F489067
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1051 | 777 | 588 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300001979|JGI24740J21852_10000287|JGI24740J21852_1000028719 |
| Length | 343 |
| Sequence | MPNGCPLSGRKRHERRGTSRMIRSVVRGFGAALPKRVMTNAEMEQVVDTSDDWIVQRSGIRQRYIAGEGETTASLGEQAARAALANAGMTPDDLDLIIVATSTPDNTFPATAVNIQNRLGMHHGFAFDVQAVCTGFVYAVTTADAYIRGGLAKRVLVIGAETFSRILNWTDRTTCVLFGDGAGALILEAGEGTGANSDRGVLTASLRSDGSHKDKLYVDGGPSTTGTVGVLHMAGREVFKHAVGMITDVIQAAFDATGTTPDDLDWLVPHQANRRIIDGSAKKLGIAPEKVVVTVDLHGNTSAASIPLALAVAAGDGRIKKGDLVMLEAMGGGFTWGAVLLRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 18 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 21 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 22 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 26 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 29 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 30 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 31 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 32 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 33 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 34 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 35 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 36 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 37 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 38 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 39 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 40 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 41 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 42 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 43 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 44 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 45 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 46 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 47 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 48 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 49 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 50 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 51 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 52 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 53 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 54 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 55 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 56 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 57 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 58 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 59 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 60 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 61 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 62 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 63 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 64 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 65 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 66 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 67 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 68 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 69 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 70 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 71 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 72 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 73 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 74 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 75 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 76 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 77 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 78 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 79 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 80 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 81 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 82 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 83 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 84 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 85 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 86 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 87 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 88 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 89 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 90 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 91 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 92 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 93 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 94 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 95 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 96 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 97 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 98 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 99 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 100 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 101 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 102 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 103 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 104 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 105 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 106 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 107 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 108 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 109 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 110 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 111 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 112 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 113 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 114 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 115 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 116 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 117 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 118 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 119 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 120 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 121 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 122 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 123 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 124 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 125 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 126 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 127 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 128 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 129 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 130 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 131 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 132 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 133 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 134 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 135 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 136 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 137 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 138 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 139 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 140 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 141 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 142 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 143 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 144 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 145 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 146 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 147 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 148 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 149 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 150 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 151 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 152 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 153 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 154 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 155 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 156 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 157 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 158 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 159 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 160 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 161 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 162 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 163 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 164 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 165 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 166 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 167 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 168 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 169 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 170 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 171 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 172 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 173 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 174 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 175 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 176 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 177 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 178 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 179 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 180 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 181 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 182 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 183 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 184 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 185 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 186 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 187 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 188 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 189 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 190 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 191 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 192 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 193 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 194 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 195 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 196 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 197 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 198 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 199 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 200 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 201 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 202 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 203 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 204 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 205 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 206 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 207 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 208 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 209 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 210 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 211 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 212 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 213 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 214 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 215 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 216 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 217 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 218 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 219 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 220 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 221 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 222 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 223 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 224 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 225 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 226 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 227 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 228 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 229 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 230 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 231 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 232 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 233 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 234 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 235 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 236 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 237 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 238 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 239 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 240 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 241 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 242 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 243 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 244 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 245 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 246 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 247 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 248 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 249 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 250 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 251 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 252 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 253 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 254 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 255 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 256 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 257 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 258 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 259 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 260 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 261 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 262 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 263 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 264 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 265 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 266 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 267 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 268 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 269 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 270 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 271 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 272 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 273 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 274 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 275 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 276 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 277 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 278 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 279 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 280 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 281 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 282 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 283 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 284 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 285 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 286 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 287 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 288 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 289 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 290 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 291 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 292 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 293 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 294 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 295 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 296 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 297 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 298 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 299 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 300 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 301 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 302 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 303 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 304 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 305 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 306 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 307 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 308 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 309 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 310 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 311 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 312 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 313 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 314 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 315 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 316 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 317 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 318 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 319 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 320 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 321 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 322 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 323 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 324 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 325 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 326 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 327 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 328 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 329 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 330 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 331 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 332 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 333 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 334 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 335 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 336 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 337 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 338 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 339 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 340 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 341 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 342 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 343 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 344 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 345 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 346 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 347 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 348 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 349 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 350 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 351 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 352 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 353 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 354 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 355 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 356 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 357 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 358 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 359 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 360 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 361 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 362 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 363 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 364 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 365 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 366 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 367 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 368 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 369 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 370 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 371 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 372 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 373 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 374 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 375 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 376 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 377 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 378 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 379 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 380 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 381 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 382 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 383 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 384 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 385 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 386 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 387 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 388 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 389 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 390 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 391 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 392 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 393 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 394 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 395 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 396 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 397 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 398 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 399 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 400 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 401 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 402 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 403 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 404 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 405 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 406 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 407 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 408 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 409 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 410 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 411 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 412 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 413 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 414 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 415 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 416 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 417 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 418 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 419 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 420 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 421 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 422 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 423 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 424 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 425 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 426 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 427 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 428 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 429 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 430 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 431 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 432 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 433 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 434 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 435 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 436 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 437 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 438 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 439 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 440 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 441 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 442 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 443 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 444 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 445 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 446 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 447 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 448 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 449 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 450 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 451 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 452 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 453 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 454 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 455 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 456 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 457 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 458 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 459 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 460 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 461 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 462 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 463 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 464 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 465 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 466 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 467 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 468 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 469 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 470 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 471 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 472 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 474 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 475 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 476 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 477 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 478 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 479 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 480 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 481 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 482 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 483 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 484 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 485 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 486 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 487 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 488 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 489 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 490 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 491 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 493 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 494 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 495 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 496 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 497 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 498 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 499 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 500 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 501 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 502 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 503 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 504 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 505 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 506 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 507 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 508 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 509 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 510 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 511 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 512 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 513 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 514 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 515 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 516 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 517 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 518 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 519 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 520 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 521 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 522 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 523 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 524 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 525 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 526 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 527 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 528 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 529 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 530 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 531 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 532 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 533 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 534 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 535 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 536 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 537 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 538 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 539 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 540 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 541 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 542 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 543 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 544 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 548 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 550 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 553 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 572 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 574 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 579 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 580 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 581 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 582 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 583 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 584 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 585 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 586 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 587 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 588 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 589 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 590 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 591 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 592 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 593 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 594 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 595 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 596 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 597 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 598 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 599 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 600 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 601 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 602 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 603 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 604 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 605 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 606 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 607 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 608 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 609 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 610 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 611 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 612 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 613 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 614 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 615 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 616 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 654 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 655 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 656 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 657 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 658 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 659 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 660 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 661 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 662 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 663 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 664 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 665 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 666 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 667 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 668 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 669 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 670 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 671 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 672 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 673 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 674 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 675 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 676 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 677 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 678 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 679 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 680 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 681 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 682 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 683 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 684 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 685 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 686 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 687 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 688 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 689 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 691 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 692 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 693 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 694 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 695 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 697 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 698 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 699 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 700 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 701 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 702 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 703 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 704 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 705 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 706 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 707 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 708 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 709 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 710 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 711 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 712 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 713 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 714 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 715 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 716 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 717 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 718 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 719 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 720 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 721 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 722 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 723 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 724 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 725 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 726 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 727 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 728 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 729 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 730 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 731 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 732 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 733 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 734 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 735 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 736 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 737 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 738 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 739 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 740 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 741 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 742 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 743 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 744 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 745 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 746 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 747 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 748 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 749 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 750 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 751 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 752 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 753 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 754 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 755 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 756 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 757 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 758 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 759 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 760 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 761 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 762 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 763 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 764 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 765 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 766 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 767 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 768 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 769 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 770 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 771 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 772 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 773 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 774 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 775 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 776 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 777 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 55.76 |
| Metatranscriptomes | 0.19 |
| Isolates | 44.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.48 |
| Bulb | 0 |
| Endosphere | 17.03 |
| Nodule | 33.68 |
| Rhizoplane | 2.76 |
| Rhizosphere | 30.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000287 | 3300001979 | Bacteria | 21515 |
| 2 | JGI25155J39150_1000019 | 3300002704 | Bacteria | 155636 |
| 3 | JGI25156J39149_1000020 | 3300002705 | Bacteria | 156628 |
| 4 | JGI25162J39368_1002520 | 3300002737 | Bacteria | 7005 |
| 5 | JGI25162J39368_1002718 | 3300002737 | Bacteria | 6378 |
| 6 | JGI25154J39366_1000102 | 3300002738 | Bacteria | 76188 |
| 7 | JGI25154J39366_1006945 | 3300002738 | Bacteria | 1597 |
| 8 | JGI25157J39369_1000070 | 3300002741 | Bacteria | 92090 |
| 9 | JGI25152J39213_1004023 | 3300002773 | Bacteria | 4791 |
| 10 | JGI25152J39213_1004196 | 3300002773 | Bacteria | 4633 |
| 11 | JGI25150J39212_1000153 | 3300002774 | Bacteria | 39087 |
| 12 | JGI25150J39212_1010191 | 3300002774 | Bacteria | 1756 |
| 13 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 14 | JGI25159J45721_1000300 | 3300002987 | Bacteria | 23241 |
| 15 | JGI25159J45721_1001084 | 3300002987 | Bacteria | 11608 |
| 16 | JGI25151J46595_10000108 | 3300003187 | Bacteria | 112874 |
| 17 | JGI25151J46595_10021500 | 3300003187 | Bacteria | 2699 |
| 18 | JGI25151J46595_10026953 | 3300003187 | Bacteria | 2311 |
| 19 | JGI25165J46597_1002321 | 3300003214 | Bacteria | 6449 |
| 20 | JGI25165J46597_1002334 | 3300003214 | Bacteria | 6395 |
| 21 | JGI25153J46596_10000919 | 3300003215 | Bacteria | 17895 |
| 22 | JGI25153J46596_10016204 | 3300003215 | Bacteria | 2997 |
| 23 | JGI25153J46596_10023192 | 3300003215 | Bacteria | 2268 |
| 24 | JGI25153J46596_10025545 | 3300003215 | Bacteria | 2108 |
| 25 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 26 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 27 | JGI25160J50197_1000673 | 3300003354 | Bacteria | 18931 |
| 28 | JGI25160J50197_1010331 | 3300003354 | Bacteria | 3384 |
| 29 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 30 | JGI25161J50226_1000051 | 3300003374 | Bacteria | 110051 |
| 31 | JGI25161J50226_1003466 | 3300003374 | Bacteria | 3599 |
| 32 | JGI25161J50226_1006097 | 3300003374 | Bacteria | 2229 |
| 33 | Ga0055526_1000738 | 3300003771 | Bacteria | 24652 |
| 34 | Ga0055526_1002187 | 3300003771 | Bacteria | 13403 |
| 35 | Ga0055526_1002478 | 3300003771 | Bacteria | 12467 |
| 36 | Ga0055526_1003233 | 3300003771 | Bacteria | 10498 |
| 37 | Ga0055526_1004400 | 3300003771 | Bacteria | 8482 |
| 38 | Ga0055524_1000570 | 3300003775 | Bacteria | 27529 |
| 39 | Ga0055524_1001845 | 3300003775 | Bacteria | 11602 |
| 40 | Ga0055524_1009296 | 3300003775 | Bacteria | 4014 |
| 41 | Ga0055524_1014257 | 3300003775 | Bacteria | 2956 |
| 42 | Ga0055536_1005880 | 3300003781 | Bacteria | 5883 |
| 43 | Ga0055536_1007660 | 3300003781 | Bacteria | 4787 |
| 44 | Ga0055528_1000373 | 3300003790 | Bacteria | 36405 |
| 45 | Ga0055528_1000922 | 3300003790 | Bacteria | 19685 |
| 46 | Ga0055528_1001416 | 3300003790 | Bacteria | 14694 |
| 47 | Ga0055528_1004205 | 3300003790 | Bacteria | 6987 |
| 48 | Ga0055528_1004900 | 3300003790 | Bacteria | 6320 |
| 49 | Ga0055540_1001138 | 3300003792 | Bacteria | 16587 |
| 50 | Ga0055540_1002752 | 3300003792 | Bacteria | 9028 |
| 51 | Ga0055540_1004045 | 3300003792 | Bacteria | 6817 |
| 52 | Ga0055540_1008033 | 3300003792 | Bacteria | 3861 |
| 53 | Ga0058692_1008587 | 3300003856 | Bacteria | 2631 |
| 54 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 55 | Ga0055543_1000027 | 3300004625 | Bacteria | 136033 |
| 56 | Ga0055543_1000095 | 3300004625 | Bacteria | 77750 |
| 57 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 58 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 59 | Ga0065165_1009983 | 3300005262 | Bacteria | 4175 |
| 60 | Ga0065165_1019313 | 3300005262 | Bacteria | 2438 |
| 61 | Ga0065712_10094883 | 3300005290 | Bacteria | 2238 |
| 62 | Ga0065715_10157385 | 3300005293 | Bacteria | 1663 |
| 63 | Ga0070670_100219186 | 3300005331 | Bacteria | 1655 |
| 64 | Ga0070666_10108247 | 3300005335 | Bacteria | 1921 |
| 65 | Ga0070680_100002875 | 3300005336 | Bacteria | 12790 |
| 66 | Ga0070660_100067342 | 3300005339 | Bacteria | 2789 |
| 67 | Ga0070675_100121103 | 3300005354 | Bacteria | 2223 |
| 68 | Ga0070671_100044993 | 3300005355 | Bacteria | 3668 |
| 69 | Ga0070674_100027684 | 3300005356 | Bacteria | 3716 |
| 70 | Ga0070714_100027694 | 3300005435 | Bacteria | 4695 |
| 71 | Ga0070701_10010529 | 3300005438 | Bacteria | 4092 |
| 72 | Ga0070705_100000653 | 3300005440 | Bacteria | 19834 |
| 73 | Ga0070700_100003250 | 3300005441 | Bacteria | 8365 |
| 74 | Ga0070700_100070391 | 3300005441 | Bacteria | 2230 |
| 75 | Ga0070694_100005837 | 3300005444 | Bacteria | 7470 |
| 76 | Ga0070694_100026932 | 3300005444 | Bacteria | 3730 |
| 77 | Ga0070708_100040723 | 3300005445 | Bacteria | 4070 |
| 78 | Ga0070663_100017890 | 3300005455 | Bacteria | 4633 |
| 79 | Ga0070681_10013728 | 3300005458 | Bacteria | 8064 |
| 80 | Ga0070706_100084799 | 3300005467 | Bacteria | 2935 |
| 81 | Ga0070699_100002983 | 3300005518 | Bacteria | 15031 |
| 82 | Ga0070679_100081207 | 3300005530 | Bacteria | 3231 |
| 83 | Ga0068853_100012306 | 3300005539 | Bacteria | 6958 |
| 84 | Ga0070695_100000696 | 3300005545 | Bacteria | 17958 |
| 85 | Ga0070695_100006656 | 3300005545 | Bacteria | 6830 |
| 86 | Ga0070695_100098065 | 3300005545 | Bacteria | 1969 |
| 87 | Ga0070696_100000152 | 3300005546 | Bacteria | 38688 |
| 88 | Ga0070696_100014427 | 3300005546 | Bacteria | 5300 |
| 89 | Ga0070693_100036204 | 3300005547 | Bacteria | 2742 |
| 90 | Ga0070665_100084715 | 3300005548 | Bacteria | 3175 |
| 91 | Ga0070704_100000818 | 3300005549 | Bacteria | 15440 |
| 92 | Ga0070704_100026853 | 3300005549 | Bacteria | 3810 |
| 93 | Ga0070664_100102851 | 3300005564 | Bacteria | 2486 |
| 94 | Ga0068857_100005016 | 3300005577 | Bacteria | 11252 |
| 95 | Ga0068856_100092212 | 3300005614 | Bacteria | 3014 |
| 96 | Ga0070702_100067281 | 3300005615 | Bacteria | 2104 |
| 97 | Ga0068859_100010251 | 3300005617 | Bacteria | 9432 |
| 98 | Ga0068864_100030022 | 3300005618 | Bacteria | 4608 |
| 99 | Ga0068858_100137433 | 3300005842 | Bacteria | 2294 |
| 100 | Ga0068860_100044151 | 3300005843 | Bacteria | 4249 |
| 101 | Ga0068862_100509710 | 3300005844 | Bacteria | 1143 |
| 102 | Ga0081540_1068695 | 3300005983 | Bacteria | 1649 |
| 103 | Ga0070717_10125915 | 3300006028 | Bacteria | 2199 |
| 104 | Ga0075365_10019730 | 3300006038 | Bacteria | 4168 |
| 105 | Ga0075364_10006144 | 3300006051 | Bacteria | 7030 |
| 106 | Ga0075364_10191378 | 3300006051 | Bacteria | 1386 |
| 107 | Ga0075362_10000623 | 3300006177 | Bacteria | 10347 |
| 108 | Ga0075362_10003295 | 3300006177 | Bacteria | 5618 |
| 109 | Ga0075362_10057678 | 3300006177 | Bacteria | 1750 |
| 110 | Ga0075367_10027235 | 3300006178 | Bacteria | 3250 |
| 111 | Ga0075369_10002200 | 3300006186 | Bacteria | 6896 |
| 112 | Ga0075369_10012031 | 3300006186 | Bacteria | 3413 |
| 113 | Ga0075369_10054317 | 3300006186 | Bacteria | 1739 |
| 114 | Ga0075369_10059328 | 3300006186 | Bacteria | 1667 |
| 115 | Ga0075366_10006857 | 3300006195 | Bacteria | 6267 |
| 116 | Ga0075370_10051004 | 3300006353 | Bacteria | 2347 |
| 117 | Ga0068871_100122856 | 3300006358 | Bacteria | 2195 |
| 118 | Ga0075430_100018717 | 3300006846 | Bacteria | 5895 |
| 119 | Ga0075431_100001010 | 3300006847 | Bacteria | 25028 |
| 120 | Ga0075436_100000192 | 3300006914 | Bacteria | 37698 |
| 121 | Ga0097620_100010251 | 3300006931 | Bacteria | 9432 |
| 122 | Ga0079104_1000032 | 3300006946 | Bacteria | 203094 |
| 123 | Ga0079104_1001413 | 3300006946 | Bacteria | 16212 |
| 124 | Ga0079104_1001771 | 3300006946 | Bacteria | 13574 |
| 125 | Ga0099826_10000246 | 3300006948 | Bacteria | 23828 |
| 126 | Ga0075435_100082558 | 3300007076 | Bacteria | 2641 |
| 127 | Ga0105251_10062526 | 3300009011 | Bacteria | 1748 |
| 128 | Ga0105244_10053958 | 3300009036 | Bacteria | 2041 |
| 129 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 130 | Ga0105240_10000287 | 3300009093 | Bacteria | 98443 |
| 131 | Ga0105240_10002268 | 3300009093 | Bacteria | 31194 |
| 132 | Ga0105245_10294754 | 3300009098 | Bacteria | 1590 |
| 133 | Ga0105243_10018870 | 3300009148 | Bacteria | 5229 |
| 134 | Ga0105243_10073231 | 3300009148 | Bacteria | 2775 |
| 135 | Ga0105248_10113488 | 3300009177 | Bacteria | 3056 |
| 136 | Ga0105248_10334639 | 3300009177 | Bacteria | 1705 |
| 137 | Ga0105237_10001638 | 3300009545 | Bacteria | 29067 |
| 138 | Ga0105237_10051510 | 3300009545 | Bacteria | 4135 |
| 139 | Ga0105238_10002201 | 3300009551 | Bacteria | 19682 |
| 140 | Ga0105249_10018572 | 3300009553 | Bacteria | 6189 |
| 141 | Ga0123341_1000023 | 3300009765 | Bacteria | 75951 |
| 142 | Ga0123341_1037023 | 3300009765 | Bacteria | 3348 |
| 143 | Ga0123342_1023941 | 3300009766 | Bacteria | 3892 |
| 144 | Ga0157373_10003634 | 3300013100 | Bacteria | 11653 |
| 145 | Ga0157371_10000073 | 3300013102 | Bacteria | 163215 |
| 146 | Ga0157371_10003149 | 3300013102 | Bacteria | 15210 |
| 147 | Ga0157370_10000367 | 3300013104 | Bacteria | 56787 |
| 148 | Ga0157370_10004276 | 3300013104 | Bacteria | 16446 |
| 149 | Ga0157370_10251655 | 3300013104 | Bacteria | 1634 |
| 150 | Ga0157369_10097785 | 3300013105 | Bacteria | 3131 |
| 151 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 152 | Ga0157378_10381705 | 3300013297 | Bacteria | 1384 |
| 153 | Ga0157375_10092712 | 3300013308 | Bacteria | 3085 |
| 154 | Ga0157379_10076380 | 3300014968 | Bacteria | 2999 |
| 155 | Ga0182007_10000751 | 3300015262 | Bacteria | 18251 |
| 156 | Ga0182005_1011106 | 3300015265 | Bacteria | 2575 |
| 157 | Ga0182005_1011158 | 3300015265 | Bacteria | 2568 |
| 158 | Ga0163161_10108871 | 3300017792 | Bacteria | 2069 |
| 159 | Ga0163161_10254688 | 3300017792 | Bacteria | 1369 |
| 160 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 161 | Ga0214542_1019617 | 3300021321 | Bacteria | 5250 |
| 162 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 163 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 164 | Ga0213876_10055260 | 3300021384 | Bacteria | 2096 |
| 165 | Ga0213875_10000025 | 3300021388 | Bacteria | 197787 |
| 166 | Ga0228711_1001210 | 3300022739 | Bacteria | 37182 |
| 167 | Ga0228710_1002040 | 3300022740 | Bacteria | 31310 |
| 168 | Ga0209435_100024 | 3300025206 | Bacteria | 199665 |
| 169 | Ga0209436_100032 | 3300025208 | Bacteria | 80755 |
| 170 | Ga0209436_100741 | 3300025208 | Bacteria | 13621 |
| 171 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 172 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 173 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 174 | Ga0207425_1002528 | 3300025245 | Bacteria | 6393 |
| 175 | Ga0207425_1006216 | 3300025245 | Bacteria | 3291 |
| 176 | Ga0207425_1012830 | 3300025245 | Bacteria | 1953 |
| 177 | Ga0209646_1000064 | 3300025246 | Bacteria | 246524 |
| 178 | Ga0209646_1003895 | 3300025246 | Bacteria | 2835 |
| 179 | Ga0209026_1000053 | 3300025250 | Bacteria | 246524 |
| 180 | Ga0209677_100251 | 3300025253 | Bacteria | 36562 |
| 181 | Ga0209759_1000042 | 3300025256 | Bacteria | 246524 |
| 182 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 183 | Ga0209129_1000137 | 3300025258 | Bacteria | 123213 |
| 184 | Ga0209129_1000321 | 3300025258 | Bacteria | 42440 |
| 185 | Ga0209129_1004651 | 3300025258 | Bacteria | 5251 |
| 186 | Ga0209129_1006501 | 3300025258 | Bacteria | 3754 |
| 187 | Ga0209129_1022927 | 3300025258 | Bacteria | 1121 |
| 188 | Ga0209129_1022931 | 3300025258 | Bacteria | 1121 |
| 189 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 190 | Ga0209233_1000223 | 3300025261 | Bacteria | 103765 |
| 191 | Ga0209233_1000301 | 3300025261 | Bacteria | 59293 |
| 192 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 193 | Ga0209673_1000692 | 3300025273 | Bacteria | 48181 |
| 194 | Ga0209673_1001599 | 3300025273 | Bacteria | 19964 |
| 195 | Ga0209673_1002821 | 3300025273 | Bacteria | 11209 |
| 196 | Ga0209673_1004149 | 3300025273 | Bacteria | 7927 |
| 197 | Ga0209673_1005461 | 3300025273 | Bacteria | 6377 |
| 198 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 199 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 200 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 201 | Ga0209130_1003906 | 3300025284 | Bacteria | 5978 |
| 202 | Ga0209676_1003826 | 3300025292 | Bacteria | 8863 |
| 203 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 204 | Ga0209025_1000149 | 3300025294 | Bacteria | 173393 |
| 205 | Ga0209025_1000195 | 3300025294 | Bacteria | 148218 |
| 206 | Ga0209025_1000199 | 3300025294 | Bacteria | 146058 |
| 207 | Ga0209025_1001254 | 3300025294 | Bacteria | 35128 |
| 208 | Ga0209025_1004423 | 3300025294 | Bacteria | 12218 |
| 209 | Ga0209025_1005728 | 3300025294 | Bacteria | 9983 |
| 210 | Ga0209025_1007065 | 3300025294 | Bacteria | 8499 |
| 211 | Ga0209025_1024639 | 3300025294 | Bacteria | 3097 |
| 212 | Ga0209025_1043027 | 3300025294 | Bacteria | 1910 |
| 213 | Ga0209025_1050622 | 3300025294 | Bacteria | 1659 |
| 214 | Ga0209564_1000330 | 3300025295 | Bacteria | 92033 |
| 215 | Ga0209564_1000668 | 3300025295 | Bacteria | 50729 |
| 216 | Ga0209564_1000689 | 3300025295 | Bacteria | 49634 |
| 217 | Ga0209564_1002094 | 3300025295 | Bacteria | 17073 |
| 218 | Ga0209564_1006711 | 3300025295 | Bacteria | 6117 |
| 219 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 220 | Ga0209758_1000333 | 3300025297 | Bacteria | 88318 |
| 221 | Ga0209758_1000939 | 3300025297 | Bacteria | 39327 |
| 222 | Ga0209758_1001333 | 3300025297 | Bacteria | 29905 |
| 223 | Ga0209758_1001529 | 3300025297 | Bacteria | 26686 |
| 224 | Ga0209758_1002147 | 3300025297 | Bacteria | 20766 |
| 225 | Ga0209050_1005246 | 3300025298 | Bacteria | 8259 |
| 226 | Ga0209050_1009022 | 3300025298 | Bacteria | 5191 |
| 227 | Ga0209256_1000445 | 3300025299 | Bacteria | 63065 |
| 228 | Ga0209256_1002049 | 3300025299 | Bacteria | 17886 |
| 229 | Ga0209256_1002795 | 3300025299 | Bacteria | 13380 |
| 230 | Ga0209256_1003247 | 3300025299 | Bacteria | 11690 |
| 231 | Ga0209256_1003424 | 3300025299 | Bacteria | 11142 |
| 232 | Ga0209256_1003505 | 3300025299 | Bacteria | 10937 |
| 233 | Ga0209256_1006028 | 3300025299 | Bacteria | 6627 |
| 234 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 235 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 236 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 237 | Ga0207426_1000119 | 3300025302 | Bacteria | 221800 |
| 238 | Ga0207426_1001660 | 3300025302 | Bacteria | 17296 |
| 239 | Ga0209051_1000198 | 3300025303 | Bacteria | 106688 |
| 240 | Ga0209051_1001187 | 3300025303 | Bacteria | 23555 |
| 241 | Ga0209051_1006097 | 3300025303 | Bacteria | 6867 |
| 242 | Ga0209051_1007393 | 3300025303 | Bacteria | 6011 |
| 243 | Ga0209051_1052842 | 3300025303 | Bacteria | 1339 |
| 244 | Ga0209051_1057895 | 3300025303 | Bacteria | 1239 |
| 245 | Ga0209257_1001197 | 3300025304 | Bacteria | 32625 |
| 246 | Ga0209257_1004359 | 3300025304 | Bacteria | 11026 |
| 247 | Ga0209257_1005909 | 3300025304 | Bacteria | 8240 |
| 248 | Ga0209257_1020380 | 3300025304 | Bacteria | 2453 |
| 249 | Ga0207653_10004438 | 3300025885 | Bacteria | 4399 |
| 250 | Ga0207647_10014660 | 3300025904 | Bacteria | 5400 |
| 251 | Ga0207699_10074236 | 3300025906 | Bacteria | 2089 |
| 252 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 253 | Ga0207695_10003756 | 3300025913 | Bacteria | 21075 |
| 254 | Ga0207652_10054040 | 3300025921 | Bacteria | 3452 |
| 255 | Ga0207652_10136381 | 3300025921 | Bacteria | 2192 |
| 256 | Ga0207650_10220266 | 3300025925 | Bacteria | 1527 |
| 257 | Ga0207659_10284613 | 3300025926 | Bacteria | 1353 |
| 258 | Ga0207664_10017769 | 3300025929 | Bacteria | 5224 |
| 259 | Ga0207644_10073870 | 3300025931 | Bacteria | 2501 |
| 260 | Ga0207706_10137357 | 3300025933 | Bacteria | 2151 |
| 261 | Ga0207709_10028555 | 3300025935 | Bacteria | 3226 |
| 262 | Ga0207669_10186988 | 3300025937 | Bacteria | 1490 |
| 263 | Ga0207665_10010248 | 3300025939 | Bacteria | 6157 |
| 264 | Ga0207711_10107918 | 3300025941 | Bacteria | 2472 |
| 265 | Ga0207711_10145508 | 3300025941 | Bacteria | 2135 |
| 266 | Ga0207689_10037982 | 3300025942 | Bacteria | 3990 |
| 267 | Ga0207661_10130247 | 3300025944 | Bacteria | 2154 |
| 268 | Ga0207651_10219877 | 3300025960 | Bacteria | 1535 |
| 269 | Ga0207712_10010754 | 3300025961 | Bacteria | 5817 |
| 270 | Ga0207668_10183134 | 3300025972 | Bacteria | 1654 |
| 271 | Ga0207703_10187414 | 3300026035 | Bacteria | 1830 |
| 272 | Ga0207703_10202689 | 3300026035 | Bacteria | 1764 |
| 273 | Ga0207639_10013263 | 3300026041 | Bacteria | 5762 |
| 274 | Ga0207678_10001597 | 3300026067 | Bacteria | 20859 |
| 275 | Ga0207678_10077942 | 3300026067 | Bacteria | 2838 |
| 276 | Ga0207678_10273964 | 3300026067 | Bacteria | 1448 |
| 277 | Ga0207708_10002614 | 3300026075 | Bacteria | 13246 |
| 278 | Ga0207702_10025463 | 3300026078 | Bacteria | 4910 |
| 279 | Ga0207676_10007549 | 3300026095 | Bacteria | 7715 |
| 280 | Ga0207674_10010738 | 3300026116 | Bacteria | 10337 |
| 281 | Ga0207683_10086820 | 3300026121 | Bacteria | 2782 |
| 282 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 283 | Ga0209281_1000236 | 3300027111 | Bacteria | 113362 |
| 284 | Ga0209281_1000666 | 3300027111 | Bacteria | 36327 |
| 285 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 286 | Ga0209371_1001000 | 3300027312 | Bacteria | 21692 |
| 287 | Ga0209371_1002004 | 3300027312 | Bacteria | 12256 |
| 288 | Ga0209282_1000022 | 3300027666 | Bacteria | 173388 |
| 289 | Ga0209282_1019506 | 3300027666 | Bacteria | 4302 |
| 290 | Ga0209813_10001495 | 3300027866 | Bacteria | 5255 |
| 291 | Ga0268266_10072784 | 3300028379 | Bacteria | 2981 |
| 292 | Ga0268266_10103119 | 3300028379 | Bacteria | 2517 |
| 293 | Ga0268265_10000666 | 3300028380 | Bacteria | 34070 |
| 294 | Ga0268264_10008316 | 3300028381 | Bacteria | 8626 |
| 295 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 296 | Ga0307515_10003358 | 3300028794 | Bacteria | 33776 |
| 297 | Ga0307515_10031717 | 3300028794 | Bacteria | 8789 |
| 298 | Ga0307515_10198518 | 3300028794 | Bacteria | 1890 |
| 299 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 300 | Ga0268256_1001752 | 3300030500 | Bacteria | 12256 |
| 301 | Ga0268256_1003889 | 3300030500 | Bacteria | 6493 |
| 302 | Ga0307513_10003448 | 3300031456 | Bacteria | 21410 |
| 303 | Ga0307513_10038489 | 3300031456 | Bacteria | 5310 |
| 304 | Ga0307408_100061695 | 3300031548 | Bacteria | 2737 |
| 305 | Ga0307408_100141482 | 3300031548 | Bacteria | 1889 |
| 306 | Ga0307405_10022442 | 3300031731 | Bacteria | 3569 |
| 307 | Ga0307406_10075804 | 3300031901 | Bacteria | 2220 |
| 308 | Ga0307406_10085988 | 3300031901 | Bacteria | 2104 |
| 309 | Ga0307406_10333447 | 3300031901 | Bacteria | 1178 |
| 310 | Ga0307412_10017364 | 3300031911 | Bacteria | 4307 |
| 311 | Ga0307412_10340530 | 3300031911 | Bacteria | 1200 |
| 312 | Ga0315914_1000027 | 3300031967 | Bacteria | 106536 |
| 313 | Ga0307409_100090847 | 3300031995 | Bacteria | 2501 |
| 314 | Ga0307416_100074867 | 3300032002 | Bacteria | 2831 |
| 315 | Ga0315913_1000631 | 3300033430 | Bacteria | 33112 |
| 316 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 317 | Ga0373935_0019248 | 3300035692 | Bacteria | 4164 |
| 318 | Ga0373927_0000284 | 3300035695 | Bacteria | 39864 |
| 319 | Ga0316582_0087429 | 3300036647 | Bacteria | 2046 |
| 320 | Ga0316584_0020033 | 3300036712 | Bacteria | 4844 |
| 321 | Ga0395900_0358169 | 3300037418 | Bacteria | 1431 |
| 322 | Ga0436364_1209910 | 3300037853 | Bacteria | 45322 |
| 323 | Ga0436365_1347694 | 3300039437 | Bacteria | 4328 |
| 324 | Ga0439436_0033487 | 3300041404 | Bacteria | 1488 |
| 325 | Ga0439436_0034797 | 3300041404 | Bacteria | 1456 |
| 326 | Ga0439453_0008879 | 3300041408 | Bacteria | 1625 |
| 327 | Ga0439465_0015313 | 3300041413 | Bacteria | 2392 |
| 328 | Ga0451798_0111375 | 3300041458 | Bacteria | 2300 |
| 329 | Ga0451833_0094896 | 3300041491 | Bacteria | 1035 |
| 330 | Ga0451835_0809115 | 3300041492 | Bacteria | 1127 |
| 331 | Ga0451840_23403 | 3300041497 | Bacteria | 4518 |
| 332 | Ga0451841_0711977 | 3300041498 | Bacteria | 2214 |
| 333 | Ga0451841_0993646 | 3300041498 | Bacteria | 1014 |
| 334 | Ga0451845_0762944 | 3300041501 | Bacteria | 1838 |
| 335 | Ga0451851_0868710 | 3300041507 | Bacteria | 2859 |
| 336 | Ga0439445_0005918 | 3300042004 | Bacteria | 2800 |
| 337 | Ga0439449_0006656 | 3300042007 | Bacteria | 4418 |
| 338 | Ga0439449_0012014 | 3300042007 | Bacteria | 3254 |
| 339 | Ga0439449_0014578 | 3300042007 | Bacteria | 2954 |
| 340 | Ga0450920_003028 | 3300042122 | Bacteria | 2899 |
| 341 | Ga0450906_015182 | 3300042145 | Bacteria | 1401 |
| 342 | Ga0439435_0003123 | 3300042436 | Bacteria | 3401 |
| 343 | Ga0450918_007781 | 3300042531 | Bacteria | 1888 |
| 344 | Ga0466966_0130349 | 3300044684 | Bacteria | 1540 |
| 345 | Ga0451576_0136399 | 3300045051 | Bacteria | 2559 |
| 346 | Ga0466967_0262483 | 3300045976 | Bacteria | 1653 |
| 347 | Ga0495617_033008 | 3300046452 | Bacteria | 1738 |
| 348 | Ga0495592_0102284 | 3300046454 | Bacteria | 2040 |
| 349 | Ga0495603_0184963 | 3300046455 | Bacteria | 1205 |
| 350 | Ga0495629_0021261 | 3300046459 | Bacteria | 4630 |
| 351 | Ga0495638_0000345 | 3300046460 | Bacteria | 58430 |
| 352 | Ga0495638_0062117 | 3300046460 | Bacteria | 2306 |
| 353 | Ga0495638_0100193 | 3300046460 | Bacteria | 1734 |
| 354 | Ga0495605_0001360 | 3300046474 | Bacteria | 16142 |
| 355 | Ga0495605_0020751 | 3300046474 | Bacteria | 3489 |
| 356 | Ga0495662_0039412 | 3300046476 | Bacteria | 2282 |
| 357 | Ga0495585_0012568 | 3300046492 | Bacteria | 4988 |
| 358 | Ga0495585_0034091 | 3300046492 | Bacteria | 2878 |
| 359 | Ga0495585_0163856 | 3300046492 | Bacteria | 1152 |
| 360 | Ga0495583_0003514 | 3300046506 | Bacteria | 11849 |
| 361 | Ga0495606_0002521 | 3300046507 | Bacteria | 21081 |
| 362 | Ga0495606_0030969 | 3300046507 | Bacteria | 3726 |
| 363 | Ga0495606_0093417 | 3300046507 | Bacteria | 1845 |
| 364 | Ga0495606_0115906 | 3300046507 | Bacteria | 1610 |
| 365 | Ga0495610_0002413 | 3300046512 | Bacteria | 15738 |
| 366 | Ga0495610_0010234 | 3300046512 | Bacteria | 5847 |
| 367 | Ga0495610_0048501 | 3300046512 | Bacteria | 2084 |
| 368 | Ga0495616_0030109 | 3300046513 | Bacteria | 2856 |
| 369 | Ga0495620_0007040 | 3300046515 | Bacteria | 6134 |
| 370 | Ga0495620_0042426 | 3300046515 | Bacteria | 1987 |
| 371 | Ga0495628_0106966 | 3300046516 | Bacteria | 2154 |
| 372 | Ga0495631_0001592 | 3300046518 | Bacteria | 13626 |
| 373 | Ga0495631_0005243 | 3300046518 | Bacteria | 6818 |
| 374 | Ga0495632_0003502 | 3300046519 | Bacteria | 11105 |
| 375 | Ga0495632_0045724 | 3300046519 | Bacteria | 2179 |
| 376 | Ga0495632_0096029 | 3300046519 | Bacteria | 1400 |
| 377 | Ga0495643_0023240 | 3300046522 | Bacteria | 3526 |
| 378 | Ga0495644_0030282 | 3300046523 | Bacteria | 2044 |
| 379 | Ga0495654_0001395 | 3300046530 | Bacteria | 16737 |
| 380 | Ga0495654_0030158 | 3300046530 | Bacteria | 2761 |
| 381 | Ga0495654_0058357 | 3300046530 | Bacteria | 1862 |
| 382 | Ga0495609_0012341 | 3300046538 | Bacteria | 4053 |
| 383 | Ga0495597_0005942 | 3300046542 | Bacteria | 6369 |
| 384 | Ga0495633_0032933 | 3300046558 | Bacteria | 2501 |
| 385 | Ga0495656_0024072 | 3300046615 | Bacteria | 2401 |
| 386 | Ga0495656_0072706 | 3300046615 | Bacteria | 1531 |
| 387 | Ga0495668_0004221 | 3300046616 | Bacteria | 10345 |
| 388 | Ga0495668_0024399 | 3300046616 | Bacteria | 3439 |
| 389 | Ga0495668_0064377 | 3300046616 | Bacteria | 2018 |
| 390 | Ga0495668_0136775 | 3300046616 | Bacteria | 1341 |
| 391 | Ga0495634_0146090 | 3300046642 | Bacteria | 1498 |
| 392 | Ga0495625_0001088 | 3300046660 | Bacteria | 35282 |
| 393 | Ga0495625_0028080 | 3300046660 | Bacteria | 4223 |
| 394 | Ga0495625_0177471 | 3300046660 | Bacteria | 1419 |
| 395 | Ga0495635_0024640 | 3300046663 | Bacteria | 4193 |
| 396 | Ga0495661_0022101 | 3300046665 | Bacteria | 4141 |
| 397 | Ga0495661_0095362 | 3300046665 | Bacteria | 1685 |
| 398 | Ga0495588_0001683 | 3300046674 | Bacteria | 9419 |
| 399 | Ga0495588_0049618 | 3300046674 | Bacteria | 2159 |
| 400 | Ga0495588_0107862 | 3300046674 | Bacteria | 1466 |
| 401 | Ga0495657_0017756 | 3300046675 | Bacteria | 5162 |
| 402 | Ga0495670_0044353 | 3300046691 | Bacteria | 2220 |
| 403 | Ga0495670_0068014 | 3300046691 | Bacteria | 1799 |
| 404 | Ga0495649_0012099 | 3300046694 | Bacteria | 5036 |
| 405 | Ga0495660_0016163 | 3300046810 | Bacteria | 4304 |
| 406 | Ga0495660_0171806 | 3300046810 | Bacteria | 1055 |
| 407 | Ga0495676_0263535 | 3300047321 | Bacteria | 1172 |
| 408 | Ga0495685_050219 | 3300047447 | Bacteria | 1416 |
| 409 | Ga0495681_0005856 | 3300047470 | Bacteria | 8164 |
| 410 | Ga0495686_0001186 | 3300047472 | Bacteria | 30396 |
| 411 | Ga0495686_0008846 | 3300047472 | Bacteria | 7330 |
| 412 | Ga0495686_0079054 | 3300047472 | Bacteria | 2012 |
| 413 | Ga0496100_0028459 | 3300048903 | Bacteria | 3447 |
| 414 | Ga0496101_0029660 | 3300048904 | Bacteria | 3827 |
| 415 | Ga0496102_0016475 | 3300048905 | Bacteria | 6459 |
| 416 | Ga0496102_0099255 | 3300048905 | Bacteria | 2702 |
| 417 | Ga0496102_0285997 | 3300048905 | Bacteria | 1554 |
| 418 | Ga0496103_0010271 | 3300048906 | Bacteria | 5536 |
| 419 | Ga0496103_0020844 | 3300048906 | Bacteria | 3941 |
| 420 | Ga0496104_0000206 | 3300048907 | Bacteria | 52627 |
| 421 | Ga0496105_0146951 | 3300048908 | Bacteria | 1938 |
| 422 | Ga0496105_0149665 | 3300048908 | Bacteria | 1919 |
| 423 | Ga0496106_0000131 | 3300048909 | Bacteria | 56905 |
| 424 | Ga0496106_0008447 | 3300048909 | Bacteria | 7619 |
| 425 | Ga0496106_0070826 | 3300048909 | Bacteria | 2663 |
| 426 | Ga0496107_0002446 | 3300048910 | Bacteria | 12041 |
| 427 | Ga0496107_0017994 | 3300048910 | Bacteria | 4972 |
| 428 | Ga0496108_0254874 | 3300048911 | Bacteria | 1527 |
| 429 | Ga0496110_0078769 | 3300048913 | Bacteria | 2934 |
| 430 | Ga0496111_0002760 | 3300048914 | Bacteria | 10681 |
| 431 | Ga0496114_0032152 | 3300048917 | Bacteria | 4318 |
| 432 | Ga0496114_0185003 | 3300048917 | Bacteria | 1820 |
| 433 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 434 | Ga0496116_0014290 | 3300048919 | Bacteria | 6350 |
| 435 | Ga0496116_0041974 | 3300048919 | Bacteria | 3132 |
| 436 | Ga0496116_0057118 | 3300048919 | Bacteria | 2553 |
| 437 | Ga0496116_0078008 | 3300048919 | Bacteria | 2067 |
| 438 | Ga0496116_0173581 | 3300048919 | Bacteria | 1164 |
| 439 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 440 | Ga0496117_0001755 | 3300048920 | Bacteria | 29822 |
| 441 | Ga0496117_0005544 | 3300048920 | Bacteria | 13212 |
| 442 | Ga0496117_0064375 | 3300048920 | Bacteria | 2500 |
| 443 | Ga0496117_0099511 | 3300048920 | Bacteria | 1844 |
| 444 | Ga0496117_0182810 | 3300048920 | Bacteria | 1203 |
| 445 | Ga0496118_0000245 | 3300048921 | Bacteria | 96235 |
| 446 | Ga0496118_0002030 | 3300048921 | Bacteria | 28629 |
| 447 | Ga0496118_0018801 | 3300048921 | Bacteria | 6205 |
| 448 | Ga0496118_0033169 | 3300048921 | Bacteria | 4242 |
| 449 | Ga0496118_0040343 | 3300048921 | Bacteria | 3713 |
| 450 | Ga0496119_0012473 | 3300048922 | Bacteria | 6896 |
| 451 | Ga0496119_0060959 | 3300048922 | Bacteria | 2255 |
| 452 | Ga0496120_0003652 | 3300048923 | Bacteria | 13790 |
| 453 | Ga0496120_0005743 | 3300048923 | Bacteria | 9762 |
| 454 | Ga0496120_0071949 | 3300048923 | Bacteria | 1896 |
| 455 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 456 | Ga0496121_0001362 | 3300048924 | Bacteria | 41630 |
| 457 | Ga0496121_0002297 | 3300048924 | Bacteria | 29664 |
| 458 | Ga0496121_0004948 | 3300048924 | Bacteria | 17475 |
| 459 | Ga0496121_0026655 | 3300048924 | Bacteria | 5435 |
| 460 | Ga0496121_0039654 | 3300048924 | Bacteria | 4145 |
| 461 | Ga0496121_0116302 | 3300048924 | Bacteria | 2028 |
| 462 | Ga0496121_0289889 | 3300048924 | Bacteria | 1116 |
| 463 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 464 | Ga0496122_0001240 | 3300048925 | Bacteria | 43048 |
| 465 | Ga0496122_0021829 | 3300048925 | Bacteria | 5713 |
| 466 | Ga0496122_0031679 | 3300048925 | Bacteria | 4392 |
| 467 | Ga0496122_0055344 | 3300048925 | Bacteria | 2969 |
| 468 | Ga0496122_0073151 | 3300048925 | Bacteria | 2432 |
| 469 | Ga0496122_0117736 | 3300048925 | Bacteria | 1724 |
| 470 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 471 | Ga0496123_0009901 | 3300048926 | Bacteria | 8506 |
| 472 | Ga0496123_0010973 | 3300048926 | Bacteria | 7924 |
| 473 | Ga0496123_0035684 | 3300048926 | Bacteria | 3539 |
| 474 | Ga0496124_0003293 | 3300048927 | Bacteria | 19911 |
| 475 | Ga0496124_0010499 | 3300048927 | Bacteria | 9370 |
| 476 | Ga0496124_0012884 | 3300048927 | Bacteria | 8210 |
| 477 | Ga0496124_0014751 | 3300048927 | Bacteria | 7540 |
| 478 | Ga0496124_0019653 | 3300048927 | Bacteria | 6275 |
| 479 | Ga0496124_0033232 | 3300048927 | Bacteria | 4539 |
| 480 | Ga0496124_0053944 | 3300048927 | Bacteria | 3404 |
| 481 | Ga0496124_0312433 | 3300048927 | Bacteria | 1129 |
| 482 | Ga0496124_0388263 | 3300048927 | Bacteria | 973 |
| 483 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 484 | Ga0496125_0000372 | 3300048928 | Bacteria | 84272 |
| 485 | Ga0496125_0007106 | 3300048928 | Bacteria | 11951 |
| 486 | Ga0496125_0008057 | 3300048928 | Bacteria | 11119 |
| 487 | Ga0496125_0038081 | 3300048928 | Bacteria | 4169 |
| 488 | Ga0496125_0299753 | 3300048928 | Bacteria | 985 |
| 489 | Ga0496126_0000156 | 3300048929 | Bacteria | 158537 |
| 490 | Ga0496126_0033319 | 3300048929 | Bacteria | 4847 |
| 491 | Ga0496126_0136908 | 3300048929 | Bacteria | 2111 |
| 492 | Ga0501031_0031646 | 3300049568 | Bacteria | 3451 |
| 493 | Ga0501031_0040766 | 3300049568 | Bacteria | 3031 |
| 494 | Ga0501032_0061225 | 3300049569 | Bacteria | 2523 |
| 495 | Ga0501032_0162324 | 3300049569 | Bacteria | 1467 |
| 496 | Ga0501033_0103709 | 3300049570 | Bacteria | 2074 |
| 497 | Ga0501034_0015883 | 3300049571 | Bacteria | 7731 |
| 498 | Ga0501034_0058603 | 3300049571 | Bacteria | 3870 |
| 499 | Ga0501034_0108137 | 3300049571 | Bacteria | 2772 |
| 500 | Ga0501034_0191926 | 3300049571 | Bacteria | 2004 |
| 501 | Ga0501036_0096502 | 3300049572 | Bacteria | 2499 |
| 502 | Ga0501037_0070315 | 3300049573 | Bacteria | 2547 |
| 503 | Ga0501038_0096666 | 3300049574 | Bacteria | 2465 |
| 504 | Ga0501039_0031973 | 3300049575 | Bacteria | 4057 |
| 505 | Ga0501042_0212001 | 3300049578 | Bacteria | 1397 |
| 506 | Ga0501043_0032530 | 3300049579 | Bacteria | 4101 |
| 507 | Ga0501043_0102136 | 3300049579 | Bacteria | 2254 |
| 508 | Ga0501047_0043731 | 3300049581 | Bacteria | 4327 |
| 509 | Ga0501047_0150795 | 3300049581 | Bacteria | 2201 |
| 510 | Ga0501047_0232703 | 3300049581 | Bacteria | 1695 |
| 511 | Ga0501047_0302897 | 3300049581 | Bacteria | 1440 |
| 512 | Ga0501048_0047307 | 3300049582 | Bacteria | 3069 |
| 513 | Ga0501048_0254611 | 3300049582 | Bacteria | 1247 |
| 514 | Ga0501067_0055512 | 3300049583 | Bacteria | 2195 |
| 515 | Ga0501068_0211263 | 3300049584 | Bacteria | 1232 |
| 516 | Ga0501069_0017084 | 3300049585 | Bacteria | 3901 |
| 517 | Ga0501069_0046480 | 3300049585 | Bacteria | 2408 |
| 518 | Ga0501069_0155426 | 3300049585 | Bacteria | 1315 |
| 519 | Ga0501070_0007975 | 3300049586 | Bacteria | 8970 |
| 520 | Ga0501070_0065280 | 3300049586 | Bacteria | 3013 |
| 521 | Ga0501070_0131503 | 3300049586 | Bacteria | 2067 |
| 522 | Ga0501070_0140797 | 3300049586 | Bacteria | 1991 |
| 523 | Ga0501071_0031091 | 3300049587 | Bacteria | 3782 |
| 524 | Ga0501073_0022827 | 3300049589 | Bacteria | 4500 |
| 525 | Ga0501073_0027826 | 3300049589 | Bacteria | 4040 |
| 526 | Ga0501073_0032875 | 3300049589 | Bacteria | 3696 |
| 527 | Ga0501073_0115636 | 3300049589 | Bacteria | 1859 |
| 528 | Ga0501074_0088466 | 3300049590 | Bacteria | 2218 |
| 529 | Ga0501074_0090168 | 3300049590 | Bacteria | 2195 |
| 530 | Ga0501074_0103468 | 3300049590 | Bacteria | 2038 |
| 531 | Ga0501076_0088269 | 3300049592 | Bacteria | 2492 |
| 532 | Ga0501079_0015885 | 3300049741 | Bacteria | 5754 |
| 533 | Ga0501080_0158944 | 3300049742 | Bacteria | 2087 |
| 534 | Ga0501080_0387180 | 3300049742 | Bacteria | 1259 |
| 535 | Ga0501083_0018433 | 3300049744 | Bacteria | 4864 |
| 536 | Ga0501280_004688 | 3300049776 | Bacteria | 1992 |
| 537 | Ga0501035_0004051 | 3300049822 | Bacteria | 13958 |
| 538 | Ga0501044_0016990 | 3300049823 | Bacteria | 7808 |
| 539 | Ga0501044_0057433 | 3300049823 | Bacteria | 3993 |
| 540 | Ga0501044_0155713 | 3300049823 | Bacteria | 2264 |
| 541 | Ga0501044_0299598 | 3300049823 | Bacteria | 1537 |
| 542 | Ga0501045_0013776 | 3300049824 | Bacteria | 5717 |
| 543 | nmdc:mga03683_47168_c1 | 3300050489 | Bacteria | 1787 |
| 544 | nmdc:mga03683_9527_c1 | 3300050489 | Bacteria | 3459 |
| 545 | nmdc:mga03n38_42047_c1 | 3300050490 | Bacteria | 1995 |
| 546 | nmdc:mga03n38_98627_c1 | 3300050490 | Bacteria | 1406 |
| 547 | nmdc:mga00v17_1229_c1 | 3300050491 | Bacteria | 13446 |
| 548 | nmdc:mga00v17_5147_c1 | 3300050491 | Bacteria | 6877 |
| 549 | nmdc:mga0yw44_432_c1 | 3300050492 | Bacteria | 14715 |
| 550 | nmdc:mga0yw44_48751_c1 | 3300050492 | Bacteria | 2554 |
| 551 | nmdc:mga0yw44_7190_c1 | 3300050492 | Bacteria | 5454 |
| 552 | nmdc:mga0k408_572_c1 | 3300050493 | Bacteria | 20327 |
| 553 | nmdc:mga06z11_21852_c1 | 3300050494 | Bacteria | 2979 |
| 554 | nmdc:mga06z11_23069_c1 | 3300050494 | Bacteria | 2917 |
| 555 | nmdc:mga04h51_112076_c1 | 3300050495 | Bacteria | 1007 |
| 556 | nmdc:mga05p37_107567_c1 | 3300050507 | Bacteria | 3431 |
| 557 | nmdc:mga0qj67_2103_c1 | 3300050509 | Bacteria | 14183 |
| 558 | nmdc:mga06r32_7619_c1 | 3300050510 | Bacteria | 9735 |
| 559 | nmdc:mga08y16_33378_c1 | 3300050511 | Bacteria | 5405 |
| 560 | nmdc:mga0rr50_38609_c1 | 3300050513 | Bacteria | 3457 |
| 561 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 562 | nmdc:mga08x19_345343_c1 | 3300050514 | Bacteria | 1038 |
| 563 | nmdc:mga0sz30_1101_c1 | 3300050516 | Bacteria | 9705 |
| 564 | nmdc:mga0sz30_29169_c1 | 3300050516 | Bacteria | 2273 |
| 565 | nmdc:mga0sz30_3155_c1 | 3300050516 | Bacteria | 5900 |
| 566 | nmdc:mga0sz30_7817_c1 | 3300050516 | Bacteria | 4020 |
| 567 | Ga0500557_057290 | 3300053105 | Bacteria | 1260 |
| 568 | Ga0500560_023531 | 3300053107 | Bacteria | 1787 |
| 569 | Ga0500562_001480 | 3300053108 | Bacteria | 5789 |
| 570 | Ga0500618_000219 | 3300053125 | Bacteria | 45126 |
| 571 | Ga0500658_0002169 | 3300053134 | Bacteria | 7627 |
| 572 | Ga0500561_0000395 | 3300053137 | Bacteria | 7211 |
| 573 | Ga0500568_0001538 | 3300053139 | Bacteria | 14675 |
| 574 | Ga0500568_0009665 | 3300053139 | Bacteria | 4567 |
| 575 | Ga0500573_0000489 | 3300053140 | Bacteria | 17073 |
| 576 | Ga0500588_0081120 | 3300053146 | Bacteria | 1085 |
| 577 | Ga0500616_0000744 | 3300053153 | Bacteria | 37551 |
| 578 | Ga0500616_0001288 | 3300053153 | Bacteria | 24938 |
| 579 | Ga0500616_0054232 | 3300053153 | Bacteria | 2100 |
| 580 | Ga0500622_0000338 | 3300053156 | Bacteria | 46041 |
| 581 | Ga0500624_000280 | 3300053157 | Bacteria | 17619 |
| 582 | Ga0500634_0000567 | 3300053161 | Bacteria | 12240 |
| 583 | Ga0500636_0000118 | 3300053177 | Bacteria | 41422 |
| 584 | Ga0500636_0127242 | 3300053177 | Bacteria | 1423 |
| 585 | Ga0500645_019310 | 3300053730 | Bacteria | 2121 |
| 586 | Ga0501084_0040029 | 3300054114 | Bacteria | 3920 |
| 587 | Ga0587090_008423 | 3300059510 | Bacteria | 1383 |
| 588 | Ga0501082_0128360 | 3300060353 | Bacteria | 2200 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2906354277 | 2906357254 | 282 |
| 2 | 3300013297 | Ga0157378_10381705 | Ga0157378_103817052 | 284 |
| 3 | 3300050492 | nmdc:mga0yw44_48751_c1 | nmdc:mga0yw44_48751_c1_330_1307 | 297 |
| 4 | 3300048905 | Ga0496102_0285997 | Ga0496102_0285997_389_1285 | 298 |
| 5 | 3300049585 | Ga0501069_0046480 | Ga0501069_0046480_1380_2276 | 298 |
| 6 | 3300049822 | Ga0501035_0004051 | Ga0501035_0004051_5645_6541 | 298 |
| 7 | 3300046454 | Ga0495592_0102284 | Ga0495592_0102284_86_988 | 300 |
| 8 | 3300037418 | Ga0395900_0358169 | Ga0395900_0358169_125_1030 | 301 |
| 9 | 3300046474 | Ga0495605_0020751 | Ga0495605_0020751_202_1107 | 301 |
| 10 | 3300046507 | Ga0495606_0030969 | Ga0495606_0030969_192_1097 | 301 |
| 11 | 3300046512 | Ga0495610_0048501 | Ga0495610_0048501_864_1769 | 301 |
| 12 | 3300046513 | Ga0495616_0030109 | Ga0495616_0030109_958_1863 | 301 |
| 13 | 3300046515 | Ga0495620_0007040 | Ga0495620_0007040_4424_5329 | 301 |
| 14 | 3300046519 | Ga0495632_0003502 | Ga0495632_0003502_1416_2321 | 301 |
| 15 | 3300046519 | Ga0495632_0045724 | Ga0495632_0045724_728_1633 | 301 |
| 16 | 3300046523 | Ga0495644_0030282 | Ga0495644_0030282_368_1273 | 301 |
| 17 | 3300046530 | Ga0495654_0058357 | Ga0495654_0058357_686_1591 | 301 |
| 18 | 3300046542 | Ga0495597_0005942 | Ga0495597_0005942_4982_5887 | 301 |
| 19 | 3300046616 | Ga0495668_0064377 | Ga0495668_0064377_250_1155 | 301 |
| 20 | 3300046660 | Ga0495625_0028080 | Ga0495625_0028080_823_1728 | 301 |
| 21 | 3300046810 | Ga0495660_0016163 | Ga0495660_0016163_61_966 | 301 |
| 22 | 3300047447 | Ga0495685_050219 | Ga0495685_050219_252_1157 | 301 |
| 23 | 3300047472 | Ga0495686_0008846 | Ga0495686_0008846_5699_6604 | 301 |
| 24 | 3300048928 | Ga0496125_0299753 | Ga0496125_0299753_69_974 | 301 |
| 25 | 3300050495 | nmdc:mga04h51_112076_c1 | nmdc:mga04h51_112076_c1_92_997 | 301 |
| 26 | 3300053134 | Ga0500658_0002169 | Ga0500658_0002169_2641_3546 | 301 |
| 27 | 3300053153 | Ga0500616_0054232 | Ga0500616_0054232_117_1022 | 301 |
| 28 | iso_pu_bacteria | 2524023209 | 2524460566 | 302 |
| 29 | iso_pu_bacteria | 2582581298 | 2585221077 | 302 |
| 30 | iso_pu_bacteria | 2585427529 | 2585549279 | 302 |
| 31 | iso_pu_bacteria | 2838022645 | 2838023056 | 302 |
| 32 | iso_pu_bacteria | 2838668709 | 2838670936 | 302 |
| 33 | iso_pu_bacteria | 2838701080 | 2838703307 | 302 |
| 34 | iso_pu_bacteria | 2841864319 | 2841865382 | 302 |
| 35 | iso_pu_bacteria | 2842110456 | 2842115063 | 302 |
| 36 | iso_pu_bacteria | 2842146304 | 2842147469 | 302 |
| 37 | iso_pu_bacteria | 2842192696 | 2842197481 | 302 |
| 38 | iso_pu_bacteria | 2842198810 | 2842199484 | 302 |
| 39 | iso_pu_bacteria | 2842205361 | 2842210000 | 302 |
| 40 | iso_pu_bacteria | 2842217011 | 2842221289 | 302 |
| 41 | iso_pu_bacteria | 2842250916 | 2842252535 | 302 |
| 42 | iso_pu_bacteria | 2842278818 | 2842283454 | 302 |
| 43 | iso_pu_bacteria | 2842285085 | 2842287040 | 302 |
| 44 | iso_pu_bacteria | 2842317721 | 2842318563 | 302 |
| 45 | iso_pu_bacteria | 2842341865 | 2842343509 | 302 |
| 46 | iso_pu_bacteria | 2842363717 | 2842365335 | 302 |
| 47 | iso_pu_bacteria | 2842395702 | 2842398163 | 302 |
| 48 | iso_pu_bacteria | 2842402390 | 2842404308 | 302 |
| 49 | iso_pu_bacteria | 2842409023 | 2842411007 | 302 |
| 50 | iso_pu_bacteria | 2842415677 | 2842417537 | 302 |
| 51 | iso_pu_bacteria | 2842489311 | 2842493846 | 302 |
| 52 | iso_pu_bacteria | 2842495871 | 2842497198 | 302 |
| 53 | iso_pu_bacteria | 2842922631 | 2842924898 | 302 |
| 54 | iso_pu_bacteria | 2857516855 | 2857521490 | 302 |
| 55 | iso_pu_bacteria | 2899803654 | 2899803873 | 302 |
| 56 | iso_pu_bacteria | 2913308742 | 2913310871 | 302 |
| 57 | iso_pu_bacteria | 2919100787 | 2919103912 | 302 |
| 58 | iso_pu_bacteria | 2923556063 | 2923557484 | 302 |
| 59 | iso_pu_bacteria | 2996887358 | 2996888769 | 302 |
| 60 | iso_pu_bacteria | 8005258706 | 8005260042 | 302 |
| 61 | iso_pu_bacteria | 8005321885 | 8005323296 | 302 |
| 62 | 3300002773 | JGI25152J39213_1004023 | JGI25152J39213_10040236 | 306 |
| 63 | 3300002773 | JGI25152J39213_1004196 | JGI25152J39213_10041965 | 306 |
| 64 | 3300003215 | JGI25153J46596_10023192 | JGI25153J46596_100231922 | 306 |
| 65 | 3300003771 | Ga0055526_1002478 | Ga0055526_10024786 | 306 |
| 66 | 3300003775 | Ga0055524_1001845 | Ga0055524_10018454 | 306 |
| 67 | 3300003790 | Ga0055528_1001416 | Ga0055528_10014165 | 306 |
| 68 | 3300003792 | Ga0055540_1002752 | Ga0055540_10027529 | 306 |
| 69 | 3300003792 | Ga0055540_1004045 | Ga0055540_10040456 | 306 |
| 70 | 3300003856 | Ga0058692_1008587 | Ga0058692_10085871 | 306 |
| 71 | 3300005331 | Ga0070670_100219186 | Ga0070670_1002191862 | 306 |
| 72 | 3300005335 | Ga0070666_10108247 | Ga0070666_101082472 | 306 |
| 73 | 3300005339 | Ga0070660_100067342 | Ga0070660_1000673421 | 306 |
| 74 | 3300005355 | Ga0070671_100044993 | Ga0070671_1000449935 | 306 |
| 75 | 3300006186 | Ga0075369_10059328 | Ga0075369_100593282 | 306 |
| 76 | 3300009011 | Ga0105251_10062526 | Ga0105251_100625262 | 306 |
| 77 | 3300009177 | Ga0105248_10113488 | Ga0105248_101134882 | 306 |
| 78 | 3300009545 | Ga0105237_10001638 | Ga0105237_100016386 | 306 |
| 79 | 3300009765 | Ga0123341_1000023 | Ga0123341_100002350 | 306 |
| 80 | 3300009765 | Ga0123341_1037023 | Ga0123341_10370234 | 306 |
| 81 | 3300009766 | Ga0123342_1023941 | Ga0123342_10239412 | 306 |
| 82 | 3300013102 | Ga0157371_10000073 | Ga0157371_1000007384 | 306 |
| 83 | 3300013104 | Ga0157370_10004276 | Ga0157370_1000427612 | 306 |
| 84 | 3300015265 | Ga0182005_1011106 | Ga0182005_10111062 | 306 |
| 85 | 3300025245 | Ga0207425_1012830 | Ga0207425_10128302 | 306 |
| 86 | 3300025258 | Ga0209129_1000137 | Ga0209129_100013770 | 306 |
| 87 | 3300025258 | Ga0209129_1000321 | Ga0209129_100032131 | 306 |
| 88 | 3300025258 | Ga0209129_1004651 | Ga0209129_10046513 | 306 |
| 89 | 3300025273 | Ga0209673_1000041 | Ga0209673_1000041158 | 306 |
| 90 | 3300025273 | Ga0209673_1004149 | Ga0209673_10041496 | 306 |
| 91 | 3300025284 | Ga0209130_1003906 | Ga0209130_10039062 | 306 |
| 92 | 3300025294 | Ga0209025_1005728 | Ga0209025_10057281 | 306 |
| 93 | 3300025294 | Ga0209025_1024639 | Ga0209025_10246394 | 306 |
| 94 | 3300025295 | Ga0209564_1006711 | Ga0209564_10067115 | 306 |
| 95 | 3300025299 | Ga0209256_1003247 | Ga0209256_10032477 | 306 |
| 96 | 3300025299 | Ga0209256_1006028 | Ga0209256_10060286 | 306 |
| 97 | 3300025302 | Ga0207426_1000106 | Ga0207426_100010633 | 306 |
| 98 | 3300025302 | Ga0207426_1001660 | Ga0207426_100166015 | 306 |
| 99 | 3300025303 | Ga0209051_1007393 | Ga0209051_10073936 | 306 |
| 100 | 3300025303 | Ga0209051_1052842 | Ga0209051_10528421 | 306 |
| 101 | 3300025925 | Ga0207650_10220266 | Ga0207650_102202662 | 306 |
| 102 | 3300025931 | Ga0207644_10073870 | Ga0207644_100738702 | 306 |
| 103 | 3300025941 | Ga0207711_10107918 | Ga0207711_101079183 | 306 |
| 104 | 3300026067 | Ga0207678_10273964 | Ga0207678_102739642 | 306 |
| 105 | 3300041404 | Ga0439436_0034797 | Ga0439436_0034797_521_1441 | 306 |
| 106 | 3300041491 | Ga0451833_0094896 | Ga0451833_0094896_13_933 | 306 |
| 107 | 3300041498 | Ga0451841_0993646 | Ga0451841_0993646_13_933 | 306 |
| 108 | 3300042004 | Ga0439445_0005918 | Ga0439445_0005918_878_1798 | 306 |
| 109 | 3300042007 | Ga0439449_0014578 | Ga0439449_0014578_1988_2908 | 306 |
| 110 | 3300042145 | Ga0450906_015182 | Ga0450906_015182_336_1256 | 306 |
| 111 | 3300046452 | Ga0495617_033008 | Ga0495617_033008_108_1028 | 306 |
| 112 | 3300046455 | Ga0495603_0184963 | Ga0495603_0184963_164_1084 | 306 |
| 113 | 3300046459 | Ga0495629_0021261 | Ga0495629_0021261_749_1669 | 306 |
| 114 | 3300046460 | Ga0495638_0000345 | Ga0495638_0000345_10815_11735 | 306 |
| 115 | 3300046474 | Ga0495605_0001360 | Ga0495605_0001360_2357_3277 | 306 |
| 116 | 3300046476 | Ga0495662_0039412 | Ga0495662_0039412_560_1480 | 306 |
| 117 | 3300046492 | Ga0495585_0012568 | Ga0495585_0012568_93_1013 | 306 |
| 118 | 3300046492 | Ga0495585_0034091 | Ga0495585_0034091_505_1425 | 306 |
| 119 | 3300046492 | Ga0495585_0163856 | Ga0495585_0163856_194_1114 | 306 |
| 120 | 3300046506 | Ga0495583_0003514 | Ga0495583_0003514_6194_7114 | 306 |
| 121 | 3300046512 | Ga0495610_0002413 | Ga0495610_0002413_9625_10545 | 306 |
| 122 | 3300046512 | Ga0495610_0010234 | Ga0495610_0010234_3089_4009 | 306 |
| 123 | 3300046515 | Ga0495620_0042426 | Ga0495620_0042426_943_1863 | 306 |
| 124 | 3300046516 | Ga0495628_0106966 | Ga0495628_0106966_803_1723 | 306 |
| 125 | 3300046518 | Ga0495631_0001592 | Ga0495631_0001592_10684_11604 | 306 |
| 126 | 3300046522 | Ga0495643_0023240 | Ga0495643_0023240_2166_3086 | 306 |
| 127 | 3300046530 | Ga0495654_0001395 | Ga0495654_0001395_3660_4580 | 306 |
| 128 | 3300046530 | Ga0495654_0030158 | Ga0495654_0030158_851_1771 | 306 |
| 129 | 3300046538 | Ga0495609_0012341 | Ga0495609_0012341_156_1076 | 306 |
| 130 | 3300046615 | Ga0495656_0024072 | Ga0495656_0024072_312_1232 | 306 |
| 131 | 3300046616 | Ga0495668_0004221 | Ga0495668_0004221_3494_4414 | 306 |
| 132 | 3300046616 | Ga0495668_0136775 | Ga0495668_0136775_259_1179 | 306 |
| 133 | 3300046642 | Ga0495634_0146090 | Ga0495634_0146090_498_1418 | 306 |
| 134 | 3300046660 | Ga0495625_0001088 | Ga0495625_0001088_31049_31969 | 306 |
| 135 | 3300046660 | Ga0495625_0177471 | Ga0495625_0177471_154_1074 | 306 |
| 136 | 3300046663 | Ga0495635_0024640 | Ga0495635_0024640_2462_3382 | 306 |
| 137 | 3300046665 | Ga0495661_0095362 | Ga0495661_0095362_692_1612 | 306 |
| 138 | 3300046674 | Ga0495588_0001683 | Ga0495588_0001683_4399_5319 | 306 |
| 139 | 3300046674 | Ga0495588_0107862 | Ga0495588_0107862_220_1140 | 306 |
| 140 | 3300046675 | Ga0495657_0017756 | Ga0495657_0017756_3492_4412 | 306 |
| 141 | 3300046691 | Ga0495670_0068014 | Ga0495670_0068014_530_1450 | 306 |
| 142 | 3300046694 | Ga0495649_0012099 | Ga0495649_0012099_368_1288 | 306 |
| 143 | 3300046810 | Ga0495660_0171806 | Ga0495660_0171806_108_1028 | 306 |
| 144 | 3300047321 | Ga0495676_0263535 | Ga0495676_0263535_71_991 | 306 |
| 145 | 3300047470 | Ga0495681_0005856 | Ga0495681_0005856_4506_5426 | 306 |
| 146 | 3300047472 | Ga0495686_0079054 | Ga0495686_0079054_289_1209 | 306 |
| 147 | 3300048904 | Ga0496101_0029660 | Ga0496101_0029660_702_1622 | 306 |
| 148 | 3300048913 | Ga0496110_0078769 | Ga0496110_0078769_1760_2680 | 306 |
| 149 | 3300048914 | Ga0496111_0002760 | Ga0496111_0002760_5003_5923 | 306 |
| 150 | 3300048919 | Ga0496116_0014290 | Ga0496116_0014290_2030_2950 | 306 |
| 151 | 3300048919 | Ga0496116_0041974 | Ga0496116_0041974_2165_3085 | 306 |
| 152 | 3300048919 | Ga0496116_0057118 | Ga0496116_0057118_1545_2465 | 306 |
| 153 | 3300048919 | Ga0496116_0078008 | Ga0496116_0078008_718_1638 | 306 |
| 154 | 3300048919 | Ga0496116_0173581 | Ga0496116_0173581_48_968 | 306 |
| 155 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1401427_1402347 | 306 |
| 156 | 3300048920 | Ga0496117_0001755 | Ga0496117_0001755_20532_21452 | 306 |
| 157 | 3300048920 | Ga0496117_0005544 | Ga0496117_0005544_10474_11394 | 306 |
| 158 | 3300048920 | Ga0496117_0064375 | Ga0496117_0064375_1451_2371 | 306 |
| 159 | 3300048920 | Ga0496117_0182810 | Ga0496117_0182810_154_1074 | 306 |
| 160 | 3300048921 | Ga0496118_0000245 | Ga0496118_0000245_68495_69415 | 306 |
| 161 | 3300048921 | Ga0496118_0002030 | Ga0496118_0002030_7013_7933 | 306 |
| 162 | 3300048921 | Ga0496118_0018801 | Ga0496118_0018801_137_1057 | 306 |
| 163 | 3300048921 | Ga0496118_0033169 | Ga0496118_0033169_2728_3648 | 306 |
| 164 | 3300048921 | Ga0496118_0040343 | Ga0496118_0040343_2068_2988 | 306 |
| 165 | 3300048922 | Ga0496119_0012473 | Ga0496119_0012473_2699_3619 | 306 |
| 166 | 3300048922 | Ga0496119_0060959 | Ga0496119_0060959_767_1687 | 306 |
| 167 | 3300048923 | Ga0496120_0003652 | Ga0496120_0003652_11896_12816 | 306 |
| 168 | 3300048923 | Ga0496120_0005743 | Ga0496120_0005743_4717_5637 | 306 |
| 169 | 3300048924 | Ga0496121_0001362 | Ga0496121_0001362_23970_24890 | 306 |
| 170 | 3300048924 | Ga0496121_0026655 | Ga0496121_0026655_2133_3053 | 306 |
| 171 | 3300048924 | Ga0496121_0116302 | Ga0496121_0116302_979_1899 | 306 |
| 172 | 3300048924 | Ga0496121_0289889 | Ga0496121_0289889_130_1050 | 306 |
| 173 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_772217_773137 | 306 |
| 174 | 3300048925 | Ga0496122_0021829 | Ga0496122_0021829_3725_4645 | 306 |
| 175 | 3300048925 | Ga0496122_0031679 | Ga0496122_0031679_1335_2255 | 306 |
| 176 | 3300048925 | Ga0496122_0055344 | Ga0496122_0055344_1000_1920 | 306 |
| 177 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_775948_776868 | 306 |
| 178 | 3300048926 | Ga0496123_0010973 | Ga0496123_0010973_3607_4527 | 306 |
| 179 | 3300048926 | Ga0496123_0035684 | Ga0496123_0035684_2138_3058 | 306 |
| 180 | 3300048927 | Ga0496124_0010499 | Ga0496124_0010499_6739_7659 | 306 |
| 181 | 3300048927 | Ga0496124_0012884 | Ga0496124_0012884_33_953 | 306 |
| 182 | 3300048927 | Ga0496124_0014751 | Ga0496124_0014751_5278_6198 | 306 |
| 183 | 3300048927 | Ga0496124_0033232 | Ga0496124_0033232_2383_3303 | 306 |
| 184 | 3300048927 | Ga0496124_0053944 | Ga0496124_0053944_2398_3318 | 306 |
| 185 | 3300048927 | Ga0496124_0312433 | Ga0496124_0312433_123_1043 | 306 |
| 186 | 3300048927 | Ga0496124_0388263 | Ga0496124_0388263_34_954 | 306 |
| 187 | 3300048928 | Ga0496125_0007106 | Ga0496125_0007106_6297_7217 | 306 |
| 188 | 3300048928 | Ga0496125_0008057 | Ga0496125_0008057_1851_2771 | 306 |
| 189 | 3300048929 | Ga0496126_0136908 | Ga0496126_0136908_718_1638 | 306 |
| 190 | 3300049581 | Ga0501047_0302897 | Ga0501047_0302897_492_1412 | 306 |
| 191 | 3300049742 | Ga0501080_0387180 | Ga0501080_0387180_44_964 | 306 |
| 192 | 3300049776 | Ga0501280_004688 | Ga0501280_004688_610_1530 | 306 |
| 193 | 3300050489 | nmdc:mga03683_47168_c1 | nmdc:mga03683_47168_c1_631_1551 | 306 |
| 194 | 3300050490 | nmdc:mga03n38_42047_c1 | nmdc:mga03n38_42047_c1_88_1008 | 306 |
| 195 | 3300050490 | nmdc:mga03n38_98627_c1 | nmdc:mga03n38_98627_c1_156_1076 | 306 |
| 196 | 3300050491 | nmdc:mga00v17_1229_c1 | nmdc:mga00v17_1229_c1_1292_2212 | 306 |
| 197 | 3300050492 | nmdc:mga0yw44_432_c1 | nmdc:mga0yw44_432_c1_9974_10894 | 306 |
| 198 | 3300050493 | nmdc:mga0k408_572_c1 | nmdc:mga0k408_572_c1_10839_11759 | 306 |
| 199 | 3300050494 | nmdc:mga06z11_23069_c1 | nmdc:mga06z11_23069_c1_1826_2746 | 306 |
| 200 | 3300050516 | nmdc:mga0sz30_1101_c1 | nmdc:mga0sz30_1101_c1_8748_9668 | 306 |
| 201 | 3300050516 | nmdc:mga0sz30_29169_c1 | nmdc:mga0sz30_29169_c1_1099_2019 | 306 |
| 202 | 3300050516 | nmdc:mga0sz30_3155_c1 | nmdc:mga0sz30_3155_c1_4727_5647 | 306 |
| 203 | 3300050516 | nmdc:mga0sz30_7817_c1 | nmdc:mga0sz30_7817_c1_3020_3940 | 306 |
| 204 | 3300053105 | Ga0500557_057290 | Ga0500557_057290_64_984 | 306 |
| 205 | 3300053107 | Ga0500560_023531 | Ga0500560_023531_841_1761 | 306 |
| 206 | 3300053125 | Ga0500618_000219 | Ga0500618_000219_12037_12957 | 306 |
| 207 | 3300053137 | Ga0500561_0000395 | Ga0500561_0000395_1556_2476 | 306 |
| 208 | 3300053139 | Ga0500568_0001538 | Ga0500568_0001538_3332_4252 | 306 |
| 209 | 3300053146 | Ga0500588_0081120 | Ga0500588_0081120_56_976 | 306 |
| 210 | 3300053153 | Ga0500616_0000744 | Ga0500616_0000744_10268_11188 | 306 |
| 211 | 3300053156 | Ga0500622_0000338 | Ga0500622_0000338_9373_10293 | 306 |
| 212 | 3300053157 | Ga0500624_000280 | Ga0500624_000280_13908_14828 | 306 |
| 213 | 3300053177 | Ga0500636_0127242 | Ga0500636_0127242_134_1054 | 306 |
| 214 | 3300025944 | Ga0207661_10130247 | Ga0207661_101302472 | 307 |
| 215 | 3300036712 | Ga0316584_0020033 | Ga0316584_0020033_1600_2523 | 307 |
| 216 | 3300049571 | Ga0501034_0191926 | Ga0501034_0191926_746_1669 | 307 |
| 217 | 3300049581 | Ga0501047_0232703 | Ga0501047_0232703_27_950 | 307 |
| 218 | 3300049582 | Ga0501048_0047307 | Ga0501048_0047307_1208_2131 | 307 |
| 219 | 3300049823 | Ga0501044_0155713 | Ga0501044_0155713_27_950 | 307 |
| 220 | 3300049824 | Ga0501045_0013776 | Ga0501045_0013776_883_1806 | 307 |
| 221 | 3300054114 | Ga0501084_0040029 | Ga0501084_0040029_1140_2063 | 307 |
| 222 | 3300009093 | Ga0105240_10000287 | Ga0105240_1000028791 | 310 |
| 223 | iso_pu_bacteria | 2967699805 | 2967702155 | 310 |
| 224 | 3300009098 | Ga0105245_10294754 | Ga0105245_102947542 | 311 |
| 225 | 3300009148 | Ga0105243_10073231 | Ga0105243_100732312 | 311 |
| 226 | 3300009545 | Ga0105237_10051510 | Ga0105237_100515103 | 311 |
| 227 | 3300009551 | Ga0105238_10002201 | Ga0105238_1000220115 | 311 |
| 228 | 3300013308 | Ga0157375_10092712 | Ga0157375_100927123 | 311 |
| 229 | 3300014968 | Ga0157379_10076380 | Ga0157379_100763804 | 311 |
| 230 | 3300048903 | Ga0496100_0028459 | Ga0496100_0028459_1500_2435 | 311 |
| 231 | 3300048905 | Ga0496102_0099255 | Ga0496102_0099255_148_1083 | 311 |
| 232 | 3300048906 | Ga0496103_0010271 | Ga0496103_0010271_1141_2076 | 311 |
| 233 | 3300048909 | Ga0496106_0070826 | Ga0496106_0070826_321_1256 | 311 |
| 234 | 3300048910 | Ga0496107_0017994 | Ga0496107_0017994_1525_2460 | 311 |
| 235 | 3300048917 | Ga0496114_0185003 | Ga0496114_0185003_677_1612 | 311 |
| 236 | 3300046460 | Ga0495638_0100193 | Ga0495638_0100193_614_1561 | 315 |
| 237 | 3300053108 | Ga0500562_001480 | Ga0500562_001480_4570_5517 | 315 |
| 238 | 3300053153 | Ga0500616_0001288 | Ga0500616_0001288_9923_10870 | 315 |
| 239 | 3300053730 | Ga0500645_019310 | Ga0500645_019310_775_1722 | 315 |
| 240 | 3300049579 | Ga0501043_0032530 | Ga0501043_0032530_1756_2712 | 318 |
| 241 | 3300049585 | Ga0501069_0017084 | Ga0501069_0017084_333_1289 | 318 |
| 242 | 3300049586 | Ga0501070_0007975 | Ga0501070_0007975_5900_6856 | 318 |
| 243 | 3300005983 | Ga0081540_1068695 | Ga0081540_10686952 | 319 |
| 244 | 3300009553 | Ga0105249_10018572 | Ga0105249_100185726 | 319 |
| 245 | 3300048905 | Ga0496102_0016475 | Ga0496102_0016475_1640_2599 | 319 |
| 246 | 3300048906 | Ga0496103_0020844 | Ga0496103_0020844_2576_3535 | 319 |
| 247 | 3300048908 | Ga0496105_0149665 | Ga0496105_0149665_797_1756 | 319 |
| 248 | 3300048909 | Ga0496106_0008447 | Ga0496106_0008447_4198_5157 | 319 |
| 249 | 3300048910 | Ga0496107_0002446 | Ga0496107_0002446_4097_5056 | 319 |
| 250 | 3300048911 | Ga0496108_0254874 | Ga0496108_0254874_207_1166 | 319 |
| 251 | 3300050507 | nmdc:mga05p37_107567_c1 | nmdc:mga05p37_107567_c1_963_1922 | 319 |
| 252 | 3300050511 | nmdc:mga08y16_33378_c1 | nmdc:mga08y16_33378_c1_1566_2525 | 319 |
| 253 | iso_pu_bacteria | 2508501122 | 2509108611 | 319 |
| 254 | iso_pu_bacteria | 2509276019 | 2509374363 | 319 |
| 255 | iso_pu_bacteria | 2510065057 | 2510305068 | 319 |
| 256 | iso_pu_bacteria | 2510461069 | 2510843573 | 319 |
| 257 | iso_pu_bacteria | 2510917022 | 2511133383 | 319 |
| 258 | iso_pu_bacteria | 2510917028 | 2511186444 | 319 |
| 259 | iso_pu_bacteria | 2510917030 | 2511197115 | 319 |
| 260 | iso_pu_bacteria | 2511231052 | 2511501111 | 319 |
| 261 | iso_pu_bacteria | 2512047086 | 2512532517 | 319 |
| 262 | iso_pu_bacteria | 2512875026 | 2512972146 | 319 |
| 263 | iso_pu_bacteria | 2513237086 | 2513582886 | 319 |
| 264 | iso_pu_bacteria | 2513237088 | 2513596331 | 319 |
| 265 | iso_pu_bacteria | 2513237089 | 2513604820 | 319 |
| 266 | iso_pu_bacteria | 2513237091 | 2513616274 | 319 |
| 267 | iso_pu_bacteria | 2513237138 | 2513868923 | 319 |
| 268 | iso_pu_bacteria | 2513237140 | 2513881003 | 319 |
| 269 | iso_pu_bacteria | 2513237143 | 2513902239 | 319 |
| 270 | iso_pu_bacteria | 2513237156 | 2513987506 | 319 |
| 271 | iso_pu_bacteria | 2513237159 | 2514001101 | 319 |
| 272 | iso_pu_bacteria | 2513237160 | 2514008575 | 319 |
| 273 | iso_pu_bacteria | 2515154107 | 2515608220 | 319 |
| 274 | iso_pu_bacteria | 2516143018 | 2516208974 | 319 |
| 275 | iso_pu_bacteria | 2516653046 | 2516892392 | 319 |
| 276 | iso_pu_bacteria | 2517487022 | 2517569188 | 319 |
| 277 | iso_pu_bacteria | 2519899620 | 2520378698 | 319 |
| 278 | iso_pu_bacteria | 2524023207 | 2524451042 | 319 |
| 279 | iso_pu_bacteria | 2534681796 | 2535515805 | 319 |
| 280 | iso_pu_bacteria | 2537561587 | 2537874167 | 319 |
| 281 | iso_pu_bacteria | 2551306084 | 2551682471 | 319 |
| 282 | iso_pu_bacteria | 2551306085 | 2551683810 | 319 |
| 283 | iso_pu_bacteria | 2551306087 | 2551703813 | 319 |
| 284 | iso_pu_bacteria | 2551306093 | 2551746421 | 319 |
| 285 | iso_pu_bacteria | 2554235003 | 2554247228 | 319 |
| 286 | iso_pu_bacteria | 2558860100 | 2558863390 | 319 |
| 287 | iso_pu_bacteria | 2558860242 | 2559294421 | 319 |
| 288 | iso_pu_bacteria | 2558860983 | 2561466134 | 319 |
| 289 | iso_pu_bacteria | 2582581283 | 2585165661 | 319 |
| 290 | iso_pu_bacteria | 2582581299 | 2585231413 | 319 |
| 291 | iso_pu_bacteria | 2582581306 | 2585266063 | 319 |
| 292 | iso_pu_bacteria | 2582581307 | 2585273177 | 319 |
| 293 | iso_pu_bacteria | 2582581308 | 2585278989 | 319 |
| 294 | iso_pu_bacteria | 2582581315 | 2585325394 | 319 |
| 295 | iso_pu_bacteria | 2582581316 | 2585329555 | 319 |
| 296 | iso_pu_bacteria | 2582581865 | 2585391617 | 319 |
| 297 | iso_pu_bacteria | 2582581866 | 2585392820 | 319 |
| 298 | iso_pu_bacteria | 2585427527 | 2585530784 | 319 |
| 299 | iso_pu_bacteria | 2585427530 | 2585554966 | 319 |
| 300 | iso_pu_bacteria | 2585427531 | 2585559524 | 319 |
| 301 | iso_pu_bacteria | 2585427594 | 2585847132 | 319 |
| 302 | iso_pu_bacteria | 2585427608 | 2585902195 | 319 |
| 303 | iso_pu_bacteria | 2585427609 | 2585905100 | 319 |
| 304 | iso_pu_bacteria | 2585428125 | 2587979785 | 319 |
| 305 | iso_pu_bacteria | 2599185156 | 2599333666 | 319 |
| 306 | iso_pu_bacteria | 2599185210 | 2599602507 | 319 |
| 307 | iso_pu_bacteria | 2599185352 | 2600192032 | 319 |
| 308 | iso_pu_bacteria | 2600254933 | 2600375350 | 319 |
| 309 | iso_pu_bacteria | 2600255279 | 2601608591 | 319 |
| 310 | iso_pu_bacteria | 2600255308 | 2601745365 | 319 |
| 311 | iso_pu_bacteria | 2615840626 | 2616305739 | 319 |
| 312 | iso_pu_bacteria | 2617270742 | 2617384214 | 319 |
| 313 | iso_pu_bacteria | 2643221557 | 2643807100 | 319 |
| 314 | iso_pu_bacteria | 2643221568 | 2643855822 | 319 |
| 315 | iso_pu_bacteria | 2643221582 | 2643918801 | 319 |
| 316 | iso_pu_bacteria | 2643221599 | 2644008007 | 319 |
| 317 | iso_pu_bacteria | 2643221607 | 2644046461 | 319 |
| 318 | iso_pu_bacteria | 2643221610 | 2644069633 | 319 |
| 319 | iso_pu_bacteria | 2643221618 | 2644108892 | 319 |
| 320 | iso_pu_bacteria | 2643221626 | 2644151414 | 319 |
| 321 | iso_pu_bacteria | 2643221636 | 2644200814 | 319 |
| 322 | iso_pu_bacteria | 2643221655 | 2644311548 | 319 |
| 323 | iso_pu_bacteria | 2643221659 | 2644329807 | 319 |
| 324 | iso_pu_bacteria | 2643221668 | 2644380482 | 319 |
| 325 | iso_pu_bacteria | 2643221675 | 2644420787 | 319 |
| 326 | iso_pu_bacteria | 2643221680 | 2644454312 | 319 |
| 327 | iso_pu_bacteria | 2643221686 | 2644479251 | 319 |
| 328 | iso_pu_bacteria | 2643221688 | 2644493307 | 319 |
| 329 | iso_pu_bacteria | 2643221689 | 2644502305 | 319 |
| 330 | iso_pu_bacteria | 2643221693 | 2644518661 | 319 |
| 331 | iso_pu_bacteria | 2643221698 | 2644546480 | 319 |
| 332 | iso_pu_bacteria | 2643221712 | 2644617347 | 319 |
| 333 | iso_pu_bacteria | 2643221723 | 2644675550 | 319 |
| 334 | iso_pu_bacteria | 2643221726 | 2644689649 | 319 |
| 335 | iso_pu_bacteria | 2657244999 | 2657683169 | 319 |
| 336 | iso_pu_bacteria | 2690316117 | 2692316731 | 319 |
| 337 | iso_pu_bacteria | 2738541293 | 2738802244 | 319 |
| 338 | iso_pu_bacteria | 2738541317 | 2738946456 | 319 |
| 339 | iso_pu_bacteria | 2751185821 | 2753460899 | 319 |
| 340 | iso_pu_bacteria | 2775507049 | 2776912917 | 319 |
| 341 | iso_pu_bacteria | 2775507266 | 2778177570 | 319 |
| 342 | iso_pu_bacteria | 2791355082 | 2792584257 | 319 |
| 343 | iso_pu_bacteria | 2791355091 | 2792622581 | 319 |
| 344 | iso_pu_bacteria | 2791355092 | 2792628498 | 319 |
| 345 | iso_pu_bacteria | 2791355094 | 2792638253 | 319 |
| 346 | iso_pu_bacteria | 2802428858 | 2802719206 | 319 |
| 347 | iso_pu_bacteria | 2802428859 | 2802723240 | 319 |
| 348 | iso_pu_bacteria | 2802428860 | 2802732401 | 319 |
| 349 | iso_pu_bacteria | 2802428861 | 2802738681 | 319 |
| 350 | iso_pu_bacteria | 2802428862 | 2802745219 | 319 |
| 351 | iso_pu_bacteria | 2802428863 | 2802751656 | 319 |
| 352 | iso_pu_bacteria | 2802429268 | 2804751442 | 319 |
| 353 | iso_pu_bacteria | 2808606387 | 2808985805 | 319 |
| 354 | iso_pu_bacteria | 2818991439 | 2819555921 | 319 |
| 355 | iso_pu_bacteria | 2818991448 | 2819611513 | 319 |
| 356 | iso_pu_bacteria | 2818991453 | 2819639167 | 319 |
| 357 | iso_pu_bacteria | 2838029111 | 2838031513 | 319 |
| 358 | iso_pu_bacteria | 2838675328 | 2838676641 | 319 |
| 359 | iso_pu_bacteria | 2838714209 | 2838715525 | 319 |
| 360 | iso_pu_bacteria | 2838719591 | 2838720675 | 319 |
| 361 | iso_pu_bacteria | 2838724970 | 2838726281 | 319 |
| 362 | iso_pu_bacteria | 2841846520 | 2841847606 | 319 |
| 363 | iso_pu_bacteria | 2841859092 | 2841859856 | 319 |
| 364 | iso_pu_bacteria | 2842124991 | 2842126364 | 319 |
| 365 | iso_pu_bacteria | 2842130223 | 2842131534 | 319 |
| 366 | iso_pu_bacteria | 2842152218 | 2842153297 | 319 |
| 367 | iso_pu_bacteria | 2842170452 | 2842171768 | 319 |
| 368 | iso_pu_bacteria | 2842175837 | 2842176916 | 319 |
| 369 | iso_pu_bacteria | 2842187318 | 2842188633 | 319 |
| 370 | iso_pu_bacteria | 2842211629 | 2842212944 | 319 |
| 371 | iso_pu_bacteria | 2842224351 | 2842225437 | 319 |
| 372 | iso_pu_bacteria | 2842298080 | 2842302369 | 319 |
| 373 | iso_pu_bacteria | 2842357229 | 2842360898 | 319 |
| 374 | iso_pu_bacteria | 2842475841 | 2842477892 | 319 |
| 375 | iso_pu_bacteria | 2842482326 | 2842482932 | 319 |
| 376 | iso_pu_bacteria | 2842502639 | 2842504701 | 319 |
| 377 | iso_pu_bacteria | 2842509118 | 2842509804 | 319 |
| 378 | iso_pu_bacteria | 2842515876 | 2842516641 | 319 |
| 379 | iso_pu_bacteria | 2842521101 | 2842526246 | 319 |
| 380 | iso_pu_bacteria | 2844163670 | 2844168412 | 319 |
| 381 | iso_pu_bacteria | 2847417321 | 2847418202 | 319 |
| 382 | iso_pu_bacteria | 2848992105 | 2848993177 | 319 |
| 383 | iso_pu_bacteria | 2850079185 | 2850080571 | 319 |
| 384 | iso_pu_bacteria | 2852387548 | 2852389167 | 319 |
| 385 | iso_pu_bacteria | 2854916844 | 2854922097 | 319 |
| 386 | iso_pu_bacteria | 2855825444 | 2855831464 | 319 |
| 387 | iso_pu_bacteria | 2855839649 | 2855840588 | 319 |
| 388 | iso_pu_bacteria | 2855872281 | 2855878842 | 319 |
| 389 | iso_pu_bacteria | 2858800743 | 2858801115 | 319 |
| 390 | iso_pu_bacteria | 2891373044 | 2891377034 | 319 |
| 391 | iso_pu_bacteria | 2899792073 | 2899796695 | 319 |
| 392 | iso_pu_bacteria | 2899845264 | 2899847045 | 319 |
| 393 | iso_pu_bacteria | 2913295892 | 2913297350 | 319 |
| 394 | iso_pu_bacteria | 2915980308 | 2915985850 | 319 |
| 395 | iso_pu_bacteria | 2915986958 | 2915989696 | 319 |
| 396 | iso_pu_bacteria | 2915993759 | 2915996119 | 319 |
| 397 | iso_pu_bacteria | 2916000859 | 2916005630 | 319 |
| 398 | iso_pu_bacteria | 2916007675 | 2916013965 | 319 |
| 399 | iso_pu_bacteria | 2916014648 | 2916021154 | 319 |
| 400 | iso_pu_bacteria | 2916021584 | 2916023169 | 319 |
| 401 | iso_pu_bacteria | 2916028427 | 2916031434 | 319 |
| 402 | iso_pu_bacteria | 2916035215 | 2916038857 | 319 |
| 403 | iso_pu_bacteria | 2916041962 | 2916044518 | 319 |
| 404 | iso_pu_bacteria | 2916048683 | 2916049574 | 319 |
| 405 | iso_pu_bacteria | 2916055098 | 2916055218 | 319 |
| 406 | iso_pu_bacteria | 2916061851 | 2916067208 | 319 |
| 407 | iso_pu_bacteria | 2916068649 | 2916071918 | 319 |
| 408 | iso_pu_bacteria | 2919114240 | 2919115681 | 319 |
| 409 | iso_pu_bacteria | 2919166419 | 2919167412 | 319 |
| 410 | iso_pu_bacteria | 2919171160 | 2919171322 | 319 |
| 411 | iso_pu_bacteria | 2919408235 | 2919409394 | 319 |
| 412 | iso_pu_bacteria | 2920760137 | 2920762781 | 319 |
| 413 | iso_pu_bacteria | 2920822456 | 2920823943 | 319 |
| 414 | iso_pu_bacteria | 2921201388 | 2921202848 | 319 |
| 415 | iso_pu_bacteria | 2921208531 | 2921214174 | 319 |
| 416 | iso_pu_bacteria | 2921237296 | 2921239256 | 319 |
| 417 | iso_pu_bacteria | 2921244191 | 2921246236 | 319 |
| 418 | iso_pu_bacteria | 2921250672 | 2921251480 | 319 |
| 419 | iso_pu_bacteria | 2921257292 | 2921257926 | 319 |
| 420 | iso_pu_bacteria | 2921263974 | 2921264095 | 319 |
| 421 | iso_pu_bacteria | 2921282425 | 2921286848 | 319 |
| 422 | iso_pu_bacteria | 2921289301 | 2921294523 | 319 |
| 423 | iso_pu_bacteria | 2921296804 | 2921299948 | 319 |
| 424 | iso_pu_bacteria | 2924144063 | 2924146545 | 319 |
| 425 | iso_pu_bacteria | 2924150972 | 2924151238 | 319 |
| 426 | iso_pu_bacteria | 2924158325 | 2924160715 | 319 |
| 427 | iso_pu_bacteria | 2924165586 | 2924171753 | 319 |
| 428 | iso_pu_bacteria | 2924172951 | 2924177484 | 319 |
| 429 | iso_pu_bacteria | 2924179722 | 2924185305 | 319 |
| 430 | iso_pu_bacteria | 2924186466 | 2924188760 | 319 |
| 431 | iso_pu_bacteria | 2924193448 | 2924196623 | 319 |
| 432 | iso_pu_bacteria | 2924200457 | 2924203062 | 319 |
| 433 | iso_pu_bacteria | 2924207177 | 2924212592 | 319 |
| 434 | iso_pu_bacteria | 2924214083 | 2924214264 | 319 |
| 435 | iso_pu_bacteria | 2924221636 | 2924224698 | 319 |
| 436 | iso_pu_bacteria | 2924228884 | 2924230331 | 319 |
| 437 | iso_pu_bacteria | 2926754445 | 2926756668 | 319 |
| 438 | iso_pu_bacteria | 2926760298 | 2926760914 | 319 |
| 439 | iso_pu_bacteria | 2929138655 | 2929139600 | 319 |
| 440 | iso_pu_bacteria | 2933006813 | 2933007940 | 319 |
| 441 | iso_pu_bacteria | 2933011516 | 2933012718 | 319 |
| 442 | iso_pu_bacteria | 2933594066 | 2933595152 | 319 |
| 443 | iso_pu_bacteria | 2936996657 | 2937000962 | 319 |
| 444 | iso_pu_bacteria | 2937002841 | 2937004357 | 319 |
| 445 | iso_pu_bacteria | 2937009748 | 2937011110 | 319 |
| 446 | iso_pu_bacteria | 2937016420 | 2937019442 | 319 |
| 447 | iso_pu_bacteria | 2937023124 | 2937028542 | 319 |
| 448 | iso_pu_bacteria | 2937029754 | 2937030473 | 319 |
| 449 | iso_pu_bacteria | 2937036028 | 2937040921 | 319 |
| 450 | iso_pu_bacteria | 2937042894 | 2937048277 | 319 |
| 451 | iso_pu_bacteria | 2937049772 | 2937055728 | 319 |
| 452 | iso_pu_bacteria | 2937056579 | 2937059213 | 319 |
| 453 | iso_pu_bacteria | 2937063883 | 2937065485 | 319 |
| 454 | iso_pu_bacteria | 2937071275 | 2937073902 | 319 |
| 455 | iso_pu_bacteria | 2937078374 | 2937082833 | 319 |
| 456 | iso_pu_bacteria | 2937091812 | 2937095731 | 319 |
| 457 | iso_pu_bacteria | 2937098957 | 2937104076 | 319 |
| 458 | iso_pu_bacteria | 2937106411 | 2937111831 | 319 |
| 459 | iso_pu_bacteria | 2937113482 | 2937114007 | 319 |
| 460 | iso_pu_bacteria | 2937119839 | 2937125505 | 319 |
| 461 | iso_pu_bacteria | 2937126314 | 2937126721 | 319 |
| 462 | iso_pu_bacteria | 2941499720 | 2941500112 | 319 |
| 463 | iso_pu_bacteria | 2957375807 | 2957380518 | 319 |
| 464 | iso_pu_bacteria | 2957382221 | 2957382788 | 319 |
| 465 | iso_pu_bacteria | 2957388812 | 2957388990 | 319 |
| 466 | iso_pu_bacteria | 2957395598 | 2957396620 | 319 |
| 467 | iso_pu_bacteria | 2957402308 | 2957407575 | 319 |
| 468 | iso_pu_bacteria | 2957408893 | 2957409670 | 319 |
| 469 | iso_pu_bacteria | 2957415311 | 2957418685 | 319 |
| 470 | iso_pu_bacteria | 2957422303 | 2957428386 | 319 |
| 471 | iso_pu_bacteria | 2957430029 | 2957432580 | 319 |
| 472 | iso_pu_bacteria | 2957437181 | 2957438592 | 319 |
| 473 | iso_pu_bacteria | 2957443900 | 2957449584 | 319 |
| 474 | iso_pu_bacteria | 2957450854 | 2957456546 | 319 |
| 475 | iso_pu_bacteria | 2957457609 | 2957463554 | 319 |
| 476 | iso_pu_bacteria | 2957464669 | 2957466590 | 319 |
| 477 | iso_pu_bacteria | 2957471148 | 2957473214 | 319 |
| 478 | iso_pu_bacteria | 2957478035 | 2957479878 | 319 |
| 479 | iso_pu_bacteria | 2957484790 | 2957486067 | 319 |
| 480 | iso_pu_bacteria | 2957491536 | 2957495771 | 319 |
| 481 | iso_pu_bacteria | 2957498199 | 2957500073 | 319 |
| 482 | iso_pu_bacteria | 2957505466 | 2957509213 | 319 |
| 483 | iso_pu_bacteria | 2960584000 | 2960590007 | 319 |
| 484 | iso_pu_bacteria | 2960591022 | 2960596008 | 319 |
| 485 | iso_pu_bacteria | 2960597568 | 2960598929 | 319 |
| 486 | iso_pu_bacteria | 2960603979 | 2960608521 | 319 |
| 487 | iso_pu_bacteria | 2960610863 | 2960611867 | 319 |
| 488 | iso_pu_bacteria | 2960617483 | 2960617843 | 319 |
| 489 | iso_pu_bacteria | 2960624210 | 2960626852 | 319 |
| 490 | iso_pu_bacteria | 2960631154 | 2960636257 | 319 |
| 491 | iso_pu_bacteria | 2960637947 | 2960643231 | 319 |
| 492 | iso_pu_bacteria | 2960645483 | 2960645751 | 319 |
| 493 | iso_pu_bacteria | 2960652885 | 2960659128 | 319 |
| 494 | iso_pu_bacteria | 2960660292 | 2960666239 | 319 |
| 495 | iso_pu_bacteria | 2960667422 | 2960668733 | 319 |
| 496 | iso_pu_bacteria | 2960674078 | 2960677513 | 319 |
| 497 | iso_pu_bacteria | 2960680706 | 2960684927 | 319 |
| 498 | iso_pu_bacteria | 2960687367 | 2960689111 | 319 |
| 499 | iso_pu_bacteria | 2960693952 | 2960699738 | 319 |
| 500 | iso_pu_bacteria | 2964607997 | 2964612571 | 319 |
| 501 | iso_pu_bacteria | 2964615318 | 2964617829 | 319 |
| 502 | iso_pu_bacteria | 2964621998 | 2964625038 | 319 |
| 503 | iso_pu_bacteria | 2964628898 | 2964635342 | 319 |
| 504 | iso_pu_bacteria | 2964636051 | 2964642498 | 319 |
| 505 | iso_pu_bacteria | 2964643177 | 2964646650 | 319 |
| 506 | iso_pu_bacteria | 2964649959 | 2964656377 | 319 |
| 507 | iso_pu_bacteria | 2964656573 | 2964659769 | 319 |
| 508 | iso_pu_bacteria | 2964663802 | 2964665617 | 319 |
| 509 | iso_pu_bacteria | 2964670856 | 2964671794 | 319 |
| 510 | iso_pu_bacteria | 2964678106 | 2964679452 | 319 |
| 511 | iso_pu_bacteria | 2964685014 | 2964688214 | 319 |
| 512 | iso_pu_bacteria | 2964691889 | 2964692180 | 319 |
| 513 | iso_pu_bacteria | 2964698721 | 2964702814 | 319 |
| 514 | iso_pu_bacteria | 2964705432 | 2964708631 | 319 |
| 515 | iso_pu_bacteria | 2964712639 | 2964718697 | 319 |
| 516 | iso_pu_bacteria | 2964719344 | 2964722259 | 319 |
| 517 | iso_pu_bacteria | 2967671571 | 2967677879 | 319 |
| 518 | iso_pu_bacteria | 2967678726 | 2967681587 | 319 |
| 519 | iso_pu_bacteria | 2967686174 | 2967692997 | 319 |
| 520 | iso_pu_bacteria | 2967693043 | 2967693387 | 319 |
| 521 | iso_pu_bacteria | 2967706974 | 2967713142 | 319 |
| 522 | iso_pu_bacteria | 2967714385 | 2967716387 | 319 |
| 523 | iso_pu_bacteria | 2967721400 | 2967723287 | 319 |
| 524 | iso_pu_bacteria | 2967728569 | 2967730937 | 319 |
| 525 | iso_pu_bacteria | 2967735183 | 2967735585 | 319 |
| 526 | iso_pu_bacteria | 2967742019 | 2967747434 | 319 |
| 527 | iso_pu_bacteria | 2967748971 | 2967754464 | 319 |
| 528 | iso_pu_bacteria | 2967755722 | 2967757036 | 319 |
| 529 | iso_pu_bacteria | 2967762386 | 2967763938 | 319 |
| 530 | iso_pu_bacteria | 2967769361 | 2967771638 | 319 |
| 531 | iso_pu_bacteria | 2967775926 | 2967777603 | 319 |
| 532 | iso_pu_bacteria | 2970019648 | 2970020580 | 319 |
| 533 | iso_pu_bacteria | 2970026789 | 2970032904 | 319 |
| 534 | iso_pu_bacteria | 2970033650 | 2970035691 | 319 |
| 535 | iso_pu_bacteria | 2970040964 | 2970041420 | 319 |
| 536 | iso_pu_bacteria | 2970047711 | 2970050439 | 319 |
| 537 | iso_pu_bacteria | 2970054988 | 2970057961 | 319 |
| 538 | iso_pu_bacteria | 2970061556 | 2970066294 | 319 |
| 539 | iso_pu_bacteria | 2970068827 | 2970072041 | 319 |
| 540 | iso_pu_bacteria | 2970076120 | 2970080513 | 319 |
| 541 | iso_pu_bacteria | 2970082768 | 2970086973 | 319 |
| 542 | iso_pu_bacteria | 2970088815 | 2970091572 | 319 |
| 543 | iso_pu_bacteria | 2970095765 | 2970097523 | 319 |
| 544 | iso_pu_bacteria | 2970102677 | 2970105034 | 319 |
| 545 | iso_pu_bacteria | 2970109326 | 2970113052 | 319 |
| 546 | iso_pu_bacteria | 2970116247 | 2970117861 | 319 |
| 547 | iso_pu_bacteria | 2970122695 | 2970128556 | 319 |
| 548 | iso_pu_bacteria | 2970129317 | 2970129659 | 319 |
| 549 | iso_pu_bacteria | 2970136068 | 2970138802 | 319 |
| 550 | iso_pu_bacteria | 2970143518 | 2970146021 | 319 |
| 551 | iso_pu_bacteria | 2970149975 | 2970151132 | 319 |
| 552 | iso_pu_bacteria | 2970156795 | 2970163080 | 319 |
| 553 | iso_pu_bacteria | 2970164137 | 2970166890 | 319 |
| 554 | iso_pu_bacteria | 2970170962 | 2970176062 | 319 |
| 555 | iso_pu_bacteria | 2970177841 | 2970178438 | 319 |
| 556 | iso_pu_bacteria | 2970184632 | 2970187427 | 319 |
| 557 | iso_pu_bacteria | 2970191845 | 2970194239 | 319 |
| 558 | iso_pu_bacteria | 2977516862 | 2977517834 | 319 |
| 559 | iso_pu_bacteria | 2977523885 | 2977527129 | 319 |
| 560 | iso_pu_bacteria | 2977530762 | 2977534512 | 319 |
| 561 | iso_pu_bacteria | 2977537788 | 2977538129 | 319 |
| 562 | iso_pu_bacteria | 2977544691 | 2977549947 | 319 |
| 563 | iso_pu_bacteria | 2977551784 | 2977552129 | 319 |
| 564 | iso_pu_bacteria | 2977558990 | 2977565108 | 319 |
| 565 | iso_pu_bacteria | 2977565890 | 2977566354 | 319 |
| 566 | iso_pu_bacteria | 2977572785 | 2977576574 | 319 |
| 567 | iso_pu_bacteria | 2977579622 | 2977581234 | 319 |
| 568 | iso_pu_bacteria | 2978969890 | 2978973842 | 319 |
| 569 | iso_pu_bacteria | 2979089926 | 2979093810 | 319 |
| 570 | iso_pu_bacteria | 2979095461 | 2979098807 | 319 |
| 571 | iso_pu_bacteria | 2979100975 | 2979105787 | 319 |
| 572 | iso_pu_bacteria | 2984509177 | 2984512366 | 319 |
| 573 | iso_pu_bacteria | 2984518228 | 2984521272 | 319 |
| 574 | iso_pu_bacteria | 2984537506 | 2984540567 | 319 |
| 575 | iso_pu_bacteria | 2984587000 | 2984589189 | 319 |
| 576 | iso_pu_bacteria | 2984601300 | 2984602763 | 319 |
| 577 | iso_pu_bacteria | 2989771324 | 2989772157 | 319 |
| 578 | iso_pu_bacteria | 3005409236 | 3005412529 | 319 |
| 579 | iso_pu_bacteria | 3005416602 | 3005419642 | 319 |
| 580 | iso_pu_bacteria | 3005452660 | 3005453534 | 319 |
| 581 | iso_pu_bacteria | 639633055 | 639647516 | 319 |
| 582 | iso_pu_bacteria | 643692032 | 643825177 | 319 |
| 583 | iso_pu_bacteria | 648276728 | 648736506 | 319 |
| 584 | iso_pu_bacteria | 650716007 | 650739618 | 319 |
| 585 | iso_pu_bacteria | 8003570095 | 8003570673 | 319 |
| 586 | iso_pu_bacteria | 8003992118 | 8003993087 | 319 |
| 587 | iso_pu_bacteria | 8003999396 | 8004000322 | 319 |
| 588 | iso_pu_bacteria | 8005246636 | 8005251215 | 319 |
| 589 | iso_pu_bacteria | 8005314921 | 8005317678 | 319 |
| 590 | iso_pu_bacteria | 8005484373 | 8005485544 | 319 |
| 591 | iso_pu_bacteria | 8005542996 | 8005544438 | 319 |
| 592 | iso_pu_bacteria | 8005556819 | 8005558842 | 319 |
| 593 | iso_pu_bacteria | 8005645114 | 8005649931 | 319 |
| 594 | iso_pu_bacteria | 8005658619 | 8005659888 | 319 |
| 595 | iso_pu_bacteria | 8024486573 | 8024489671 | 319 |
| 596 | iso_pu_bacteria | 8046767195 | 8046767757 | 319 |
| 597 | iso_pu_bacteria | 8049293176 | 8049294015 | 319 |
| 598 | iso_pu_bacteria | 8054460903 | 8054462728 | 319 |
| 599 | iso_pu_bacteria | 8054558443 | 8054559090 | 319 |
| 600 | iso_pu_bacteria | 8056875544 | 8056879415 | 319 |
| 601 | iso_pu_bacteria | 8057575449 | 8057582114 | 319 |
| 602 | 3300049568 | Ga0501031_0031646 | Ga0501031_0031646_1719_2684 | 320 |
| 603 | 3300049570 | Ga0501033_0103709 | Ga0501033_0103709_57_1022 | 320 |
| 604 | 3300049572 | Ga0501036_0096502 | Ga0501036_0096502_294_1259 | 320 |
| 605 | 3300049573 | Ga0501037_0070315 | Ga0501037_0070315_1307_2272 | 320 |
| 606 | 3300049581 | Ga0501047_0043731 | Ga0501047_0043731_2647_3612 | 320 |
| 607 | 3300049583 | Ga0501067_0055512 | Ga0501067_0055512_436_1401 | 320 |
| 608 | 3300049585 | Ga0501069_0155426 | Ga0501069_0155426_281_1246 | 320 |
| 609 | 3300049586 | Ga0501070_0065280 | Ga0501070_0065280_1317_2282 | 320 |
| 610 | 3300049589 | Ga0501073_0032875 | Ga0501073_0032875_169_1134 | 320 |
| 611 | 3300049590 | Ga0501074_0088466 | Ga0501074_0088466_808_1773 | 320 |
| 612 | 3300049823 | Ga0501044_0057433 | Ga0501044_0057433_1237_2202 | 320 |
| 613 | iso_pu_bacteria | 2643221643 | 2644239018 | 321 |
| 614 | iso_pu_bacteria | 2939669807 | 2939670720 | 321 |
| 615 | iso_pu_bacteria | 3003930520 | 3003932774 | 321 |
| 616 | 3300049571 | Ga0501034_0015883 | Ga0501034_0015883_3538_4506 | 322 |
| 617 | 3300049589 | Ga0501073_0115636 | Ga0501073_0115636_14_982 | 322 |
| 618 | iso_pu_bacteria | 2837678835 | 2837681955 | 322 |
| 619 | iso_pu_bacteria | 8045864390 | 8045865836 | 322 |
| 620 | 3300002704 | JGI25155J39150_1000019 | JGI25155J39150_100001926 | 323 |
| 621 | 3300002705 | JGI25156J39149_1000020 | JGI25156J39149_1000020144 | 323 |
| 622 | 3300002737 | JGI25162J39368_1002520 | JGI25162J39368_10025209 | 323 |
| 623 | 3300002738 | JGI25154J39366_1000102 | JGI25154J39366_100010226 | 323 |
| 624 | 3300002738 | JGI25154J39366_1006945 | JGI25154J39366_10069452 | 323 |
| 625 | 3300002741 | JGI25157J39369_1000070 | JGI25157J39369_100007026 | 323 |
| 626 | 3300002774 | JGI25150J39212_1010191 | JGI25150J39212_10101912 | 323 |
| 627 | 3300002987 | JGI25159J45721_1000002 | JGI25159J45721_1000002131 | 323 |
| 628 | 3300003187 | JGI25151J46595_10021500 | JGI25151J46595_100215002 | 323 |
| 629 | 3300003187 | JGI25151J46595_10026953 | JGI25151J46595_100269532 | 323 |
| 630 | 3300003214 | JGI25165J46597_1002321 | JGI25165J46597_10023218 | 323 |
| 631 | 3300003215 | JGI25153J46596_10025545 | JGI25153J46596_100255453 | 323 |
| 632 | 3300003354 | JGI25160J50197_1000008 | JGI25160J50197_1000008131 | 323 |
| 633 | 3300003374 | JGI25161J50226_1006097 | JGI25161J50226_10060973 | 323 |
| 634 | 3300003771 | Ga0055526_1000738 | Ga0055526_100073825 | 323 |
| 635 | 3300003771 | Ga0055526_1004400 | Ga0055526_10044008 | 323 |
| 636 | 3300003775 | Ga0055524_1000570 | Ga0055524_100057016 | 323 |
| 637 | 3300003781 | Ga0055536_1005880 | Ga0055536_10058805 | 323 |
| 638 | 3300003781 | Ga0055536_1007660 | Ga0055536_10076603 | 323 |
| 639 | 3300003792 | Ga0055540_1008033 | Ga0055540_10080335 | 323 |
| 640 | 3300004625 | Ga0055543_1000027 | Ga0055543_10000272 | 323 |
| 641 | 3300005262 | Ga0065165_1000015 | Ga0065165_1000015132 | 323 |
| 642 | 3300005548 | Ga0070665_100084715 | Ga0070665_1000847152 | 323 |
| 643 | 3300006051 | Ga0075364_10006144 | Ga0075364_100061446 | 323 |
| 644 | 3300006051 | Ga0075364_10191378 | Ga0075364_101913782 | 323 |
| 645 | 3300006177 | Ga0075362_10003295 | Ga0075362_100032954 | 323 |
| 646 | 3300006177 | Ga0075362_10057678 | Ga0075362_100576782 | 323 |
| 647 | 3300006186 | Ga0075369_10002200 | Ga0075369_100022008 | 323 |
| 648 | 3300006186 | Ga0075369_10054317 | Ga0075369_100543172 | 323 |
| 649 | 3300006946 | Ga0079104_1000032 | Ga0079104_1000032180 | 323 |
| 650 | 3300006946 | Ga0079104_1001413 | Ga0079104_100141314 | 323 |
| 651 | 3300006946 | Ga0079104_1001771 | Ga0079104_100177112 | 323 |
| 652 | 3300006948 | Ga0099826_10000246 | Ga0099826_1000024621 | 323 |
| 653 | 3300009036 | Ga0105244_10053958 | Ga0105244_100539581 | 323 |
| 654 | 3300009093 | Ga0105240_10000032 | Ga0105240_10000032133 | 323 |
| 655 | 3300009093 | Ga0105240_10002268 | Ga0105240_100022689 | 323 |
| 656 | 3300009148 | Ga0105243_10018870 | Ga0105243_100188705 | 323 |
| 657 | 3300009177 | Ga0105248_10334639 | Ga0105248_103346392 | 323 |
| 658 | 3300013100 | Ga0157373_10003634 | Ga0157373_100036343 | 323 |
| 659 | 3300013102 | Ga0157371_10003149 | Ga0157371_1000314911 | 323 |
| 660 | 3300013104 | Ga0157370_10000367 | Ga0157370_1000036712 | 323 |
| 661 | 3300013104 | Ga0157370_10251655 | Ga0157370_102516552 | 323 |
| 662 | 3300013105 | Ga0157369_10097785 | Ga0157369_100977852 | 323 |
| 663 | 3300013249 | Ga0171463_1001 | Ga0171463_1001122 | 323 |
| 664 | 3300015262 | Ga0182007_10000751 | Ga0182007_1000075119 | 323 |
| 665 | 3300017792 | Ga0163161_10254688 | Ga0163161_102546882 | 323 |
| 666 | 3300021321 | Ga0214542_1000006 | Ga0214542_1000006136 | 323 |
| 667 | 3300021321 | Ga0214542_1019617 | Ga0214542_10196178 | 323 |
| 668 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003572 | 323 |
| 669 | 3300021327 | Ga0214543_1000014 | Ga0214543_1000014187 | 323 |
| 670 | 3300022739 | Ga0228711_1001210 | Ga0228711_100121028 | 323 |
| 671 | 3300022740 | Ga0228710_1002040 | Ga0228710_100204013 | 323 |
| 672 | 3300025206 | Ga0209435_100024 | Ga0209435_10002426 | 323 |
| 673 | 3300025208 | Ga0209436_100032 | Ga0209436_10003227 | 323 |
| 674 | 3300025208 | Ga0209436_100741 | Ga0209436_1007416 | 323 |
| 675 | 3300025233 | Ga0209437_100033 | Ga0209437_100033358 | 323 |
| 676 | 3300025245 | Ga0207425_1000031 | Ga0207425_100003132 | 323 |
| 677 | 3300025245 | Ga0207425_1006216 | Ga0207425_10062163 | 323 |
| 678 | 3300025246 | Ga0209646_1000064 | Ga0209646_100006426 | 323 |
| 679 | 3300025250 | Ga0209026_1000053 | Ga0209026_100005326 | 323 |
| 680 | 3300025253 | Ga0209677_100251 | Ga0209677_10025123 | 323 |
| 681 | 3300025256 | Ga0209759_1000042 | Ga0209759_100004226 | 323 |
| 682 | 3300025258 | Ga0209129_1000053 | Ga0209129_100005333 | 323 |
| 683 | 3300025258 | Ga0209129_1022927 | Ga0209129_10229271 | 323 |
| 684 | 3300025258 | Ga0209129_1022931 | Ga0209129_10229311 | 323 |
| 685 | 3300025261 | Ga0209233_1000064 | Ga0209233_100006464 | 323 |
| 686 | 3300025273 | Ga0209673_1002821 | Ga0209673_10028212 | 323 |
| 687 | 3300025273 | Ga0209673_1005461 | Ga0209673_10054617 | 323 |
| 688 | 3300025284 | Ga0209130_1000006 | Ga0209130_1000006456 | 323 |
| 689 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007171 | 323 |
| 690 | 3300025284 | Ga0209130_1000018 | Ga0209130_1000018182 | 323 |
| 691 | 3300025292 | Ga0209676_1003826 | Ga0209676_10038265 | 323 |
| 692 | 3300025294 | Ga0209025_1000087 | Ga0209025_100008732 | 323 |
| 693 | 3300025294 | Ga0209025_1000149 | Ga0209025_1000149151 | 323 |
| 694 | 3300025294 | Ga0209025_1000195 | Ga0209025_100019523 | 323 |
| 695 | 3300025294 | Ga0209025_1001254 | Ga0209025_100125419 | 323 |
| 696 | 3300025294 | Ga0209025_1007065 | Ga0209025_10070658 | 323 |
| 697 | 3300025294 | Ga0209025_1043027 | Ga0209025_10430272 | 323 |
| 698 | 3300025295 | Ga0209564_1000330 | Ga0209564_100033054 | 323 |
| 699 | 3300025295 | Ga0209564_1000668 | Ga0209564_100066817 | 323 |
| 700 | 3300025295 | Ga0209564_1002094 | Ga0209564_10020948 | 323 |
| 701 | 3300025297 | Ga0209758_1000081 | Ga0209758_100008132 | 323 |
| 702 | 3300025297 | Ga0209758_1000939 | Ga0209758_100093928 | 323 |
| 703 | 3300025297 | Ga0209758_1001333 | Ga0209758_10013332 | 323 |
| 704 | 3300025297 | Ga0209758_1001529 | Ga0209758_100152929 | 323 |
| 705 | 3300025297 | Ga0209758_1002147 | Ga0209758_100214724 | 323 |
| 706 | 3300025298 | Ga0209050_1009022 | Ga0209050_10090223 | 323 |
| 707 | 3300025299 | Ga0209256_1000445 | Ga0209256_100044541 | 323 |
| 708 | 3300025299 | Ga0209256_1002049 | Ga0209256_100204915 | 323 |
| 709 | 3300025299 | Ga0209256_1002795 | Ga0209256_100279517 | 323 |
| 710 | 3300025299 | Ga0209256_1003424 | Ga0209256_10034245 | 323 |
| 711 | 3300025302 | Ga0207426_1000044 | Ga0207426_1000044207 | 323 |
| 712 | 3300025302 | Ga0207426_1000064 | Ga0207426_1000064171 | 323 |
| 713 | 3300025303 | Ga0209051_1001187 | Ga0209051_10011875 | 323 |
| 714 | 3300025304 | Ga0209257_1001197 | Ga0209257_100119715 | 323 |
| 715 | 3300025304 | Ga0209257_1005909 | Ga0209257_10059094 | 323 |
| 716 | 3300025304 | Ga0209257_1020380 | Ga0209257_10203802 | 323 |
| 717 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024134 | 323 |
| 718 | 3300025913 | Ga0207695_10003756 | Ga0207695_1000375610 | 323 |
| 719 | 3300025935 | Ga0207709_10028555 | Ga0207709_100285553 | 323 |
| 720 | 3300027111 | Ga0209281_1000053 | Ga0209281_1000053284 | 323 |
| 721 | 3300027111 | Ga0209281_1000236 | Ga0209281_100023683 | 323 |
| 722 | 3300027111 | Ga0209281_1000666 | Ga0209281_100066619 | 323 |
| 723 | 3300027312 | Ga0209371_1000021 | Ga0209371_1000021395 | 323 |
| 724 | 3300027312 | Ga0209371_1001000 | Ga0209371_100100014 | 323 |
| 725 | 3300027666 | Ga0209282_1000022 | Ga0209282_1000022143 | 323 |
| 726 | 3300027666 | Ga0209282_1019506 | Ga0209282_10195062 | 323 |
| 727 | 3300027866 | Ga0209813_10001495 | Ga0209813_100014956 | 323 |
| 728 | 3300028379 | Ga0268266_10072784 | Ga0268266_100727841 | 323 |
| 729 | 3300028379 | Ga0268266_10103119 | Ga0268266_101031193 | 323 |
| 730 | 3300028794 | Ga0307515_10000070 | Ga0307515_1000007084 | 323 |
| 731 | 3300028794 | Ga0307515_10003358 | Ga0307515_1000335821 | 323 |
| 732 | 3300028794 | Ga0307515_10031717 | Ga0307515_100317179 | 323 |
| 733 | 3300028794 | Ga0307515_10198518 | Ga0307515_101985182 | 323 |
| 734 | 3300030500 | Ga0268256_1000020 | Ga0268256_1000020401 | 323 |
| 735 | 3300030500 | Ga0268256_1003889 | Ga0268256_10038891 | 323 |
| 736 | 3300031456 | Ga0307513_10003448 | Ga0307513_1000344819 | 323 |
| 737 | 3300031456 | Ga0307513_10038489 | Ga0307513_100384891 | 323 |
| 738 | 3300031548 | Ga0307408_100061695 | Ga0307408_1000616953 | 323 |
| 739 | 3300031548 | Ga0307408_100141482 | Ga0307408_1001414822 | 323 |
| 740 | 3300031731 | Ga0307405_10022442 | Ga0307405_100224424 | 323 |
| 741 | 3300031901 | Ga0307406_10085988 | Ga0307406_100859882 | 323 |
| 742 | 3300031901 | Ga0307406_10333447 | Ga0307406_103334471 | 323 |
| 743 | 3300031911 | Ga0307412_10017364 | Ga0307412_100173644 | 323 |
| 744 | 3300031911 | Ga0307412_10340530 | Ga0307412_103405301 | 323 |
| 745 | 3300031967 | Ga0315914_1000027 | Ga0315914_100002763 | 323 |
| 746 | 3300031995 | Ga0307409_100090847 | Ga0307409_1000908473 | 323 |
| 747 | 3300032002 | Ga0307416_100074867 | Ga0307416_1000748673 | 323 |
| 748 | 3300033430 | Ga0315913_1000631 | Ga0315913_100063115 | 323 |
| 749 | 3300033464 | Ga0315915_1000001 | Ga0315915_1000001209 | 323 |
| 750 | 3300035695 | Ga0373927_0000284 | Ga0373927_0000284_25957_26928 | 323 |
| 751 | 3300041404 | Ga0439436_0033487 | Ga0439436_0033487_395_1366 | 323 |
| 752 | 3300041408 | Ga0439453_0008879 | Ga0439453_0008879_141_1112 | 323 |
| 753 | 3300041413 | Ga0439465_0015313 | Ga0439465_0015313_743_1714 | 323 |
| 754 | 3300041458 | Ga0451798_0111375 | Ga0451798_0111375_589_1560 | 323 |
| 755 | 3300041492 | Ga0451835_0809115 | Ga0451835_0809115_54_1025 | 323 |
| 756 | 3300041497 | Ga0451840_23403 | Ga0451840_23403_928_1899 | 323 |
| 757 | 3300041498 | Ga0451841_0711977 | Ga0451841_0711977_1162_2133 | 323 |
| 758 | 3300041501 | Ga0451845_0762944 | Ga0451845_0762944_765_1736 | 323 |
| 759 | 3300041507 | Ga0451851_0868710 | Ga0451851_0868710_726_1697 | 323 |
| 760 | 3300042007 | Ga0439449_0006656 | Ga0439449_0006656_2261_3232 | 323 |
| 761 | 3300042007 | Ga0439449_0012014 | Ga0439449_0012014_2200_3171 | 323 |
| 762 | 3300042122 | Ga0450920_003028 | Ga0450920_003028_236_1207 | 323 |
| 763 | 3300042436 | Ga0439435_0003123 | Ga0439435_0003123_902_1873 | 323 |
| 764 | 3300042531 | Ga0450918_007781 | Ga0450918_007781_375_1346 | 323 |
| 765 | 3300044684 | Ga0466966_0130349 | Ga0466966_0130349_423_1394 | 323 |
| 766 | 3300045976 | Ga0466967_0262483 | Ga0466967_0262483_290_1261 | 323 |
| 767 | 3300046460 | Ga0495638_0062117 | Ga0495638_0062117_38_1009 | 323 |
| 768 | 3300046507 | Ga0495606_0002521 | Ga0495606_0002521_17936_18907 | 323 |
| 769 | 3300046507 | Ga0495606_0093417 | Ga0495606_0093417_346_1317 | 323 |
| 770 | 3300046507 | Ga0495606_0115906 | Ga0495606_0115906_455_1426 | 323 |
| 771 | 3300046518 | Ga0495631_0005243 | Ga0495631_0005243_4667_5638 | 323 |
| 772 | 3300046519 | Ga0495632_0096029 | Ga0495632_0096029_40_1011 | 323 |
| 773 | 3300046558 | Ga0495633_0032933 | Ga0495633_0032933_873_1844 | 323 |
| 774 | 3300046615 | Ga0495656_0072706 | Ga0495656_0072706_90_1061 | 323 |
| 775 | 3300046616 | Ga0495668_0024399 | Ga0495668_0024399_2268_3239 | 323 |
| 776 | 3300046665 | Ga0495661_0022101 | Ga0495661_0022101_186_1157 | 323 |
| 777 | 3300046674 | Ga0495588_0049618 | Ga0495588_0049618_878_1849 | 323 |
| 778 | 3300046691 | Ga0495670_0044353 | Ga0495670_0044353_491_1462 | 323 |
| 779 | 3300047472 | Ga0495686_0001186 | Ga0495686_0001186_16052_17023 | 323 |
| 780 | 3300048907 | Ga0496104_0000206 | Ga0496104_0000206_5400_6371 | 323 |
| 781 | 3300048908 | Ga0496105_0146951 | Ga0496105_0146951_171_1142 | 323 |
| 782 | 3300048909 | Ga0496106_0000131 | Ga0496106_0000131_55390_56361 | 323 |
| 783 | 3300048917 | Ga0496114_0032152 | Ga0496114_0032152_690_1661 | 323 |
| 784 | 3300048919 | Ga0496116_0000036 | Ga0496116_0000036_322375_323346 | 323 |
| 785 | 3300048920 | Ga0496117_0099511 | Ga0496117_0099511_503_1474 | 323 |
| 786 | 3300048923 | Ga0496120_0071949 | Ga0496120_0071949_783_1754 | 323 |
| 787 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_973662_974633 | 323 |
| 788 | 3300048924 | Ga0496121_0002297 | Ga0496121_0002297_17818_18789 | 323 |
| 789 | 3300048924 | Ga0496121_0004948 | Ga0496121_0004948_16098_17069 | 323 |
| 790 | 3300048924 | Ga0496121_0039654 | Ga0496121_0039654_3149_4120 | 323 |
| 791 | 3300048925 | Ga0496122_0001240 | Ga0496122_0001240_30125_31096 | 323 |
| 792 | 3300048925 | Ga0496122_0073151 | Ga0496122_0073151_258_1229 | 323 |
| 793 | 3300048925 | Ga0496122_0117736 | Ga0496122_0117736_739_1710 | 323 |
| 794 | 3300048926 | Ga0496123_0009901 | Ga0496123_0009901_3241_4212 | 323 |
| 795 | 3300048927 | Ga0496124_0003293 | Ga0496124_0003293_12095_13066 | 323 |
| 796 | 3300048927 | Ga0496124_0019653 | Ga0496124_0019653_343_1314 | 323 |
| 797 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1087541_1088512 | 323 |
| 798 | 3300048928 | Ga0496125_0000372 | Ga0496125_0000372_11851_12822 | 323 |
| 799 | 3300048928 | Ga0496125_0038081 | Ga0496125_0038081_974_1945 | 323 |
| 800 | 3300048929 | Ga0496126_0000156 | Ga0496126_0000156_53107_54078 | 323 |
| 801 | 3300048929 | Ga0496126_0033319 | Ga0496126_0033319_441_1412 | 323 |
| 802 | 3300049569 | Ga0501032_0162324 | Ga0501032_0162324_291_1262 | 323 |
| 803 | 3300049574 | Ga0501038_0096666 | Ga0501038_0096666_619_1590 | 323 |
| 804 | 3300049575 | Ga0501039_0031973 | Ga0501039_0031973_2163_3134 | 323 |
| 805 | 3300049581 | Ga0501047_0150795 | Ga0501047_0150795_296_1267 | 323 |
| 806 | 3300049582 | Ga0501048_0254611 | Ga0501048_0254611_163_1134 | 323 |
| 807 | 3300049584 | Ga0501068_0211263 | Ga0501068_0211263_178_1149 | 323 |
| 808 | 3300049586 | Ga0501070_0131503 | Ga0501070_0131503_566_1537 | 323 |
| 809 | 3300049587 | Ga0501071_0031091 | Ga0501071_0031091_1340_2311 | 323 |
| 810 | 3300049592 | Ga0501076_0088269 | Ga0501076_0088269_841_1812 | 323 |
| 811 | 3300049744 | Ga0501083_0018433 | Ga0501083_0018433_107_1078 | 323 |
| 812 | 3300049823 | Ga0501044_0299598 | Ga0501044_0299598_103_1074 | 323 |
| 813 | 3300050489 | nmdc:mga03683_9527_c1 | nmdc:mga03683_9527_c1_1285_2256 | 323 |
| 814 | 3300050491 | nmdc:mga00v17_5147_c1 | nmdc:mga00v17_5147_c1_1980_2951 | 323 |
| 815 | 3300050492 | nmdc:mga0yw44_7190_c1 | nmdc:mga0yw44_7190_c1_4391_5362 | 323 |
| 816 | 3300050494 | nmdc:mga06z11_21852_c1 | nmdc:mga06z11_21852_c1_1286_2257 | 323 |
| 817 | 3300053139 | Ga0500568_0009665 | Ga0500568_0009665_2356_3327 | 323 |
| 818 | 3300053140 | Ga0500573_0000489 | Ga0500573_0000489_10345_11316 | 323 |
| 819 | 3300053161 | Ga0500634_0000567 | Ga0500634_0000567_4369_5340 | 323 |
| 820 | 3300053177 | Ga0500636_0000118 | Ga0500636_0000118_29707_30678 | 323 |
| 821 | 3300059510 | Ga0587090_008423 | Ga0587090_008423_185_1156 | 323 |
| 822 | 3300060353 | Ga0501082_0128360 | Ga0501082_0128360_246_1217 | 323 |
| 823 | 3300005290 | Ga0065712_10094883 | Ga0065712_100948832 | 325 |
| 824 | 3300005293 | Ga0065715_10157385 | Ga0065715_101573852 | 325 |
| 825 | 3300005336 | Ga0070680_100002875 | Ga0070680_1000028752 | 325 |
| 826 | 3300005354 | Ga0070675_100121103 | Ga0070675_1001211032 | 325 |
| 827 | 3300005356 | Ga0070674_100027684 | Ga0070674_1000276841 | 325 |
| 828 | 3300005435 | Ga0070714_100027694 | Ga0070714_1000276943 | 325 |
| 829 | 3300005438 | Ga0070701_10010529 | Ga0070701_100105294 | 325 |
| 830 | 3300005440 | Ga0070705_100000653 | Ga0070705_10000065316 | 325 |
| 831 | 3300005441 | Ga0070700_100003250 | Ga0070700_1000032507 | 325 |
| 832 | 3300005444 | Ga0070694_100005837 | Ga0070694_1000058373 | 325 |
| 833 | 3300005445 | Ga0070708_100040723 | Ga0070708_1000407236 | 325 |
| 834 | 3300005467 | Ga0070706_100084799 | Ga0070706_1000847992 | 325 |
| 835 | 3300005518 | Ga0070699_100002983 | Ga0070699_10000298313 | 325 |
| 836 | 3300005545 | Ga0070695_100000696 | Ga0070695_1000006966 | 325 |
| 837 | 3300005545 | Ga0070695_100006656 | Ga0070695_1000066567 | 325 |
| 838 | 3300005546 | Ga0070696_100000152 | Ga0070696_10000015229 | 325 |
| 839 | 3300005547 | Ga0070693_100036204 | Ga0070693_1000362043 | 325 |
| 840 | 3300005549 | Ga0070704_100000818 | Ga0070704_1000008184 | 325 |
| 841 | 3300005577 | Ga0068857_100005016 | Ga0068857_1000050168 | 325 |
| 842 | 3300005615 | Ga0070702_100067281 | Ga0070702_1000672813 | 325 |
| 843 | 3300005617 | Ga0068859_100010251 | Ga0068859_1000102517 | 325 |
| 844 | 3300005618 | Ga0068864_100030022 | Ga0068864_1000300226 | 325 |
| 845 | 3300005843 | Ga0068860_100044151 | Ga0068860_1000441515 | 325 |
| 846 | 3300005844 | Ga0068862_100509710 | Ga0068862_1005097101 | 325 |
| 847 | 3300006028 | Ga0070717_10125915 | Ga0070717_101259152 | 325 |
| 848 | 3300006914 | Ga0075436_100000192 | Ga0075436_10000019223 | 325 |
| 849 | 3300006931 | Ga0097620_100010251 | Ga0097620_1000102517 | 325 |
| 850 | 3300007076 | Ga0075435_100082558 | Ga0075435_1000825582 | 325 |
| 851 | 3300015265 | Ga0182005_1011158 | Ga0182005_10111583 | 325 |
| 852 | 3300017792 | Ga0163161_10108871 | Ga0163161_101088712 | 325 |
| 853 | 3300021384 | Ga0213876_10055260 | Ga0213876_100552603 | 325 |
| 854 | 3300021388 | Ga0213875_10000025 | Ga0213875_10000025113 | 325 |
| 855 | 3300025294 | Ga0209025_1050622 | Ga0209025_10506222 | 325 |
| 856 | 3300025885 | Ga0207653_10004438 | Ga0207653_100044384 | 325 |
| 857 | 3300025906 | Ga0207699_10074236 | Ga0207699_100742363 | 325 |
| 858 | 3300025921 | Ga0207652_10136381 | Ga0207652_101363813 | 325 |
| 859 | 3300025926 | Ga0207659_10284613 | Ga0207659_102846132 | 325 |
| 860 | 3300025929 | Ga0207664_10017769 | Ga0207664_100177695 | 325 |
| 861 | 3300025937 | Ga0207669_10186988 | Ga0207669_101869881 | 325 |
| 862 | 3300025939 | Ga0207665_10010248 | Ga0207665_100102488 | 325 |
| 863 | 3300025942 | Ga0207689_10037982 | Ga0207689_100379823 | 325 |
| 864 | 3300025961 | Ga0207712_10010754 | Ga0207712_100107546 | 325 |
| 865 | 3300025972 | Ga0207668_10183134 | Ga0207668_101831341 | 325 |
| 866 | 3300026035 | Ga0207703_10187414 | Ga0207703_101874142 | 325 |
| 867 | 3300026067 | Ga0207678_10077942 | Ga0207678_100779425 | 325 |
| 868 | 3300026075 | Ga0207708_10002614 | Ga0207708_100026147 | 325 |
| 869 | 3300026095 | Ga0207676_10007549 | Ga0207676_100075492 | 325 |
| 870 | 3300026116 | Ga0207674_10010738 | Ga0207674_100107387 | 325 |
| 871 | 3300028380 | Ga0268265_10000666 | Ga0268265_100006669 | 325 |
| 872 | 3300028381 | Ga0268264_10008316 | Ga0268264_100083162 | 325 |
| 873 | 3300031901 | Ga0307406_10075804 | Ga0307406_100758042 | 325 |
| 874 | 3300035692 | Ga0373935_0019248 | Ga0373935_0019248_1002_1979 | 325 |
| 875 | 3300036647 | Ga0316582_0087429 | Ga0316582_0087429_37_1014 | 325 |
| 876 | 3300037853 | Ga0436364_1209910 | Ga0436364_1209910_31911_32888 | 325 |
| 877 | 3300039437 | Ga0436365_1347694 | Ga0436365_1347694_2988_3965 | 325 |
| 878 | 3300045051 | Ga0451576_0136399 | Ga0451576_0136399_379_1356 | 325 |
| 879 | 3300049568 | Ga0501031_0040766 | Ga0501031_0040766_582_1559 | 325 |
| 880 | 3300049569 | Ga0501032_0061225 | Ga0501032_0061225_31_1008 | 325 |
| 881 | 3300049571 | Ga0501034_0058603 | Ga0501034_0058603_1333_2310 | 325 |
| 882 | 3300049571 | Ga0501034_0108137 | Ga0501034_0108137_1329_2306 | 325 |
| 883 | 3300049578 | Ga0501042_0212001 | Ga0501042_0212001_60_1037 | 325 |
| 884 | 3300049579 | Ga0501043_0102136 | Ga0501043_0102136_533_1510 | 325 |
| 885 | 3300049586 | Ga0501070_0140797 | Ga0501070_0140797_129_1106 | 325 |
| 886 | 3300049589 | Ga0501073_0022827 | Ga0501073_0022827_117_1094 | 325 |
| 887 | 3300049589 | Ga0501073_0027826 | Ga0501073_0027826_1578_2555 | 325 |
| 888 | 3300049590 | Ga0501074_0090168 | Ga0501074_0090168_1098_2075 | 325 |
| 889 | 3300049590 | Ga0501074_0103468 | Ga0501074_0103468_461_1438 | 325 |
| 890 | 3300049741 | Ga0501079_0015885 | Ga0501079_0015885_4222_5199 | 325 |
| 891 | 3300049742 | Ga0501080_0158944 | Ga0501080_0158944_990_1967 | 325 |
| 892 | 3300049823 | Ga0501044_0016990 | Ga0501044_0016990_4544_5521 | 325 |
| 893 | 3300050513 | nmdc:mga0rr50_38609_c1 | nmdc:mga0rr50_38609_c1_306_1283 | 325 |
| 894 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_100797_101774 | 325 |
| 895 | 3300050514 | nmdc:mga08x19_345343_c1 | nmdc:mga08x19_345343_c1_29_1006 | 325 |
| 896 | 3300005441 | Ga0070700_100070391 | Ga0070700_1000703912 | 326 |
| 897 | 3300005444 | Ga0070694_100026932 | Ga0070694_1000269323 | 326 |
| 898 | 3300005455 | Ga0070663_100017890 | Ga0070663_1000178905 | 326 |
| 899 | 3300005458 | Ga0070681_10013728 | Ga0070681_100137283 | 326 |
| 900 | 3300005530 | Ga0070679_100081207 | Ga0070679_1000812073 | 326 |
| 901 | 3300005539 | Ga0068853_100012306 | Ga0068853_1000123064 | 326 |
| 902 | 3300005545 | Ga0070695_100098065 | Ga0070695_1000980653 | 326 |
| 903 | 3300005546 | Ga0070696_100014427 | Ga0070696_1000144274 | 326 |
| 904 | 3300005549 | Ga0070704_100026853 | Ga0070704_1000268533 | 326 |
| 905 | 3300005564 | Ga0070664_100102851 | Ga0070664_1001028512 | 326 |
| 906 | 3300005842 | Ga0068858_100137433 | Ga0068858_1001374333 | 326 |
| 907 | 3300006358 | Ga0068871_100122856 | Ga0068871_1001228563 | 326 |
| 908 | 3300006846 | Ga0075430_100018717 | Ga0075430_1000187177 | 326 |
| 909 | 3300006847 | Ga0075431_100001010 | Ga0075431_10000101023 | 326 |
| 910 | 3300025904 | Ga0207647_10014660 | Ga0207647_100146605 | 326 |
| 911 | 3300025921 | Ga0207652_10054040 | Ga0207652_100540403 | 326 |
| 912 | 3300025960 | Ga0207651_10219877 | Ga0207651_102198772 | 326 |
| 913 | 3300026035 | Ga0207703_10202689 | Ga0207703_102026893 | 326 |
| 914 | 3300026041 | Ga0207639_10013263 | Ga0207639_100132633 | 326 |
| 915 | 3300026067 | Ga0207678_10001597 | Ga0207678_100015979 | 326 |
| 916 | 3300026121 | Ga0207683_10086820 | Ga0207683_100868204 | 326 |
| 917 | 3300050509 | nmdc:mga0qj67_2103_c1 | nmdc:mga0qj67_2103_c1_5354_6334 | 326 |
| 918 | 3300050510 | nmdc:mga06r32_7619_c1 | nmdc:mga06r32_7619_c1_7843_8823 | 326 |
| 919 | 3300003215 | JGI25153J46596_10016204 | JGI25153J46596_100162042 | 327 |
| 920 | 3300003354 | JGI25160J50197_1000673 | JGI25160J50197_100067315 | 327 |
| 921 | 3300003374 | JGI25161J50226_1003466 | JGI25161J50226_10034663 | 327 |
| 922 | 3300003771 | Ga0055526_1003233 | Ga0055526_10032332 | 327 |
| 923 | 3300003775 | Ga0055524_1009296 | Ga0055524_10092964 | 327 |
| 924 | 3300003790 | Ga0055528_1004205 | Ga0055528_10042057 | 327 |
| 925 | 3300003792 | Ga0055540_1001138 | Ga0055540_10011382 | 327 |
| 926 | 3300006038 | Ga0075365_10019730 | Ga0075365_100197301 | 327 |
| 927 | 3300006177 | Ga0075362_10000623 | Ga0075362_100006238 | 327 |
| 928 | 3300006178 | Ga0075367_10027235 | Ga0075367_100272353 | 327 |
| 929 | 3300006186 | Ga0075369_10012031 | Ga0075369_100120313 | 327 |
| 930 | 3300006195 | Ga0075366_10006857 | Ga0075366_100068576 | 327 |
| 931 | 3300006353 | Ga0075370_10051004 | Ga0075370_100510042 | 327 |
| 932 | 3300025245 | Ga0207425_1002528 | Ga0207425_10025286 | 327 |
| 933 | 3300025258 | Ga0209129_1006501 | Ga0209129_10065013 | 327 |
| 934 | 3300025273 | Ga0209673_1000692 | Ga0209673_100069211 | 327 |
| 935 | 3300025273 | Ga0209673_1001599 | Ga0209673_100159917 | 327 |
| 936 | 3300025294 | Ga0209025_1000199 | Ga0209025_100019993 | 327 |
| 937 | 3300025295 | Ga0209564_1000689 | Ga0209564_100068915 | 327 |
| 938 | 3300025297 | Ga0209758_1000333 | Ga0209758_100033335 | 327 |
| 939 | 3300025298 | Ga0209050_1005246 | Ga0209050_10052463 | 327 |
| 940 | 3300025299 | Ga0209256_1003505 | Ga0209256_10035054 | 327 |
| 941 | 3300025302 | Ga0207426_1000119 | Ga0207426_1000119129 | 327 |
| 942 | 3300025303 | Ga0209051_1000198 | Ga0209051_100019852 | 327 |
| 943 | 3300025303 | Ga0209051_1006097 | Ga0209051_10060972 | 327 |
| 944 | 3300025304 | Ga0209257_1004359 | Ga0209257_10043596 | 327 |
| 945 | iso_pu_bacteria | 2509276021 | 2509387624 | 327 |
| 946 | iso_pu_bacteria | 2509276033 | 2509442988 | 327 |
| 947 | iso_pu_bacteria | 2510065019 | 2510132393 | 327 |
| 948 | iso_pu_bacteria | 2510461076 | 2510898723 | 327 |
| 949 | iso_pu_bacteria | 2513237084 | 2513569230 | 327 |
| 950 | iso_pu_bacteria | 2513237093 | 2513632669 | 327 |
| 951 | iso_pu_bacteria | 2513237103 | 2513709121 | 327 |
| 952 | iso_pu_bacteria | 2513237162 | 2514020664 | 327 |
| 953 | iso_pu_bacteria | 2515075009 | 2515111371 | 327 |
| 954 | iso_pu_bacteria | 2515154113 | 2515637084 | 327 |
| 955 | iso_pu_bacteria | 2515154114 | 2515644317 | 327 |
| 956 | iso_pu_bacteria | 2515154116 | 2515659106 | 327 |
| 957 | iso_pu_bacteria | 2516653077 | 2517040012 | 327 |
| 958 | iso_pu_bacteria | 2517093000 | 2517094145 | 327 |
| 959 | iso_pu_bacteria | 2517287029 | 2517405963 | 327 |
| 960 | iso_pu_bacteria | 2585427528 | 2585541344 | 327 |
| 961 | iso_pu_bacteria | 2585427593 | 2585839524 | 327 |
| 962 | iso_pu_bacteria | 2615840624 | 2616296133 | 327 |
| 963 | iso_pu_bacteria | 2718217882 | 2719180370 | 327 |
| 964 | iso_pu_bacteria | 2718217927 | 2719384961 | 327 |
| 965 | iso_pu_bacteria | 2718218009 | 2719731119 | 327 |
| 966 | iso_pu_bacteria | 2718218363 | 2721146464 | 327 |
| 967 | iso_pu_bacteria | 2718218365 | 2721157985 | 327 |
| 968 | iso_pu_bacteria | 2718218366 | 2721163343 | 327 |
| 969 | iso_pu_bacteria | 2718218423 | 2721398681 | 327 |
| 970 | iso_pu_bacteria | 2721755514 | 2722839513 | 327 |
| 971 | iso_pu_bacteria | 2721755809 | 2724037494 | 327 |
| 972 | iso_pu_bacteria | 2721755810 | 2724043875 | 327 |
| 973 | iso_pu_bacteria | 2724679232 | 2725946723 | 327 |
| 974 | iso_pu_bacteria | 2728369365 | 2730163607 | 327 |
| 975 | iso_pu_bacteria | 2728369397 | 2730297617 | 327 |
| 976 | iso_pu_bacteria | 2738541333 | 2739035984 | 327 |
| 977 | iso_pu_bacteria | 2765235942 | 2766063876 | 327 |
| 978 | iso_pu_bacteria | 2791355259 | 2793316204 | 327 |
| 979 | iso_pu_bacteria | 2791355260 | 2793321010 | 327 |
| 980 | iso_pu_bacteria | 2791355261 | 2793327048 | 327 |
| 981 | iso_pu_bacteria | 2791355262 | 2793333701 | 327 |
| 982 | iso_pu_bacteria | 2791355264 | 2793348010 | 327 |
| 983 | iso_pu_bacteria | 2791355265 | 2793355111 | 327 |
| 984 | iso_pu_bacteria | 2791355267 | 2793367934 | 327 |
| 985 | iso_pu_bacteria | 2802429605 | 2805926489 | 327 |
| 986 | iso_pu_bacteria | 2802429606 | 2805933300 | 327 |
| 987 | iso_pu_bacteria | 2802429633 | 2806046837 | 327 |
| 988 | iso_pu_bacteria | 2802429634 | 2806052420 | 327 |
| 989 | iso_pu_bacteria | 2802429635 | 2806058809 | 327 |
| 990 | iso_pu_bacteria | 2802429636 | 2806067423 | 327 |
| 991 | iso_pu_bacteria | 2802429637 | 2806074073 | 327 |
| 992 | iso_pu_bacteria | 2933586486 | 2933591462 | 327 |
| 993 | iso_pu_bacteria | 2936367885 | 2936368037 | 327 |
| 994 | iso_pu_bacteria | 2936375103 | 2936381570 | 327 |
| 995 | iso_pu_bacteria | 2996893221 | 2996898697 | 327 |
| 996 | iso_pu_bacteria | 8005275841 | 8005279682 | 327 |
| 997 | iso_pu_bacteria | 8005289223 | 8005292874 | 327 |
| 998 | iso_pu_bacteria | 8005301065 | 8005304680 | 327 |
| 999 | iso_pu_bacteria | 8005376324 | 8005376527 | 327 |
| 1000 | iso_pu_bacteria | 8005382845 | 8005385908 | 327 |
| 1001 | iso_pu_bacteria | 8005395548 | 8005400315 | 327 |
| 1002 | iso_pu_bacteria | 8005460587 | 8005462017 | 327 |
| 1003 | iso_pu_bacteria | 8005563573 | 8005570527 | 327 |
| 1004 | iso_pu_bacteria | 8005570704 | 8005572771 | 327 |
| 1005 | iso_pu_bacteria | 8005688590 | 8005691105 | 327 |
| 1006 | iso_pu_bacteria | 8005695170 | 8005698686 | 327 |
| 1007 | iso_pu_bacteria | 8018163183 | 8018169418 | 327 |
| 1008 | iso_pu_bacteria | 8018176218 | 8018182601 | 327 |
| 1009 | iso_pu_bacteria | 8024479707 | 8024481197 | 327 |
| 1010 | iso_pu_bacteria | 8024501048 | 8024503163 | 327 |
| 1011 | iso_pu_bacteria | 8056375014 | 8056380815 | 327 |
| 1012 | iso_pu_bacteria | 8056382006 | 8056384657 | 327 |
| 1013 | iso_pu_bacteria | 8057874678 | 8057876387 | 327 |
| 1014 | 3300003771 | Ga0055526_1002187 | Ga0055526_10021872 | 335 |
| 1015 | 3300003775 | Ga0055524_1014257 | Ga0055524_10142573 | 335 |
| 1016 | 3300003790 | Ga0055528_1004900 | Ga0055528_10049007 | 335 |
| 1017 | iso_pu_bacteria | 2582581294 | 2585203165 | 339 |
| 1018 | iso_pu_bacteria | 2615840698 | 2616554024 | 339 |
| 1019 | iso_pu_bacteria | 2667528174 | 2671115223 | 339 |
| 1020 | iso_pu_bacteria | 8005682033 | 8005684482 | 339 |
| 1021 | 3300001979 | JGI24740J21852_10000287 | JGI24740J21852_1000028719 | 343 |
| 1022 | 3300002737 | JGI25162J39368_1002718 | JGI25162J39368_10027182 | 343 |
| 1023 | 3300002774 | JGI25150J39212_1000153 | JGI25150J39212_100015315 | 343 |
| 1024 | 3300002987 | JGI25159J45721_1000300 | JGI25159J45721_100030021 | 343 |
| 1025 | 3300002987 | JGI25159J45721_1001084 | JGI25159J45721_10010846 | 343 |
| 1026 | 3300003187 | JGI25151J46595_10000108 | JGI25151J46595_1000010884 | 343 |
| 1027 | 3300003214 | JGI25165J46597_1002334 | JGI25165J46597_10023348 | 343 |
| 1028 | 3300003215 | JGI25153J46596_10000919 | JGI25153J46596_1000091911 | 343 |
| 1029 | 3300003354 | JGI25160J50197_1000015 | JGI25160J50197_100001588 | 343 |
| 1030 | 3300003354 | JGI25160J50197_1010331 | JGI25160J50197_10103312 | 343 |
| 1031 | 3300003374 | JGI25161J50226_1000005 | JGI25161J50226_1000005153 | 343 |
| 1032 | 3300003374 | JGI25161J50226_1000051 | JGI25161J50226_100005158 | 343 |
| 1033 | 3300003790 | Ga0055528_1000373 | Ga0055528_100037339 | 343 |
| 1034 | 3300003790 | Ga0055528_1000922 | Ga0055528_100092216 | 343 |
| 1035 | 3300004625 | Ga0055543_1000012 | Ga0055543_100001289 | 343 |
| 1036 | 3300004625 | Ga0055543_1000095 | Ga0055543_100009535 | 343 |
| 1037 | 3300005262 | Ga0065165_1000125 | Ga0065165_100012552 | 343 |
| 1038 | 3300005262 | Ga0065165_1009983 | Ga0065165_10099832 | 343 |
| 1039 | 3300005262 | Ga0065165_1019313 | Ga0065165_10193133 | 343 |
| 1040 | 3300005614 | Ga0068856_100092212 | Ga0068856_1000922124 | 343 |
| 1041 | 3300025233 | Ga0209437_100075 | Ga0209437_100075145 | 343 |
| 1042 | 3300025246 | Ga0209646_1003895 | Ga0209646_10038953 | 343 |
| 1043 | 3300025261 | Ga0209233_1000223 | Ga0209233_100022331 | 343 |
| 1044 | 3300025261 | Ga0209233_1000301 | Ga0209233_100030134 | 343 |
| 1045 | 3300025294 | Ga0209025_1004423 | Ga0209025_10044239 | 343 |
| 1046 | 3300025303 | Ga0209051_1057895 | Ga0209051_10578951 | 343 |
| 1047 | 3300025933 | Ga0207706_10137357 | Ga0207706_101373572 | 343 |
| 1048 | 3300025941 | Ga0207711_10145508 | Ga0207711_101455082 | 343 |
| 1049 | 3300026078 | Ga0207702_10025463 | Ga0207702_100254634 | 343 |
| 1050 | 3300027312 | Ga0209371_1002004 | Ga0209371_10020044 | 343 |
| 1051 | 3300030500 | Ga0268256_1001752 | Ga0268256_100175213 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9793 | 24 | 343 |
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.973 | 24 | 343 |
| 4x9o-assembly1.cif.gz_B | beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate | 0.9718 | 21 | 343 |
| 4x9o-assembly1.cif.gz_A | beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate | 0.9694 | 21 | 343 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9656 | 23 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9877 | 23 | 190 | 3.40.47.10 |
| 2ebdB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9788 | 201 | 343 | 3.40.47.10 |
| 2x3eB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9729 | 23 | 190 | 3.40.47.10 |
| 1zowB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9722 | 23 | 188 | 3.40.47.10 |
| 4x9oB00 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9718 | 21 | 343 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538M788-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9916 | 245 | 343 |
GO:0016746
|
| AF-A0A800M9R9-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.989 | 28 | 175 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A7C5GL44-F1-model_v4 | 3-oxoacyl-ACP synthase (EC 2.3.1.180) | 0.9887 | 246 | 343 |
GO:0033818
|
| AF-A0A2M8PKT7-F1-model_v4 | 3-oxoacyl-ACP synthase (EC 2.3.1.180) | 0.9863 | 22 | 151 |
GO:0004315
GO:0006633 GO:0033818 GO:0044550 |
| AF-A0A535AJN1-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9856 | 21 | 180 |
GO:0004315
GO:0006633 GO:0044550 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar