 468 | 3300009553 | Ga0105249_10224511 | Ga0105249_102245112 | 313 |
| 469 | 3300010375 | Ga0105239_10000019 | Ga0105239_10000019249 | 313 |
| 470 | 3300010375 | Ga0105239_10006447 | Ga0105239_100064476 | 313 |
| 471 | 3300010375 | Ga0105239_10009941 | Ga0105239_100099417 | 313 |
| 472 | 3300010375 | Ga0105239_10012772 | Ga0105239_100127726 | 313 |
| 473 | 3300010375 | Ga0105239_10013262 | Ga0105239_100132628 | 313 |
| 474 | 3300010375 | Ga0105239_10116749 | Ga0105239_101167492 | 313 |
| 475 | 3300011119 | Ga0105246_10027988 | Ga0105246_100279883 | 313 |
| 476 | 3300011119 | Ga0105246_10175641 | Ga0105246_101756412 | 313 |
| 477 | 3300011119 | Ga0105246_10229745 | Ga0105246_102297451 | 313 |
| 478 | 3300013100 | Ga0157373_10031265 | Ga0157373_100312654 | 313 |
| 479 | 3300013100 | Ga0157373_10040205 | Ga0157373_100402052 | 313 |
| 480 | 3300013100 | Ga0157373_10058618 | Ga0157373_100586183 | 313 |
| 481 | 3300013104 | Ga0157370_10013171 | Ga0157370_100131713 | 313 |
| 482 | 3300013296 | Ga0157374_10000011 | Ga0157374_10000011121 | 313 |
| 483 | 3300013296 | Ga0157374_10004455 | Ga0157374_100044559 | 313 |
| 484 | 3300013296 | Ga0157374_10009692 | Ga0157374_100096923 | 313 |
| 485 | 3300013296 | Ga0157374_10050543 | Ga0157374_100505433 | 313 |
| 486 | 3300013297 | Ga0157378_10001083 | Ga0157378_1000108319 | 313 |
| 487 | 3300013297 | Ga0157378_10003875 | Ga0157378_100038756 | 313 |
| 488 | 3300013297 | Ga0157378_10061615 | Ga0157378_100616152 | 313 |
| 489 | 3300013297 | Ga0157378_10066657 | Ga0157378_100666573 | 313 |
| 490 | 3300013297 | Ga0157378_10068698 | Ga0157378_100686982 | 313 |
| 491 | 3300013306 | Ga0163162_10000029 | Ga0163162_10000029145 | 313 |
| 492 | 3300013306 | Ga0163162_10000424 | Ga0163162_1000042428 | 313 |
| 493 | 3300013306 | Ga0163162_10000672 | Ga0163162_100006727 | 313 |
| 494 | 3300013306 | Ga0163162_10001000 | Ga0163162_1000100022 | 313 |
| 495 | 3300013306 | Ga0163162_10007147 | Ga0163162_100071475 | 313 |
| 496 | 3300013306 | Ga0163162_10026603 | Ga0163162_100266033 | 313 |
| 497 | 3300013306 | Ga0163162_10029016 | Ga0163162_100290164 | 313 |
| 498 | 3300013306 | Ga0163162_10126262 | Ga0163162_101262624 | 313 |
| 499 | 3300013306 | Ga0163162_10133118 | Ga0163162_101331183 | 313 |
| 500 | 3300013306 | Ga0163162_10168474 | Ga0163162_101684742 | 313 |
| 501 | 3300013306 | Ga0163162_10426492 | Ga0163162_104264921 | 313 |
| 502 | 3300013306 | Ga0163162_10465489 | Ga0163162_104654892 | 313 |
| 503 | 3300013307 | Ga0157372_10012413 | Ga0157372_100124138 | 313 |
| 504 | 3300013307 | Ga0157372_10054702 | Ga0157372_100547023 | 313 |
| 505 | 3300013307 | Ga0157372_10303899 | Ga0157372_103038992 | 313 |
| 506 | 3300013307 | Ga0157372_10304701 | Ga0157372_103047012 | 313 |
| 507 | 3300013307 | Ga0157372_10652283 | Ga0157372_106522832 | 313 |
| 508 | 3300013307 | Ga0157372_10691182 | Ga0157372_106911821 | 313 |
| 509 | 3300013308 | Ga0157375_10000042 | Ga0157375_1000004216 | 313 |
| 510 | 3300013308 | Ga0157375_10002200 | Ga0157375_100022006 | 313 |
| 511 | 3300013308 | Ga0157375_10011363 | Ga0157375_100113632 | 313 |
| 512 | 3300013308 | Ga0157375_10012413 | Ga0157375_100124132 | 313 |
| 513 | 3300013308 | Ga0157375_10038591 | Ga0157375_100385913 | 313 |
| 514 | 3300013308 | Ga0157375_10043524 | Ga0157375_100435243 | 313 |
| 515 | 3300013308 | Ga0157375_10100779 | Ga0157375_101007792 | 313 |
| 516 | 3300013308 | Ga0157375_10117350 | Ga0157375_101173502 | 313 |
| 517 | 3300013308 | Ga0157375_10147379 | Ga0157375_101473791 | 313 |
| 518 | 3300013308 | Ga0157375_10157851 | Ga0157375_101578512 | 313 |
| 519 | 3300014325 | Ga0163163_10000076 | Ga0163163_1000007685 | 313 |
| 520 | 3300014325 | Ga0163163_10000831 | Ga0163163_1000083113 | 313 |
| 521 | 3300014325 | Ga0163163_10001057 | Ga0163163_1000105718 | 313 |
| 522 | 3300014325 | Ga0163163_10015513 | Ga0163163_100155133 | 313 |
| 523 | 3300014325 | Ga0163163_10076823 | Ga0163163_100768232 | 313 |
| 524 | 3300014325 | Ga0163163_10099343 | Ga0163163_100993432 | 313 |
| 525 | 3300014325 | Ga0163163_10197237 | Ga0163163_101972372 | 313 |
| 526 | 3300014325 | Ga0163163_10220755 | Ga0163163_102207551 | 313 |
| 527 | 3300014325 | Ga0163163_10284532 | Ga0163163_102845321 | 313 |
| 528 | 3300014325 | Ga0163163_10432213 | Ga0163163_104322131 | 313 |
| 529 | 3300014325 | Ga0163163_10609346 | Ga0163163_106093461 | 313 |
| 530 | 3300014326 | Ga0157380_10001454 | Ga0157380_100014549 | 313 |
| 531 | 3300014326 | Ga0157380_10003690 | Ga0157380_100036906 | 313 |
| 532 | 3300014326 | Ga0157380_10007843 | Ga0157380_100078434 | 313 |
| 533 | 3300014326 | Ga0157380_10040123 | Ga0157380_100401233 | 313 |
| 534 | 3300014326 | Ga0157380_10126199 | Ga0157380_101261992 | 313 |
| 535 | 3300014745 | Ga0157377_10022605 | Ga0157377_100226052 | 313 |
| 536 | 3300014745 | Ga0157377_10023737 | Ga0157377_100237372 | 313 |
| 537 | 3300014745 | Ga0157377_10031442 | Ga0157377_100314422 | 313 |
| 538 | 3300014745 | Ga0157377_10163313 | Ga0157377_101633131 | 313 |
| 539 | 3300014968 | Ga0157379_10000016 | Ga0157379_1000001679 | 313 |
| 540 | 3300014968 | Ga0157379_10016392 | Ga0157379_100163927 | 313 |
| 541 | 3300014968 | Ga0157379_10037080 | Ga0157379_100370804 | 313 |
| 542 | 3300014968 | Ga0157379_10077651 | Ga0157379_100776513 | 313 |
| 543 | 3300014968 | Ga0157379_10087394 | Ga0157379_100873942 | 313 |
| 544 | 3300014968 | Ga0157379_10421162 | Ga0157379_104211622 | 313 |
| 545 | 3300014969 | Ga0157376_10000558 | Ga0157376_1000055816 | 313 |
| 546 | 3300014969 | Ga0157376_10000938 | Ga0157376_100009382 | 313 |
| 547 | 3300014969 | Ga0157376_10002924 | Ga0157376_100029247 | 313 |
| 548 | 3300014969 | Ga0157376_10010684 | Ga0157376_100106844 | 313 |
| 549 | 3300014969 | Ga0157376_10011063 | Ga0157376_100110632 | 313 |
| 550 | 3300014969 | Ga0157376_10035769 | Ga0157376_100357692 | 313 |
| 551 | 3300014969 | Ga0157376_10256115 | Ga0157376_102561152 | 313 |
| 552 | 3300017792 | Ga0163161_10003336 | Ga0163161_100033367 | 313 |
| 553 | 3300017792 | Ga0163161_10024726 | Ga0163161_100247263 | 313 |
| 554 | 3300017792 | Ga0163161_10040821 | Ga0163161_100408212 | 313 |
| 555 | 3300025321 | Ga0207656_10000821 | Ga0207656_100008214 | 313 |
| 556 | 3300025321 | Ga0207656_10022275 | Ga0207656_100222752 | 313 |
| 557 | 3300025321 | Ga0207656_10027719 | Ga0207656_100277192 | 313 |
| 558 | 3300025893 | Ga0207682_10030613 | Ga0207682_100306132 | 313 |
| 559 | 3300025899 | Ga0207642_10081862 | Ga0207642_100818622 | 313 |
| 560 | 3300025900 | Ga0207710_10004843 | Ga0207710_100048434 | 313 |
| 561 | 3300025903 | Ga0207680_10000086 | Ga0207680_1000008641 | 313 |
| 562 | 3300025903 | Ga0207680_10014877 | Ga0207680_100148772 | 313 |
| 563 | 3300025903 | Ga0207680_10053067 | Ga0207680_100530672 | 313 |
| 564 | 3300025903 | Ga0207680_10093486 | Ga0207680_100934861 | 313 |
| 565 | 3300025904 | Ga0207647_10000096 | Ga0207647_1000009635 | 313 |
| 566 | 3300025907 | Ga0207645_10002123 | Ga0207645_1000212311 | 313 |
| 567 | 3300025907 | Ga0207645_10012288 | Ga0207645_100122882 | 313 |
| 568 | 3300025907 | Ga0207645_10014367 | Ga0207645_100143673 | 313 |
| 569 | 3300025907 | Ga0207645_10033610 | Ga0207645_100336102 | 313 |
| 570 | 3300025907 | Ga0207645_10045869 | Ga0207645_100458692 | 313 |
| 571 | 3300025907 | Ga0207645_10064822 | Ga0207645_100648222 | 313 |
| 572 | 3300025908 | Ga0207643_10009004 | Ga0207643_100090042 | 313 |
| 573 | 3300025908 | Ga0207643_10013248 | Ga0207643_100132483 | 313 |
| 574 | 3300025909 | Ga0207705_10002045 | Ga0207705_1000204512 | 313 |
| 575 | 3300025911 | Ga0207654_10006725 | Ga0207654_100067252 | 313 |
| 576 | 3300025911 | Ga0207654_10018640 | Ga0207654_100186402 | 313 |
| 577 | 3300025911 | Ga0207654_10038316 | Ga0207654_100383161 | 313 |
| 578 | 3300025911 | Ga0207654_10123445 | Ga0207654_101234451 | 313 |
| 579 | 3300025912 | Ga0207707_10135962 | Ga0207707_101359622 | 313 |
| 580 | 3300025913 | Ga0207695_10001109 | Ga0207695_100011098 | 313 |
| 581 | 3300025913 | Ga0207695_10001387 | Ga0207695_100013876 | 313 |
| 582 | 3300025913 | Ga0207695_10001527 | Ga0207695_100015273 | 313 |
| 583 | 3300025913 | Ga0207695_10075830 | Ga0207695_100758303 | 313 |
| 584 | 3300025913 | Ga0207695_10113737 | Ga0207695_101137372 | 313 |
| 585 | 3300025913 | Ga0207695_10140779 | Ga0207695_101407792 | 313 |
| 586 | 3300025913 | Ga0207695_10144647 | Ga0207695_101446472 | 313 |
| 587 | 3300025913 | Ga0207695_10165680 | Ga0207695_101656802 | 313 |
| 588 | 3300025914 | Ga0207671_10001331 | Ga0207671_1000133113 | 313 |
| 589 | 3300025914 | Ga0207671_10001357 | Ga0207671_100013579 | 313 |
| 590 | 3300025914 | Ga0207671_10003705 | Ga0207671_100037059 | 313 |
| 591 | 3300025914 | Ga0207671_10011884 | Ga0207671_100118842 | 313 |
| 592 | 3300025917 | Ga0207660_10002449 | Ga0207660_100024492 | 313 |
| 593 | 3300025918 | Ga0207662_10005744 | Ga0207662_100057444 | 313 |
| 594 | 3300025919 | Ga0207657_10113061 | Ga0207657_101130612 | 313 |
| 595 | 3300025919 | Ga0207657_10244120 | Ga0207657_102441201 | 313 |
| 596 | 3300025920 | Ga0207649_10000517 | Ga0207649_100005177 | 313 |
| 597 | 3300025920 | Ga0207649_10075233 | Ga0207649_100752332 | 313 |
| 598 | 3300025920 | Ga0207649_10128467 | Ga0207649_101284672 | 313 |
| 599 | 3300025921 | Ga0207652_10008720 | Ga0207652_100087201 | 313 |
| 600 | 3300025924 | Ga0207694_10254215 | Ga0207694_102542151 | 313 |
| 601 | 3300025924 | Ga0207694_10268334 | Ga0207694_102683341 | 313 |
| 602 | 3300025925 | Ga0207650_10001946 | Ga0207650_1000194614 | 313 |
| 603 | 3300025925 | Ga0207650_10049132 | Ga0207650_100491322 | 313 |
| 604 | 3300025925 | Ga0207650_10054046 | Ga0207650_100540462 | 313 |
| 605 | 3300025925 | Ga0207650_10089489 | Ga0207650_100894891 | 313 |
| 606 | 3300025925 | Ga0207650_10115912 | Ga0207650_101159122 | 313 |
| 607 | 3300025925 | Ga0207650_10175068 | Ga0207650_101750682 | 313 |
| 608 | 3300025926 | Ga0207659_10020402 | Ga0207659_100204023 | 313 |
| 609 | 3300025926 | Ga0207659_10022314 | Ga0207659_100223142 | 313 |
| 610 | 3300025926 | Ga0207659_10056682 | Ga0207659_100566822 | 313 |
| 611 | 3300025926 | Ga0207659_10069850 | Ga0207659_100698502 | 313 |
| 612 | 3300025926 | Ga0207659_10101043 | Ga0207659_101010431 | 313 |
| 613 | 3300025926 | Ga0207659_10346531 | Ga0207659_103465311 | 313 |
| 614 | 3300025927 | Ga0207687_10077510 | Ga0207687_100775103 | 313 |
| 615 | 3300025931 | Ga0207644_10014077 | Ga0207644_100140773 | 313 |
| 616 | 3300025931 | Ga0207644_10066397 | Ga0207644_100663972 | 313 |
| 617 | 3300025931 | Ga0207644_10234941 | Ga0207644_102349412 | 313 |
| 618 | 3300025931 | Ga0207644_10382775 | Ga0207644_103827751 | 313 |
| 619 | 3300025932 | Ga0207690_10010864 | Ga0207690_100108642 | 313 |
| 620 | 3300025932 | Ga0207690_10029625 | Ga0207690_100296253 | 313 |
| 621 | 3300025933 | Ga0207706_10008919 | Ga0207706_100089192 | 313 |
| 622 | 3300025933 | Ga0207706_10086069 | Ga0207706_100860692 | 313 |
| 623 | 3300025934 | Ga0207686_10011437 | Ga0207686_100114372 | 313 |
| 624 | 3300025934 | Ga0207686_10058469 | Ga0207686_100584692 | 313 |
| 625 | 3300025934 | Ga0207686_10130358 | Ga0207686_101303582 | 313 |
| 626 | 3300025934 | Ga0207686_10198984 | Ga0207686_101989841 | 313 |
| 627 | 3300025936 | Ga0207670_10146506 | Ga0207670_101465061 | 313 |
| 628 | 3300025936 | Ga0207670_10177418 | Ga0207670_101774181 | 313 |
| 629 | 3300025936 | Ga0207670_10315732 | Ga0207670_103157321 | 313 |
| 630 | 3300025937 | Ga0207669_10008011 | Ga0207669_100080113 | 313 |
| 631 | 3300025938 | Ga0207704_10053403 | Ga0207704_100534032 | 313 |
| 632 | 3300025938 | Ga0207704_10106756 | Ga0207704_101067562 | 313 |
| 633 | 3300025938 | Ga0207704_10111584 | Ga0207704_101115842 | 313 |
| 634 | 3300025938 | Ga0207704_10116052 | Ga0207704_101160521 | 313 |
| 635 | 3300025940 | Ga0207691_10000004 | Ga0207691_10000004145 | 313 |
| 636 | 3300025940 | Ga0207691_10026490 | Ga0207691_100264902 | 313 |
| 637 | 3300025940 | Ga0207691_10045858 | Ga0207691_100458584 | 313 |
| 638 | 3300025940 | Ga0207691_10129252 | Ga0207691_101292522 | 313 |
| 639 | 3300025940 | Ga0207691_10140802 | Ga0207691_101408022 | 313 |
| 640 | 3300025942 | Ga0207689_10000208 | Ga0207689_100002083 | 313 |
| 641 | 3300025942 | Ga0207689_10002065 | Ga0207689_100020655 | 313 |
| 642 | 3300025942 | Ga0207689_10002750 | Ga0207689_100027506 | 313 |
| 643 | 3300025942 | Ga0207689_10008548 | Ga0207689_100085482 | 313 |
| 644 | 3300025942 | Ga0207689_10029255 | Ga0207689_100292552 | 313 |
| 645 | 3300025942 | Ga0207689_10032175 | Ga0207689_100321751 | 313 |
| 646 | 3300025942 | Ga0207689_10053043 | Ga0207689_100530434 | 313 |
| 647 | 3300025942 | Ga0207689_10062503 | Ga0207689_100625032 | 313 |
| 648 | 3300025942 | Ga0207689_10275819 | Ga0207689_102758191 | 313 |
| 649 | 3300025945 | Ga0207679_10000091 | Ga0207679_1000009136 | 313 |
| 650 | 3300025945 | Ga0207679_10038824 | Ga0207679_100388241 | 313 |
| 651 | 3300025949 | Ga0207667_10003621 | Ga0207667_100036211 | 313 |
| 652 | 3300025949 | Ga0207667_10008497 | Ga0207667_100084978 | 313 |
| 653 | 3300025949 | Ga0207667_10024439 | Ga0207667_100244393 | 313 |
| 654 | 3300025960 | Ga0207651_10004794 | Ga0207651_100047943 | 313 |
| 655 | 3300025960 | Ga0207651_10009976 | Ga0207651_100099763 | 313 |
| 656 | 3300025960 | Ga0207651_10024166 | Ga0207651_100241664 | 313 |
| 657 | 3300025960 | Ga0207651_10053609 | Ga0207651_100536093 | 313 |
| 658 | 3300025960 | Ga0207651_10063786 | Ga0207651_100637863 | 313 |
| 659 | 3300025960 | Ga0207651_10072179 | Ga0207651_100721792 | 313 |
| 660 | 3300025960 | Ga0207651_10092415 | Ga0207651_100924151 | 313 |
| 661 | 3300025960 | Ga0207651_10106291 | Ga0207651_101062912 | 313 |
| 662 | 3300025961 | Ga0207712_10000725 | Ga0207712_100007257 | 313 |
| 663 | 3300025961 | Ga0207712_10000915 | Ga0207712_100009157 | 313 |
| 664 | 3300025961 | Ga0207712_10001923 | Ga0207712_100019235 | 313 |
| 665 | 3300025961 | Ga0207712_10005612 | Ga0207712_100056121 | 313 |
| 666 | 3300025961 | Ga0207712_10016389 | Ga0207712_100163893 | 313 |
| 667 | 3300025961 | Ga0207712_10040250 | Ga0207712_100402502 | 313 |
| 668 | 3300025961 | Ga0207712_10102517 | Ga0207712_101025172 | 313 |
| 669 | 3300025972 | Ga0207668_10001031 | Ga0207668_1000103115 | 313 |
| 670 | 3300025981 | Ga0207640_10026559 | Ga0207640_100265592 | 313 |
| 671 | 3300025981 | Ga0207640_10097792 | Ga0207640_100977922 | 313 |
| 672 | 3300025986 | Ga0207658_10001793 | Ga0207658_1000179314 | 313 |
| 673 | 3300025986 | Ga0207658_10023217 | Ga0207658_100232173 | 313 |
| 674 | 3300025986 | Ga0207658_10049019 | Ga0207658_100490191 | 313 |
| 675 | 3300026023 | Ga0207677_10071596 | Ga0207677_100715961 | 313 |
| 676 | 3300026023 | Ga0207677_10104052 | Ga0207677_101040521 | 313 |
| 677 | 3300026023 | Ga0207677_10209907 | Ga0207677_102099072 | 313 |
| 678 | 3300026023 | Ga0207677_10224246 | Ga0207677_102242461 | 313 |
| 679 | 3300026035 | Ga0207703_10002453 | Ga0207703_100024532 | 313 |
| 680 | 3300026035 | Ga0207703_10003536 | Ga0207703_100035361 | 313 |
| 681 | 3300026035 | Ga0207703_10496832 | Ga0207703_104968322 | 313 |
| 682 | 3300026035 | Ga0207703_10524140 | Ga0207703_105241401 | 313 |
| 683 | 3300026041 | Ga0207639_10004779 | Ga0207639_100047797 | 313 |
| 684 | 3300026041 | Ga0207639_10017252 | Ga0207639_100172523 | 313 |
| 685 | 3300026041 | Ga0207639_10017338 | Ga0207639_100173382 | 313 |
| 686 | 3300026041 | Ga0207639_10018922 | Ga0207639_100189223 | 313 |
| 687 | 3300026067 | Ga0207678_10143913 | Ga0207678_101439132 | 313 |
| 688 | 3300026075 | Ga0207708_10211128 | Ga0207708_102111282 | 313 |
| 689 | 3300026078 | Ga0207702_10093485 | Ga0207702_100934852 | 313 |
| 690 | 3300026088 | Ga0207641_10000132 | Ga0207641_1000013243 | 313 |
| 691 | 3300026088 | Ga0207641_10002004 | Ga0207641_1000200415 | 313 |
| 692 | 3300026088 | Ga0207641_10005148 | Ga0207641_100051482 | 313 |
| 693 | 3300026088 | Ga0207641_10030371 | Ga0207641_100303714 | 313 |
| 694 | 3300026088 | Ga0207641_10039756 | Ga0207641_100397563 | 313 |
| 695 | 3300026088 | Ga0207641_10114190 | Ga0207641_101141902 | 313 |
| 696 | 3300026088 | Ga0207641_10125353 | Ga0207641_101253532 | 313 |
| 697 | 3300026089 | Ga0207648_10001340 | Ga0207648_100013405 | 313 |
| 698 | 3300026089 | Ga0207648_10001507 | Ga0207648_1000150722 | 313 |
| 699 | 3300026089 | Ga0207648_10003198 | Ga0207648_1000319811 | 313 |
| 700 | 3300026089 | Ga0207648_10023065 | Ga0207648_100230653 | 313 |
| 701 | 3300026089 | Ga0207648_10028580 | Ga0207648_100285803 | 313 |
| 702 | 3300026089 | Ga0207648_10059000 | Ga0207648_100590002 | 313 |
| 703 | 3300026089 | Ga0207648_10175954 | Ga0207648_101759542 | 313 |
| 704 | 3300026089 | Ga0207648_10227889 | Ga0207648_102278892 | 313 |
| 705 | 3300026095 | Ga0207676_10006520 | Ga0207676_100065203 | 313 |
| 706 | 3300026095 | Ga0207676_10021806 | Ga0207676_100218063 | 313 |
| 707 | 3300026095 | Ga0207676_10050031 | Ga0207676_100500312 | 313 |
| 708 | 3300026095 | Ga0207676_10270325 | Ga0207676_102703251 | 313 |
| 709 | 3300026095 | Ga0207676_10271133 | Ga0207676_102711331 | 313 |
| 710 | 3300026116 | Ga0207674_10006827 | Ga0207674_100068273 | 313 |
| 711 | 3300026116 | Ga0207674_10006954 | Ga0207674_1000695410 | 313 |
| 712 | 3300026116 | Ga0207674_10011869 | Ga0207674_100118696 | 313 |
| 713 | 3300026116 | Ga0207674_10020844 | Ga0207674_100208444 | 313 |
| 714 | 3300026116 | Ga0207674_10037247 | Ga0207674_100372471 | 313 |
| 715 | 3300026116 | Ga0207674_10084698 | Ga0207674_100846982 | 313 |
| 716 | 3300026116 | Ga0207674_10096318 | Ga0207674_100963182 | 313 |
| 717 | 3300026118 | Ga0207675_100003521 | Ga0207675_1000035213 | 313 |
| 718 | 3300026118 | Ga0207675_100012750 | Ga0207675_1000127503 | 313 |
| 719 | 3300026118 | Ga0207675_100013899 | Ga0207675_1000138995 | 313 |
| 720 | 3300026118 | Ga0207675_100020709 | Ga0207675_1000207096 | 313 |
| 721 | 3300026118 | Ga0207675_100022252 | Ga0207675_1000222523 | 313 |
| 722 | 3300026118 | Ga0207675_100048083 | Ga0207675_1000480834 | 313 |
| 723 | 3300026118 | Ga0207675_100055083 | Ga0207675_1000550832 | 313 |
| 724 | 3300026118 | Ga0207675_100330590 | Ga0207675_1003305902 | 313 |
| 725 | 3300026121 | Ga0207683_10002163 | Ga0207683_1000216313 | 313 |
| 726 | 3300026121 | Ga0207683_10045450 | Ga0207683_100454502 | 313 |
| 727 | 3300026121 | Ga0207683_10049536 | Ga0207683_100495363 | 313 |
| 728 | 3300026121 | Ga0207683_10067112 | Ga0207683_100671123 | 313 |
| 729 | 3300026121 | Ga0207683_10204356 | Ga0207683_102043562 | 313 |
| 730 | 3300026121 | Ga0207683_10207800 | Ga0207683_102078001 | 313 |
| 731 | 3300026142 | Ga0207698_10000539 | Ga0207698_1000053911 | 313 |
| 732 | 3300026142 | Ga0207698_10004422 | Ga0207698_100044225 | 313 |
| 733 | 3300026142 | Ga0207698_10013262 | Ga0207698_100132624 | 313 |
| 734 | 3300026142 | Ga0207698_10088594 | Ga0207698_100885943 | 313 |
| 735 | 3300026142 | Ga0207698_10200495 | Ga0207698_102004952 | 313 |
| 736 | 3300026142 | Ga0207698_10413125 | Ga0207698_104131251 | 313 |
| 737 | 3300028379 | Ga0268266_10000068 | Ga0268266_1000006818 | 313 |
| 738 | 3300028379 | Ga0268266_10006637 | Ga0268266_100066372 | 313 |
| 739 | 3300028379 | Ga0268266_10103748 | Ga0268266_101037482 | 313 |
| 740 | 3300028380 | Ga0268265_10009330 | Ga0268265_100093301 | 313 |
| 741 | 3300028380 | Ga0268265_10066428 | Ga0268265_100664283 | 313 |
| 742 | 3300028380 | Ga0268265_10300965 | Ga0268265_103009652 | 313 |
| 743 | 3300028381 | Ga0268264_10000559 | Ga0268264_1000055927 | 313 |
| 744 | 3300028381 | Ga0268264_10001420 | Ga0268264_100014206 | 313 |
| 745 | 3300028381 | Ga0268264_10006807 | Ga0268264_100068073 | 313 |
| 746 | 3300028381 | Ga0268264_10012189 | Ga0268264_100121892 | 313 |
| 747 | 3300028381 | Ga0268264_10017234 | Ga0268264_100172344 | 313 |
| 748 | 3300028381 | Ga0268264_10024105 | Ga0268264_100241052 | 313 |
| 749 | 3300028381 | Ga0268264_10046883 | Ga0268264_100468832 | 313 |
| 750 | 3300028381 | Ga0268264_10337992 | Ga0268264_103379921 | 313 |
| 751 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012032 | 313 |
| 752 | 3300028794 | Ga0307515_10000437 | Ga0307515_100004376 | 313 |
| 753 | 3300030521 | Ga0307511_10000211 | Ga0307511_1000021142 | 313 |
| 754 | 3300031456 | Ga0307513_10043985 | Ga0307513_100439852 | 313 |
| 755 | 3300031507 | Ga0307509_10221350 | Ga0307509_102213502 | 313 |
| 756 | 3300031507 | Ga0307509_10256855 | Ga0307509_102568551 | 313 |
| 757 | 3300031595 | Ga0265313_10047862 | Ga0265313_100478622 | 313 |
| 758 | 3300031616 | Ga0307508_10014167 | Ga0307508_100141671 | 313 |
| 759 | 3300031852 | Ga0307410_10083320 | Ga0307410_100833202 | 313 |
| 760 | 3300032005 | Ga0307411_10086575 | Ga0307411_100865752 | 313 |
| 761 | 3300035172 | Ga0373955_0072914 | Ga0373955_0072914_706_1740 | 313 |
| 762 | 3300035724 | Ga0373933_0097376 | Ga0373933_0097376_150_1184 | 313 |
| 763 | 3300036401 | Ga0373937_0269587 | Ga0373937_0269587_258_1292 | 313 |
| 764 | 3300037068 | Ga0373925_0275674 | Ga0373925_0275674_35_1072 | 313 |
| 765 | 3300037471 | Ga0395905_0006214 | Ga0395905_0006214_6971_8020 | 313 |
| 766 | 3300041404 | Ga0439436_0000350 | Ga0439436_0000350_5006_6043 | 313 |
| 767 | 3300041413 | Ga0439465_0031831 | Ga0439465_0031831_487_1533 | 313 |
| 768 | 3300042004 | Ga0439445_0044106 | Ga0439445_0044106_96_1130 | 313 |
| 769 | 3300042007 | Ga0439449_0017050 | Ga0439449_0017050_527_1564 | 313 |
| 770 | 3300042007 | Ga0439449_0041243 | Ga0439449_0041243_639_1706 | 313 |
| 771 | 3300042014 | Ga0439457_000130 | Ga0439457_000130_10230_11267 | 313 |
| 772 | 3300042015 | Ga0439462_0003152 | Ga0439462_0003152_1809_2846 | 313 |
| 773 | 3300044656 | Ga0466969_0000356 | Ga0466969_0000356_10290_11327 | 313 |
| 774 | 3300044658 | Ga0466972_0000047 | Ga0466972_0000047_8198_9235 | 313 |
| 775 | 3300044658 | Ga0466972_0029484 | Ga0466972_0029484_1068_2105 | 313 |
| 776 | 3300044684 | Ga0466966_0000038 | Ga0466966_0000038_64698_65735 | 313 |
| 777 | 3300044684 | Ga0466966_0087507 | Ga0466966_0087507_343_1392 | 313 |
| 778 | 3300044712 | Ga0453684_0062022 | Ga0453684_0062022_546_1583 | 313 |
| 779 | 3300044712 | Ga0453684_0366909 | Ga0453684_0366909_305_1345 | 313 |
| 780 | 3300044735 | Ga0466968_0016485 | Ga0466968_0016485_1734_2771 | 313 |
| 781 | 3300044765 | Ga0466970_0029085 | Ga0466970_0029085_909_1958 | 313 |
| 782 | 3300044842 | Ga0466957_0000329 | Ga0466957_0000329_20455_21522 | 313 |
| 783 | 3300044842 | Ga0466957_0000739 | Ga0466957_0000739_1905_2984 | 313 |
| 784 | 3300044901 | Ga0466960_0066308 | Ga0466960_0066308_73_1110 | 313 |
| 785 | 3300045049 | Ga0466959_0000289 | Ga0466959_0000289_22489_23526 | 313 |
| 786 | 3300045049 | Ga0466959_0005476 | Ga0466959_0005476_6182_7231 | 313 |
| 787 | 3300045836 | Ga0466958_0017362 | Ga0466958_0017362_2467_3516 | 313 |
| 788 | 3300046454 | Ga0495592_0036614 | Ga0495592_0036614_2553_3587 | 313 |
| 789 | 3300046460 | Ga0495638_0016015 | Ga0495638_0016015_161_1198 | 313 |
| 790 | 3300046460 | Ga0495638_0184904 | Ga0495638_0184904_97_1137 | 313 |
| 791 | 3300046511 | Ga0495608_0064405 | Ga0495608_0064405_464_1498 | 313 |
| 792 | 3300046516 | Ga0495628_0112500 | Ga0495628_0112500_1041_2075 | 313 |
| 793 | 3300046517 | Ga0495630_0140484 | Ga0495630_0140484_495_1529 | 313 |
| 794 | 3300046517 | Ga0495630_0261146 | Ga0495630_0261146_71_1108 | 313 |
| 795 | 3300046524 | Ga0495648_0002523 | Ga0495648_0002523_4792_5829 | 313 |
| 796 | 3300046648 | Ga0495611_0008231 | Ga0495611_0008231_2981_4042 | 313 |
| 797 | 3300046691 | Ga0495670_0113298 | Ga0495670_0113298_58_1107 | 313 |
| 798 | 3300046691 | Ga0495670_0120811 | Ga0495670_0120811_121_1155 | 313 |
| 799 | 3300047320 | Ga0495672_0008699 | Ga0495672_0008699_2249_3286 | 313 |
| 800 | 3300047443 | Ga0495687_000058 | Ga0495687_000058_61772_62809 | 313 |
| 801 | 3300047444 | Ga0495675_0191494 | Ga0495675_0191494_161_1195 | 313 |
| 802 | 3300047471 | Ga0495684_0156852 | Ga0495684_0156852_166_1200 | 313 |
| 803 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_325272_326297 | 313 |
| 804 | 3300047472 | Ga0495686_0051544 | Ga0495686_0051544_868_1905 | 313 |
| 805 | 3300048903 | Ga0496100_0107490 | Ga0496100_0107490_176_1204 | 313 |
| 806 | 3300048904 | Ga0496101_0009191 | Ga0496101_0009191_1125_2153 | 313 |
| 807 | 3300048909 | Ga0496106_0056974 | Ga0496106_0056974_1604_2632 | 313 |
| 808 | 3300048913 | Ga0496110_0132971 | Ga0496110_0132971_628_1662 | 313 |
| 809 | 3300048914 | Ga0496111_0201891 | Ga0496111_0201891_119_1153 | 313 |
| 810 | 3300048917 | Ga0496114_0038907 | Ga0496114_0038907_1668_2696 | 313 |
| 811 | 3300049521 | Ga0501298_000085 | Ga0501298_000085_1315_2358 | 313 |
| 812 | 3300049568 | Ga0501031_0003151 | Ga0501031_0003151_2197_3237 | 313 |
| 813 | 3300049569 | Ga0501032_0188764 | Ga0501032_0188764_195_1235 | 313 |
| 814 | 3300049570 | Ga0501033_0167316 | Ga0501033_0167316_443_1471 | 313 |
| 815 | 3300049571 | Ga0501034_0024144 | Ga0501034_0024144_207_1244 | 313 |
| 816 | 3300049571 | Ga0501034_0024924 | Ga0501034_0024924_901_1929 | 313 |
| 817 | 3300049571 | Ga0501034_0074987 | Ga0501034_0074987_1842_2885 | 313 |
| 818 | 3300049571 | Ga0501034_0198498 | Ga0501034_0198498_873_1910 | 313 |
| 819 | 3300049571 | Ga0501034_0388457 | Ga0501034_0388457_54_1091 | 313 |
| 820 | 3300049572 | Ga0501036_0046476 | Ga0501036_0046476_2004_3047 | 313 |
| 821 | 3300049572 | Ga0501036_0145405 | Ga0501036_0145405_673_1701 | 313 |
| 822 | 3300049573 | Ga0501037_0007495 | Ga0501037_0007495_6584_7624 | 313 |
| 823 | 3300049574 | Ga0501038_0047620 | Ga0501038_0047620_318_1361 | 313 |
| 824 | 3300049574 | Ga0501038_0057989 | Ga0501038_0057989_574_1614 | 313 |
| 825 | 3300049574 | Ga0501038_0110638 | Ga0501038_0110638_657_1685 | 313 |
| 826 | 3300049575 | Ga0501039_0042051 | Ga0501039_0042051_1863_2906 | 313 |
| 827 | 3300049575 | Ga0501039_0151510 | Ga0501039_0151510_575_1615 | 313 |
| 828 | 3300049579 | Ga0501043_0001798 | Ga0501043_0001798_2365_3405 | 313 |
| 829 | 3300049579 | Ga0501043_0002152 | Ga0501043_0002152_6947_7975 | 313 |
| 830 | 3300049579 | Ga0501043_0016289 | Ga0501043_0016289_2138_3181 | 313 |
| 831 | 3300049579 | Ga0501043_0056650 | Ga0501043_0056650_991_2067 | 313 |
| 832 | 3300049580 | Ga0501046_0041840 | Ga0501046_0041840_326_1369 | 313 |
| 833 | 3300049580 | Ga0501046_0151332 | Ga0501046_0151332_107_1147 | 313 |
| 834 | 3300049581 | Ga0501047_0032624 | Ga0501047_0032624_1498_2535 | 313 |
| 835 | 3300049581 | Ga0501047_0037183 | Ga0501047_0037183_1214_2257 | 313 |
| 836 | 3300049581 | Ga0501047_0041518 | Ga0501047_0041518_225_1265 | 313 |
| 837 | 3300049581 | Ga0501047_0049748 | Ga0501047_0049748_362_1438 | 313 |
| 838 | 3300049581 | Ga0501047_0143303 | Ga0501047_0143303_720_1757 | 313 |
| 839 | 3300049583 | Ga0501067_0015790 | Ga0501067_0015790_2835_3878 | 313 |
| 840 | 3300049586 | Ga0501070_0179530 | Ga0501070_0179530_230_1267 | 313 |
| 841 | 3300049589 | Ga0501073_0035482 | Ga0501073_0035482_1288_2331 | 313 |
| 842 | 3300049590 | Ga0501074_0021945 | Ga0501074_0021945_1601_2644 | 313 |
| 843 | 3300049651 | Ga0501201_000236 | Ga0501201_000236_2242_3285 | 313 |
| 844 | 3300049652 | Ga0501202_000452 | Ga0501202_000452_3853_4896 | 313 |
| 845 | 3300049653 | Ga0501206_000782 | Ga0501206_000782_2122_3165 | 313 |
| 846 | 3300049654 | Ga0501207_000054 | Ga0501207_000054_5289_6332 | 313 |
| 847 | 3300049661 | Ga0501217_000181 | Ga0501217_000181_807_1850 | 313 |
| 848 | 3300049662 | Ga0501222_004155 | Ga0501222_004155_93_1136 | 313 |
| 849 | 3300049663 | Ga0501223_003113 | Ga0501223_003113_2394_3437 | 313 |
| 850 | 3300049664 | Ga0501224_002202 | Ga0501224_002202_814_1857 | 313 |
| 851 | 3300049668 | Ga0501233_006861 | Ga0501233_006861_689_1732 | 313 |
| 852 | 3300049673 | Ga0501240_000840 | Ga0501240_000840_790_1833 | 313 |
| 853 | 3300049675 | Ga0501243_000876 | Ga0501243_000876_2962_4005 | 313 |
| 854 | 3300049681 | Ga0501251_000740 | Ga0501251_000740_1130_2173 | 313 |
| 855 | 3300049686 | Ga0501257_001703 | Ga0501257_001703_409_1452 | 313 |
| 856 | 3300049688 | Ga0501259_000287 | Ga0501259_000287_6357_7400 | 313 |
| 857 | 3300049690 | Ga0501261_000774 | Ga0501261_000774_2470_3513 | 313 |
| 858 | 3300049703 | Ga0501219_000020 | Ga0501219_000020_19965_21002 | 313 |
| 859 | 3300049704 | Ga0501221_000607 | Ga0501221_000607_31_1074 | 313 |
| 860 | 3300049705 | Ga0501225_0000285 | Ga0501225_0000285_14207_15244 | 313 |
| 861 | 3300049708 | Ga0501245_000238 | Ga0501245_000238_4284_5327 | 313 |
| 862 | 3300049741 | Ga0501079_0008887 | Ga0501079_0008887_5380_6417 | 313 |
| 863 | 3300049741 | Ga0501079_0034323 | Ga0501079_0034323_1988_3031 | 313 |
| 864 | 3300049742 | Ga0501080_0039205 | Ga0501080_0039205_2293_3336 | 313 |
| 865 | 3300049742 | Ga0501080_0109537 | Ga0501080_0109537_577_1614 | 313 |
| 866 | 3300049744 | Ga0501083_0015447 | Ga0501083_0015447_4085_5122 | 313 |
| 867 | 3300049765 | Ga0501268_007668 | Ga0501268_007668_177_1220 | 313 |
| 868 | 3300049779 | Ga0501283_004516 | Ga0501283_004516_172_1215 | 313 |
| 869 | 3300049822 | Ga0501035_0023552 | Ga0501035_0023552_1833_2876 | 313 |
| 870 | 3300049822 | Ga0501035_0132391 | Ga0501035_0132391_95_1123 | 313 |
| 871 | 3300049823 | Ga0501044_0005008 | Ga0501044_0005008_2911_3948 | 313 |
| 872 | 3300049823 | Ga0501044_0028917 | Ga0501044_0028917_1938_2981 | 313 |
| 873 | 3300049823 | Ga0501044_0031459 | Ga0501044_0031459_3465_4502 | 313 |
| 874 | 3300049823 | Ga0501044_0041171 | Ga0501044_0041171_1187_2224 | 313 |
| 875 | 3300049823 | Ga0501044_0149703 | Ga0501044_0149703_885_1961 | 313 |
| 876 | 3300049823 | Ga0501044_0174341 | Ga0501044_0174341_657_1685 | 313 |
| 877 | 3300050005 | Ga0501284_00030 | Ga0501284_00030_22994_24031 | 313 |
| 878 | 3300050493 | nmdc:mga0k408_103955_c1 | nmdc:mga0k408_103955_c1_593_1630 | 313 |
| 879 | 3300050493 | nmdc:mga0k408_26438_c1 | nmdc:mga0k408_26438_c1_1455_2492 | 313 |
| 880 | 3300050493 | nmdc:mga0k408_9076_c1 | nmdc:mga0k408_9076_c1_495_1532 | 313 |
| 881 | 3300050507 | nmdc:mga05p37_32575_c1 | nmdc:mga05p37_32575_c1_1654_2787 | 313 |
| 882 | 3300050508 | nmdc:mga09592_998_c1 | nmdc:mga09592_998_c1_18075_19109 | 313 |
| 883 | 3300050511 | nmdc:mga08y16_5081_c1 | nmdc:mga08y16_5081_c1_10634_11677 | 313 |
| 884 | 3300050512 | nmdc:mga0n895_35785_c1 | nmdc:mga0n895_35785_c1_3196_4239 | 313 |
| 885 | 3300053086 | Ga0500578_0000469 | Ga0500578_0000469_8423_9850 | 313 |
| 886 | 3300053086 | Ga0500578_0123206 | Ga0500578_0123206_93_1130 | 313 |
| 887 | 3300053090 | Ga0500646_0003186 | Ga0500646_0003186_922_1959 | 313 |
| 888 | 3300053092 | Ga0500583_0000182 | Ga0500583_0000182_4727_5764 | 313 |
| 889 | 3300053092 | Ga0500583_0000288 | Ga0500583_0000288_2770_3948 | 313 |
| 890 | 3300053139 | Ga0500568_0000155 | Ga0500568_0000155_33979_35007 | 313 |
| 891 | 3300053146 | Ga0500588_0002305 | Ga0500588_0002305_2051_3091 | 313 |
| 892 | 3300053147 | Ga0500589_003476 | Ga0500589_003476_386_1423 | 313 |
| 893 | 3300053156 | Ga0500622_0001399 | Ga0500622_0001399_392_1429 | 313 |
| 894 | 3300053156 | Ga0500622_0024966 | Ga0500622_0024966_394_1431 | 313 |
| 895 | 3300053177 | Ga0500636_0102165 | Ga0500636_0102165_141_1178 | 313 |
| 896 | 3300053178 | Ga0500637_0101020 | Ga0500637_0101020_433_1470 | 313 |
| 897 | 3300054114 | Ga0501084_0019472 | Ga0501084_0019472_3935_4972 | 313 |
| 898 | 3300061719 | Ga0466962_0004394 | Ga0466962_0004394_651_1700 | 313 |
| 899 | 3300005327 | Ga0070658_10018168 | Ga0070658_100181688 | 314 |
| 900 | 3300005327 | Ga0070658_10035739 | Ga0070658_100357392 | 314 |
| 901 | 3300005327 | Ga0070658_10036722 | Ga0070658_100367221 | 314 |
| 902 | 3300005327 | Ga0070658_10197762 | Ga0070658_101977622 | 314 |
| 903 | 3300005329 | Ga0070683_100141336 | Ga0070683_1001413362 | 314 |
| 904 | 3300005329 | Ga0070683_100245519 | Ga0070683_1002455192 | 314 |
| 905 | 3300005336 | Ga0070680_100004897 | Ga0070680_1000048978 | 314 |
| 906 | 3300005336 | Ga0070680_100009953 | Ga0070680_1000099533 | 314 |
| 907 | 3300005336 | Ga0070680_100075888 | Ga0070680_1000758883 | 314 |
| 908 | 3300005337 | Ga0070682_100038484 | Ga0070682_1000384843 | 314 |
| 909 | 3300005339 | Ga0070660_100000242 | Ga0070660_1000002428 | 314 |
| 910 | 3300005339 | Ga0070660_100107303 | Ga0070660_1001073032 | 314 |
| 911 | 3300005347 | Ga0070668_100409751 | Ga0070668_1004097511 | 314 |
| 912 | 3300005366 | Ga0070659_100066917 | Ga0070659_1000669173 | 314 |
| 913 | 3300005455 | Ga0070663_100035851 | Ga0070663_1000358512 | 314 |
| 914 | 3300005455 | Ga0070663_100111797 | Ga0070663_1001117972 | 314 |
| 915 | 3300005455 | Ga0070663_100121269 | Ga0070663_1001212692 | 314 |
| 916 | 3300005458 | Ga0070681_10069975 | Ga0070681_100699752 | 314 |
| 917 | 3300005530 | Ga0070679_100000216 | Ga0070679_10000021625 | 314 |
| 918 | 3300005530 | Ga0070679_100002882 | Ga0070679_1000028829 | 314 |
| 919 | 3300005530 | Ga0070679_100026094 | Ga0070679_1000260945 | 314 |
| 920 | 3300005530 | Ga0070679_100056098 | Ga0070679_1000560982 | 314 |
| 921 | 3300005530 | Ga0070679_100163284 | Ga0070679_1001632842 | 314 |
| 922 | 3300005539 | Ga0068853_100313543 | Ga0068853_1003135431 | 314 |
| 923 | 3300005548 | Ga0070665_100443516 | Ga0070665_1004435162 | 314 |
| 924 | 3300005563 | Ga0068855_100000189 | Ga0068855_10000018938 | 314 |
| 925 | 3300005563 | Ga0068855_100006503 | Ga0068855_10000650315 | 314 |
| 926 | 3300005563 | Ga0068855_100064228 | Ga0068855_1000642284 | 314 |
| 927 | 3300005563 | Ga0068855_100417914 | Ga0068855_1004179141 | 314 |
| 928 | 3300005614 | Ga0068856_100005092 | Ga0068856_1000050927 | 314 |
| 929 | 3300005616 | Ga0068852_100000633 | Ga0068852_1000006339 | 314 |
| 930 | 3300005616 | Ga0068852_100108980 | Ga0068852_1001089802 | 314 |
| 931 | 3300005843 | Ga0068860_100000759 | Ga0068860_10000075933 | 314 |
| 932 | 3300005844 | Ga0068862_100003608 | Ga0068862_10000360812 | 314 |
| 933 | 3300009093 | Ga0105240_10025004 | Ga0105240_100250046 | 314 |
| 934 | 3300009174 | Ga0105241_10130995 | Ga0105241_101309951 | 314 |
| 935 | 3300009545 | Ga0105237_10031026 | Ga0105237_100310262 | 314 |
| 936 | 3300009553 | Ga0105249_10492864 | Ga0105249_104928642 | 314 |
| 937 | 3300010375 | Ga0105239_10441177 | Ga0105239_104411771 | 314 |
| 938 | 3300013100 | Ga0157373_10037348 | Ga0157373_100373483 | 314 |
| 939 | 3300013102 | Ga0157371_10000518 | Ga0157371_1000051828 | 314 |
| 940 | 3300013102 | Ga0157371_10000650 | Ga0157371_1000065028 | 314 |
| 941 | 3300013102 | Ga0157371_10000898 | Ga0157371_1000089835 | 314 |
| 942 | 3300013102 | Ga0157371_10001280 | Ga0157371_1000128021 | 314 |
| 943 | 3300013102 | Ga0157371_10076478 | Ga0157371_100764782 | 314 |
| 944 | 3300013104 | Ga0157370_10000313 | Ga0157370_100003133 | 314 |
| 945 | 3300013104 | Ga0157370_10000478 | Ga0157370_100004785 | 314 |
| 946 | 3300013104 | Ga0157370_10006366 | Ga0157370_100063667 | 314 |
| 947 | 3300013104 | Ga0157370_10077626 | Ga0157370_100776262 | 314 |
| 948 | 3300013105 | Ga0157369_10015979 | Ga0157369_100159792 | 314 |
| 949 | 3300013105 | Ga0157369_10018825 | Ga0157369_100188253 | 314 |
| 950 | 3300013105 | Ga0157369_10032914 | Ga0157369_100329147 | 314 |
| 951 | 3300013296 | Ga0157374_10203631 | Ga0157374_102036312 | 314 |
| 952 | 3300013306 | Ga0163162_10157845 | Ga0163162_101578451 | 314 |
| 953 | 3300013307 | Ga0157372_10021759 | Ga0157372_100217596 | 314 |
| 954 | 3300013307 | Ga0157372_10023200 | Ga0157372_100232009 | 314 |
| 955 | 3300013307 | Ga0157372_10052578 | Ga0157372_100525782 | 314 |
| 956 | 3300013307 | Ga0157372_10137536 | Ga0157372_101375361 | 314 |
| 957 | 3300013307 | Ga0157372_10167152 | Ga0157372_101671522 | 314 |
| 958 | 3300025904 | Ga0207647_10009352 | Ga0207647_100093526 | 314 |
| 959 | 3300025909 | Ga0207705_10006383 | Ga0207705_100063835 | 314 |
| 960 | 3300025909 | Ga0207705_10033756 | Ga0207705_100337564 | 314 |
| 961 | 3300025911 | Ga0207654_10046622 | Ga0207654_100466223 | 314 |
| 962 | 3300025912 | Ga0207707_10126078 | Ga0207707_101260781 | 314 |
| 963 | 3300025913 | Ga0207695_10011310 | Ga0207695_100113109 | 314 |
| 964 | 3300025917 | Ga0207660_10002218 | Ga0207660_100022185 | 314 |
| 965 | 3300025917 | Ga0207660_10287939 | Ga0207660_102879392 | 314 |
| 966 | 3300025919 | Ga0207657_10148949 | Ga0207657_101489492 | 314 |
| 967 | 3300025921 | Ga0207652_10000090 | Ga0207652_1000009056 | 314 |
| 968 | 3300025921 | Ga0207652_10000999 | Ga0207652_1000099919 | 314 |
| 969 | 3300025921 | Ga0207652_10001591 | Ga0207652_1000159116 | 314 |
| 970 | 3300025921 | Ga0207652_10011840 | Ga0207652_100118405 | 314 |
| 971 | 3300025921 | Ga0207652_10059552 | Ga0207652_100595522 | 314 |
| 972 | 3300025921 | Ga0207652_10193882 | Ga0207652_101938822 | 314 |
| 973 | 3300025925 | Ga0207650_10197267 | Ga0207650_101972672 | 314 |
| 974 | 3300025932 | Ga0207690_10100317 | Ga0207690_101003172 | 314 |
| 975 | 3300025940 | Ga0207691_10094120 | Ga0207691_100941203 | 314 |
| 976 | 3300025944 | Ga0207661_10051748 | Ga0207661_100517482 | 314 |
| 977 | 3300025949 | Ga0207667_10000492 | Ga0207667_1000049254 | 314 |
| 978 | 3300025949 | Ga0207667_10002948 | Ga0207667_1000294823 | 314 |
| 979 | 3300025949 | Ga0207667_10013252 | Ga0207667_100132523 | 314 |
| 980 | 3300026067 | Ga0207678_10004101 | Ga0207678_1000410114 | 314 |
| 981 | 3300026116 | Ga0207674_10211388 | Ga0207674_102113882 | 314 |
| 982 | 3300026142 | Ga0207698_10026361 | Ga0207698_100263612 | 314 |
| 983 | 3300026142 | Ga0207698_10045981 | Ga0207698_100459812 | 314 |
| 984 | 3300028381 | Ga0268264_10007210 | Ga0268264_100072107 | 314 |
| 985 | 3300037312 | Ga0395899_0034830 | Ga0395899_0034830_2178_3221 | 314 |
| 986 | 3300037418 | Ga0395900_0000927 | Ga0395900_0000927_9779_10819 | 314 |
| 987 | 3300037418 | Ga0395900_0032022 | Ga0395900_0032022_3427_4464 | 314 |
| 988 | 3300037466 | Ga0395898_0009829 | Ga0395898_0009829_6512_7552 | 314 |
| 989 | 3300037466 | Ga0395898_0313565 | Ga0395898_0313565_441_1478 | 314 |
| 990 | 3300037471 | Ga0395905_0095772 | Ga0395905_0095772_136_1173 | 314 |
| 991 | 3300038443 | Ga0395901_0001347 | Ga0395901_0001347_22981_24021 | 314 |
| 992 | 3300038443 | Ga0395901_0010081 | Ga0395901_0010081_1342_2382 | 314 |
| 993 | 3300046616 | Ga0495668_0000257 | Ga0495668_0000257_961_1998 | 314 |
| 994 | 3300048924 | Ga0496121_0000086 | Ga0496121_0000086_95545_96549 | 314 |
| 995 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_81749_82795 | 314 |
| 996 | 3300049586 | Ga0501070_0259217 | Ga0501070_0259217_232_1272 | 314 |
| 997 | 3300049822 | Ga0501035_0102713 | Ga0501035_0102713_962_2002 | 314 |
| 998 | 3300049823 | Ga0501044_0472302 | Ga0501044_0472302_78_1115 | 314 |
| 999 | iso_pu_bacteria | 2840677318 | 2840679021 | 314 |
| 1000 | iso_pu_bacteria | 2883068021 | 2883070302 | 314 |
| 1001 | iso_pu_bacteria | 2896085136 | 2896086834 | 314 |
| 1002 | 3300003794 | Ga0055531_10000059 | Ga0055531_1000005947 | 315 |
| 1003 | 3300025304 | Ga0209257_1000070 | Ga0209257_1000070226 | 315 |
| 1004 | 3300041997 | Ga0439431_0001588 | Ga0439431_0001588_2418_3437 | 315 |
| 1005 | 3300042004 | Ga0439445_0024350 | Ga0439445_0024350_191_1210 | 315 |
| 1006 | 3300046453 | Ga0495627_019616 | Ga0495627_019616_876_1895 | 315 |
| 1007 | 3300046558 | Ga0495633_0000089 | Ga0495633_0000089_7788_8807 | 315 |
| 1008 | 3300049758 | Ga0501241_000145 | Ga0501241_000145_2540_3562 | 315 |
| 1009 | 3300053093 | Ga0500651_0093030 | Ga0500651_0093030_139_1158 | 315 |
| 1010 | iso_pu_bacteria | 2929177148 | 2929177974 | 315 |
| 1011 | iso_pu_bacteria | 2945977869 | 2945980328 | 315 |
| 1012 | iso_pu_bacteria | 2946013367 | 2946013808 | 315 |
| 1013 | 3300003320 | rootH2_10013765 | rootH2_100137656 | 316 |
| 1014 | 3300005262 | Ga0065165_1004314 | Ga0065165_100431410 | 316 |
| 1015 | 3300025208 | Ga0209436_100742 | Ga0209436_1007425 | 316 |
| 1016 | 3300025284 | Ga0209130_1001880 | Ga0209130_100188010 | 316 |
| 1017 | 3300025302 | Ga0207426_1000033 | Ga0207426_1000033214 | 316 |
| 1018 | 3300053088 | Ga0500644_0000545 | Ga0500644_0000545_13514_14518 | 316 |
| 1019 | 3300053160 | Ga0500633_0000426 | Ga0500633_0000426_630_1634 | 316 |
| 1020 | iso_pu_bacteria | 2896109856 | 2896112822 | 316 |
| 1021 | iso_pu_bacteria | 2929921140 | 2929922046 | 316 |
| 1022 | iso_pu_bacteria | 8003151029 | 8003155735 | 316 |
| 1023 | 3300049671 | Ga0501238_002085 | Ga0501238_002085_441_1454 | 317 |
| 1024 | iso_pu_bacteria | 2884791551 | 2884796512 | 317 |
| 1025 | 3300002738 | JGI25154J39366_1000003 | JGI25154J39366_100000361 | 320 |
| 1026 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004276 | 320 |
| 1027 | 3300025250 | Ga0209026_1000156 | Ga0209026_100015666 | 320 |
| 1028 | 3300003322 | rootL2_10017734 | rootL2_100177344 | 322 |
| 1029 | 3300001989 | JGI24739J22299_10000023 | JGI24739J22299_1000002340 | 324 |
| 1030 | 3300003354 | JGI25160J50197_1015108 | JGI25160J50197_10151082 | 324 |
| 1031 | 3300003790 | Ga0055528_1000539 | Ga0055528_10005396 | 324 |
| 1032 | 3300003791 | Ga0055530_10000620 | Ga0055530_1000062023 | 324 |
| 1033 | 3300004625 | Ga0055543_1008738 | Ga0055543_10087383 | 324 |
| 1034 | 3300005262 | Ga0065165_1001718 | Ga0065165_100171817 | 324 |
| 1035 | 3300025273 | Ga0209673_1000258 | Ga0209673_10002582 | 324 |
| 1036 | 3300025298 | Ga0209050_1000097 | Ga0209050_100009714 | 324 |
| 1037 | 3300025302 | Ga0207426_1000472 | Ga0207426_100047250 | 324 |
| 1038 | 3300025304 | Ga0209257_1005191 | Ga0209257_10051915 | 324 |
| 1039 | 3300003323 | rootH1_10014197 | rootH1_100141974 | 326 |
| 1040 | 3300014325 | Ga0163163_10160777 | Ga0163163_101607772 | 328 |
| 1041 | 3300025941 | Ga0207711_10224042 | Ga0207711_102240422 | 328 |
| 1042 | 3300053136 | Ga0500559_0044762 | Ga0500559_0044762_575_1645 | 329 |
| 1043 | 3300053177 | Ga0500636_0029952 | Ga0500636_0029952_1712_2782 | 329 |
| 1044 | 3300015265 | Ga0182005_1000161 | Ga0182005_100016115 | 337 |
| 1045 | iso_pu_bacteria | 2818991442 | 2819574743 | 337 |
| 1046 | 3300001979 | JGI24740J21852_10001374 | JGI24740J21852_100013743 | 341 |
| 1047 | 3300003215 | JGI25153J46596_10000403 | JGI25153J46596_100004036 | 341 |
| 1048 | 3300003354 | JGI25160J50197_1010623 | JGI25160J50197_10106232 | 341 |
| 1049 | 3300025297 | Ga0209758_1007402 | Ga0209758_10074027 | 341 |
| 1050 | 3300025302 | Ga0207426_1000321 | Ga0207426_100032120 | 341 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k4j-assembly1.cif.gz_A | pyranose 2-oxidase h450q mutant | 0.9355 | 23 | 50 |
| 4ccr-assembly2.cif.gz_D | crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor | 0.9336 | 22 | 50 |
| 7kho-assembly2.cif.gz_B | nica2 variant n462v in complex with (s)-nicotine | 0.9323 | 23 | 50 |
| 4up3-assembly1.cif.gz_B | crystal structure of the mutant c140s,c286q thioredoxin reductase from entamoeba histolytica | 0.9309 | 22 | 50 |
| 4moi-assembly1.cif.gz_A | pyranose 2-oxidase h450g/v546c double mutant with 3-fluorinated glucose | 0.9307 | 23 | 50 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN77_2_187_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9452 | 21 | 203 | 3.40.50.720 |
| af_P9WN77_2_187_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9209 | 21 | 203 | 3.40.50.720 |
| 1z82B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9191 | 24 | 206 | 3.40.50.720 |
| 3k96B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.919 | 22 | 207 | 3.40.50.720 |
| 2q7vB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9167 | 24 | 53 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A388Q292-F1-model_v4 | Glycerol-3-phosphate dehydrogenase [NAD(P)+] | 0.9896 | 21 | 212 |
GO:0005829
GO:0046168 GO:0047952 GO:0051287 |
| AF-A0A838TRA3-F1-model_v4 | NAD(P)-binding domain-containing protein | 0.9859 | 19 | 107 |
GO:0005829
GO:0046168 GO:0047952 GO:0051287 |
| AF-A0A353RBC3-F1-model_v4 | Glycerol-3-phosphate dehydrogenase | 0.9836 | 22 | 213 |
GO:0005829
GO:0046168 GO:0047952 GO:0051287 |
| AF-A0A357Z8I8-F1-model_v4 | Glycerol-3-phosphate dehydrogenase | 0.9804 | 16 | 192 |
GO:0005829
GO:0046168 GO:0047952 GO:0051287 |
| AF-A0A4Q3UNA3-F1-model_v4 | Glycerol-3-phosphate dehydrogenase NAD-dependent N-terminal domain-containing protein | 0.9699 | 21 | 166 |
GO:0005829
GO:0046168 GO:0047952 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar