F489067

General Info

Members Datasets Scaffolds Average Seq Length
1051 777 588 319

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10000287|JGI24740J21852_1000028719
Length 343
Sequence MPNGCPLSGRKRHERRGTSRMIRSVVRGFGAALPKRVMTNAEMEQVVDTSDDWIVQRSGIRQRYIAGEGETTASLGEQAARAALANAGMTPDDLDLIIVATSTPDNTFPATAVNIQNRLGMHHGFAFDVQAVCTGFVYAVTTADAYIRGGLAKRVLVIGAETFSRILNWTDRTTCVLFGDGAGALILEAGEGTGANSDRGVLTASLRSDGSHKDKLYVDGGPSTTGTVGVLHMAGREVFKHAVGMITDVIQAAFDATGTTPDDLDWLVPHQANRRIIDGSAKKLGIAPEKVVVTVDLHGNTSAASIPLALAVAAGDGRIKKGDLVMLEAMGGGFTWGAVLLRW

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
21 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
22 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
26 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
29 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2516143018 Ensifer sp. BR816 Isolate Nodule
35 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
36 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2519899620 Rhizobium sp. Pop5 Isolate Nodule
41 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
42 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
43 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
44 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
45 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
46 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
47 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
48 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
49 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
50 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
51 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
52 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
53 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
54 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
55 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
56 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
57 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
58 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
59 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
60 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
61 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
62 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
63 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
64 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
65 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
66 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
67 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
68 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
69 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
70 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
71 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
72 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
73 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
74 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
75 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
76 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
77 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
78 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
79 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
80 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
81 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
82 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
83 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
84 2643221557 Ensifer sp. Root558 Isolate Unclassified
85 2643221568 Rhizobium sp. Root564 Isolate Unclassified
86 2643221582 Rhizobium sp. Root651 Isolate Unclassified
87 2643221599 Rhizobium sp. Root708 Isolate Unclassified
88 2643221607 Rhizobium sp. Root73 Isolate Unclassified
89 2643221610 Ensifer sp. Root74 Isolate Unclassified
90 2643221618 Ensifer sp. Root231 Isolate Unclassified
91 2643221626 Ensifer sp. Root31 Isolate Unclassified
92 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
93 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
94 2643221655 Ensifer sp. Root1252 Isolate Unclassified
95 2643221659 Ensifer sp. Root127 Isolate Unclassified
96 2643221668 Ensifer sp. Root423 Isolate Unclassified
97 2643221675 Ensifer sp. Root1298 Isolate Unclassified
98 2643221680 Ensifer sp. Root1312 Isolate Unclassified
99 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
100 2643221688 Rhizobium sp. Root482 Isolate Unclassified
101 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
102 2643221693 Rhizobium sp. Root491 Isolate Unclassified
103 2643221698 Ensifer sp. Root142 Isolate Unclassified
104 2643221712 Ensifer sp. Root258 Isolate Unclassified
105 2643221723 Ensifer sp. Root278 Isolate Unclassified
106 2643221726 Ensifer sp. Root954 Isolate Unclassified
107 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
108 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
109 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
110 2718217882 Rhizobium sp. N741 Isolate Nodule
111 2718217927 Rhizobium sp. N324 Isolate Nodule
112 2718218009 Rhizobium sp. N561 Isolate Nodule
113 2718218363 Rhizobium sp. N113 Isolate Nodule
114 2718218365 Rhizobium sp. N731 Isolate Nodule
115 2718218366 Rhizobium sp. N621 Isolate Nodule
116 2718218423 Rhizobium sp. N941 Isolate Nodule
117 2721755514 Rhizobium sp. N6212 Isolate Nodule
118 2721755809 Rhizobium sp. N541 Isolate Nodule
119 2721755810 Rhizobium sp. N871 Isolate Nodule
120 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
121 2728369365 Rhizobium sp. N1341 Isolate Nodule
122 2728369397 Rhizobium sp. N1314 Isolate Nodule
123 2738541293 Rhizobium sp. GV031 Isolate Unclassified
124 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
125 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
126 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
127 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
128 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
129 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
130 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
131 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
132 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
133 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
134 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
135 2791355260 Rhizobium sp. L9 Isolate Nodule
136 2791355261 Rhizobium sp. J15 Isolate Nodule
137 2791355262 Rhizobium sp. M1 Isolate Nodule
138 2791355264 Rhizobium sp. S9 Isolate Nodule
139 2791355265 Rhizobium sp. H4 Isolate Nodule
140 2791355267 Rhizobium sp. L18 Isolate Nodule
141 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
142 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
143 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
144 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
145 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
146 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
147 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
148 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
149 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
150 2802429633 Rhizobium anhuiense J3 Isolate Nodule
151 2802429634 Rhizobium anhuiense S10 Isolate Nodule
152 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
153 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
154 2802429637 Rhizobium anhuiense C15 Isolate Nodule
155 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
156 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
157 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
158 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
159 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
160 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
161 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
162 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
163 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
164 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
165 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
166 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
167 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
168 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
169 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
170 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
171 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
172 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
173 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
174 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
175 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
176 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
177 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
178 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
179 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
180 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
181 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
182 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
183 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
184 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
185 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
186 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
187 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
188 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
189 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
190 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
191 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
192 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
193 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
194 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
195 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
196 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
197 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
198 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
199 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
200 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
201 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
202 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
203 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
204 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
205 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
206 2844163670 Ensifer sp. 1H6 Isolate Unclassified
207 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
208 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
209 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
210 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
211 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
212 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
213 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
214 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
215 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
216 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
217 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
218 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
219 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
220 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
221 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
222 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
223 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
224 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
225 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
226 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
227 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
228 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
229 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
230 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
231 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
232 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
233 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
234 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
235 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
236 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
237 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
238 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
239 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
240 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
241 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
242 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
243 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
244 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
245 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
246 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
247 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
248 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
249 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
250 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
251 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
252 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
253 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
254 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
255 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
256 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
257 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
258 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
259 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
260 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
261 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
262 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
263 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
264 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
265 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
266 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
267 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
268 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
269 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
270 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
271 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
272 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
273 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
274 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
275 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
276 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
277 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
278 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
279 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
280 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
281 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
282 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
283 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
284 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
285 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
286 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
287 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
288 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
289 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
290 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
291 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
292 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
293 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
294 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
295 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
296 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
297 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
298 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
299 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
300 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
301 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
302 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
303 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
304 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
305 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
306 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
307 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
308 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
309 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
310 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
311 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
312 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
313 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
314 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
315 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
316 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
317 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
318 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
319 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
320 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
321 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
322 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
323 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
324 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
325 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
326 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
327 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
328 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
329 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
330 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
331 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
332 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
333 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
334 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
335 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
336 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
337 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
338 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
339 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
340 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
341 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
342 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
343 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
344 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
345 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
346 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
347 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
348 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
349 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
350 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
351 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
352 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
353 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
354 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
355 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
356 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
357 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
358 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
359 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
360 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
361 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
362 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
363 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
364 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
365 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
366 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
367 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
368 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
369 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
370 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
371 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
372 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
373 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
374 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
375 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
376 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
377 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
378 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
379 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
380 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
381 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
382 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
383 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
384 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
385 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
386 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
387 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
388 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
389 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
390 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
391 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
392 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
393 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
394 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
395 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
396 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
397 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
398 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
399 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
400 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
401 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
402 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
403 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
404 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
405 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
406 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
407 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
408 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
409 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
410 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
411 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
412 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
413 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
414 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
415 2996887358 Rhizobium sp. R711 Isolate Nodule
416 2996893221 Rhizobium sp. R635 Isolate Nodule
417 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
418 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
419 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
420 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
421 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
422 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
423 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
424 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
425 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
426 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
427 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
428 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
429 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
430 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
431 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
432 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
433 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
434 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
435 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
436 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
437 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
438 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
439 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
440 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
441 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
442 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
443 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
444 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
445 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
446 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
447 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
448 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
449 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
450 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
451 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
452 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
453 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
454 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
455 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
456 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
457 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
458 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
459 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
460 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
461 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
462 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
463 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
464 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
465 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
466 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
467 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
468 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
469 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
470 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
471 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
472 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
473 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
474 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
475 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
476 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
477 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
478 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
479 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
480 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
481 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
482 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
483 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
484 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
485 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
486 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
487 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
488 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
489 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
490 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
491 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
492 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
493 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
494 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
495 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
496 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
497 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
498 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
499 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
500 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
501 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
502 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
503 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
504 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
505 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
506 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
507 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
508 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
509 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
510 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
511 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
512 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
513 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
514 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
515 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
516 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
517 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
518 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
519 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
520 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
521 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
522 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
523 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
524 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
525 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
526 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
527 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
528 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
529 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
530 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
531 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
532 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
533 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
534 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
535 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
536 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
537 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
538 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
539 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
540 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
541 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
542 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
543 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
544 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
565 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
569 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
570 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
572 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
573 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
574 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
575 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
579 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
580 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
581 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
582 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
583 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
584 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
585 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
586 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
587 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
588 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
589 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
590 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
591 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
592 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
593 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
594 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
595 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
596 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
597 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
598 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
599 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
600 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
601 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
602 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
603 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
604 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
605 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
606 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
607 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
608 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
609 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
610 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
611 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
612 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
613 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
614 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
615 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
616 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
617 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
618 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
619 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
620 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
621 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
622 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
623 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
624 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
625 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
626 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
627 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
628 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
629 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
630 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
631 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
632 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
633 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
634 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
635 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
636 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
637 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
638 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
639 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
640 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
641 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
642 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
643 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
644 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
645 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
646 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
647 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
648 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
649 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
650 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
651 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
652 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
653 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
654 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
655 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
656 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
657 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
658 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
659 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
660 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
661 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
662 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
663 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
664 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
665 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
666 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
667 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
668 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
669 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
670 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
671 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
672 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
673 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
674 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
675 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
676 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
678 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
679 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
680 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
681 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
682 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
683 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
684 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
685 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
686 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
687 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
688 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
689 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
690 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
691 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
692 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
693 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
694 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
695 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
696 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
697 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
698 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
699 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
700 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
701 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
702 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
703 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
704 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
705 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
706 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
707 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
708 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
709 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
710 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
711 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
712 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
713 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
714 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
715 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
716 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
717 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
718 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
719 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
720 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
721 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
722 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
723 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
724 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
725 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
726 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
727 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
728 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
729 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
730 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
731 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
732 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
733 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
735 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
736 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
737 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
738 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
739 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
740 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
741 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
742 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
743 8005258706 Rhizobium sp. R693 Isolate Nodule
744 8005275841 Rhizobium sp. N4311 Isolate Nodule
745 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
746 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
747 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
748 8005321885 Rhizobium sp. R72 Isolate Nodule
749 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
750 8005382845 Rhizobium sp. R634 Isolate Nodule
751 8005395548 Rhizobium sp. R339 Isolate Nodule
752 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
753 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
754 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
755 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
756 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
757 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
758 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
759 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
760 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
761 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
762 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
763 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
764 8018176218 Rhizobium sp. N122 Isolate Nodule
765 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
766 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
767 8024501048 Rhizobium sp. H4 Isolate Nodule
768 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
769 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
770 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
771 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
772 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
773 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
774 8056382006 Rhizobium croatiense 13T Isolate Nodule
775 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
776 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
777 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.76
Metatranscriptomes 0.19
Isolates 44.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 17.03
Nodule 33.68
Rhizoplane 2.76
Rhizosphere 30.92
Stem 0
Stem Tuber 0
Unclassified 15.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000287 3300001979 Bacteria 21515
2 JGI25155J39150_1000019 3300002704 Bacteria 155636
3 JGI25156J39149_1000020 3300002705 Bacteria 156628
4 JGI25162J39368_1002520 3300002737 Bacteria 7005
5 JGI25162J39368_1002718 3300002737 Bacteria 6378
6 JGI25154J39366_1000102 3300002738 Bacteria 76188
7 JGI25154J39366_1006945 3300002738 Bacteria 1597
8 JGI25157J39369_1000070 3300002741 Bacteria 92090
9 JGI25152J39213_1004023 3300002773 Bacteria 4791
10 JGI25152J39213_1004196 3300002773 Bacteria 4633
11 JGI25150J39212_1000153 3300002774 Bacteria 39087
12 JGI25150J39212_1010191 3300002774 Bacteria 1756
13 JGI25159J45721_1000002 3300002987 Bacteria 289163
14 JGI25159J45721_1000300 3300002987 Bacteria 23241
15 JGI25159J45721_1001084 3300002987 Bacteria 11608
16 JGI25151J46595_10000108 3300003187 Bacteria 112874
17 JGI25151J46595_10021500 3300003187 Bacteria 2699
18 JGI25151J46595_10026953 3300003187 Bacteria 2311
19 JGI25165J46597_1002321 3300003214 Bacteria 6449
20 JGI25165J46597_1002334 3300003214 Bacteria 6395
21 JGI25153J46596_10000919 3300003215 Bacteria 17895
22 JGI25153J46596_10016204 3300003215 Bacteria 2997
23 JGI25153J46596_10023192 3300003215 Bacteria 2268
24 JGI25153J46596_10025545 3300003215 Bacteria 2108
25 JGI25160J50197_1000008 3300003354 Bacteria 289163
26 JGI25160J50197_1000015 3300003354 Bacteria 250902
27 JGI25160J50197_1000673 3300003354 Bacteria 18931
28 JGI25160J50197_1010331 3300003354 Bacteria 3384
29 JGI25161J50226_1000005 3300003374 Bacteria 292548
30 JGI25161J50226_1000051 3300003374 Bacteria 110051
31 JGI25161J50226_1003466 3300003374 Bacteria 3599
32 JGI25161J50226_1006097 3300003374 Bacteria 2229
33 Ga0055526_1000738 3300003771 Bacteria 24652
34 Ga0055526_1002187 3300003771 Bacteria 13403
35 Ga0055526_1002478 3300003771 Bacteria 12467
36 Ga0055526_1003233 3300003771 Bacteria 10498
37 Ga0055526_1004400 3300003771 Bacteria 8482
38 Ga0055524_1000570 3300003775 Bacteria 27529
39 Ga0055524_1001845 3300003775 Bacteria 11602
40 Ga0055524_1009296 3300003775 Bacteria 4014
41 Ga0055524_1014257 3300003775 Bacteria 2956
42 Ga0055536_1005880 3300003781 Bacteria 5883
43 Ga0055536_1007660 3300003781 Bacteria 4787
44 Ga0055528_1000373 3300003790 Bacteria 36405
45 Ga0055528_1000922 3300003790 Bacteria 19685
46 Ga0055528_1001416 3300003790 Bacteria 14694
47 Ga0055528_1004205 3300003790 Bacteria 6987
48 Ga0055528_1004900 3300003790 Bacteria 6320
49 Ga0055540_1001138 3300003792 Bacteria 16587
50 Ga0055540_1002752 3300003792 Bacteria 9028
51 Ga0055540_1004045 3300003792 Bacteria 6817
52 Ga0055540_1008033 3300003792 Bacteria 3861
53 Ga0058692_1008587 3300003856 Bacteria 2631
54 Ga0055543_1000012 3300004625 Bacteria 186581
55 Ga0055543_1000027 3300004625 Bacteria 136033
56 Ga0055543_1000095 3300004625 Bacteria 77750
57 Ga0065165_1000015 3300005262 Bacteria 289201
58 Ga0065165_1000125 3300005262 Bacteria 130283
59 Ga0065165_1009983 3300005262 Bacteria 4175
60 Ga0065165_1019313 3300005262 Bacteria 2438
61 Ga0065712_10094883 3300005290 Bacteria 2238
62 Ga0065715_10157385 3300005293 Bacteria 1663
63 Ga0070670_100219186 3300005331 Bacteria 1655
64 Ga0070666_10108247 3300005335 Bacteria 1921
65 Ga0070680_100002875 3300005336 Bacteria 12790
66 Ga0070660_100067342 3300005339 Bacteria 2789
67 Ga0070675_100121103 3300005354 Bacteria 2223
68 Ga0070671_100044993 3300005355 Bacteria 3668
69 Ga0070674_100027684 3300005356 Bacteria 3716
70 Ga0070714_100027694 3300005435 Bacteria 4695
71 Ga0070701_10010529 3300005438 Bacteria 4092
72 Ga0070705_100000653 3300005440 Bacteria 19834
73 Ga0070700_100003250 3300005441 Bacteria 8365
74 Ga0070700_100070391 3300005441 Bacteria 2230
75 Ga0070694_100005837 3300005444 Bacteria 7470
76 Ga0070694_100026932 3300005444 Bacteria 3730
77 Ga0070708_100040723 3300005445 Bacteria 4070
78 Ga0070663_100017890 3300005455 Bacteria 4633
79 Ga0070681_10013728 3300005458 Bacteria 8064
80 Ga0070706_100084799 3300005467 Bacteria 2935
81 Ga0070699_100002983 3300005518 Bacteria 15031
82 Ga0070679_100081207 3300005530 Bacteria 3231
83 Ga0068853_100012306 3300005539 Bacteria 6958
84 Ga0070695_100000696 3300005545 Bacteria 17958
85 Ga0070695_100006656 3300005545 Bacteria 6830
86 Ga0070695_100098065 3300005545 Bacteria 1969
87 Ga0070696_100000152 3300005546 Bacteria 38688
88 Ga0070696_100014427 3300005546 Bacteria 5300
89 Ga0070693_100036204 3300005547 Bacteria 2742
90 Ga0070665_100084715 3300005548 Bacteria 3175
91 Ga0070704_100000818 3300005549 Bacteria 15440
92 Ga0070704_100026853 3300005549 Bacteria 3810
93 Ga0070664_100102851 3300005564 Bacteria 2486
94 Ga0068857_100005016 3300005577 Bacteria 11252
95 Ga0068856_100092212 3300005614 Bacteria 3014
96 Ga0070702_100067281 3300005615 Bacteria 2104
97 Ga0068859_100010251 3300005617 Bacteria 9432
98 Ga0068864_100030022 3300005618 Bacteria 4608
99 Ga0068858_100137433 3300005842 Bacteria 2294
100 Ga0068860_100044151 3300005843 Bacteria 4249
101 Ga0068862_100509710 3300005844 Bacteria 1143
102 Ga0081540_1068695 3300005983 Bacteria 1649
103 Ga0070717_10125915 3300006028 Bacteria 2199
104 Ga0075365_10019730 3300006038 Bacteria 4168
105 Ga0075364_10006144 3300006051 Bacteria 7030
106 Ga0075364_10191378 3300006051 Bacteria 1386
107 Ga0075362_10000623 3300006177 Bacteria 10347
108 Ga0075362_10003295 3300006177 Bacteria 5618
109 Ga0075362_10057678 3300006177 Bacteria 1750
110 Ga0075367_10027235 3300006178 Bacteria 3250
111 Ga0075369_10002200 3300006186 Bacteria 6896
112 Ga0075369_10012031 3300006186 Bacteria 3413
113 Ga0075369_10054317 3300006186 Bacteria 1739
114 Ga0075369_10059328 3300006186 Bacteria 1667
115 Ga0075366_10006857 3300006195 Bacteria 6267
116 Ga0075370_10051004 3300006353 Bacteria 2347
117 Ga0068871_100122856 3300006358 Bacteria 2195
118 Ga0075430_100018717 3300006846 Bacteria 5895
119 Ga0075431_100001010 3300006847 Bacteria 25028
120 Ga0075436_100000192 3300006914 Bacteria 37698
121 Ga0097620_100010251 3300006931 Bacteria 9432
122 Ga0079104_1000032 3300006946 Bacteria 203094
123 Ga0079104_1001413 3300006946 Bacteria 16212
124 Ga0079104_1001771 3300006946 Bacteria 13574
125 Ga0099826_10000246 3300006948 Bacteria 23828
126 Ga0075435_100082558 3300007076 Bacteria 2641
127 Ga0105251_10062526 3300009011 Bacteria 1748
128 Ga0105244_10053958 3300009036 Bacteria 2041
129 Ga0105240_10000032 3300009093 Bacteria 283907
130 Ga0105240_10000287 3300009093 Bacteria 98443
131 Ga0105240_10002268 3300009093 Bacteria 31194
132 Ga0105245_10294754 3300009098 Bacteria 1590
133 Ga0105243_10018870 3300009148 Bacteria 5229
134 Ga0105243_10073231 3300009148 Bacteria 2775
135 Ga0105248_10113488 3300009177 Bacteria 3056
136 Ga0105248_10334639 3300009177 Bacteria 1705
137 Ga0105237_10001638 3300009545 Bacteria 29067
138 Ga0105237_10051510 3300009545 Bacteria 4135
139 Ga0105238_10002201 3300009551 Bacteria 19682
140 Ga0105249_10018572 3300009553 Bacteria 6189
141 Ga0123341_1000023 3300009765 Bacteria 75951
142 Ga0123341_1037023 3300009765 Bacteria 3348
143 Ga0123342_1023941 3300009766 Bacteria 3892
144 Ga0157373_10003634 3300013100 Bacteria 11653
145 Ga0157371_10000073 3300013102 Bacteria 163215
146 Ga0157371_10003149 3300013102 Bacteria 15210
147 Ga0157370_10000367 3300013104 Bacteria 56787
148 Ga0157370_10004276 3300013104 Bacteria 16446
149 Ga0157370_10251655 3300013104 Bacteria 1634
150 Ga0157369_10097785 3300013105 Bacteria 3131
151 Ga0171463_1001 3300013249 Bacteria 1406070
152 Ga0157378_10381705 3300013297 Bacteria 1384
153 Ga0157375_10092712 3300013308 Bacteria 3085
154 Ga0157379_10076380 3300014968 Bacteria 2999
155 Ga0182007_10000751 3300015262 Bacteria 18251
156 Ga0182005_1011106 3300015265 Bacteria 2575
157 Ga0182005_1011158 3300015265 Bacteria 2568
158 Ga0163161_10108871 3300017792 Bacteria 2069
159 Ga0163161_10254688 3300017792 Bacteria 1369
160 Ga0214542_1000006 3300021321 Bacteria 345164
161 Ga0214542_1019617 3300021321 Bacteria 5250
162 Ga0214543_1000003 3300021327 Bacteria 692327
163 Ga0214543_1000014 3300021327 Bacteria 324986
164 Ga0213876_10055260 3300021384 Bacteria 2096
165 Ga0213875_10000025 3300021388 Bacteria 197787
166 Ga0228711_1001210 3300022739 Bacteria 37182
167 Ga0228710_1002040 3300022740 Bacteria 31310
168 Ga0209435_100024 3300025206 Bacteria 199665
169 Ga0209436_100032 3300025208 Bacteria 80755
170 Ga0209436_100741 3300025208 Bacteria 13621
171 Ga0209437_100033 3300025233 Bacteria 512520
172 Ga0209437_100075 3300025233 Bacteria 297202
173 Ga0207425_1000031 3300025245 Bacteria 261181
174 Ga0207425_1002528 3300025245 Bacteria 6393
175 Ga0207425_1006216 3300025245 Bacteria 3291
176 Ga0207425_1012830 3300025245 Bacteria 1953
177 Ga0209646_1000064 3300025246 Bacteria 246524
178 Ga0209646_1003895 3300025246 Bacteria 2835
179 Ga0209026_1000053 3300025250 Bacteria 246524
180 Ga0209677_100251 3300025253 Bacteria 36562
181 Ga0209759_1000042 3300025256 Bacteria 246524
182 Ga0209129_1000053 3300025258 Bacteria 262823
183 Ga0209129_1000137 3300025258 Bacteria 123213
184 Ga0209129_1000321 3300025258 Bacteria 42440
185 Ga0209129_1004651 3300025258 Bacteria 5251
186 Ga0209129_1006501 3300025258 Bacteria 3754
187 Ga0209129_1022927 3300025258 Bacteria 1121
188 Ga0209129_1022931 3300025258 Bacteria 1121
189 Ga0209233_1000064 3300025261 Bacteria 392156
190 Ga0209233_1000223 3300025261 Bacteria 103765
191 Ga0209233_1000301 3300025261 Bacteria 59293
192 Ga0209673_1000041 3300025273 Bacteria 307397
193 Ga0209673_1000692 3300025273 Bacteria 48181
194 Ga0209673_1001599 3300025273 Bacteria 19964
195 Ga0209673_1002821 3300025273 Bacteria 11209
196 Ga0209673_1004149 3300025273 Bacteria 7927
197 Ga0209673_1005461 3300025273 Bacteria 6377
198 Ga0209130_1000006 3300025284 Bacteria 596528
199 Ga0209130_1000007 3300025284 Bacteria 591584
200 Ga0209130_1000018 3300025284 Bacteria 388301
201 Ga0209130_1003906 3300025284 Bacteria 5978
202 Ga0209676_1003826 3300025292 Bacteria 8863
203 Ga0209025_1000087 3300025294 Bacteria 261181
204 Ga0209025_1000149 3300025294 Bacteria 173393
205 Ga0209025_1000195 3300025294 Bacteria 148218
206 Ga0209025_1000199 3300025294 Bacteria 146058
207 Ga0209025_1001254 3300025294 Bacteria 35128
208 Ga0209025_1004423 3300025294 Bacteria 12218
209 Ga0209025_1005728 3300025294 Bacteria 9983
210 Ga0209025_1007065 3300025294 Bacteria 8499
211 Ga0209025_1024639 3300025294 Bacteria 3097
212 Ga0209025_1043027 3300025294 Bacteria 1910
213 Ga0209025_1050622 3300025294 Bacteria 1659
214 Ga0209564_1000330 3300025295 Bacteria 92033
215 Ga0209564_1000668 3300025295 Bacteria 50729
216 Ga0209564_1000689 3300025295 Bacteria 49634
217 Ga0209564_1002094 3300025295 Bacteria 17073
218 Ga0209564_1006711 3300025295 Bacteria 6117
219 Ga0209758_1000081 3300025297 Bacteria 261181
220 Ga0209758_1000333 3300025297 Bacteria 88318
221 Ga0209758_1000939 3300025297 Bacteria 39327
222 Ga0209758_1001333 3300025297 Bacteria 29905
223 Ga0209758_1001529 3300025297 Bacteria 26686
224 Ga0209758_1002147 3300025297 Bacteria 20766
225 Ga0209050_1005246 3300025298 Bacteria 8259
226 Ga0209050_1009022 3300025298 Bacteria 5191
227 Ga0209256_1000445 3300025299 Bacteria 63065
228 Ga0209256_1002049 3300025299 Bacteria 17886
229 Ga0209256_1002795 3300025299 Bacteria 13380
230 Ga0209256_1003247 3300025299 Bacteria 11690
231 Ga0209256_1003424 3300025299 Bacteria 11142
232 Ga0209256_1003505 3300025299 Bacteria 10937
233 Ga0209256_1006028 3300025299 Bacteria 6627
234 Ga0207426_1000044 3300025302 Bacteria 428043
235 Ga0207426_1000064 3300025302 Bacteria 358276
236 Ga0207426_1000106 3300025302 Bacteria 244368
237 Ga0207426_1000119 3300025302 Bacteria 221800
238 Ga0207426_1001660 3300025302 Bacteria 17296
239 Ga0209051_1000198 3300025303 Bacteria 106688
240 Ga0209051_1001187 3300025303 Bacteria 23555
241 Ga0209051_1006097 3300025303 Bacteria 6867
242 Ga0209051_1007393 3300025303 Bacteria 6011
243 Ga0209051_1052842 3300025303 Bacteria 1339
244 Ga0209051_1057895 3300025303 Bacteria 1239
245 Ga0209257_1001197 3300025304 Bacteria 32625
246 Ga0209257_1004359 3300025304 Bacteria 11026
247 Ga0209257_1005909 3300025304 Bacteria 8240
248 Ga0209257_1020380 3300025304 Bacteria 2453
249 Ga0207653_10004438 3300025885 Bacteria 4399
250 Ga0207647_10014660 3300025904 Bacteria 5400
251 Ga0207699_10074236 3300025906 Bacteria 2089
252 Ga0207695_10000024 3300025913 Bacteria 632311
253 Ga0207695_10003756 3300025913 Bacteria 21075
254 Ga0207652_10054040 3300025921 Bacteria 3452
255 Ga0207652_10136381 3300025921 Bacteria 2192
256 Ga0207650_10220266 3300025925 Bacteria 1527
257 Ga0207659_10284613 3300025926 Bacteria 1353
258 Ga0207664_10017769 3300025929 Bacteria 5224
259 Ga0207644_10073870 3300025931 Bacteria 2501
260 Ga0207706_10137357 3300025933 Bacteria 2151
261 Ga0207709_10028555 3300025935 Bacteria 3226
262 Ga0207669_10186988 3300025937 Bacteria 1490
263 Ga0207665_10010248 3300025939 Bacteria 6157
264 Ga0207711_10107918 3300025941 Bacteria 2472
265 Ga0207711_10145508 3300025941 Bacteria 2135
266 Ga0207689_10037982 3300025942 Bacteria 3990
267 Ga0207661_10130247 3300025944 Bacteria 2154
268 Ga0207651_10219877 3300025960 Bacteria 1535
269 Ga0207712_10010754 3300025961 Bacteria 5817
270 Ga0207668_10183134 3300025972 Bacteria 1654
271 Ga0207703_10187414 3300026035 Bacteria 1830
272 Ga0207703_10202689 3300026035 Bacteria 1764
273 Ga0207639_10013263 3300026041 Bacteria 5762
274 Ga0207678_10001597 3300026067 Bacteria 20859
275 Ga0207678_10077942 3300026067 Bacteria 2838
276 Ga0207678_10273964 3300026067 Bacteria 1448
277 Ga0207708_10002614 3300026075 Bacteria 13246
278 Ga0207702_10025463 3300026078 Bacteria 4910
279 Ga0207676_10007549 3300026095 Bacteria 7715
280 Ga0207674_10010738 3300026116 Bacteria 10337
281 Ga0207683_10086820 3300026121 Bacteria 2782
282 Ga0209281_1000053 3300027111 Bacteria 309587
283 Ga0209281_1000236 3300027111 Bacteria 113362
284 Ga0209281_1000666 3300027111 Bacteria 36327
285 Ga0209371_1000021 3300027312 Bacteria 555864
286 Ga0209371_1001000 3300027312 Bacteria 21692
287 Ga0209371_1002004 3300027312 Bacteria 12256
288 Ga0209282_1000022 3300027666 Bacteria 173388
289 Ga0209282_1019506 3300027666 Bacteria 4302
290 Ga0209813_10001495 3300027866 Bacteria 5255
291 Ga0268266_10072784 3300028379 Bacteria 2981
292 Ga0268266_10103119 3300028379 Bacteria 2517
293 Ga0268265_10000666 3300028380 Bacteria 34070
294 Ga0268264_10008316 3300028381 Bacteria 8626
295 Ga0307515_10000070 3300028794 Bacteria 239322
296 Ga0307515_10003358 3300028794 Bacteria 33776
297 Ga0307515_10031717 3300028794 Bacteria 8789
298 Ga0307515_10198518 3300028794 Bacteria 1890
299 Ga0268256_1000020 3300030500 Bacteria 557873
300 Ga0268256_1001752 3300030500 Bacteria 12256
301 Ga0268256_1003889 3300030500 Bacteria 6493
302 Ga0307513_10003448 3300031456 Bacteria 21410
303 Ga0307513_10038489 3300031456 Bacteria 5310
304 Ga0307408_100061695 3300031548 Bacteria 2737
305 Ga0307408_100141482 3300031548 Bacteria 1889
306 Ga0307405_10022442 3300031731 Bacteria 3569
307 Ga0307406_10075804 3300031901 Bacteria 2220
308 Ga0307406_10085988 3300031901 Bacteria 2104
309 Ga0307406_10333447 3300031901 Bacteria 1178
310 Ga0307412_10017364 3300031911 Bacteria 4307
311 Ga0307412_10340530 3300031911 Bacteria 1200
312 Ga0315914_1000027 3300031967 Bacteria 106536
313 Ga0307409_100090847 3300031995 Bacteria 2501
314 Ga0307416_100074867 3300032002 Bacteria 2831
315 Ga0315913_1000631 3300033430 Bacteria 33112
316 Ga0315915_1000001 3300033464 Bacteria 481518
317 Ga0373935_0019248 3300035692 Bacteria 4164
318 Ga0373927_0000284 3300035695 Bacteria 39864
319 Ga0316582_0087429 3300036647 Bacteria 2046
320 Ga0316584_0020033 3300036712 Bacteria 4844
321 Ga0395900_0358169 3300037418 Bacteria 1431
322 Ga0436364_1209910 3300037853 Bacteria 45322
323 Ga0436365_1347694 3300039437 Bacteria 4328
324 Ga0439436_0033487 3300041404 Bacteria 1488
325 Ga0439436_0034797 3300041404 Bacteria 1456
326 Ga0439453_0008879 3300041408 Bacteria 1625
327 Ga0439465_0015313 3300041413 Bacteria 2392
328 Ga0451798_0111375 3300041458 Bacteria 2300
329 Ga0451833_0094896 3300041491 Bacteria 1035
330 Ga0451835_0809115 3300041492 Bacteria 1127
331 Ga0451840_23403 3300041497 Bacteria 4518
332 Ga0451841_0711977 3300041498 Bacteria 2214
333 Ga0451841_0993646 3300041498 Bacteria 1014
334 Ga0451845_0762944 3300041501 Bacteria 1838
335 Ga0451851_0868710 3300041507 Bacteria 2859
336 Ga0439445_0005918 3300042004 Bacteria 2800
337 Ga0439449_0006656 3300042007 Bacteria 4418
338 Ga0439449_0012014 3300042007 Bacteria 3254
339 Ga0439449_0014578 3300042007 Bacteria 2954
340 Ga0450920_003028 3300042122 Bacteria 2899
341 Ga0450906_015182 3300042145 Bacteria 1401
342 Ga0439435_0003123 3300042436 Bacteria 3401
343 Ga0450918_007781 3300042531 Bacteria 1888
344 Ga0466966_0130349 3300044684 Bacteria 1540
345 Ga0451576_0136399 3300045051 Bacteria 2559
346 Ga0466967_0262483 3300045976 Bacteria 1653
347 Ga0495617_033008 3300046452 Bacteria 1738
348 Ga0495592_0102284 3300046454 Bacteria 2040
349 Ga0495603_0184963 3300046455 Bacteria 1205
350 Ga0495629_0021261 3300046459 Bacteria 4630
351 Ga0495638_0000345 3300046460 Bacteria 58430
352 Ga0495638_0062117 3300046460 Bacteria 2306
353 Ga0495638_0100193 3300046460 Bacteria 1734
354 Ga0495605_0001360 3300046474 Bacteria 16142
355 Ga0495605_0020751 3300046474 Bacteria 3489
356 Ga0495662_0039412 3300046476 Bacteria 2282
357 Ga0495585_0012568 3300046492 Bacteria 4988
358 Ga0495585_0034091 3300046492 Bacteria 2878
359 Ga0495585_0163856 3300046492 Bacteria 1152
360 Ga0495583_0003514 3300046506 Bacteria 11849
361 Ga0495606_0002521 3300046507 Bacteria 21081
362 Ga0495606_0030969 3300046507 Bacteria 3726
363 Ga0495606_0093417 3300046507 Bacteria 1845
364 Ga0495606_0115906 3300046507 Bacteria 1610
365 Ga0495610_0002413 3300046512 Bacteria 15738
366 Ga0495610_0010234 3300046512 Bacteria 5847
367 Ga0495610_0048501 3300046512 Bacteria 2084
368 Ga0495616_0030109 3300046513 Bacteria 2856
369 Ga0495620_0007040 3300046515 Bacteria 6134
370 Ga0495620_0042426 3300046515 Bacteria 1987
371 Ga0495628_0106966 3300046516 Bacteria 2154
372 Ga0495631_0001592 3300046518 Bacteria 13626
373 Ga0495631_0005243 3300046518 Bacteria 6818
374 Ga0495632_0003502 3300046519 Bacteria 11105
375 Ga0495632_0045724 3300046519 Bacteria 2179
376 Ga0495632_0096029 3300046519 Bacteria 1400
377 Ga0495643_0023240 3300046522 Bacteria 3526
378 Ga0495644_0030282 3300046523 Bacteria 2044
379 Ga0495654_0001395 3300046530 Bacteria 16737
380 Ga0495654_0030158 3300046530 Bacteria 2761
381 Ga0495654_0058357 3300046530 Bacteria 1862
382 Ga0495609_0012341 3300046538 Bacteria 4053
383 Ga0495597_0005942 3300046542 Bacteria 6369
384 Ga0495633_0032933 3300046558 Bacteria 2501
385 Ga0495656_0024072 3300046615 Bacteria 2401
386 Ga0495656_0072706 3300046615 Bacteria 1531
387 Ga0495668_0004221 3300046616 Bacteria 10345
388 Ga0495668_0024399 3300046616 Bacteria 3439
389 Ga0495668_0064377 3300046616 Bacteria 2018
390 Ga0495668_0136775 3300046616 Bacteria 1341
391 Ga0495634_0146090 3300046642 Bacteria 1498
392 Ga0495625_0001088 3300046660 Bacteria 35282
393 Ga0495625_0028080 3300046660 Bacteria 4223
394 Ga0495625_0177471 3300046660 Bacteria 1419
395 Ga0495635_0024640 3300046663 Bacteria 4193
396 Ga0495661_0022101 3300046665 Bacteria 4141
397 Ga0495661_0095362 3300046665 Bacteria 1685
398 Ga0495588_0001683 3300046674 Bacteria 9419
399 Ga0495588_0049618 3300046674 Bacteria 2159
400 Ga0495588_0107862 3300046674 Bacteria 1466
401 Ga0495657_0017756 3300046675 Bacteria 5162
402 Ga0495670_0044353 3300046691 Bacteria 2220
403 Ga0495670_0068014 3300046691 Bacteria 1799
404 Ga0495649_0012099 3300046694 Bacteria 5036
405 Ga0495660_0016163 3300046810 Bacteria 4304
406 Ga0495660_0171806 3300046810 Bacteria 1055
407 Ga0495676_0263535 3300047321 Bacteria 1172
408 Ga0495685_050219 3300047447 Bacteria 1416
409 Ga0495681_0005856 3300047470 Bacteria 8164
410 Ga0495686_0001186 3300047472 Bacteria 30396
411 Ga0495686_0008846 3300047472 Bacteria 7330
412 Ga0495686_0079054 3300047472 Bacteria 2012
413 Ga0496100_0028459 3300048903 Bacteria 3447
414 Ga0496101_0029660 3300048904 Bacteria 3827
415 Ga0496102_0016475 3300048905 Bacteria 6459
416 Ga0496102_0099255 3300048905 Bacteria 2702
417 Ga0496102_0285997 3300048905 Bacteria 1554
418 Ga0496103_0010271 3300048906 Bacteria 5536
419 Ga0496103_0020844 3300048906 Bacteria 3941
420 Ga0496104_0000206 3300048907 Bacteria 52627
421 Ga0496105_0146951 3300048908 Bacteria 1938
422 Ga0496105_0149665 3300048908 Bacteria 1919
423 Ga0496106_0000131 3300048909 Bacteria 56905
424 Ga0496106_0008447 3300048909 Bacteria 7619
425 Ga0496106_0070826 3300048909 Bacteria 2663
426 Ga0496107_0002446 3300048910 Bacteria 12041
427 Ga0496107_0017994 3300048910 Bacteria 4972
428 Ga0496108_0254874 3300048911 Bacteria 1527
429 Ga0496110_0078769 3300048913 Bacteria 2934
430 Ga0496111_0002760 3300048914 Bacteria 10681
431 Ga0496114_0032152 3300048917 Bacteria 4318
432 Ga0496114_0185003 3300048917 Bacteria 1820
433 Ga0496116_0000036 3300048919 Bacteria 388508
434 Ga0496116_0014290 3300048919 Bacteria 6350
435 Ga0496116_0041974 3300048919 Bacteria 3132
436 Ga0496116_0057118 3300048919 Bacteria 2553
437 Ga0496116_0078008 3300048919 Bacteria 2067
438 Ga0496116_0173581 3300048919 Bacteria 1164
439 Ga0496117_0000002 3300048920 Bacteria 2483758
440 Ga0496117_0001755 3300048920 Bacteria 29822
441 Ga0496117_0005544 3300048920 Bacteria 13212
442 Ga0496117_0064375 3300048920 Bacteria 2500
443 Ga0496117_0099511 3300048920 Bacteria 1844
444 Ga0496117_0182810 3300048920 Bacteria 1203
445 Ga0496118_0000245 3300048921 Bacteria 96235
446 Ga0496118_0002030 3300048921 Bacteria 28629
447 Ga0496118_0018801 3300048921 Bacteria 6205
448 Ga0496118_0033169 3300048921 Bacteria 4242
449 Ga0496118_0040343 3300048921 Bacteria 3713
450 Ga0496119_0012473 3300048922 Bacteria 6896
451 Ga0496119_0060959 3300048922 Bacteria 2255
452 Ga0496120_0003652 3300048923 Bacteria 13790
453 Ga0496120_0005743 3300048923 Bacteria 9762
454 Ga0496120_0071949 3300048923 Bacteria 1896
455 Ga0496121_0000001 3300048924 Bacteria 1830318
456 Ga0496121_0001362 3300048924 Bacteria 41630
457 Ga0496121_0002297 3300048924 Bacteria 29664
458 Ga0496121_0004948 3300048924 Bacteria 17475
459 Ga0496121_0026655 3300048924 Bacteria 5435
460 Ga0496121_0039654 3300048924 Bacteria 4145
461 Ga0496121_0116302 3300048924 Bacteria 2028
462 Ga0496121_0289889 3300048924 Bacteria 1116
463 Ga0496122_0000001 3300048925 Bacteria 1827766
464 Ga0496122_0001240 3300048925 Bacteria 43048
465 Ga0496122_0021829 3300048925 Bacteria 5713
466 Ga0496122_0031679 3300048925 Bacteria 4392
467 Ga0496122_0055344 3300048925 Bacteria 2969
468 Ga0496122_0073151 3300048925 Bacteria 2432
469 Ga0496122_0117736 3300048925 Bacteria 1724
470 Ga0496123_0000001 3300048926 Bacteria 1831497
471 Ga0496123_0009901 3300048926 Bacteria 8506
472 Ga0496123_0010973 3300048926 Bacteria 7924
473 Ga0496123_0035684 3300048926 Bacteria 3539
474 Ga0496124_0003293 3300048927 Bacteria 19911
475 Ga0496124_0010499 3300048927 Bacteria 9370
476 Ga0496124_0012884 3300048927 Bacteria 8210
477 Ga0496124_0014751 3300048927 Bacteria 7540
478 Ga0496124_0019653 3300048927 Bacteria 6275
479 Ga0496124_0033232 3300048927 Bacteria 4539
480 Ga0496124_0053944 3300048927 Bacteria 3404
481 Ga0496124_0312433 3300048927 Bacteria 1129
482 Ga0496124_0388263 3300048927 Bacteria 973
483 Ga0496125_0000001 3300048928 Bacteria 1766138
484 Ga0496125_0000372 3300048928 Bacteria 84272
485 Ga0496125_0007106 3300048928 Bacteria 11951
486 Ga0496125_0008057 3300048928 Bacteria 11119
487 Ga0496125_0038081 3300048928 Bacteria 4169
488 Ga0496125_0299753 3300048928 Bacteria 985
489 Ga0496126_0000156 3300048929 Bacteria 158537
490 Ga0496126_0033319 3300048929 Bacteria 4847
491 Ga0496126_0136908 3300048929 Bacteria 2111
492 Ga0501031_0031646 3300049568 Bacteria 3451
493 Ga0501031_0040766 3300049568 Bacteria 3031
494 Ga0501032_0061225 3300049569 Bacteria 2523
495 Ga0501032_0162324 3300049569 Bacteria 1467
496 Ga0501033_0103709 3300049570 Bacteria 2074
497 Ga0501034_0015883 3300049571 Bacteria 7731
498 Ga0501034_0058603 3300049571 Bacteria 3870
499 Ga0501034_0108137 3300049571 Bacteria 2772
500 Ga0501034_0191926 3300049571 Bacteria 2004
501 Ga0501036_0096502 3300049572 Bacteria 2499
502 Ga0501037_0070315 3300049573 Bacteria 2547
503 Ga0501038_0096666 3300049574 Bacteria 2465
504 Ga0501039_0031973 3300049575 Bacteria 4057
505 Ga0501042_0212001 3300049578 Bacteria 1397
506 Ga0501043_0032530 3300049579 Bacteria 4101
507 Ga0501043_0102136 3300049579 Bacteria 2254
508 Ga0501047_0043731 3300049581 Bacteria 4327
509 Ga0501047_0150795 3300049581 Bacteria 2201
510 Ga0501047_0232703 3300049581 Bacteria 1695
511 Ga0501047_0302897 3300049581 Bacteria 1440
512 Ga0501048_0047307 3300049582 Bacteria 3069
513 Ga0501048_0254611 3300049582 Bacteria 1247
514 Ga0501067_0055512 3300049583 Bacteria 2195
515 Ga0501068_0211263 3300049584 Bacteria 1232
516 Ga0501069_0017084 3300049585 Bacteria 3901
517 Ga0501069_0046480 3300049585 Bacteria 2408
518 Ga0501069_0155426 3300049585 Bacteria 1315
519 Ga0501070_0007975 3300049586 Bacteria 8970
520 Ga0501070_0065280 3300049586 Bacteria 3013
521 Ga0501070_0131503 3300049586 Bacteria 2067
522 Ga0501070_0140797 3300049586 Bacteria 1991
523 Ga0501071_0031091 3300049587 Bacteria 3782
524 Ga0501073_0022827 3300049589 Bacteria 4500
525 Ga0501073_0027826 3300049589 Bacteria 4040
526 Ga0501073_0032875 3300049589 Bacteria 3696
527 Ga0501073_0115636 3300049589 Bacteria 1859
528 Ga0501074_0088466 3300049590 Bacteria 2218
529 Ga0501074_0090168 3300049590 Bacteria 2195
530 Ga0501074_0103468 3300049590 Bacteria 2038
531 Ga0501076_0088269 3300049592 Bacteria 2492
532 Ga0501079_0015885 3300049741 Bacteria 5754
533 Ga0501080_0158944 3300049742 Bacteria 2087
534 Ga0501080_0387180 3300049742 Bacteria 1259
535 Ga0501083_0018433 3300049744 Bacteria 4864
536 Ga0501280_004688 3300049776 Bacteria 1992
537 Ga0501035_0004051 3300049822 Bacteria 13958
538 Ga0501044_0016990 3300049823 Bacteria 7808
539 Ga0501044_0057433 3300049823 Bacteria 3993
540 Ga0501044_0155713 3300049823 Bacteria 2264
541 Ga0501044_0299598 3300049823 Bacteria 1537
542 Ga0501045_0013776 3300049824 Bacteria 5717
543 nmdc:mga03683_47168_c1 3300050489 Bacteria 1787
544 nmdc:mga03683_9527_c1 3300050489 Bacteria 3459
545 nmdc:mga03n38_42047_c1 3300050490 Bacteria 1995
546 nmdc:mga03n38_98627_c1 3300050490 Bacteria 1406
547 nmdc:mga00v17_1229_c1 3300050491 Bacteria 13446
548 nmdc:mga00v17_5147_c1 3300050491 Bacteria 6877
549 nmdc:mga0yw44_432_c1 3300050492 Bacteria 14715
550 nmdc:mga0yw44_48751_c1 3300050492 Bacteria 2554
551 nmdc:mga0yw44_7190_c1 3300050492 Bacteria 5454
552 nmdc:mga0k408_572_c1 3300050493 Bacteria 20327
553 nmdc:mga06z11_21852_c1 3300050494 Bacteria 2979
554 nmdc:mga06z11_23069_c1 3300050494 Bacteria 2917
555 nmdc:mga04h51_112076_c1 3300050495 Bacteria 1007
556 nmdc:mga05p37_107567_c1 3300050507 Bacteria 3431
557 nmdc:mga0qj67_2103_c1 3300050509 Bacteria 14183
558 nmdc:mga06r32_7619_c1 3300050510 Bacteria 9735
559 nmdc:mga08y16_33378_c1 3300050511 Bacteria 5405
560 nmdc:mga0rr50_38609_c1 3300050513 Bacteria 3457
561 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
562 nmdc:mga08x19_345343_c1 3300050514 Bacteria 1038
563 nmdc:mga0sz30_1101_c1 3300050516 Bacteria 9705
564 nmdc:mga0sz30_29169_c1 3300050516 Bacteria 2273
565 nmdc:mga0sz30_3155_c1 3300050516 Bacteria 5900
566 nmdc:mga0sz30_7817_c1 3300050516 Bacteria 4020
567 Ga0500557_057290 3300053105 Bacteria 1260
568 Ga0500560_023531 3300053107 Bacteria 1787
569 Ga0500562_001480 3300053108 Bacteria 5789
570 Ga0500618_000219 3300053125 Bacteria 45126
571 Ga0500658_0002169 3300053134 Bacteria 7627
572 Ga0500561_0000395 3300053137 Bacteria 7211
573 Ga0500568_0001538 3300053139 Bacteria 14675
574 Ga0500568_0009665 3300053139 Bacteria 4567
575 Ga0500573_0000489 3300053140 Bacteria 17073
576 Ga0500588_0081120 3300053146 Bacteria 1085
577 Ga0500616_0000744 3300053153 Bacteria 37551
578 Ga0500616_0001288 3300053153 Bacteria 24938
579 Ga0500616_0054232 3300053153 Bacteria 2100
580 Ga0500622_0000338 3300053156 Bacteria 46041
581 Ga0500624_000280 3300053157 Bacteria 17619
582 Ga0500634_0000567 3300053161 Bacteria 12240
583 Ga0500636_0000118 3300053177 Bacteria 41422
584 Ga0500636_0127242 3300053177 Bacteria 1423
585 Ga0500645_019310 3300053730 Bacteria 2121
586 Ga0501084_0040029 3300054114 Bacteria 3920
587 Ga0587090_008423 3300059510 Bacteria 1383
588 Ga0501082_0128360 3300060353 Bacteria 2200

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2906354277 2906357254 282
2 3300013297 Ga0157378_10381705 Ga0157378_103817052 284
3 3300050492 nmdc:mga0yw44_48751_c1 nmdc:mga0yw44_48751_c1_330_1307 297
4 3300048905 Ga0496102_0285997 Ga0496102_0285997_389_1285 298
5 3300049585 Ga0501069_0046480 Ga0501069_0046480_1380_2276 298
6 3300049822 Ga0501035_0004051 Ga0501035_0004051_5645_6541 298
7 3300046454 Ga0495592_0102284 Ga0495592_0102284_86_988 300
8 3300037418 Ga0395900_0358169 Ga0395900_0358169_125_1030 301
9 3300046474 Ga0495605_0020751 Ga0495605_0020751_202_1107 301
10 3300046507 Ga0495606_0030969 Ga0495606_0030969_192_1097 301
11 3300046512 Ga0495610_0048501 Ga0495610_0048501_864_1769 301
12 3300046513 Ga0495616_0030109 Ga0495616_0030109_958_1863 301
13 3300046515 Ga0495620_0007040 Ga0495620_0007040_4424_5329 301
14 3300046519 Ga0495632_0003502 Ga0495632_0003502_1416_2321 301
15 3300046519 Ga0495632_0045724 Ga0495632_0045724_728_1633 301
16 3300046523 Ga0495644_0030282 Ga0495644_0030282_368_1273 301
17 3300046530 Ga0495654_0058357 Ga0495654_0058357_686_1591 301
18 3300046542 Ga0495597_0005942 Ga0495597_0005942_4982_5887 301
19 3300046616 Ga0495668_0064377 Ga0495668_0064377_250_1155 301
20 3300046660 Ga0495625_0028080 Ga0495625_0028080_823_1728 301
21 3300046810 Ga0495660_0016163 Ga0495660_0016163_61_966 301
22 3300047447 Ga0495685_050219 Ga0495685_050219_252_1157 301
23 3300047472 Ga0495686_0008846 Ga0495686_0008846_5699_6604 301
24 3300048928 Ga0496125_0299753 Ga0496125_0299753_69_974 301
25 3300050495 nmdc:mga04h51_112076_c1 nmdc:mga04h51_112076_c1_92_997 301
26 3300053134 Ga0500658_0002169 Ga0500658_0002169_2641_3546 301
27 3300053153 Ga0500616_0054232 Ga0500616_0054232_117_1022 301
28 iso_pu_bacteria 2524023209 2524460566 302
29 iso_pu_bacteria 2582581298 2585221077 302
30 iso_pu_bacteria 2585427529 2585549279 302
31 iso_pu_bacteria 2838022645 2838023056 302
32 iso_pu_bacteria 2838668709 2838670936 302
33 iso_pu_bacteria 2838701080 2838703307 302
34 iso_pu_bacteria 2841864319 2841865382 302
35 iso_pu_bacteria 2842110456 2842115063 302
36 iso_pu_bacteria 2842146304 2842147469 302
37 iso_pu_bacteria 2842192696 2842197481 302
38 iso_pu_bacteria 2842198810 2842199484 302
39 iso_pu_bacteria 2842205361 2842210000 302
40 iso_pu_bacteria 2842217011 2842221289 302
41 iso_pu_bacteria 2842250916 2842252535 302
42 iso_pu_bacteria 2842278818 2842283454 302
43 iso_pu_bacteria 2842285085 2842287040 302
44 iso_pu_bacteria 2842317721 2842318563 302
45 iso_pu_bacteria 2842341865 2842343509 302
46 iso_pu_bacteria 2842363717 2842365335 302
47 iso_pu_bacteria 2842395702 2842398163 302
48 iso_pu_bacteria 2842402390 2842404308 302
49 iso_pu_bacteria 2842409023 2842411007 302
50 iso_pu_bacteria 2842415677 2842417537 302
51 iso_pu_bacteria 2842489311 2842493846 302
52 iso_pu_bacteria 2842495871 2842497198 302
53 iso_pu_bacteria 2842922631 2842924898 302
54 iso_pu_bacteria 2857516855 2857521490 302
55 iso_pu_bacteria 2899803654 2899803873 302
56 iso_pu_bacteria 2913308742 2913310871 302
57 iso_pu_bacteria 2919100787 2919103912 302
58 iso_pu_bacteria 2923556063 2923557484 302
59 iso_pu_bacteria 2996887358 2996888769 302
60 iso_pu_bacteria 8005258706 8005260042 302
61 iso_pu_bacteria 8005321885 8005323296 302
62 3300002773 JGI25152J39213_1004023 JGI25152J39213_10040236 306
63 3300002773 JGI25152J39213_1004196 JGI25152J39213_10041965 306
64 3300003215 JGI25153J46596_10023192 JGI25153J46596_100231922 306
65 3300003771 Ga0055526_1002478 Ga0055526_10024786 306
66 3300003775 Ga0055524_1001845 Ga0055524_10018454 306
67 3300003790 Ga0055528_1001416 Ga0055528_10014165 306
68 3300003792 Ga0055540_1002752 Ga0055540_10027529 306
69 3300003792 Ga0055540_1004045 Ga0055540_10040456 306
70 3300003856 Ga0058692_1008587 Ga0058692_10085871 306
71 3300005331 Ga0070670_100219186 Ga0070670_1002191862 306
72 3300005335 Ga0070666_10108247 Ga0070666_101082472 306
73 3300005339 Ga0070660_100067342 Ga0070660_1000673421 306
74 3300005355 Ga0070671_100044993 Ga0070671_1000449935 306
75 3300006186 Ga0075369_10059328 Ga0075369_100593282 306
76 3300009011 Ga0105251_10062526 Ga0105251_100625262 306
77 3300009177 Ga0105248_10113488 Ga0105248_101134882 306
78 3300009545 Ga0105237_10001638 Ga0105237_100016386 306
79 3300009765 Ga0123341_1000023 Ga0123341_100002350 306
80 3300009765 Ga0123341_1037023 Ga0123341_10370234 306
81 3300009766 Ga0123342_1023941 Ga0123342_10239412 306
82 3300013102 Ga0157371_10000073 Ga0157371_1000007384 306
83 3300013104 Ga0157370_10004276 Ga0157370_1000427612 306
84 3300015265 Ga0182005_1011106 Ga0182005_10111062 306
85 3300025245 Ga0207425_1012830 Ga0207425_10128302 306
86 3300025258 Ga0209129_1000137 Ga0209129_100013770 306
87 3300025258 Ga0209129_1000321 Ga0209129_100032131 306
88 3300025258 Ga0209129_1004651 Ga0209129_10046513 306
89 3300025273 Ga0209673_1000041 Ga0209673_1000041158 306
90 3300025273 Ga0209673_1004149 Ga0209673_10041496 306
91 3300025284 Ga0209130_1003906 Ga0209130_10039062 306
92 3300025294 Ga0209025_1005728 Ga0209025_10057281 306
93 3300025294 Ga0209025_1024639 Ga0209025_10246394 306
94 3300025295 Ga0209564_1006711 Ga0209564_10067115 306
95 3300025299 Ga0209256_1003247 Ga0209256_10032477 306
96 3300025299 Ga0209256_1006028 Ga0209256_10060286 306
97 3300025302 Ga0207426_1000106 Ga0207426_100010633 306
98 3300025302 Ga0207426_1001660 Ga0207426_100166015 306
99 3300025303 Ga0209051_1007393 Ga0209051_10073936 306
100 3300025303 Ga0209051_1052842 Ga0209051_10528421 306
101 3300025925 Ga0207650_10220266 Ga0207650_102202662 306
102 3300025931 Ga0207644_10073870 Ga0207644_100738702 306
103 3300025941 Ga0207711_10107918 Ga0207711_101079183 306
104 3300026067 Ga0207678_10273964 Ga0207678_102739642 306
105 3300041404 Ga0439436_0034797 Ga0439436_0034797_521_1441 306
106 3300041491 Ga0451833_0094896 Ga0451833_0094896_13_933 306
107 3300041498 Ga0451841_0993646 Ga0451841_0993646_13_933 306
108 3300042004 Ga0439445_0005918 Ga0439445_0005918_878_1798 306
109 3300042007 Ga0439449_0014578 Ga0439449_0014578_1988_2908 306
110 3300042145 Ga0450906_015182 Ga0450906_015182_336_1256 306
111 3300046452 Ga0495617_033008 Ga0495617_033008_108_1028 306
112 3300046455 Ga0495603_0184963 Ga0495603_0184963_164_1084 306
113 3300046459 Ga0495629_0021261 Ga0495629_0021261_749_1669 306
114 3300046460 Ga0495638_0000345 Ga0495638_0000345_10815_11735 306
115 3300046474 Ga0495605_0001360 Ga0495605_0001360_2357_3277 306
116 3300046476 Ga0495662_0039412 Ga0495662_0039412_560_1480 306
117 3300046492 Ga0495585_0012568 Ga0495585_0012568_93_1013 306
118 3300046492 Ga0495585_0034091 Ga0495585_0034091_505_1425 306
119 3300046492 Ga0495585_0163856 Ga0495585_0163856_194_1114 306
120 3300046506 Ga0495583_0003514 Ga0495583_0003514_6194_7114 306
121 3300046512 Ga0495610_0002413 Ga0495610_0002413_9625_10545 306
122 3300046512 Ga0495610_0010234 Ga0495610_0010234_3089_4009 306
123 3300046515 Ga0495620_0042426 Ga0495620_0042426_943_1863 306
124 3300046516 Ga0495628_0106966 Ga0495628_0106966_803_1723 306
125 3300046518 Ga0495631_0001592 Ga0495631_0001592_10684_11604 306
126 3300046522 Ga0495643_0023240 Ga0495643_0023240_2166_3086 306
127 3300046530 Ga0495654_0001395 Ga0495654_0001395_3660_4580 306
128 3300046530 Ga0495654_0030158 Ga0495654_0030158_851_1771 306
129 3300046538 Ga0495609_0012341 Ga0495609_0012341_156_1076 306
130 3300046615 Ga0495656_0024072 Ga0495656_0024072_312_1232 306
131 3300046616 Ga0495668_0004221 Ga0495668_0004221_3494_4414 306
132 3300046616 Ga0495668_0136775 Ga0495668_0136775_259_1179 306
133 3300046642 Ga0495634_0146090 Ga0495634_0146090_498_1418 306
134 3300046660 Ga0495625_0001088 Ga0495625_0001088_31049_31969 306
135 3300046660 Ga0495625_0177471 Ga0495625_0177471_154_1074 306
136 3300046663 Ga0495635_0024640 Ga0495635_0024640_2462_3382 306
137 3300046665 Ga0495661_0095362 Ga0495661_0095362_692_1612 306
138 3300046674 Ga0495588_0001683 Ga0495588_0001683_4399_5319 306
139 3300046674 Ga0495588_0107862 Ga0495588_0107862_220_1140 306
140 3300046675 Ga0495657_0017756 Ga0495657_0017756_3492_4412 306
141 3300046691 Ga0495670_0068014 Ga0495670_0068014_530_1450 306
142 3300046694 Ga0495649_0012099 Ga0495649_0012099_368_1288 306
143 3300046810 Ga0495660_0171806 Ga0495660_0171806_108_1028 306
144 3300047321 Ga0495676_0263535 Ga0495676_0263535_71_991 306
145 3300047470 Ga0495681_0005856 Ga0495681_0005856_4506_5426 306
146 3300047472 Ga0495686_0079054 Ga0495686_0079054_289_1209 306
147 3300048904 Ga0496101_0029660 Ga0496101_0029660_702_1622 306
148 3300048913 Ga0496110_0078769 Ga0496110_0078769_1760_2680 306
149 3300048914 Ga0496111_0002760 Ga0496111_0002760_5003_5923 306
150 3300048919 Ga0496116_0014290 Ga0496116_0014290_2030_2950 306
151 3300048919 Ga0496116_0041974 Ga0496116_0041974_2165_3085 306
152 3300048919 Ga0496116_0057118 Ga0496116_0057118_1545_2465 306
153 3300048919 Ga0496116_0078008 Ga0496116_0078008_718_1638 306
154 3300048919 Ga0496116_0173581 Ga0496116_0173581_48_968 306
155 3300048920 Ga0496117_0000002 Ga0496117_0000002_1401427_1402347 306
156 3300048920 Ga0496117_0001755 Ga0496117_0001755_20532_21452 306
157 3300048920 Ga0496117_0005544 Ga0496117_0005544_10474_11394 306
158 3300048920 Ga0496117_0064375 Ga0496117_0064375_1451_2371 306
159 3300048920 Ga0496117_0182810 Ga0496117_0182810_154_1074 306
160 3300048921 Ga0496118_0000245 Ga0496118_0000245_68495_69415 306
161 3300048921 Ga0496118_0002030 Ga0496118_0002030_7013_7933 306
162 3300048921 Ga0496118_0018801 Ga0496118_0018801_137_1057 306
163 3300048921 Ga0496118_0033169 Ga0496118_0033169_2728_3648 306
164 3300048921 Ga0496118_0040343 Ga0496118_0040343_2068_2988 306
165 3300048922 Ga0496119_0012473 Ga0496119_0012473_2699_3619 306
166 3300048922 Ga0496119_0060959 Ga0496119_0060959_767_1687 306
167 3300048923 Ga0496120_0003652 Ga0496120_0003652_11896_12816 306
168 3300048923 Ga0496120_0005743 Ga0496120_0005743_4717_5637 306
169 3300048924 Ga0496121_0001362 Ga0496121_0001362_23970_24890 306
170 3300048924 Ga0496121_0026655 Ga0496121_0026655_2133_3053 306
171 3300048924 Ga0496121_0116302 Ga0496121_0116302_979_1899 306
172 3300048924 Ga0496121_0289889 Ga0496121_0289889_130_1050 306
173 3300048925 Ga0496122_0000001 Ga0496122_0000001_772217_773137 306
174 3300048925 Ga0496122_0021829 Ga0496122_0021829_3725_4645 306
175 3300048925 Ga0496122_0031679 Ga0496122_0031679_1335_2255 306
176 3300048925 Ga0496122_0055344 Ga0496122_0055344_1000_1920 306
177 3300048926 Ga0496123_0000001 Ga0496123_0000001_775948_776868 306
178 3300048926 Ga0496123_0010973 Ga0496123_0010973_3607_4527 306
179 3300048926 Ga0496123_0035684 Ga0496123_0035684_2138_3058 306
180 3300048927 Ga0496124_0010499 Ga0496124_0010499_6739_7659 306
181 3300048927 Ga0496124_0012884 Ga0496124_0012884_33_953 306
182 3300048927 Ga0496124_0014751 Ga0496124_0014751_5278_6198 306
183 3300048927 Ga0496124_0033232 Ga0496124_0033232_2383_3303 306
184 3300048927 Ga0496124_0053944 Ga0496124_0053944_2398_3318 306
185 3300048927 Ga0496124_0312433 Ga0496124_0312433_123_1043 306
186 3300048927 Ga0496124_0388263 Ga0496124_0388263_34_954 306
187 3300048928 Ga0496125_0007106 Ga0496125_0007106_6297_7217 306
188 3300048928 Ga0496125_0008057 Ga0496125_0008057_1851_2771 306
189 3300048929 Ga0496126_0136908 Ga0496126_0136908_718_1638 306
190 3300049581 Ga0501047_0302897 Ga0501047_0302897_492_1412 306
191 3300049742 Ga0501080_0387180 Ga0501080_0387180_44_964 306
192 3300049776 Ga0501280_004688 Ga0501280_004688_610_1530 306
193 3300050489 nmdc:mga03683_47168_c1 nmdc:mga03683_47168_c1_631_1551 306
194 3300050490 nmdc:mga03n38_42047_c1 nmdc:mga03n38_42047_c1_88_1008 306
195 3300050490 nmdc:mga03n38_98627_c1 nmdc:mga03n38_98627_c1_156_1076 306
196 3300050491 nmdc:mga00v17_1229_c1 nmdc:mga00v17_1229_c1_1292_2212 306
197 3300050492 nmdc:mga0yw44_432_c1 nmdc:mga0yw44_432_c1_9974_10894 306
198 3300050493 nmdc:mga0k408_572_c1 nmdc:mga0k408_572_c1_10839_11759 306
199 3300050494 nmdc:mga06z11_23069_c1 nmdc:mga06z11_23069_c1_1826_2746 306
200 3300050516 nmdc:mga0sz30_1101_c1 nmdc:mga0sz30_1101_c1_8748_9668 306
201 3300050516 nmdc:mga0sz30_29169_c1 nmdc:mga0sz30_29169_c1_1099_2019 306
202 3300050516 nmdc:mga0sz30_3155_c1 nmdc:mga0sz30_3155_c1_4727_5647 306
203 3300050516 nmdc:mga0sz30_7817_c1 nmdc:mga0sz30_7817_c1_3020_3940 306
204 3300053105 Ga0500557_057290 Ga0500557_057290_64_984 306
205 3300053107 Ga0500560_023531 Ga0500560_023531_841_1761 306
206 3300053125 Ga0500618_000219 Ga0500618_000219_12037_12957 306
207 3300053137 Ga0500561_0000395 Ga0500561_0000395_1556_2476 306
208 3300053139 Ga0500568_0001538 Ga0500568_0001538_3332_4252 306
209 3300053146 Ga0500588_0081120 Ga0500588_0081120_56_976 306
210 3300053153 Ga0500616_0000744 Ga0500616_0000744_10268_11188 306
211 3300053156 Ga0500622_0000338 Ga0500622_0000338_9373_10293 306
212 3300053157 Ga0500624_000280 Ga0500624_000280_13908_14828 306
213 3300053177 Ga0500636_0127242 Ga0500636_0127242_134_1054 306
214 3300025944 Ga0207661_10130247 Ga0207661_101302472 307
215 3300036712 Ga0316584_0020033 Ga0316584_0020033_1600_2523 307
216 3300049571 Ga0501034_0191926 Ga0501034_0191926_746_1669 307
217 3300049581 Ga0501047_0232703 Ga0501047_0232703_27_950 307
218 3300049582 Ga0501048_0047307 Ga0501048_0047307_1208_2131 307
219 3300049823 Ga0501044_0155713 Ga0501044_0155713_27_950 307
220 3300049824 Ga0501045_0013776 Ga0501045_0013776_883_1806 307
221 3300054114 Ga0501084_0040029 Ga0501084_0040029_1140_2063 307
222 3300009093 Ga0105240_10000287 Ga0105240_1000028791 310
223 iso_pu_bacteria 2967699805 2967702155 310
224 3300009098 Ga0105245_10294754 Ga0105245_102947542 311
225 3300009148 Ga0105243_10073231 Ga0105243_100732312 311
226 3300009545 Ga0105237_10051510 Ga0105237_100515103 311
227 3300009551 Ga0105238_10002201 Ga0105238_1000220115 311
228 3300013308 Ga0157375_10092712 Ga0157375_100927123 311
229 3300014968 Ga0157379_10076380 Ga0157379_100763804 311
230 3300048903 Ga0496100_0028459 Ga0496100_0028459_1500_2435 311
231 3300048905 Ga0496102_0099255 Ga0496102_0099255_148_1083 311
232 3300048906 Ga0496103_0010271 Ga0496103_0010271_1141_2076 311
233 3300048909 Ga0496106_0070826 Ga0496106_0070826_321_1256 311
234 3300048910 Ga0496107_0017994 Ga0496107_0017994_1525_2460 311
235 3300048917 Ga0496114_0185003 Ga0496114_0185003_677_1612 311
236 3300046460 Ga0495638_0100193 Ga0495638_0100193_614_1561 315
237 3300053108 Ga0500562_001480 Ga0500562_001480_4570_5517 315
238 3300053153 Ga0500616_0001288 Ga0500616_0001288_9923_10870 315
239 3300053730 Ga0500645_019310 Ga0500645_019310_775_1722 315
240 3300049579 Ga0501043_0032530 Ga0501043_0032530_1756_2712 318
241 3300049585 Ga0501069_0017084 Ga0501069_0017084_333_1289 318
242 3300049586 Ga0501070_0007975 Ga0501070_0007975_5900_6856 318
243 3300005983 Ga0081540_1068695 Ga0081540_10686952 319
244 3300009553 Ga0105249_10018572 Ga0105249_100185726 319
245 3300048905 Ga0496102_0016475 Ga0496102_0016475_1640_2599 319
246 3300048906 Ga0496103_0020844 Ga0496103_0020844_2576_3535 319
247 3300048908 Ga0496105_0149665 Ga0496105_0149665_797_1756 319
248 3300048909 Ga0496106_0008447 Ga0496106_0008447_4198_5157 319
249 3300048910 Ga0496107_0002446 Ga0496107_0002446_4097_5056 319
250 3300048911 Ga0496108_0254874 Ga0496108_0254874_207_1166 319
251 3300050507 nmdc:mga05p37_107567_c1 nmdc:mga05p37_107567_c1_963_1922 319
252 3300050511 nmdc:mga08y16_33378_c1 nmdc:mga08y16_33378_c1_1566_2525 319
253 iso_pu_bacteria 2508501122 2509108611 319
254 iso_pu_bacteria 2509276019 2509374363 319
255 iso_pu_bacteria 2510065057 2510305068 319
256 iso_pu_bacteria 2510461069 2510843573 319
257 iso_pu_bacteria 2510917022 2511133383 319
258 iso_pu_bacteria 2510917028 2511186444 319
259 iso_pu_bacteria 2510917030 2511197115 319
260 iso_pu_bacteria 2511231052 2511501111 319
261 iso_pu_bacteria 2512047086 2512532517 319
262 iso_pu_bacteria 2512875026 2512972146 319
263 iso_pu_bacteria 2513237086 2513582886 319
264 iso_pu_bacteria 2513237088 2513596331 319
265 iso_pu_bacteria 2513237089 2513604820 319
266 iso_pu_bacteria 2513237091 2513616274 319
267 iso_pu_bacteria 2513237138 2513868923 319
268 iso_pu_bacteria 2513237140 2513881003 319
269 iso_pu_bacteria 2513237143 2513902239 319
270 iso_pu_bacteria 2513237156 2513987506 319
271 iso_pu_bacteria 2513237159 2514001101 319
272 iso_pu_bacteria 2513237160 2514008575 319
273 iso_pu_bacteria 2515154107 2515608220 319
274 iso_pu_bacteria 2516143018 2516208974 319
275 iso_pu_bacteria 2516653046 2516892392 319
276 iso_pu_bacteria 2517487022 2517569188 319
277 iso_pu_bacteria 2519899620 2520378698 319
278 iso_pu_bacteria 2524023207 2524451042 319
279 iso_pu_bacteria 2534681796 2535515805 319
280 iso_pu_bacteria 2537561587 2537874167 319
281 iso_pu_bacteria 2551306084 2551682471 319
282 iso_pu_bacteria 2551306085 2551683810 319
283 iso_pu_bacteria 2551306087 2551703813 319
284 iso_pu_bacteria 2551306093 2551746421 319
285 iso_pu_bacteria 2554235003 2554247228 319
286 iso_pu_bacteria 2558860100 2558863390 319
287 iso_pu_bacteria 2558860242 2559294421 319
288 iso_pu_bacteria 2558860983 2561466134 319
289 iso_pu_bacteria 2582581283 2585165661 319
290 iso_pu_bacteria 2582581299 2585231413 319
291 iso_pu_bacteria 2582581306 2585266063 319
292 iso_pu_bacteria 2582581307 2585273177 319
293 iso_pu_bacteria 2582581308 2585278989 319
294 iso_pu_bacteria 2582581315 2585325394 319
295 iso_pu_bacteria 2582581316 2585329555 319
296 iso_pu_bacteria 2582581865 2585391617 319
297 iso_pu_bacteria 2582581866 2585392820 319
298 iso_pu_bacteria 2585427527 2585530784 319
299 iso_pu_bacteria 2585427530 2585554966 319
300 iso_pu_bacteria 2585427531 2585559524 319
301 iso_pu_bacteria 2585427594 2585847132 319
302 iso_pu_bacteria 2585427608 2585902195 319
303 iso_pu_bacteria 2585427609 2585905100 319
304 iso_pu_bacteria 2585428125 2587979785 319
305 iso_pu_bacteria 2599185156 2599333666 319
306 iso_pu_bacteria 2599185210 2599602507 319
307 iso_pu_bacteria 2599185352 2600192032 319
308 iso_pu_bacteria 2600254933 2600375350 319
309 iso_pu_bacteria 2600255279 2601608591 319
310 iso_pu_bacteria 2600255308 2601745365 319
311 iso_pu_bacteria 2615840626 2616305739 319
312 iso_pu_bacteria 2617270742 2617384214 319
313 iso_pu_bacteria 2643221557 2643807100 319
314 iso_pu_bacteria 2643221568 2643855822 319
315 iso_pu_bacteria 2643221582 2643918801 319
316 iso_pu_bacteria 2643221599 2644008007 319
317 iso_pu_bacteria 2643221607 2644046461 319
318 iso_pu_bacteria 2643221610 2644069633 319
319 iso_pu_bacteria 2643221618 2644108892 319
320 iso_pu_bacteria 2643221626 2644151414 319
321 iso_pu_bacteria 2643221636 2644200814 319
322 iso_pu_bacteria 2643221655 2644311548 319
323 iso_pu_bacteria 2643221659 2644329807 319
324 iso_pu_bacteria 2643221668 2644380482 319
325 iso_pu_bacteria 2643221675 2644420787 319
326 iso_pu_bacteria 2643221680 2644454312 319
327 iso_pu_bacteria 2643221686 2644479251 319
328 iso_pu_bacteria 2643221688 2644493307 319
329 iso_pu_bacteria 2643221689 2644502305 319
330 iso_pu_bacteria 2643221693 2644518661 319
331 iso_pu_bacteria 2643221698 2644546480 319
332 iso_pu_bacteria 2643221712 2644617347 319
333 iso_pu_bacteria 2643221723 2644675550 319
334 iso_pu_bacteria 2643221726 2644689649 319
335 iso_pu_bacteria 2657244999 2657683169 319
336 iso_pu_bacteria 2690316117 2692316731 319
337 iso_pu_bacteria 2738541293 2738802244 319
338 iso_pu_bacteria 2738541317 2738946456 319
339 iso_pu_bacteria 2751185821 2753460899 319
340 iso_pu_bacteria 2775507049 2776912917 319
341 iso_pu_bacteria 2775507266 2778177570 319
342 iso_pu_bacteria 2791355082 2792584257 319
343 iso_pu_bacteria 2791355091 2792622581 319
344 iso_pu_bacteria 2791355092 2792628498 319
345 iso_pu_bacteria 2791355094 2792638253 319
346 iso_pu_bacteria 2802428858 2802719206 319
347 iso_pu_bacteria 2802428859 2802723240 319
348 iso_pu_bacteria 2802428860 2802732401 319
349 iso_pu_bacteria 2802428861 2802738681 319
350 iso_pu_bacteria 2802428862 2802745219 319
351 iso_pu_bacteria 2802428863 2802751656 319
352 iso_pu_bacteria 2802429268 2804751442 319
353 iso_pu_bacteria 2808606387 2808985805 319
354 iso_pu_bacteria 2818991439 2819555921 319
355 iso_pu_bacteria 2818991448 2819611513 319
356 iso_pu_bacteria 2818991453 2819639167 319
357 iso_pu_bacteria 2838029111 2838031513 319
358 iso_pu_bacteria 2838675328 2838676641 319
359 iso_pu_bacteria 2838714209 2838715525 319
360 iso_pu_bacteria 2838719591 2838720675 319
361 iso_pu_bacteria 2838724970 2838726281 319
362 iso_pu_bacteria 2841846520 2841847606 319
363 iso_pu_bacteria 2841859092 2841859856 319
364 iso_pu_bacteria 2842124991 2842126364 319
365 iso_pu_bacteria 2842130223 2842131534 319
366 iso_pu_bacteria 2842152218 2842153297 319
367 iso_pu_bacteria 2842170452 2842171768 319
368 iso_pu_bacteria 2842175837 2842176916 319
369 iso_pu_bacteria 2842187318 2842188633 319
370 iso_pu_bacteria 2842211629 2842212944 319
371 iso_pu_bacteria 2842224351 2842225437 319
372 iso_pu_bacteria 2842298080 2842302369 319
373 iso_pu_bacteria 2842357229 2842360898 319
374 iso_pu_bacteria 2842475841 2842477892 319
375 iso_pu_bacteria 2842482326 2842482932 319
376 iso_pu_bacteria 2842502639 2842504701 319
377 iso_pu_bacteria 2842509118 2842509804 319
378 iso_pu_bacteria 2842515876 2842516641 319
379 iso_pu_bacteria 2842521101 2842526246 319
380 iso_pu_bacteria 2844163670 2844168412 319
381 iso_pu_bacteria 2847417321 2847418202 319
382 iso_pu_bacteria 2848992105 2848993177 319
383 iso_pu_bacteria 2850079185 2850080571 319
384 iso_pu_bacteria 2852387548 2852389167 319
385 iso_pu_bacteria 2854916844 2854922097 319
386 iso_pu_bacteria 2855825444 2855831464 319
387 iso_pu_bacteria 2855839649 2855840588 319
388 iso_pu_bacteria 2855872281 2855878842 319
389 iso_pu_bacteria 2858800743 2858801115 319
390 iso_pu_bacteria 2891373044 2891377034 319
391 iso_pu_bacteria 2899792073 2899796695 319
392 iso_pu_bacteria 2899845264 2899847045 319
393 iso_pu_bacteria 2913295892 2913297350 319
394 iso_pu_bacteria 2915980308 2915985850 319
395 iso_pu_bacteria 2915986958 2915989696 319
396 iso_pu_bacteria 2915993759 2915996119 319
397 iso_pu_bacteria 2916000859 2916005630 319
398 iso_pu_bacteria 2916007675 2916013965 319
399 iso_pu_bacteria 2916014648 2916021154 319
400 iso_pu_bacteria 2916021584 2916023169 319
401 iso_pu_bacteria 2916028427 2916031434 319
402 iso_pu_bacteria 2916035215 2916038857 319
403 iso_pu_bacteria 2916041962 2916044518 319
404 iso_pu_bacteria 2916048683 2916049574 319
405 iso_pu_bacteria 2916055098 2916055218 319
406 iso_pu_bacteria 2916061851 2916067208 319
407 iso_pu_bacteria 2916068649 2916071918 319
408 iso_pu_bacteria 2919114240 2919115681 319
409 iso_pu_bacteria 2919166419 2919167412 319
410 iso_pu_bacteria 2919171160 2919171322 319
411 iso_pu_bacteria 2919408235 2919409394 319
412 iso_pu_bacteria 2920760137 2920762781 319
413 iso_pu_bacteria 2920822456 2920823943 319
414 iso_pu_bacteria 2921201388 2921202848 319
415 iso_pu_bacteria 2921208531 2921214174 319
416 iso_pu_bacteria 2921237296 2921239256 319
417 iso_pu_bacteria 2921244191 2921246236 319
418 iso_pu_bacteria 2921250672 2921251480 319
419 iso_pu_bacteria 2921257292 2921257926 319
420 iso_pu_bacteria 2921263974 2921264095 319
421 iso_pu_bacteria 2921282425 2921286848 319
422 iso_pu_bacteria 2921289301 2921294523 319
423 iso_pu_bacteria 2921296804 2921299948 319
424 iso_pu_bacteria 2924144063 2924146545 319
425 iso_pu_bacteria 2924150972 2924151238 319
426 iso_pu_bacteria 2924158325 2924160715 319
427 iso_pu_bacteria 2924165586 2924171753 319
428 iso_pu_bacteria 2924172951 2924177484 319
429 iso_pu_bacteria 2924179722 2924185305 319
430 iso_pu_bacteria 2924186466 2924188760 319
431 iso_pu_bacteria 2924193448 2924196623 319
432 iso_pu_bacteria 2924200457 2924203062 319
433 iso_pu_bacteria 2924207177 2924212592 319
434 iso_pu_bacteria 2924214083 2924214264 319
435 iso_pu_bacteria 2924221636 2924224698 319
436 iso_pu_bacteria 2924228884 2924230331 319
437 iso_pu_bacteria 2926754445 2926756668 319
438 iso_pu_bacteria 2926760298 2926760914 319
439 iso_pu_bacteria 2929138655 2929139600 319
440 iso_pu_bacteria 2933006813 2933007940 319
441 iso_pu_bacteria 2933011516 2933012718 319
442 iso_pu_bacteria 2933594066 2933595152 319
443 iso_pu_bacteria 2936996657 2937000962 319
444 iso_pu_bacteria 2937002841 2937004357 319
445 iso_pu_bacteria 2937009748 2937011110 319
446 iso_pu_bacteria 2937016420 2937019442 319
447 iso_pu_bacteria 2937023124 2937028542 319
448 iso_pu_bacteria 2937029754 2937030473 319
449 iso_pu_bacteria 2937036028 2937040921 319
450 iso_pu_bacteria 2937042894 2937048277 319
451 iso_pu_bacteria 2937049772 2937055728 319
452 iso_pu_bacteria 2937056579 2937059213 319
453 iso_pu_bacteria 2937063883 2937065485 319
454 iso_pu_bacteria 2937071275 2937073902 319
455 iso_pu_bacteria 2937078374 2937082833 319
456 iso_pu_bacteria 2937091812 2937095731 319
457 iso_pu_bacteria 2937098957 2937104076 319
458 iso_pu_bacteria 2937106411 2937111831 319
459 iso_pu_bacteria 2937113482 2937114007 319
460 iso_pu_bacteria 2937119839 2937125505 319
461 iso_pu_bacteria 2937126314 2937126721 319
462 iso_pu_bacteria 2941499720 2941500112 319
463 iso_pu_bacteria 2957375807 2957380518 319
464 iso_pu_bacteria 2957382221 2957382788 319
465 iso_pu_bacteria 2957388812 2957388990 319
466 iso_pu_bacteria 2957395598 2957396620 319
467 iso_pu_bacteria 2957402308 2957407575 319
468 iso_pu_bacteria 2957408893 2957409670 319
469 iso_pu_bacteria 2957415311 2957418685 319
470 iso_pu_bacteria 2957422303 2957428386 319
471 iso_pu_bacteria 2957430029 2957432580 319
472 iso_pu_bacteria 2957437181 2957438592 319
473 iso_pu_bacteria 2957443900 2957449584 319
474 iso_pu_bacteria 2957450854 2957456546 319
475 iso_pu_bacteria 2957457609 2957463554 319
476 iso_pu_bacteria 2957464669 2957466590 319
477 iso_pu_bacteria 2957471148 2957473214 319
478 iso_pu_bacteria 2957478035 2957479878 319
479 iso_pu_bacteria 2957484790 2957486067 319
480 iso_pu_bacteria 2957491536 2957495771 319
481 iso_pu_bacteria 2957498199 2957500073 319
482 iso_pu_bacteria 2957505466 2957509213 319
483 iso_pu_bacteria 2960584000 2960590007 319
484 iso_pu_bacteria 2960591022 2960596008 319
485 iso_pu_bacteria 2960597568 2960598929 319
486 iso_pu_bacteria 2960603979 2960608521 319
487 iso_pu_bacteria 2960610863 2960611867 319
488 iso_pu_bacteria 2960617483 2960617843 319
489 iso_pu_bacteria 2960624210 2960626852 319
490 iso_pu_bacteria 2960631154 2960636257 319
491 iso_pu_bacteria 2960637947 2960643231 319
492 iso_pu_bacteria 2960645483 2960645751 319
493 iso_pu_bacteria 2960652885 2960659128 319
494 iso_pu_bacteria 2960660292 2960666239 319
495 iso_pu_bacteria 2960667422 2960668733 319
496 iso_pu_bacteria 2960674078 2960677513 319
497 iso_pu_bacteria 2960680706 2960684927 319
498 iso_pu_bacteria 2960687367 2960689111 319
499 iso_pu_bacteria 2960693952 2960699738 319
500 iso_pu_bacteria 2964607997 2964612571 319
501 iso_pu_bacteria 2964615318 2964617829 319
502 iso_pu_bacteria 2964621998 2964625038 319
503 iso_pu_bacteria 2964628898 2964635342 319
504 iso_pu_bacteria 2964636051 2964642498 319
505 iso_pu_bacteria 2964643177 2964646650 319
506 iso_pu_bacteria 2964649959 2964656377 319
507 iso_pu_bacteria 2964656573 2964659769 319
508 iso_pu_bacteria 2964663802 2964665617 319
509 iso_pu_bacteria 2964670856 2964671794 319
510 iso_pu_bacteria 2964678106 2964679452 319
511 iso_pu_bacteria 2964685014 2964688214 319
512 iso_pu_bacteria 2964691889 2964692180 319
513 iso_pu_bacteria 2964698721 2964702814 319
514 iso_pu_bacteria 2964705432 2964708631 319
515 iso_pu_bacteria 2964712639 2964718697 319
516 iso_pu_bacteria 2964719344 2964722259 319
517 iso_pu_bacteria 2967671571 2967677879 319
518 iso_pu_bacteria 2967678726 2967681587 319
519 iso_pu_bacteria 2967686174 2967692997 319
520 iso_pu_bacteria 2967693043 2967693387 319
521 iso_pu_bacteria 2967706974 2967713142 319
522 iso_pu_bacteria 2967714385 2967716387 319
523 iso_pu_bacteria 2967721400 2967723287 319
524 iso_pu_bacteria 2967728569 2967730937 319
525 iso_pu_bacteria 2967735183 2967735585 319
526 iso_pu_bacteria 2967742019 2967747434 319
527 iso_pu_bacteria 2967748971 2967754464 319
528 iso_pu_bacteria 2967755722 2967757036 319
529 iso_pu_bacteria 2967762386 2967763938 319
530 iso_pu_bacteria 2967769361 2967771638 319
531 iso_pu_bacteria 2967775926 2967777603 319
532 iso_pu_bacteria 2970019648 2970020580 319
533 iso_pu_bacteria 2970026789 2970032904 319
534 iso_pu_bacteria 2970033650 2970035691 319
535 iso_pu_bacteria 2970040964 2970041420 319
536 iso_pu_bacteria 2970047711 2970050439 319
537 iso_pu_bacteria 2970054988 2970057961 319
538 iso_pu_bacteria 2970061556 2970066294 319
539 iso_pu_bacteria 2970068827 2970072041 319
540 iso_pu_bacteria 2970076120 2970080513 319
541 iso_pu_bacteria 2970082768 2970086973 319
542 iso_pu_bacteria 2970088815 2970091572 319
543 iso_pu_bacteria 2970095765 2970097523 319
544 iso_pu_bacteria 2970102677 2970105034 319
545 iso_pu_bacteria 2970109326 2970113052 319
546 iso_pu_bacteria 2970116247 2970117861 319
547 iso_pu_bacteria 2970122695 2970128556 319
548 iso_pu_bacteria 2970129317 2970129659 319
549 iso_pu_bacteria 2970136068 2970138802 319
550 iso_pu_bacteria 2970143518 2970146021 319
551 iso_pu_bacteria 2970149975 2970151132 319
552 iso_pu_bacteria 2970156795 2970163080 319
553 iso_pu_bacteria 2970164137 2970166890 319
554 iso_pu_bacteria 2970170962 2970176062 319
555 iso_pu_bacteria 2970177841 2970178438 319
556 iso_pu_bacteria 2970184632 2970187427 319
557 iso_pu_bacteria 2970191845 2970194239 319
558 iso_pu_bacteria 2977516862 2977517834 319
559 iso_pu_bacteria 2977523885 2977527129 319
560 iso_pu_bacteria 2977530762 2977534512 319
561 iso_pu_bacteria 2977537788 2977538129 319
562 iso_pu_bacteria 2977544691 2977549947 319
563 iso_pu_bacteria 2977551784 2977552129 319
564 iso_pu_bacteria 2977558990 2977565108 319
565 iso_pu_bacteria 2977565890 2977566354 319
566 iso_pu_bacteria 2977572785 2977576574 319
567 iso_pu_bacteria 2977579622 2977581234 319
568 iso_pu_bacteria 2978969890 2978973842 319
569 iso_pu_bacteria 2979089926 2979093810 319
570 iso_pu_bacteria 2979095461 2979098807 319
571 iso_pu_bacteria 2979100975 2979105787 319
572 iso_pu_bacteria 2984509177 2984512366 319
573 iso_pu_bacteria 2984518228 2984521272 319
574 iso_pu_bacteria 2984537506 2984540567 319
575 iso_pu_bacteria 2984587000 2984589189 319
576 iso_pu_bacteria 2984601300 2984602763 319
577 iso_pu_bacteria 2989771324 2989772157 319
578 iso_pu_bacteria 3005409236 3005412529 319
579 iso_pu_bacteria 3005416602 3005419642 319
580 iso_pu_bacteria 3005452660 3005453534 319
581 iso_pu_bacteria 639633055 639647516 319
582 iso_pu_bacteria 643692032 643825177 319
583 iso_pu_bacteria 648276728 648736506 319
584 iso_pu_bacteria 650716007 650739618 319
585 iso_pu_bacteria 8003570095 8003570673 319
586 iso_pu_bacteria 8003992118 8003993087 319
587 iso_pu_bacteria 8003999396 8004000322 319
588 iso_pu_bacteria 8005246636 8005251215 319
589 iso_pu_bacteria 8005314921 8005317678 319
590 iso_pu_bacteria 8005484373 8005485544 319
591 iso_pu_bacteria 8005542996 8005544438 319
592 iso_pu_bacteria 8005556819 8005558842 319
593 iso_pu_bacteria 8005645114 8005649931 319
594 iso_pu_bacteria 8005658619 8005659888 319
595 iso_pu_bacteria 8024486573 8024489671 319
596 iso_pu_bacteria 8046767195 8046767757 319
597 iso_pu_bacteria 8049293176 8049294015 319
598 iso_pu_bacteria 8054460903 8054462728 319
599 iso_pu_bacteria 8054558443 8054559090 319
600 iso_pu_bacteria 8056875544 8056879415 319
601 iso_pu_bacteria 8057575449 8057582114 319
602 3300049568 Ga0501031_0031646 Ga0501031_0031646_1719_2684 320
603 3300049570 Ga0501033_0103709 Ga0501033_0103709_57_1022 320
604 3300049572 Ga0501036_0096502 Ga0501036_0096502_294_1259 320
605 3300049573 Ga0501037_0070315 Ga0501037_0070315_1307_2272 320
606 3300049581 Ga0501047_0043731 Ga0501047_0043731_2647_3612 320
607 3300049583 Ga0501067_0055512 Ga0501067_0055512_436_1401 320
608 3300049585 Ga0501069_0155426 Ga0501069_0155426_281_1246 320
609 3300049586 Ga0501070_0065280 Ga0501070_0065280_1317_2282 320
610 3300049589 Ga0501073_0032875 Ga0501073_0032875_169_1134 320
611 3300049590 Ga0501074_0088466 Ga0501074_0088466_808_1773 320
612 3300049823 Ga0501044_0057433 Ga0501044_0057433_1237_2202 320
613 iso_pu_bacteria 2643221643 2644239018 321
614 iso_pu_bacteria 2939669807 2939670720 321
615 iso_pu_bacteria 3003930520 3003932774 321
616 3300049571 Ga0501034_0015883 Ga0501034_0015883_3538_4506 322
617 3300049589 Ga0501073_0115636 Ga0501073_0115636_14_982 322
618 iso_pu_bacteria 2837678835 2837681955 322
619 iso_pu_bacteria 8045864390 8045865836 322
620 3300002704 JGI25155J39150_1000019 JGI25155J39150_100001926 323
621 3300002705 JGI25156J39149_1000020 JGI25156J39149_1000020144 323
622 3300002737 JGI25162J39368_1002520 JGI25162J39368_10025209 323
623 3300002738 JGI25154J39366_1000102 JGI25154J39366_100010226 323
624 3300002738 JGI25154J39366_1006945 JGI25154J39366_10069452 323
625 3300002741 JGI25157J39369_1000070 JGI25157J39369_100007026 323
626 3300002774 JGI25150J39212_1010191 JGI25150J39212_10101912 323
627 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002131 323
628 3300003187 JGI25151J46595_10021500 JGI25151J46595_100215002 323
629 3300003187 JGI25151J46595_10026953 JGI25151J46595_100269532 323
630 3300003214 JGI25165J46597_1002321 JGI25165J46597_10023218 323
631 3300003215 JGI25153J46596_10025545 JGI25153J46596_100255453 323
632 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008131 323
633 3300003374 JGI25161J50226_1006097 JGI25161J50226_10060973 323
634 3300003771 Ga0055526_1000738 Ga0055526_100073825 323
635 3300003771 Ga0055526_1004400 Ga0055526_10044008 323
636 3300003775 Ga0055524_1000570 Ga0055524_100057016 323
637 3300003781 Ga0055536_1005880 Ga0055536_10058805 323
638 3300003781 Ga0055536_1007660 Ga0055536_10076603 323
639 3300003792 Ga0055540_1008033 Ga0055540_10080335 323
640 3300004625 Ga0055543_1000027 Ga0055543_10000272 323
641 3300005262 Ga0065165_1000015 Ga0065165_1000015132 323
642 3300005548 Ga0070665_100084715 Ga0070665_1000847152 323
643 3300006051 Ga0075364_10006144 Ga0075364_100061446 323
644 3300006051 Ga0075364_10191378 Ga0075364_101913782 323
645 3300006177 Ga0075362_10003295 Ga0075362_100032954 323
646 3300006177 Ga0075362_10057678 Ga0075362_100576782 323
647 3300006186 Ga0075369_10002200 Ga0075369_100022008 323
648 3300006186 Ga0075369_10054317 Ga0075369_100543172 323
649 3300006946 Ga0079104_1000032 Ga0079104_1000032180 323
650 3300006946 Ga0079104_1001413 Ga0079104_100141314 323
651 3300006946 Ga0079104_1001771 Ga0079104_100177112 323
652 3300006948 Ga0099826_10000246 Ga0099826_1000024621 323
653 3300009036 Ga0105244_10053958 Ga0105244_100539581 323
654 3300009093 Ga0105240_10000032 Ga0105240_10000032133 323
655 3300009093 Ga0105240_10002268 Ga0105240_100022689 323
656 3300009148 Ga0105243_10018870 Ga0105243_100188705 323
657 3300009177 Ga0105248_10334639 Ga0105248_103346392 323
658 3300013100 Ga0157373_10003634 Ga0157373_100036343 323
659 3300013102 Ga0157371_10003149 Ga0157371_1000314911 323
660 3300013104 Ga0157370_10000367 Ga0157370_1000036712 323
661 3300013104 Ga0157370_10251655 Ga0157370_102516552 323
662 3300013105 Ga0157369_10097785 Ga0157369_100977852 323
663 3300013249 Ga0171463_1001 Ga0171463_1001122 323
664 3300015262 Ga0182007_10000751 Ga0182007_1000075119 323
665 3300017792 Ga0163161_10254688 Ga0163161_102546882 323
666 3300021321 Ga0214542_1000006 Ga0214542_1000006136 323
667 3300021321 Ga0214542_1019617 Ga0214542_10196178 323
668 3300021327 Ga0214543_1000003 Ga0214543_1000003572 323
669 3300021327 Ga0214543_1000014 Ga0214543_1000014187 323
670 3300022739 Ga0228711_1001210 Ga0228711_100121028 323
671 3300022740 Ga0228710_1002040 Ga0228710_100204013 323
672 3300025206 Ga0209435_100024 Ga0209435_10002426 323
673 3300025208 Ga0209436_100032 Ga0209436_10003227 323
674 3300025208 Ga0209436_100741 Ga0209436_1007416 323
675 3300025233 Ga0209437_100033 Ga0209437_100033358 323
676 3300025245 Ga0207425_1000031 Ga0207425_100003132 323
677 3300025245 Ga0207425_1006216 Ga0207425_10062163 323
678 3300025246 Ga0209646_1000064 Ga0209646_100006426 323
679 3300025250 Ga0209026_1000053 Ga0209026_100005326 323
680 3300025253 Ga0209677_100251 Ga0209677_10025123 323
681 3300025256 Ga0209759_1000042 Ga0209759_100004226 323
682 3300025258 Ga0209129_1000053 Ga0209129_100005333 323
683 3300025258 Ga0209129_1022927 Ga0209129_10229271 323
684 3300025258 Ga0209129_1022931 Ga0209129_10229311 323
685 3300025261 Ga0209233_1000064 Ga0209233_100006464 323
686 3300025273 Ga0209673_1002821 Ga0209673_10028212 323
687 3300025273 Ga0209673_1005461 Ga0209673_10054617 323
688 3300025284 Ga0209130_1000006 Ga0209130_1000006456 323
689 3300025284 Ga0209130_1000007 Ga0209130_1000007171 323
690 3300025284 Ga0209130_1000018 Ga0209130_1000018182 323
691 3300025292 Ga0209676_1003826 Ga0209676_10038265 323
692 3300025294 Ga0209025_1000087 Ga0209025_100008732 323
693 3300025294 Ga0209025_1000149 Ga0209025_1000149151 323
694 3300025294 Ga0209025_1000195 Ga0209025_100019523 323
695 3300025294 Ga0209025_1001254 Ga0209025_100125419 323
696 3300025294 Ga0209025_1007065 Ga0209025_10070658 323
697 3300025294 Ga0209025_1043027 Ga0209025_10430272 323
698 3300025295 Ga0209564_1000330 Ga0209564_100033054 323
699 3300025295 Ga0209564_1000668 Ga0209564_100066817 323
700 3300025295 Ga0209564_1002094 Ga0209564_10020948 323
701 3300025297 Ga0209758_1000081 Ga0209758_100008132 323
702 3300025297 Ga0209758_1000939 Ga0209758_100093928 323
703 3300025297 Ga0209758_1001333 Ga0209758_10013332 323
704 3300025297 Ga0209758_1001529 Ga0209758_100152929 323
705 3300025297 Ga0209758_1002147 Ga0209758_100214724 323
706 3300025298 Ga0209050_1009022 Ga0209050_10090223 323
707 3300025299 Ga0209256_1000445 Ga0209256_100044541 323
708 3300025299 Ga0209256_1002049 Ga0209256_100204915 323
709 3300025299 Ga0209256_1002795 Ga0209256_100279517 323
710 3300025299 Ga0209256_1003424 Ga0209256_10034245 323
711 3300025302 Ga0207426_1000044 Ga0207426_1000044207 323
712 3300025302 Ga0207426_1000064 Ga0207426_1000064171 323
713 3300025303 Ga0209051_1001187 Ga0209051_10011875 323
714 3300025304 Ga0209257_1001197 Ga0209257_100119715 323
715 3300025304 Ga0209257_1005909 Ga0209257_10059094 323
716 3300025304 Ga0209257_1020380 Ga0209257_10203802 323
717 3300025913 Ga0207695_10000024 Ga0207695_10000024134 323
718 3300025913 Ga0207695_10003756 Ga0207695_1000375610 323
719 3300025935 Ga0207709_10028555 Ga0207709_100285553 323
720 3300027111 Ga0209281_1000053 Ga0209281_1000053284 323
721 3300027111 Ga0209281_1000236 Ga0209281_100023683 323
722 3300027111 Ga0209281_1000666 Ga0209281_100066619 323
723 3300027312 Ga0209371_1000021 Ga0209371_1000021395 323
724 3300027312 Ga0209371_1001000 Ga0209371_100100014 323
725 3300027666 Ga0209282_1000022 Ga0209282_1000022143 323
726 3300027666 Ga0209282_1019506 Ga0209282_10195062 323
727 3300027866 Ga0209813_10001495 Ga0209813_100014956 323
728 3300028379 Ga0268266_10072784 Ga0268266_100727841 323
729 3300028379 Ga0268266_10103119 Ga0268266_101031193 323
730 3300028794 Ga0307515_10000070 Ga0307515_1000007084 323
731 3300028794 Ga0307515_10003358 Ga0307515_1000335821 323
732 3300028794 Ga0307515_10031717 Ga0307515_100317179 323
733 3300028794 Ga0307515_10198518 Ga0307515_101985182 323
734 3300030500 Ga0268256_1000020 Ga0268256_1000020401 323
735 3300030500 Ga0268256_1003889 Ga0268256_10038891 323
736 3300031456 Ga0307513_10003448 Ga0307513_1000344819 323
737 3300031456 Ga0307513_10038489 Ga0307513_100384891 323
738 3300031548 Ga0307408_100061695 Ga0307408_1000616953 323
739 3300031548 Ga0307408_100141482 Ga0307408_1001414822 323
740 3300031731 Ga0307405_10022442 Ga0307405_100224424 323
741 3300031901 Ga0307406_10085988 Ga0307406_100859882 323
742 3300031901 Ga0307406_10333447 Ga0307406_103334471 323
743 3300031911 Ga0307412_10017364 Ga0307412_100173644 323
744 3300031911 Ga0307412_10340530 Ga0307412_103405301 323
745 3300031967 Ga0315914_1000027 Ga0315914_100002763 323
746 3300031995 Ga0307409_100090847 Ga0307409_1000908473 323
747 3300032002 Ga0307416_100074867 Ga0307416_1000748673 323
748 3300033430 Ga0315913_1000631 Ga0315913_100063115 323
749 3300033464 Ga0315915_1000001 Ga0315915_1000001209 323
750 3300035695 Ga0373927_0000284 Ga0373927_0000284_25957_26928 323
751 3300041404 Ga0439436_0033487 Ga0439436_0033487_395_1366 323
752 3300041408 Ga0439453_0008879 Ga0439453_0008879_141_1112 323
753 3300041413 Ga0439465_0015313 Ga0439465_0015313_743_1714 323
754 3300041458 Ga0451798_0111375 Ga0451798_0111375_589_1560 323
755 3300041492 Ga0451835_0809115 Ga0451835_0809115_54_1025 323
756 3300041497 Ga0451840_23403 Ga0451840_23403_928_1899 323
757 3300041498 Ga0451841_0711977 Ga0451841_0711977_1162_2133 323
758 3300041501 Ga0451845_0762944 Ga0451845_0762944_765_1736 323
759 3300041507 Ga0451851_0868710 Ga0451851_0868710_726_1697 323
760 3300042007 Ga0439449_0006656 Ga0439449_0006656_2261_3232 323
761 3300042007 Ga0439449_0012014 Ga0439449_0012014_2200_3171 323
762 3300042122 Ga0450920_003028 Ga0450920_003028_236_1207 323
763 3300042436 Ga0439435_0003123 Ga0439435_0003123_902_1873 323
764 3300042531 Ga0450918_007781 Ga0450918_007781_375_1346 323
765 3300044684 Ga0466966_0130349 Ga0466966_0130349_423_1394 323
766 3300045976 Ga0466967_0262483 Ga0466967_0262483_290_1261 323
767 3300046460 Ga0495638_0062117 Ga0495638_0062117_38_1009 323
768 3300046507 Ga0495606_0002521 Ga0495606_0002521_17936_18907 323
769 3300046507 Ga0495606_0093417 Ga0495606_0093417_346_1317 323
770 3300046507 Ga0495606_0115906 Ga0495606_0115906_455_1426 323
771 3300046518 Ga0495631_0005243 Ga0495631_0005243_4667_5638 323
772 3300046519 Ga0495632_0096029 Ga0495632_0096029_40_1011 323
773 3300046558 Ga0495633_0032933 Ga0495633_0032933_873_1844 323
774 3300046615 Ga0495656_0072706 Ga0495656_0072706_90_1061 323
775 3300046616 Ga0495668_0024399 Ga0495668_0024399_2268_3239 323
776 3300046665 Ga0495661_0022101 Ga0495661_0022101_186_1157 323
777 3300046674 Ga0495588_0049618 Ga0495588_0049618_878_1849 323
778 3300046691 Ga0495670_0044353 Ga0495670_0044353_491_1462 323
779 3300047472 Ga0495686_0001186 Ga0495686_0001186_16052_17023 323
780 3300048907 Ga0496104_0000206 Ga0496104_0000206_5400_6371 323
781 3300048908 Ga0496105_0146951 Ga0496105_0146951_171_1142 323
782 3300048909 Ga0496106_0000131 Ga0496106_0000131_55390_56361 323
783 3300048917 Ga0496114_0032152 Ga0496114_0032152_690_1661 323
784 3300048919 Ga0496116_0000036 Ga0496116_0000036_322375_323346 323
785 3300048920 Ga0496117_0099511 Ga0496117_0099511_503_1474 323
786 3300048923 Ga0496120_0071949 Ga0496120_0071949_783_1754 323
787 3300048924 Ga0496121_0000001 Ga0496121_0000001_973662_974633 323
788 3300048924 Ga0496121_0002297 Ga0496121_0002297_17818_18789 323
789 3300048924 Ga0496121_0004948 Ga0496121_0004948_16098_17069 323
790 3300048924 Ga0496121_0039654 Ga0496121_0039654_3149_4120 323
791 3300048925 Ga0496122_0001240 Ga0496122_0001240_30125_31096 323
792 3300048925 Ga0496122_0073151 Ga0496122_0073151_258_1229 323
793 3300048925 Ga0496122_0117736 Ga0496122_0117736_739_1710 323
794 3300048926 Ga0496123_0009901 Ga0496123_0009901_3241_4212 323
795 3300048927 Ga0496124_0003293 Ga0496124_0003293_12095_13066 323
796 3300048927 Ga0496124_0019653 Ga0496124_0019653_343_1314 323
797 3300048928 Ga0496125_0000001 Ga0496125_0000001_1087541_1088512 323
798 3300048928 Ga0496125_0000372 Ga0496125_0000372_11851_12822 323
799 3300048928 Ga0496125_0038081 Ga0496125_0038081_974_1945 323
800 3300048929 Ga0496126_0000156 Ga0496126_0000156_53107_54078 323
801 3300048929 Ga0496126_0033319 Ga0496126_0033319_441_1412 323
802 3300049569 Ga0501032_0162324 Ga0501032_0162324_291_1262 323
803 3300049574 Ga0501038_0096666 Ga0501038_0096666_619_1590 323
804 3300049575 Ga0501039_0031973 Ga0501039_0031973_2163_3134 323
805 3300049581 Ga0501047_0150795 Ga0501047_0150795_296_1267 323
806 3300049582 Ga0501048_0254611 Ga0501048_0254611_163_1134 323
807 3300049584 Ga0501068_0211263 Ga0501068_0211263_178_1149 323
808 3300049586 Ga0501070_0131503 Ga0501070_0131503_566_1537 323
809 3300049587 Ga0501071_0031091 Ga0501071_0031091_1340_2311 323
810 3300049592 Ga0501076_0088269 Ga0501076_0088269_841_1812 323
811 3300049744 Ga0501083_0018433 Ga0501083_0018433_107_1078 323
812 3300049823 Ga0501044_0299598 Ga0501044_0299598_103_1074 323
813 3300050489 nmdc:mga03683_9527_c1 nmdc:mga03683_9527_c1_1285_2256 323
814 3300050491 nmdc:mga00v17_5147_c1 nmdc:mga00v17_5147_c1_1980_2951 323
815 3300050492 nmdc:mga0yw44_7190_c1 nmdc:mga0yw44_7190_c1_4391_5362 323
816 3300050494 nmdc:mga06z11_21852_c1 nmdc:mga06z11_21852_c1_1286_2257 323
817 3300053139 Ga0500568_0009665 Ga0500568_0009665_2356_3327 323
818 3300053140 Ga0500573_0000489 Ga0500573_0000489_10345_11316 323
819 3300053161 Ga0500634_0000567 Ga0500634_0000567_4369_5340 323
820 3300053177 Ga0500636_0000118 Ga0500636_0000118_29707_30678 323
821 3300059510 Ga0587090_008423 Ga0587090_008423_185_1156 323
822 3300060353 Ga0501082_0128360 Ga0501082_0128360_246_1217 323
823 3300005290 Ga0065712_10094883 Ga0065712_100948832 325
824 3300005293 Ga0065715_10157385 Ga0065715_101573852 325
825 3300005336 Ga0070680_100002875 Ga0070680_1000028752 325
826 3300005354 Ga0070675_100121103 Ga0070675_1001211032 325
827 3300005356 Ga0070674_100027684 Ga0070674_1000276841 325
828 3300005435 Ga0070714_100027694 Ga0070714_1000276943 325
829 3300005438 Ga0070701_10010529 Ga0070701_100105294 325
830 3300005440 Ga0070705_100000653 Ga0070705_10000065316 325
831 3300005441 Ga0070700_100003250 Ga0070700_1000032507 325
832 3300005444 Ga0070694_100005837 Ga0070694_1000058373 325
833 3300005445 Ga0070708_100040723 Ga0070708_1000407236 325
834 3300005467 Ga0070706_100084799 Ga0070706_1000847992 325
835 3300005518 Ga0070699_100002983 Ga0070699_10000298313 325
836 3300005545 Ga0070695_100000696 Ga0070695_1000006966 325
837 3300005545 Ga0070695_100006656 Ga0070695_1000066567 325
838 3300005546 Ga0070696_100000152 Ga0070696_10000015229 325
839 3300005547 Ga0070693_100036204 Ga0070693_1000362043 325
840 3300005549 Ga0070704_100000818 Ga0070704_1000008184 325
841 3300005577 Ga0068857_100005016 Ga0068857_1000050168 325
842 3300005615 Ga0070702_100067281 Ga0070702_1000672813 325
843 3300005617 Ga0068859_100010251 Ga0068859_1000102517 325
844 3300005618 Ga0068864_100030022 Ga0068864_1000300226 325
845 3300005843 Ga0068860_100044151 Ga0068860_1000441515 325
846 3300005844 Ga0068862_100509710 Ga0068862_1005097101 325
847 3300006028 Ga0070717_10125915 Ga0070717_101259152 325
848 3300006914 Ga0075436_100000192 Ga0075436_10000019223 325
849 3300006931 Ga0097620_100010251 Ga0097620_1000102517 325
850 3300007076 Ga0075435_100082558 Ga0075435_1000825582 325
851 3300015265 Ga0182005_1011158 Ga0182005_10111583 325
852 3300017792 Ga0163161_10108871 Ga0163161_101088712 325
853 3300021384 Ga0213876_10055260 Ga0213876_100552603 325
854 3300021388 Ga0213875_10000025 Ga0213875_10000025113 325
855 3300025294 Ga0209025_1050622 Ga0209025_10506222 325
856 3300025885 Ga0207653_10004438 Ga0207653_100044384 325
857 3300025906 Ga0207699_10074236 Ga0207699_100742363 325
858 3300025921 Ga0207652_10136381 Ga0207652_101363813 325
859 3300025926 Ga0207659_10284613 Ga0207659_102846132 325
860 3300025929 Ga0207664_10017769 Ga0207664_100177695 325
861 3300025937 Ga0207669_10186988 Ga0207669_101869881 325
862 3300025939 Ga0207665_10010248 Ga0207665_100102488 325
863 3300025942 Ga0207689_10037982 Ga0207689_100379823 325
864 3300025961 Ga0207712_10010754 Ga0207712_100107546 325
865 3300025972 Ga0207668_10183134 Ga0207668_101831341 325
866 3300026035 Ga0207703_10187414 Ga0207703_101874142 325
867 3300026067 Ga0207678_10077942 Ga0207678_100779425 325
868 3300026075 Ga0207708_10002614 Ga0207708_100026147 325
869 3300026095 Ga0207676_10007549 Ga0207676_100075492 325
870 3300026116 Ga0207674_10010738 Ga0207674_100107387 325
871 3300028380 Ga0268265_10000666 Ga0268265_100006669 325
872 3300028381 Ga0268264_10008316 Ga0268264_100083162 325
873 3300031901 Ga0307406_10075804 Ga0307406_100758042 325
874 3300035692 Ga0373935_0019248 Ga0373935_0019248_1002_1979 325
875 3300036647 Ga0316582_0087429 Ga0316582_0087429_37_1014 325
876 3300037853 Ga0436364_1209910 Ga0436364_1209910_31911_32888 325
877 3300039437 Ga0436365_1347694 Ga0436365_1347694_2988_3965 325
878 3300045051 Ga0451576_0136399 Ga0451576_0136399_379_1356 325
879 3300049568 Ga0501031_0040766 Ga0501031_0040766_582_1559 325
880 3300049569 Ga0501032_0061225 Ga0501032_0061225_31_1008 325
881 3300049571 Ga0501034_0058603 Ga0501034_0058603_1333_2310 325
882 3300049571 Ga0501034_0108137 Ga0501034_0108137_1329_2306 325
883 3300049578 Ga0501042_0212001 Ga0501042_0212001_60_1037 325
884 3300049579 Ga0501043_0102136 Ga0501043_0102136_533_1510 325
885 3300049586 Ga0501070_0140797 Ga0501070_0140797_129_1106 325
886 3300049589 Ga0501073_0022827 Ga0501073_0022827_117_1094 325
887 3300049589 Ga0501073_0027826 Ga0501073_0027826_1578_2555 325
888 3300049590 Ga0501074_0090168 Ga0501074_0090168_1098_2075 325
889 3300049590 Ga0501074_0103468 Ga0501074_0103468_461_1438 325
890 3300049741 Ga0501079_0015885 Ga0501079_0015885_4222_5199 325
891 3300049742 Ga0501080_0158944 Ga0501080_0158944_990_1967 325
892 3300049823 Ga0501044_0016990 Ga0501044_0016990_4544_5521 325
893 3300050513 nmdc:mga0rr50_38609_c1 nmdc:mga0rr50_38609_c1_306_1283 325
894 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_100797_101774 325
895 3300050514 nmdc:mga08x19_345343_c1 nmdc:mga08x19_345343_c1_29_1006 325
896 3300005441 Ga0070700_100070391 Ga0070700_1000703912 326
897 3300005444 Ga0070694_100026932 Ga0070694_1000269323 326
898 3300005455 Ga0070663_100017890 Ga0070663_1000178905 326
899 3300005458 Ga0070681_10013728 Ga0070681_100137283 326
900 3300005530 Ga0070679_100081207 Ga0070679_1000812073 326
901 3300005539 Ga0068853_100012306 Ga0068853_1000123064 326
902 3300005545 Ga0070695_100098065 Ga0070695_1000980653 326
903 3300005546 Ga0070696_100014427 Ga0070696_1000144274 326
904 3300005549 Ga0070704_100026853 Ga0070704_1000268533 326
905 3300005564 Ga0070664_100102851 Ga0070664_1001028512 326
906 3300005842 Ga0068858_100137433 Ga0068858_1001374333 326
907 3300006358 Ga0068871_100122856 Ga0068871_1001228563 326
908 3300006846 Ga0075430_100018717 Ga0075430_1000187177 326
909 3300006847 Ga0075431_100001010 Ga0075431_10000101023 326
910 3300025904 Ga0207647_10014660 Ga0207647_100146605 326
911 3300025921 Ga0207652_10054040 Ga0207652_100540403 326
912 3300025960 Ga0207651_10219877 Ga0207651_102198772 326
913 3300026035 Ga0207703_10202689 Ga0207703_102026893 326
914 3300026041 Ga0207639_10013263 Ga0207639_100132633 326
915 3300026067 Ga0207678_10001597 Ga0207678_100015979 326
916 3300026121 Ga0207683_10086820 Ga0207683_100868204 326
917 3300050509 nmdc:mga0qj67_2103_c1 nmdc:mga0qj67_2103_c1_5354_6334 326
918 3300050510 nmdc:mga06r32_7619_c1 nmdc:mga06r32_7619_c1_7843_8823 326
919 3300003215 JGI25153J46596_10016204 JGI25153J46596_100162042 327
920 3300003354 JGI25160J50197_1000673 JGI25160J50197_100067315 327
921 3300003374 JGI25161J50226_1003466 JGI25161J50226_10034663 327
922 3300003771 Ga0055526_1003233 Ga0055526_10032332 327
923 3300003775 Ga0055524_1009296 Ga0055524_10092964 327
924 3300003790 Ga0055528_1004205 Ga0055528_10042057 327
925 3300003792 Ga0055540_1001138 Ga0055540_10011382 327
926 3300006038 Ga0075365_10019730 Ga0075365_100197301 327
927 3300006177 Ga0075362_10000623 Ga0075362_100006238 327
928 3300006178 Ga0075367_10027235 Ga0075367_100272353 327
929 3300006186 Ga0075369_10012031 Ga0075369_100120313 327
930 3300006195 Ga0075366_10006857 Ga0075366_100068576 327
931 3300006353 Ga0075370_10051004 Ga0075370_100510042 327
932 3300025245 Ga0207425_1002528 Ga0207425_10025286 327
933 3300025258 Ga0209129_1006501 Ga0209129_10065013 327
934 3300025273 Ga0209673_1000692 Ga0209673_100069211 327
935 3300025273 Ga0209673_1001599 Ga0209673_100159917 327
936 3300025294 Ga0209025_1000199 Ga0209025_100019993 327
937 3300025295 Ga0209564_1000689 Ga0209564_100068915 327
938 3300025297 Ga0209758_1000333 Ga0209758_100033335 327
939 3300025298 Ga0209050_1005246 Ga0209050_10052463 327
940 3300025299 Ga0209256_1003505 Ga0209256_10035054 327
941 3300025302 Ga0207426_1000119 Ga0207426_1000119129 327
942 3300025303 Ga0209051_1000198 Ga0209051_100019852 327
943 3300025303 Ga0209051_1006097 Ga0209051_10060972 327
944 3300025304 Ga0209257_1004359 Ga0209257_10043596 327
945 iso_pu_bacteria 2509276021 2509387624 327
946 iso_pu_bacteria 2509276033 2509442988 327
947 iso_pu_bacteria 2510065019 2510132393 327
948 iso_pu_bacteria 2510461076 2510898723 327
949 iso_pu_bacteria 2513237084 2513569230 327
950 iso_pu_bacteria 2513237093 2513632669 327
951 iso_pu_bacteria 2513237103 2513709121 327
952 iso_pu_bacteria 2513237162 2514020664 327
953 iso_pu_bacteria 2515075009 2515111371 327
954 iso_pu_bacteria 2515154113 2515637084 327
955 iso_pu_bacteria 2515154114 2515644317 327
956 iso_pu_bacteria 2515154116 2515659106 327
957 iso_pu_bacteria 2516653077 2517040012 327
958 iso_pu_bacteria 2517093000 2517094145 327
959 iso_pu_bacteria 2517287029 2517405963 327
960 iso_pu_bacteria 2585427528 2585541344 327
961 iso_pu_bacteria 2585427593 2585839524 327
962 iso_pu_bacteria 2615840624 2616296133 327
963 iso_pu_bacteria 2718217882 2719180370 327
964 iso_pu_bacteria 2718217927 2719384961 327
965 iso_pu_bacteria 2718218009 2719731119 327
966 iso_pu_bacteria 2718218363 2721146464 327
967 iso_pu_bacteria 2718218365 2721157985 327
968 iso_pu_bacteria 2718218366 2721163343 327
969 iso_pu_bacteria 2718218423 2721398681 327
970 iso_pu_bacteria 2721755514 2722839513 327
971 iso_pu_bacteria 2721755809 2724037494 327
972 iso_pu_bacteria 2721755810 2724043875 327
973 iso_pu_bacteria 2724679232 2725946723 327
974 iso_pu_bacteria 2728369365 2730163607 327
975 iso_pu_bacteria 2728369397 2730297617 327
976 iso_pu_bacteria 2738541333 2739035984 327
977 iso_pu_bacteria 2765235942 2766063876 327
978 iso_pu_bacteria 2791355259 2793316204 327
979 iso_pu_bacteria 2791355260 2793321010 327
980 iso_pu_bacteria 2791355261 2793327048 327
981 iso_pu_bacteria 2791355262 2793333701 327
982 iso_pu_bacteria 2791355264 2793348010 327
983 iso_pu_bacteria 2791355265 2793355111 327
984 iso_pu_bacteria 2791355267 2793367934 327
985 iso_pu_bacteria 2802429605 2805926489 327
986 iso_pu_bacteria 2802429606 2805933300 327
987 iso_pu_bacteria 2802429633 2806046837 327
988 iso_pu_bacteria 2802429634 2806052420 327
989 iso_pu_bacteria 2802429635 2806058809 327
990 iso_pu_bacteria 2802429636 2806067423 327
991 iso_pu_bacteria 2802429637 2806074073 327
992 iso_pu_bacteria 2933586486 2933591462 327
993 iso_pu_bacteria 2936367885 2936368037 327
994 iso_pu_bacteria 2936375103 2936381570 327
995 iso_pu_bacteria 2996893221 2996898697 327
996 iso_pu_bacteria 8005275841 8005279682 327
997 iso_pu_bacteria 8005289223 8005292874 327
998 iso_pu_bacteria 8005301065 8005304680 327
999 iso_pu_bacteria 8005376324 8005376527 327
1000 iso_pu_bacteria 8005382845 8005385908 327
1001 iso_pu_bacteria 8005395548 8005400315 327
1002 iso_pu_bacteria 8005460587 8005462017 327
1003 iso_pu_bacteria 8005563573 8005570527 327
1004 iso_pu_bacteria 8005570704 8005572771 327
1005 iso_pu_bacteria 8005688590 8005691105 327
1006 iso_pu_bacteria 8005695170 8005698686 327
1007 iso_pu_bacteria 8018163183 8018169418 327
1008 iso_pu_bacteria 8018176218 8018182601 327
1009 iso_pu_bacteria 8024479707 8024481197 327
1010 iso_pu_bacteria 8024501048 8024503163 327
1011 iso_pu_bacteria 8056375014 8056380815 327
1012 iso_pu_bacteria 8056382006 8056384657 327
1013 iso_pu_bacteria 8057874678 8057876387 327
1014 3300003771 Ga0055526_1002187 Ga0055526_10021872 335
1015 3300003775 Ga0055524_1014257 Ga0055524_10142573 335
1016 3300003790 Ga0055528_1004900 Ga0055528_10049007 335
1017 iso_pu_bacteria 2582581294 2585203165 339
1018 iso_pu_bacteria 2615840698 2616554024 339
1019 iso_pu_bacteria 2667528174 2671115223 339
1020 iso_pu_bacteria 8005682033 8005684482 339
1021 3300001979 JGI24740J21852_10000287 JGI24740J21852_1000028719 343
1022 3300002737 JGI25162J39368_1002718 JGI25162J39368_10027182 343
1023 3300002774 JGI25150J39212_1000153 JGI25150J39212_100015315 343
1024 3300002987 JGI25159J45721_1000300 JGI25159J45721_100030021 343
1025 3300002987 JGI25159J45721_1001084 JGI25159J45721_10010846 343
1026 3300003187 JGI25151J46595_10000108 JGI25151J46595_1000010884 343
1027 3300003214 JGI25165J46597_1002334 JGI25165J46597_10023348 343
1028 3300003215 JGI25153J46596_10000919 JGI25153J46596_1000091911 343
1029 3300003354 JGI25160J50197_1000015 JGI25160J50197_100001588 343
1030 3300003354 JGI25160J50197_1010331 JGI25160J50197_10103312 343
1031 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005153 343
1032 3300003374 JGI25161J50226_1000051 JGI25161J50226_100005158 343
1033 3300003790 Ga0055528_1000373 Ga0055528_100037339 343
1034 3300003790 Ga0055528_1000922 Ga0055528_100092216 343
1035 3300004625 Ga0055543_1000012 Ga0055543_100001289 343
1036 3300004625 Ga0055543_1000095 Ga0055543_100009535 343
1037 3300005262 Ga0065165_1000125 Ga0065165_100012552 343
1038 3300005262 Ga0065165_1009983 Ga0065165_10099832 343
1039 3300005262 Ga0065165_1019313 Ga0065165_10193133 343
1040 3300005614 Ga0068856_100092212 Ga0068856_1000922124 343
1041 3300025233 Ga0209437_100075 Ga0209437_100075145 343
1042 3300025246 Ga0209646_1003895 Ga0209646_10038953 343
1043 3300025261 Ga0209233_1000223 Ga0209233_100022331 343
1044 3300025261 Ga0209233_1000301 Ga0209233_100030134 343
1045 3300025294 Ga0209025_1004423 Ga0209025_10044239 343
1046 3300025303 Ga0209051_1057895 Ga0209051_10578951 343
1047 3300025933 Ga0207706_10137357 Ga0207706_101373572 343
1048 3300025941 Ga0207711_10145508 Ga0207711_101455082 343
1049 3300026078 Ga0207702_10025463 Ga0207702_100254634 343
1050 3300027312 Ga0209371_1002004 Ga0209371_10020044 343
1051 3300030500 Ga0268256_1001752 Ga0268256_100175213 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

254

343

0.98

PF00108

Thiolase_N

Thiolase, N-terminal domain

56

188

0.92

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

127

210

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9793 24 343
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.973 24 343
4x9o-assembly1.cif.gz_B beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate 0.9718 21 343
4x9o-assembly1.cif.gz_A beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate 0.9694 21 343
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9656 23 343
ID Description Score Start End Superfamily
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9877 23 190 3.40.47.10
2ebdB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9788 201 343 3.40.47.10
2x3eB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9729 23 190 3.40.47.10
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9722 23 188 3.40.47.10
4x9oB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9718 21 343 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A538M788-F1-model_v4 3-oxoacyl-ACP synthase 0.9916 245 343 GO:0016746
AF-A0A800M9R9-F1-model_v4 3-oxoacyl-ACP synthase 0.989 28 175 GO:0004315
GO:0006633
GO:0044550
AF-A0A7C5GL44-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9887 246 343 GO:0033818
AF-A0A2M8PKT7-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9863 22 151 GO:0004315
GO:0006633
GO:0033818
GO:0044550
AF-A0A535AJN1-F1-model_v4 3-oxoacyl-ACP synthase 0.9856 21 180 GO:0004315
GO:0006633
GO:0044550

Feature Viewer

pLDDT pTM Quality
91.19 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map