F489071

General Info

Members Datasets Scaffolds Average Seq Length
1051 559 2102 291

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100358001|Ga0070663_1003580012
Length 265
Sequence MYHSIFTQALFKDQVVIVTGGGSGIGRCAAHELATLGALVALVGRTPEKLAAVQAEIAQAGGRSDTYPCNIRDEEFPAPLKDISLKGWEAVLQTNLTGGFLMARECLNQAMAASGGAIVNIVADMWGGMPGMGHSGAARAGMVNFTESASFEWAQYGVRVNAVAPGYVASSGMDAYPPAMHETIRAFPQTVPMKRFGTEAEVSAAIVFLLSPAASFITGSTLRVDGGRPNVRPGMPMPAVRNPAAPLNGFHLATLPKILQDGGDD

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
118 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
198 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
199 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
200 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
201 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
202 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
203 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
237 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
240 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
241 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
242 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
243 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
244 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
245 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
246 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
247 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
248 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
249 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
250 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
251 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
252 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
259 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
260 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
261 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
262 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
267 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
289 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
362 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
363 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
364 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
372 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
394 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
399 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
407 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
408 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
409 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
410 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
411 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
412 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
413 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
414 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
420 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
421 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
422 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
423 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
424 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
425 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
426 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
431 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
434 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
435 2511231008 Pseudomonas sp. GM21 Isolate Nodule
436 2511231010 Pseudomonas sp. GM25 Isolate Nodule
437 2511231011 Pseudomonas sp. GM30 Isolate Nodule
438 2511231012 Pseudomonas sp. GM33 Isolate Nodule
439 2511231014 Pseudomonas sp. GM48 Isolate Nodule
440 2511231016 Pseudomonas sp. GM50 Isolate Nodule
441 2511231017 Pseudomonas sp. GM55 Isolate Nodule
442 2511231018 Pseudomonas sp. GM60 Isolate Nodule
443 2511231019 Pseudomonas sp. GM67 Isolate Nodule
444 2511231020 Pseudomonas sp. GM74 Isolate Nodule
445 2511231021 Pseudomonas sp. GM78 Isolate Nodule
446 2511231023 Pseudomonas sp. GM80 Isolate Nodule
447 2547132374 Acidovorax radicis N35 Isolate Unclassified
448 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
449 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
450 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
451 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
452 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
453 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
454 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
455 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
456 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
457 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
458 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
459 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
460 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
461 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
462 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
463 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
464 2643221570 Acidovorax sp. Root568 Isolate Unclassified
465 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
466 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
467 2643221596 Acidovorax sp. Root70 Isolate Unclassified
468 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
469 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
470 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
471 2643221638 Duganella sp. Root336D2 Isolate Unclassified
472 2643221652 Acidovorax sp. Root402 Isolate Unclassified
473 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
474 2643221717 Acidovorax sp. Root267 Isolate Unclassified
475 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
476 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
477 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
478 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
479 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
480 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
481 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
482 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
483 2773857670 Pseudomonas sp. 478 Isolate Unclassified
484 2773857673 Pseudomonas sp. 443 Isolate Unclassified
485 2784132063 Pseudomonas sp. 424 Isolate Unclassified
486 2784132072 Pseudomonas sp. 460 Isolate Unclassified
487 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
488 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
489 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
490 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
491 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
492 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
493 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
494 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
495 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
496 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
497 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
498 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
499 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
500 2842677519 Variovorax sp. R-72495 Isolate Unclassified
501 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
502 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
503 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
504 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
505 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
506 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
507 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
508 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
509 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
510 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
511 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
512 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
513 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
514 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
515 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
516 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
517 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
518 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
519 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
520 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
521 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
522 2928058823 Ralstonia sp. 1138 Isolate Unclassified
523 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
524 2929520902 Variovorax beijingensis 502 Isolate Unclassified
525 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
526 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
527 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
528 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
529 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
530 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
531 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
532 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
533 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
534 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
535 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
536 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
537 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
538 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
539 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
540 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
541 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
542 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
543 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
544 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
545 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
546 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
547 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
548 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
549 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
550 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
551 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
552 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
553 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
554 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
555 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
556 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
557 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
558 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
559 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.73
Metatranscriptomes 0.29
Isolates 11.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.42
Nodule 2.57
Rhizoplane 3.33
Rhizosphere 71.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100358001 3300005455 Bacteria 1183
2 MRS2a_Contig_45 2124908027 Bacteria 78063
3 JGI24741J21665_1000563 3300001915 Bacteria 11347
4 JGI24740J21852_10003720 3300001979 Bacteria 6640
5 JGI25156J39149_1001699 3300002705 Bacteria 8855
6 JGI25162J39368_1000166 3300002737 Bacteria 72515
7 JGI25163J39215_1000715 3300002771 Bacteria 8626
8 JGI25164J39214_1000129 3300002772 Bacteria 72515
9 JGI25151J46595_10030891 3300003187 Bacteria 2100
10 JGI25165J46597_1000251 3300003214 Bacteria 72515
11 rootH2_10054890 3300003320 Bacteria 1576
12 JGI25160J50197_1024790 3300003354 Bacteria 1694
13 Ga0006562J51391_1127201 3300003578 Bacteria 9680
14 Ga0006562J51391_1133065 3300003578 Bacteria 3250
15 Ga0006562J51391_1133066 3300003578 Bacteria 2570
16 Ga0055538_1000405 3300003751 Bacteria 17180
17 Ga0055538_1001223 3300003751 Bacteria 5348
18 Ga0055538_1001224 3300003751 Bacteria 5345
19 Ga0055539_1000185 3300003752 Bacteria 52003
20 Ga0055539_1000397 3300003752 Bacteria 17180
21 Ga0055533_1000398 3300003756 Bacteria 17180
22 Ga0055533_1001284 3300003756 Bacteria 6833
23 Ga0055532_1000006 3300003758 Bacteria 451244
24 Ga0055532_1000498 3300003758 Bacteria 17180
25 Ga0055525_1000501 3300003759 Bacteria 19691
26 Ga0055525_1000553 3300003759 Bacteria 17180
27 Ga0055535_1000004 3300003761 Bacteria 451244
28 Ga0055529_1000273 3300003763 Bacteria 61443
29 Ga0055526_1005404 3300003771 Bacteria 7351
30 Ga0055526_1018471 3300003771 Bacteria 2600
31 Ga0055537_1004515 3300003773 Bacteria 3965
32 Ga0055536_1000239 3300003781 Bacteria 44007
33 Ga0055536_1002621 3300003781 Bacteria 10016
34 Ga0055534_1000600 3300003784 Bacteria 18687
35 Ga0055530_10000289 3300003791 Bacteria 45948
36 Ga0055530_10002048 3300003791 Bacteria 13578
37 Ga0055540_1000105 3300003792 Bacteria 93593
38 Ga0055531_10000081 3300003794 Bacteria 103600
39 Ga0055531_10004735 3300003794 Bacteria 8140
40 Ga0055541_1000284 3300003841 Bacteria 17180
41 Ga0055541_1001906 3300003841 Bacteria 4329
42 Ga0055541_1003832 3300003841 Bacteria 2786
43 Ga0055543_1000305 3300004625 Bacteria 34343
44 Ga0065165_1002126 3300005262 Bacteria 18020
45 Ga0065165_1045245 3300005262 Bacteria 1283
46 Ga0065714_10002480 3300005288 Bacteria 17144
47 Ga0065714_10065498 3300005288 Bacteria 9734
48 Ga0065714_10086658 3300005288 Bacteria 2074
49 Ga0065714_10103566 3300005288 Bacteria 1601
50 Ga0065712_10000845 3300005290 Bacteria 7983
51 Ga0065715_10012261 3300005293 Bacteria 2254
52 Ga0070676_10112978 3300005328 Bacteria 1694
53 Ga0070676_10144881 3300005328 Bacteria 1515
54 Ga0070670_100000224 3300005331 Bacteria 52252
55 Ga0068868_100091992 3300005338 Bacteria 2445
56 Ga0068868_100107647 3300005338 Bacteria 2262
57 Ga0068868_100136496 3300005338 Bacteria 2011
58 Ga0070689_100063076 3300005340 Bacteria 2884
59 Ga0070661_100000336 3300005344 Bacteria 37535
60 Ga0070661_100228619 3300005344 Bacteria 1429
61 Ga0070669_100006480 3300005353 Bacteria 8428
62 Ga0070671_100047273 3300005355 Bacteria 3579
63 Ga0070671_100106756 3300005355 Bacteria 2351
64 Ga0070673_100165583 3300005364 Bacteria 1883
65 Ga0070688_100331366 3300005365 Bacteria 1109
66 Ga0070705_100113686 3300005440 Bacteria 1735
67 Ga0070663_100000246 3300005455 Bacteria 27518
68 Ga0070663_100155007 3300005455 Bacteria 1759
69 Ga0070663_100186749 3300005455 Bacteria 1611
70 Ga0070678_100078656 3300005456 Bacteria 2492
71 Ga0070662_100000056 3300005457 Bacteria 60234
72 Ga0070697_100296058 3300005536 Bacteria 1391
73 Ga0068853_100023937 3300005539 Bacteria 5118
74 Ga0068853_100210067 3300005539 Bacteria 1774
75 Ga0070686_100253765 3300005544 Bacteria 1286
76 Ga0070695_100009160 3300005545 Bacteria 5885
77 Ga0070696_100173698 3300005546 Bacteria 1594
78 Ga0070665_100033455 3300005548 Bacteria 5172
79 Ga0070704_100009794 3300005549 Bacteria 5811
80 Ga0070704_100392120 3300005549 Bacteria 1183
81 Ga0070664_100000122 3300005564 Bacteria 51758
82 Ga0070664_100071994 3300005564 Bacteria 2964
83 Ga0070664_100420602 3300005564 Bacteria 1224
84 Ga0068854_100000121 3300005578 Bacteria 53603
85 Ga0068854_100014586 3300005578 Bacteria 5185
86 Ga0068854_100029670 3300005578 Bacteria 3788
87 Ga0068856_100001446 3300005614 Bacteria 24888
88 Ga0068856_100199475 3300005614 Bacteria 2016
89 Ga0070702_100185214 3300005615 Bacteria 1366
90 Ga0068859_100141340 3300005617 Bacteria 2481
91 Ga0068859_100293899 3300005617 Bacteria 1718
92 Ga0068864_100003161 3300005618 Bacteria 13614
93 Ga0068861_100040406 3300005719 Bacteria 3489
94 Ga0068861_100040594 3300005719 Bacteria 3482
95 Ga0068851_10000028 3300005834 Bacteria 117106
96 Ga0068863_100140768 3300005841 Bacteria 2306
97 Ga0068863_100321234 3300005841 Bacteria 1504
98 Ga0068863_100362306 3300005841 Bacteria 1413
99 Ga0068860_100032977 3300005843 Bacteria 4973
100 Ga0081540_1004812 3300005983 Bacteria 10173
101 Ga0081540_1015156 3300005983 Bacteria 4892
102 Ga0081539_10032068 3300005985 Bacteria 3224
103 Ga0070717_10004861 3300006028 Bacteria 9772
104 Ga0070717_10025882 3300006028 Bacteria 4675
105 Ga0075365_10028979 3300006038 Bacteria 3533
106 Ga0075365_10033580 3300006038 Bacteria 3308
107 Ga0075368_10020265 3300006042 Bacteria 2516
108 Ga0075432_10016974 3300006058 Bacteria 2485
109 Ga0075367_10048532 3300006178 Bacteria 2501
110 Ga0075367_10106909 3300006178 Bacteria 1715
111 Ga0075366_10020174 3300006195 Bacteria 3864
112 Ga0075366_10159319 3300006195 Bacteria 1368
113 Ga0097621_100190550 3300006237 Bacteria 1776
114 Ga0075370_10049297 3300006353 Bacteria 2387
115 Ga0068871_100052556 3300006358 Bacteria 3300
116 Ga0075428_100042245 3300006844 Bacteria 5014
117 Ga0075428_100213784 3300006844 Bacteria 2083
118 Ga0075428_100339326 3300006844 Bacteria 1614
119 Ga0075430_100143969 3300006846 Bacteria 1985
120 Ga0075430_100186936 3300006846 Bacteria 1723
121 Ga0075431_100235557 3300006847 Bacteria 1864
122 Ga0075429_100361443 3300006880 Bacteria 1271
123 Ga0075436_100007551 3300006914 Bacteria 7427
124 Ga0075436_100060272 3300006914 Bacteria 2621
125 Ga0097620_100141338 3300006931 Bacteria 2481
126 Ga0097620_100293900 3300006931 Bacteria 1718
127 Ga0079104_1000124 3300006946 Bacteria 110752
128 Ga0079104_1008588 3300006946 Bacteria 3553
129 Ga0075435_100012311 3300007076 Bacteria 6329
130 Ga0099794_10000175 3300007265 Bacteria 23393
131 Ga0099794_10008266 3300007265 Bacteria 4313
132 Ga0099795_10000165 3300007788 Bacteria 11089
133 Ga0105251_10000346 3300009011 Bacteria 46116
134 Ga0105251_10034727 3300009011 Bacteria 2493
135 Ga0105244_10000322 3300009036 Bacteria 45812
136 Ga0105250_10002492 3300009092 Bacteria 9232
137 Ga0105250_10053842 3300009092 Bacteria 1614
138 Ga0105240_10015691 3300009093 Bacteria 10283
139 Ga0105240_10105334 3300009093 Bacteria 3424
140 Ga0105240_10318109 3300009093 Bacteria 1775
141 Ga0111539_10024343 3300009094 Bacteria 7431
142 Ga0111539_10064464 3300009094 Bacteria 4334
143 Ga0105245_10013885 3300009098 Bacteria 7016
144 Ga0105245_10039587 3300009098 Bacteria 4196
145 Ga0105245_10099935 3300009098 Bacteria 2683
146 Ga0105245_10121680 3300009098 Bacteria 2439
147 Ga0105245_10237725 3300009098 Bacteria 1764
148 Ga0105247_10041933 3300009101 Bacteria 2801
149 Ga0114129_10368819 3300009147 Bacteria 1898
150 Ga0105243_10000103 3300009148 Bacteria 97091
151 Ga0105241_10039449 3300009174 Bacteria 3562
152 Ga0105248_10071469 3300009177 Bacteria 3898
153 Ga0105248_10188843 3300009177 Bacteria 2322
154 Ga0105238_10076260 3300009551 Bacteria 3344
155 Ga0105249_10109781 3300009553 Bacteria 2606
156 Ga0099796_10000071 3300010159 Bacteria 18016
157 Ga0105246_10006736 3300011119 Bacteria 7025
158 Ga0105246_10101796 3300011119 Bacteria 2093
159 Ga0105246_10163692 3300011119 Bacteria 1697
160 Ga0157345_1000009 3300012498 Bacteria 55332
161 Ga0157373_10003474 3300013100 Bacteria 11913
162 Ga0157373_10033971 3300013100 Bacteria 3664
163 Ga0157373_10038079 3300013100 Bacteria 3447
164 Ga0157373_10156321 3300013100 Bacteria 1604
165 Ga0157371_10000072 3300013102 Bacteria 163917
166 Ga0157371_10000306 3300013102 Bacteria 64149
167 Ga0157371_10006322 3300013102 Bacteria 9807
168 Ga0157371_10027785 3300013102 Bacteria 4100
169 Ga0157370_10000031 3300013104 Bacteria 139879
170 Ga0157370_10098156 3300013104 Bacteria 2747
171 Ga0157370_10152759 3300013104 Bacteria 2148
172 Ga0157369_10003537 3300013105 Bacteria 18566
173 Ga0157369_10013154 3300013105 Bacteria 9364
174 Ga0157369_10114886 3300013105 Bacteria 2858
175 Ga0157369_10259065 3300013105 Bacteria 1814
176 Ga0157374_10022608 3300013296 Bacteria 5610
177 Ga0157378_10261127 3300013297 Bacteria 1662
178 Ga0163162_10000072 3300013306 Bacteria 92818
179 Ga0163162_10032056 3300013306 Bacteria 5217
180 Ga0163162_10127391 3300013306 Bacteria 2653
181 Ga0163162_10212141 3300013306 Bacteria 2066
182 Ga0157372_10001411 3300013307 Bacteria 25934
183 Ga0163163_10010321 3300014325 Bacteria 8396
184 Ga0163163_10557829 3300014325 Bacteria 1208
185 Ga0157380_10031465 3300014326 Bacteria 4073
186 Ga0182008_10003577 3300014497 Bacteria 9313
187 Ga0182008_10006269 3300014497 Bacteria 6679
188 Ga0182008_10022716 3300014497 Bacteria 3211
189 Ga0182008_10084256 3300014497 Bacteria 1565
190 Ga0157379_10186184 3300014968 Bacteria 1876
191 Ga0157379_10443523 3300014968 Bacteria 1197
192 Ga0157376_10018698 3300014969 Bacteria 5321
193 Ga0182006_1051303 3300015261 Bacteria 1587
194 Ga0182006_1093032 3300015261 Bacteria 1082
195 Ga0182005_1015952 3300015265 Bacteria 2092
196 Ga0182005_1058996 3300015265 Bacteria 1047
197 Ga0163161_10006408 3300017792 Bacteria 8151
198 Ga0163161_10016557 3300017792 Bacteria 5148
199 Ga0163161_10016783 3300017792 Bacteria 5118
200 Ga0163161_10068832 3300017792 Bacteria 2587
201 Ga0163161_10241643 3300017792 Bacteria 1404
202 Ga0213872_10000489 3300021361 Bacteria 31637
203 Ga0213872_10000610 3300021361 Bacteria 27068
204 Ga0213872_10001402 3300021361 Bacteria 15883
205 Ga0209435_100432 3300025206 Bacteria 8686
206 Ga0209760_100043 3300025207 Bacteria 113964
207 Ga0209436_100149 3300025208 Bacteria 33529
208 Ga0209436_102498 3300025208 Bacteria 5492
209 Ga0209784_100006 3300025224 Bacteria 930704
210 Ga0209784_100017 3300025224 Bacteria 472003
211 Ga0209784_100391 3300025224 Bacteria 20022
212 Ga0209784_100520 3300025224 Bacteria 14622
213 Ga0209566_100002 3300025225 Bacteria 2614868
214 Ga0209566_100014 3300025225 Bacteria 472003
215 Ga0209566_103002 3300025225 Bacteria 2786
216 Ga0209674_100010 3300025226 Bacteria 1038638
217 Ga0209674_100028 3300025226 Bacteria 472003
218 Ga0209674_100796 3300025226 Bacteria 10588
219 Ga0209672_100448 3300025228 Bacteria 23309
220 Ga0209672_100849 3300025228 Bacteria 14061
221 Ga0209147_100015 3300025229 Bacteria 565073
222 Ga0209147_100038 3300025229 Bacteria 314497
223 Ga0209563_100004 3300025230 Bacteria 1814108
224 Ga0209563_100032 3300025230 Bacteria 472003
225 Ga0207427_100047 3300025231 Bacteria 240409
226 Ga0209437_100009 3300025233 Bacteria 915954
227 Ga0209258_100021 3300025242 Bacteria 565073
228 Ga0209258_100828 3300025242 Bacteria 17186
229 Ga0207425_1000160 3300025245 Bacteria 57151
230 Ga0207425_1000961 3300025245 Bacteria 13552
231 Ga0209646_1000171 3300025246 Bacteria 84951
232 Ga0209026_1002374 3300025250 Bacteria 7112
233 Ga0209677_100007 3300025253 Bacteria 1021332
234 Ga0209677_100018 3300025253 Bacteria 472003
235 Ga0209759_1000926 3300025256 Bacteria 21318
236 Ga0209759_1001154 3300025256 Bacteria 16779
237 Ga0209129_1011559 3300025258 Bacteria 2097
238 Ga0209233_1000032 3300025261 Bacteria 623596
239 Ga0209233_1001245 3300025261 Bacteria 10239
240 Ga0209565_1000664 3300025263 Bacteria 21943
241 Ga0209565_1003248 3300025263 Bacteria 5359
242 Ga0209455_1000028 3300025272 Bacteria 565073
243 Ga0209673_1011371 3300025273 Bacteria 3675
244 Ga0209673_1016051 3300025273 Bacteria 2816
245 Ga0209130_1000624 3300025284 Bacteria 33738
246 Ga0209130_1003920 3300025284 Bacteria 5963
247 Ga0209675_1000467 3300025291 Bacteria 31046
248 Ga0209675_1001555 3300025291 Bacteria 13032
249 Ga0209675_1020112 3300025291 Bacteria 1818
250 Ga0209676_1000010 3300025292 Bacteria 954025
251 Ga0209676_1000646 3300025292 Bacteria 50033
252 Ga0209676_1004434 3300025292 Bacteria 7832
253 Ga0209676_1005348 3300025292 Bacteria 6757
254 Ga0209025_1000718 3300025294 Bacteria 56292
255 Ga0209564_1000088 3300025295 Bacteria 250268
256 Ga0209564_1004515 3300025295 Bacteria 8472
257 Ga0209564_1007989 3300025295 Bacteria 5316
258 Ga0209050_1000081 3300025298 Bacteria 267533
259 Ga0209050_1000363 3300025298 Bacteria 86923
260 Ga0209050_1000430 3300025298 Bacteria 77008
261 Ga0209050_1000535 3300025298 Bacteria 62996
262 Ga0209050_1007738 3300025298 Bacteria 5929
263 Ga0209256_1000560 3300025299 Bacteria 53201
264 Ga0209256_1001254 3300025299 Bacteria 27951
265 Ga0209256_1002634 3300025299 Bacteria 14142
266 Ga0207426_1006486 3300025302 Bacteria 5079
267 Ga0207426_1034679 3300025302 Bacteria 1617
268 Ga0209051_1000025 3300025303 Bacteria 415397
269 Ga0209051_1000185 3300025303 Bacteria 110195
270 Ga0209257_1000039 3300025304 Bacteria 591694
271 Ga0209257_1000040 3300025304 Bacteria 538759
272 Ga0209257_1000157 3300025304 Bacteria 181004
273 Ga0209257_1058303 3300025304 Bacteria 1059
274 Ga0207656_10000056 3300025321 Bacteria 44124
275 Ga0207696_1000193 3300025711 Bacteria 94161
276 Ga0207696_1001821 3300025711 Bacteria 10979
277 Ga0207655_1000505 3300025728 Bacteria 49919
278 Ga0207655_1010484 3300025728 Bacteria 5613
279 Ga0207655_1020359 3300025728 Bacteria 3414
280 Ga0207655_1030332 3300025728 Bacteria 2516
281 Ga0207713_1000386 3300025735 Bacteria 47877
282 Ga0207713_1000431 3300025735 Bacteria 44260
283 Ga0207713_1001314 3300025735 Bacteria 20391
284 Ga0207713_1002492 3300025735 Bacteria 13378
285 Ga0207713_1012230 3300025735 Bacteria 4608
286 Ga0207713_1016633 3300025735 Bacteria 3726
287 Ga0207647_10124892 3300025904 Bacteria 1515
288 Ga0207699_10326536 3300025906 Bacteria 1078
289 Ga0207645_10065700 3300025907 Bacteria 2319
290 Ga0207654_10014283 3300025911 Bacteria 4102
291 Ga0207695_10002542 3300025913 Bacteria 26794
292 Ga0207671_10061555 3300025914 Bacteria 2785
293 Ga0207693_10084413 3300025915 Bacteria 2488
294 Ga0207649_10000449 3300025920 Bacteria 29607
295 Ga0207681_10001738 3300025923 Bacteria 13982
296 Ga0207681_10203679 3300025923 Bacteria 1521
297 Ga0207650_10000291 3300025925 Bacteria 50791
298 Ga0207687_10005746 3300025927 Bacteria 8211
299 Ga0207687_10011264 3300025927 Bacteria 5842
300 Ga0207644_10031910 3300025931 Bacteria 3674
301 Ga0207644_10102053 3300025931 Bacteria 2157
302 Ga0207644_10164695 3300025931 Bacteria 1726
303 Ga0207706_10000445 3300025933 Bacteria 44135
304 Ga0207706_10007508 3300025933 Bacteria 10086
305 Ga0207709_10000035 3300025935 Bacteria 300968
306 Ga0207670_10303073 3300025936 Bacteria 1252
307 Ga0207669_10263229 3300025937 Bacteria 1291
308 Ga0207691_10247796 3300025940 Bacteria 1539
309 Ga0207711_10328351 3300025941 Bacteria 1414
310 Ga0207689_10009277 3300025942 Bacteria 8506
311 Ga0207679_10000007 3300025945 Bacteria 460140
312 Ga0207679_10458960 3300025945 Bacteria 1131
313 Ga0207667_10412081 3300025949 Bacteria 1375
314 Ga0207651_10165626 3300025960 Bacteria 1738
315 Ga0207651_10205169 3300025960 Bacteria 1583
316 Ga0207668_10091720 3300025972 Bacteria 2234
317 Ga0207640_10000107 3300025981 Bacteria 63143
318 Ga0207640_10026064 3300025981 Bacteria 3546
319 Ga0207658_10189908 3300025986 Bacteria 1707
320 Ga0207677_10009786 3300026023 Bacteria 5402
321 Ga0207677_10108219 3300026023 Bacteria 2063
322 Ga0207639_10126991 3300026041 Bacteria 2105
323 Ga0207639_10324051 3300026041 Bacteria 1369
324 Ga0207678_10000207 3300026067 Bacteria 51939
325 Ga0207678_10002939 3300026067 Bacteria 15441
326 Ga0207702_10000260 3300026078 Bacteria 61036
327 Ga0207641_10177909 3300026088 Bacteria 1946
328 Ga0207641_10240258 3300026088 Bacteria 1687
329 Ga0207648_10122901 3300026089 Bacteria 2283
330 Ga0207676_10190227 3300026095 Bacteria 1805
331 Ga0207675_100036501 3300026118 Bacteria 4584
332 Ga0207675_100112511 3300026118 Bacteria 2569
333 Ga0207675_100160586 3300026118 Bacteria 2143
334 Ga0207683_10009292 3300026121 Bacteria 8378
335 Ga0207698_10172974 3300026142 Bacteria 1904
336 Ga0209281_1000077 3300027111 Bacteria 262887
337 Ga0209281_1006210 3300027111 Bacteria 3155
338 Ga0209179_1000643 3300027512 Bacteria 3720
339 Ga0209179_1010378 3300027512 Bacteria 1622
340 Ga0209588_1006727 3300027671 Bacteria 3358
341 Ga0209588_1006757 3300027671 Bacteria 3352
342 Ga0207428_10015756 3300027907 Bacteria 6527
343 Ga0207428_10035452 3300027907 Bacteria 4078
344 Ga0207428_10045233 3300027907 Bacteria 3547
345 Ga0207428_10073411 3300027907 Bacteria 2684
346 Ga0268266_10040831 3300028379 Bacteria 3955
347 Ga0268266_10134411 3300028379 Bacteria 2214
348 Ga0268264_10462527 3300028381 Bacteria 1231
349 Ga0265318_10011277 3300028577 Bacteria 3854
350 Ga0307515_10000208 3300028794 Bacteria 144484
351 Ga0307515_10080725 3300028794 Bacteria 4236
352 Ga0307511_10175496 3300030521 Bacteria 1167
353 Ga0307512_10112371 3300030522 Bacteria 1788
354 Ga0316177_1020845 3300030731 Bacteria 5959
355 Ga0314311_1060215 3300030733 Bacteria 2732
356 Ga0316178_1101239 3300030735 Bacteria 23092
357 Ga0316183_1015378 3300030742 Bacteria 9501
358 Ga0316181_1075075 3300030744 Bacteria 2452
359 Ga0316181_1158467 3300030744 Bacteria 2152
360 Ga0316182_1280847 3300030745 Bacteria 2052
361 Ga0265330_10000076 3300031235 Bacteria 84642
362 Ga0265332_10000002 3300031238 Bacteria 709510
363 Ga0265325_10026911 3300031241 Bacteria 3112
364 Ga0307513_10000090 3300031456 Bacteria 129750
365 Ga0307513_10012431 3300031456 Bacteria 10506
366 Ga0307513_10131489 3300031456 Bacteria 2447
367 Ga0307513_10317661 3300031456 Bacteria 1317
368 Ga0307509_10056371 3300031507 Bacteria 4171
369 Ga0307408_100000115 3300031548 Bacteria 88580
370 Ga0307408_100000125 3300031548 Bacteria 84749
371 Ga0307408_100000895 3300031548 Bacteria 23425
372 Ga0307408_100007259 3300031548 Bacteria 7331
373 Ga0307408_100007580 3300031548 Bacteria 7173
374 Ga0307408_100044798 3300031548 Bacteria 3155
375 Ga0265314_10000066 3300031711 Bacteria 156399
376 Ga0265314_10128062 3300031711 Bacteria 1588
377 Ga0316576_10000405 3300031727 Bacteria 19893
378 Ga0307516_10006050 3300031730 Bacteria 14298
379 Ga0307405_10317636 3300031731 Bacteria 1188
380 Ga0307413_10142044 3300031824 Bacteria 1660
381 Ga0307413_10220092 3300031824 Bacteria 1386
382 Ga0307406_10058978 3300031901 Bacteria 2468
383 Ga0307406_10094923 3300031901 Bacteria 2017
384 Ga0307406_10106872 3300031901 Bacteria 1918
385 Ga0307412_10010358 3300031911 Bacteria 5367
386 Ga0307412_10017587 3300031911 Bacteria 4281
387 Ga0307412_10112378 3300031911 Bacteria 1947
388 Ga0307412_10335631 3300031911 Bacteria 1208
389 Ga0307409_100034446 3300031995 Bacteria 3698
390 Ga0307416_100070969 3300032002 Bacteria 2891
391 Ga0307416_100100216 3300032002 Bacteria 2518
392 Ga0307416_100187721 3300032002 Bacteria 1945
393 Ga0307416_100496800 3300032002 Bacteria 1283
394 Ga0307414_10086753 3300032004 Bacteria 2310
395 Ga0307414_10109249 3300032004 Bacteria 2100
396 Ga0307414_10267957 3300032004 Bacteria 1429
397 Ga0307510_10014599 3300033180 Bacteria 9297
398 Ga0373923_0059551 3300035111 Bacteria 1619
399 Ga0373936_0058574 3300035113 Bacteria 1568
400 Ga0373945_0005853 3300035116 Bacteria 3946
401 Ga0373954_0010190 3300035118 Bacteria 4143
402 Ga0373955_0006435 3300035172 Bacteria 5350
403 Ga0373924_0001251 3300035410 Bacteria 8137
404 Ga0373935_0075239 3300035692 Bacteria 2184
405 Ga0373927_0019954 3300035695 Bacteria 4395
406 Ga0373927_0113034 3300035695 Bacteria 1770
407 Ga0373933_0008240 3300035724 Bacteria 5688
408 Ga0373947_0015164 3300035725 Bacteria 4424
409 Ga0373947_0047205 3300035725 Bacteria 2580
410 Ga0373937_0007858 3300036401 Bacteria 9246
411 Ga0373925_0170037 3300037068 Bacteria 1720
412 Ga0373925_0330040 3300037068 Bacteria 1236
413 Ga0395900_0003101 3300037418 Bacteria 18047
414 Ga0237819_04223 3300038705 Bacteria 2395
415 Ga0436361_0324341 3300039447 Bacteria 73428
416 Ga0436361_0729857 3300039447 Bacteria 22870
417 Ga0436361_0922740 3300039447 Bacteria 2443
418 Ga0436361_1103726 3300039447 Bacteria 27088
419 Ga0439438_000117 3300041405 Bacteria 36333
420 Ga0439438_016146 3300041405 Bacteria 2176
421 Ga0439438_018549 3300041405 Bacteria 1979
422 Ga0439447_000258 3300041407 Bacteria 18640
423 Ga0439447_004731 3300041407 Bacteria 4637
424 Ga0439466_0003476 3300041411 Bacteria 6105
425 Ga0439466_0011397 3300041411 Bacteria 3288
426 Ga0439466_0013472 3300041411 Bacteria 2992
427 Ga0439466_0022658 3300041411 Bacteria 2214
428 Ga0439466_0054731 3300041411 Bacteria 1298
429 Ga0451839_1226771 3300041496 Bacteria 926
430 Ga0439431_0041170 3300041997 Bacteria 1177
431 Ga0439432_000381 3300042006 Bacteria 16378
432 Ga0439432_005659 3300042006 Bacteria 4494
433 Ga0439452_000091 3300042010 Bacteria 78007
434 Ga0439452_000164 3300042010 Bacteria 49561
435 Ga0439452_006049 3300042010 Bacteria 3827
436 Ga0439452_009472 3300042010 Bacteria 2867
437 Ga0439452_009980 3300042010 Bacteria 2777
438 Ga0439452_023100 3300042010 Bacteria 1603
439 Ga0439456_005828 3300042013 Bacteria 2506
440 Ga0450911_000746 3300042115 Bacteria 9346
441 Ga0450920_007188 3300042122 Bacteria 2014
442 Ga0450896_003141 3300042133 Bacteria 2176
443 Ga0450902_006117 3300042137 Bacteria 1836
444 Ga0450903_001867 3300042138 Bacteria 3835
445 Ga0450903_002715 3300042138 Bacteria 3116
446 Ga0450904_001840 3300042139 Bacteria 2756
447 Ga0450905_002056 3300042142 Bacteria 2568
448 Ga0450905_012374 3300042142 Bacteria 1201
449 Ga0450906_004872 3300042145 Bacteria 2791
450 Ga0450907_000038 3300042146 Bacteria 57421
451 Ga0450907_001262 3300042146 Bacteria 5666
452 Ga0439446_0005711 3300042156 Bacteria 3212
453 Ga0450909_000970 3300042185 Bacteria 3925
454 Ga0439434_0000146 3300042435 Bacteria 18978
455 Ga0439464_0026399 3300042439 Bacteria 1611
456 Ga0439460_0000739 3300042461 Bacteria 7319
457 Ga0439460_0004830 3300042461 Bacteria 3293
458 Ga0450918_003063 3300042531 Bacteria 3125
459 Ga0450893_0007396 3300042532 Bacteria 1784
460 Ga0450901_001528 3300042533 Bacteria 2633
461 Ga0439440_0000716 3300042993 Bacteria 5697
462 Ga0466986_0214250 3300044650 Bacteria 1255
463 Ga0453683_0071593 3300044673 Bacteria 2169
464 Ga0451576_0007815 3300045051 Bacteria 12675
465 Ga0466967_0019240 3300045976 Bacteria 5486
466 Ga0495617_000309 3300046452 Bacteria 27418
467 Ga0495617_002310 3300046452 Bacteria 7685
468 Ga0495617_015897 3300046452 Bacteria 2546
469 Ga0495617_085817 3300046452 Bacteria 1029
470 Ga0495627_000785 3300046453 Bacteria 23415
471 Ga0495627_002296 3300046453 Bacteria 9432
472 Ga0495627_002700 3300046453 Bacteria 8295
473 Ga0495627_007208 3300046453 Bacteria 4288
474 Ga0495603_0016957 3300046455 Bacteria 4407
475 Ga0495603_0022975 3300046455 Bacteria 3774
476 Ga0495603_0037472 3300046455 Bacteria 2910
477 Ga0495590_0000265 3300046457 Bacteria 28527
478 Ga0495590_0008924 3300046457 Bacteria 3809
479 Ga0495590_0012789 3300046457 Bacteria 3104
480 Ga0495590_0035563 3300046457 Bacteria 1738
481 Ga0495591_000114 3300046458 Bacteria 93304
482 Ga0495591_000445 3300046458 Bacteria 33637
483 Ga0495591_001195 3300046458 Bacteria 16934
484 Ga0495591_004397 3300046458 Bacteria 6918
485 Ga0495591_016254 3300046458 Bacteria 2599
486 Ga0495638_0001380 3300046460 Bacteria 22144
487 Ga0495638_0006818 3300046460 Bacteria 8245
488 Ga0495638_0016469 3300046460 Bacteria 4951
489 Ga0495638_0018041 3300046460 Bacteria 4695
490 Ga0495638_0043694 3300046460 Bacteria 2825
491 Ga0495638_0067457 3300046460 Bacteria 2196
492 Ga0495638_0093891 3300046460 Bacteria 1803
493 Ga0495641_0061637 3300046461 Bacteria 1693
494 Ga0495653_0008254 3300046463 Bacteria 8536
495 Ga0495653_0045047 3300046463 Bacteria 3421
496 Ga0495653_0125903 3300046463 Bacteria 1820
497 Ga0495653_0137805 3300046463 Bacteria 1719
498 Ga0495653_0250158 3300046463 Bacteria 1176
499 Ga0495650_0004067 3300046471 Bacteria 10231
500 Ga0495650_0005308 3300046471 Bacteria 8427
501 Ga0495650_0006574 3300046471 Bacteria 7224
502 Ga0495650_0019510 3300046471 Bacteria 3333
503 Ga0495650_0020296 3300046471 Bacteria 3243
504 Ga0495650_0021261 3300046471 Bacteria 3142
505 Ga0495650_0023776 3300046471 Bacteria 2909
506 Ga0495650_0051426 3300046471 Bacteria 1697
507 Ga0495580_0035117 3300046472 Bacteria 3605
508 Ga0495582_0006023 3300046473 Bacteria 6760
509 Ga0495605_0000309 3300046474 Bacteria 51425
510 Ga0495605_0006838 3300046474 Bacteria 6517
511 Ga0495605_0008079 3300046474 Bacteria 5955
512 Ga0495605_0043267 3300046474 Bacteria 2233
513 Ga0495605_0043460 3300046474 Bacteria 2227
514 Ga0495605_0047189 3300046474 Bacteria 2113
515 Ga0495639_0011124 3300046475 Bacteria 3878
516 Ga0495639_0165555 3300046475 Bacteria 1072
517 Ga0495664_0003593 3300046477 Bacteria 8456
518 Ga0495584_0000217 3300046491 Bacteria 41596
519 Ga0495584_0002031 3300046491 Bacteria 11633
520 Ga0495584_0002563 3300046491 Bacteria 10249
521 Ga0495584_0002853 3300046491 Bacteria 9652
522 Ga0495584_0005652 3300046491 Bacteria 6608
523 Ga0495584_0022627 3300046491 Bacteria 3188
524 Ga0495584_0026694 3300046491 Bacteria 2926
525 Ga0495584_0049159 3300046491 Bacteria 2125
526 Ga0495584_0116231 3300046491 Bacteria 1354
527 Ga0495585_0000228 3300046492 Bacteria 57922
528 Ga0495585_0001137 3300046492 Bacteria 21805
529 Ga0495585_0013961 3300046492 Bacteria 4690
530 Ga0495585_0016331 3300046492 Bacteria 4301
531 Ga0495585_0026568 3300046492 Bacteria 3307
532 Ga0495585_0081529 3300046492 Bacteria 1752
533 Ga0495594_0002102 3300046499 Bacteria 10368
534 Ga0495594_0018587 3300046499 Bacteria 3684
535 Ga0495594_0018919 3300046499 Bacteria 3655
536 Ga0495594_0025710 3300046499 Bacteria 3165
537 Ga0495596_0000107 3300046500 Bacteria 59095
538 Ga0495596_0081682 3300046500 Bacteria 1255
539 Ga0495607_0000159 3300046501 Bacteria 71580
540 Ga0495607_0005431 3300046501 Bacteria 9129
541 Ga0495607_0017665 3300046501 Bacteria 4571
542 Ga0495607_0030429 3300046501 Bacteria 3314
543 Ga0495607_0030914 3300046501 Bacteria 3281
544 Ga0495607_0032508 3300046501 Bacteria 3183
545 Ga0495607_0032518 3300046501 Bacteria 3183
546 Ga0495607_0049590 3300046501 Bacteria 2447
547 Ga0495583_0005717 3300046506 Bacteria 8349
548 Ga0495583_0006667 3300046506 Bacteria 7486
549 Ga0495606_0001649 3300046507 Bacteria 29053
550 Ga0495606_0006186 3300046507 Bacteria 11140
551 Ga0495606_0008665 3300046507 Bacteria 8769
552 Ga0495606_0009531 3300046507 Bacteria 8199
553 Ga0495606_0067050 3300046507 Bacteria 2273
554 Ga0495610_0006283 3300046512 Bacteria 8226
555 Ga0495610_0013703 3300046512 Bacteria 4802
556 Ga0495610_0042373 3300046512 Bacteria 2277
557 Ga0495610_0047414 3300046512 Bacteria 2113
558 Ga0495610_0054393 3300046512 Bacteria 1934
559 Ga0495610_0066359 3300046512 Bacteria 1699
560 Ga0495616_0000784 3300046513 Bacteria 23206
561 Ga0495616_0001395 3300046513 Bacteria 16838
562 Ga0495616_0007013 3300046513 Bacteria 6780
563 Ga0495616_0010643 3300046513 Bacteria 5314
564 Ga0495616_0061958 3300046513 Bacteria 1833
565 Ga0495616_0078062 3300046513 Bacteria 1588
566 Ga0495618_0010007 3300046514 Bacteria 5735
567 Ga0495620_0003338 3300046515 Bacteria 9208
568 Ga0495620_0011242 3300046515 Bacteria 4677
569 Ga0495620_0020374 3300046515 Bacteria 3239
570 Ga0495628_0147763 3300046516 Bacteria 1791
571 Ga0495628_0164081 3300046516 Bacteria 1687
572 Ga0495630_0013745 3300046517 Bacteria 5887
573 Ga0495630_0041268 3300046517 Bacteria 3445
574 Ga0495631_0000020 3300046518 Bacteria 92958
575 Ga0495631_0001259 3300046518 Bacteria 15668
576 Ga0495631_0012134 3300046518 Bacteria 4218
577 Ga0495631_0021789 3300046518 Bacteria 2982
578 Ga0495632_0000436 3300046519 Bacteria 39746
579 Ga0495632_0000587 3300046519 Bacteria 33746
580 Ga0495632_0009113 3300046519 Bacteria 6003
581 Ga0495632_0036455 3300046519 Bacteria 2501
582 Ga0495632_0043736 3300046519 Bacteria 2237
583 Ga0495632_0066478 3300046519 Bacteria 1739
584 Ga0495637_0000447 3300046520 Bacteria 30138
585 Ga0495637_0003645 3300046520 Bacteria 8157
586 Ga0495637_0010835 3300046520 Bacteria 4394
587 Ga0495637_0011026 3300046520 Bacteria 4353
588 Ga0495637_0013087 3300046520 Bacteria 3947
589 Ga0495637_0017482 3300046520 Bacteria 3340
590 Ga0495637_0017509 3300046520 Bacteria 3336
591 Ga0495637_0025356 3300046520 Bacteria 2672
592 Ga0495637_0034713 3300046520 Bacteria 2206
593 Ga0495643_0013102 3300046522 Bacteria 4979
594 Ga0495643_0013270 3300046522 Bacteria 4937
595 Ga0495643_0026473 3300046522 Bacteria 3273
596 Ga0495643_0051925 3300046522 Bacteria 2203
597 Ga0495644_0001885 3300046523 Bacteria 8443
598 Ga0495644_0002346 3300046523 Bacteria 7547
599 Ga0495644_0007004 3300046523 Bacteria 4362
600 Ga0495644_0017843 3300046523 Bacteria 2711
601 Ga0495648_0002549 3300046524 Bacteria 16696
602 Ga0495648_0003472 3300046524 Bacteria 13848
603 Ga0495648_0005540 3300046524 Bacteria 10471
604 Ga0495648_0036039 3300046524 Bacteria 3199
605 Ga0495648_0058583 3300046524 Bacteria 2302
606 Ga0495648_0058762 3300046524 Bacteria 2297
607 Ga0495648_0114056 3300046524 Bacteria 1464
608 Ga0495648_0148613 3300046524 Bacteria 1224
609 Ga0495666_0007185 3300046526 Bacteria 5590
610 Ga0495666_0050335 3300046526 Bacteria 2002
611 Ga0495666_0115221 3300046526 Bacteria 1261
612 Ga0495642_0000033 3300046528 Bacteria 85849
613 Ga0495642_0003997 3300046528 Bacteria 5762
614 Ga0495642_0007333 3300046528 Bacteria 4232
615 Ga0495642_0012253 3300046528 Bacteria 3304
616 Ga0495654_0000324 3300046530 Bacteria 41969
617 Ga0495654_0001457 3300046530 Bacteria 16202
618 Ga0495654_0002179 3300046530 Bacteria 12729
619 Ga0495654_0002442 3300046530 Bacteria 11957
620 Ga0495654_0018170 3300046530 Bacteria 3688
621 Ga0495654_0023880 3300046530 Bacteria 3163
622 Ga0495654_0029567 3300046530 Bacteria 2793
623 Ga0495654_0048816 3300046530 Bacteria 2075
624 Ga0495654_0062265 3300046530 Bacteria 1789
625 Ga0495654_0145907 3300046530 Bacteria 1050
626 Ga0495665_0011303 3300046531 Bacteria 4831
627 Ga0495640_0022970 3300046533 Bacteria 4554
628 Ga0495586_0006584 3300046535 Bacteria 6207
629 Ga0495587_0003070 3300046536 Bacteria 11155
630 Ga0495587_0009581 3300046536 Bacteria 6200
631 Ga0495609_0000405 3300046538 Bacteria 36116
632 Ga0495609_0020986 3300046538 Bacteria 3014
633 Ga0495609_0033359 3300046538 Bacteria 2337
634 Ga0495597_0011731 3300046542 Bacteria 4244
635 Ga0495597_0016052 3300046542 Bacteria 3540
636 Ga0495597_0018166 3300046542 Bacteria 3302
637 Ga0495597_0032715 3300046542 Bacteria 2358
638 Ga0495597_0043568 3300046542 Bacteria 1998
639 Ga0495645_0098176 3300046543 Bacteria 2085
640 Ga0495622_0000775 3300046557 Bacteria 17829
641 Ga0495622_0001094 3300046557 Bacteria 14169
642 Ga0495622_0002578 3300046557 Bacteria 8749
643 Ga0495622_0005904 3300046557 Bacteria 5686
644 Ga0495622_0006370 3300046557 Bacteria 5479
645 Ga0495622_0059423 3300046557 Bacteria 1770
646 Ga0495622_0086941 3300046557 Bacteria 1437
647 Ga0495633_0001444 3300046558 Bacteria 18478
648 Ga0495633_0003372 3300046558 Bacteria 10700
649 Ga0495633_0003895 3300046558 Bacteria 9734
650 Ga0495633_0023821 3300046558 Bacteria 3030
651 Ga0495668_0000568 3300046616 Bacteria 45426
652 Ga0495668_0012847 3300046616 Bacteria 4959
653 Ga0495668_0020910 3300046616 Bacteria 3758
654 Ga0495634_0096292 3300046642 Bacteria 1916
655 Ga0495611_0004442 3300046648 Bacteria 6071
656 Ga0495611_0013170 3300046648 Bacteria 3518
657 Ga0495625_0000136 3300046660 Bacteria 114576
658 Ga0495625_0013373 3300046660 Bacteria 6596
659 Ga0495625_0021444 3300046660 Bacteria 4976
660 Ga0495625_0026162 3300046660 Bacteria 4412
661 Ga0495625_0043881 3300046660 Bacteria 3240
662 Ga0495625_0061946 3300046660 Bacteria 2645
663 Ga0495625_0203618 3300046660 Bacteria 1304
664 Ga0495635_0000856 3300046663 Bacteria 19937
665 Ga0495635_0003406 3300046663 Bacteria 10990
666 Ga0495635_0028386 3300046663 Bacteria 3889
667 Ga0495659_0008916 3300046664 Bacteria 3195
668 Ga0495661_0001179 3300046665 Bacteria 22716
669 Ga0495661_0001607 3300046665 Bacteria 18526
670 Ga0495661_0014015 3300046665 Bacteria 5374
671 Ga0495661_0014963 3300046665 Bacteria 5186
672 Ga0495661_0125253 3300046665 Bacteria 1414
673 Ga0495588_0020285 3300046674 Bacteria 3264
674 Ga0495588_0065219 3300046674 Bacteria 1889
675 Ga0495657_0117295 3300046675 Bacteria 1680
676 Ga0495623_0011490 3300046679 Bacteria 5732
677 Ga0495646_0044646 3300046680 Bacteria 2709
678 Ga0495658_0003833 3300046683 Bacteria 7442
679 Ga0495669_0032844 3300046684 Bacteria 2282
680 Ga0495613_0012404 3300046689 Bacteria 6333
681 Ga0495624_0099652 3300046690 Bacteria 1789
682 Ga0495670_0000548 3300046691 Bacteria 17887
683 Ga0495670_0001711 3300046691 Bacteria 10798
684 Ga0495670_0020139 3300046691 Bacteria 3288
685 Ga0495670_0057332 3300046691 Bacteria 1955
686 Ga0495670_0069267 3300046691 Bacteria 1783
687 Ga0495670_0069573 3300046691 Bacteria 1780
688 Ga0495670_0073397 3300046691 Bacteria 1734
689 Ga0495671_0004328 3300046692 Bacteria 8529
690 Ga0495671_0004525 3300046692 Bacteria 8290
691 Ga0495671_0036458 3300046692 Bacteria 2490
692 Ga0495671_0040446 3300046692 Bacteria 2351
693 Ga0495671_0064534 3300046692 Bacteria 1802
694 Ga0495671_0072438 3300046692 Bacteria 1691
695 Ga0495671_0129869 3300046692 Bacteria 1228
696 Ga0495649_0000201 3300046694 Bacteria 53035
697 Ga0495649_0005892 3300046694 Bacteria 7691
698 Ga0495649_0043434 3300046694 Bacteria 2453
699 Ga0495649_0072974 3300046694 Bacteria 1839
700 Ga0495649_0202439 3300046694 Bacteria 1030
701 Ga0495589_0014529 3300046794 Bacteria 4052
702 Ga0495589_0014663 3300046794 Bacteria 4032
703 Ga0495589_0015429 3300046794 Bacteria 3931
704 Ga0495589_0048323 3300046794 Bacteria 2106
705 Ga0495600_0019348 3300046809 Bacteria 4347
706 Ga0495600_0076451 3300046809 Bacteria 2186
707 Ga0495660_0002421 3300046810 Bacteria 11890
708 Ga0495660_0007901 3300046810 Bacteria 6246
709 Ga0495660_0009749 3300046810 Bacteria 5596
710 Ga0495660_0010336 3300046810 Bacteria 5426
711 Ga0495660_0010495 3300046810 Bacteria 5388
712 Ga0495660_0029941 3300046810 Bacteria 3068
713 Ga0495660_0047141 3300046810 Bacteria 2361
714 Ga0495660_0058609 3300046810 Bacteria 2073
715 Ga0495660_0065298 3300046810 Bacteria 1943
716 Ga0495660_0085028 3300046810 Bacteria 1653
717 Ga0495660_0116418 3300046810 Bacteria 1358
718 Ga0495660_0142719 3300046810 Bacteria 1189
719 Ga0495604_0006513 3300047317 Bacteria 9253
720 Ga0495604_0034282 3300047317 Bacteria 4016
721 Ga0495604_0049990 3300047317 Bacteria 3247
722 Ga0495604_0178343 3300047317 Bacteria 1488
723 Ga0495636_0018420 3300047318 Bacteria 2801
724 Ga0495636_0082294 3300047318 Bacteria 1388
725 Ga0495674_0046526 3300047319 Bacteria 3850
726 Ga0495672_0000540 3300047320 Bacteria 42937
727 Ga0495672_0001849 3300047320 Bacteria 20188
728 Ga0495672_0010364 3300047320 Bacteria 6650
729 Ga0495672_0013564 3300047320 Bacteria 5616
730 Ga0495672_0016147 3300047320 Bacteria 5044
731 Ga0495672_0016365 3300047320 Bacteria 5000
732 Ga0495672_0045374 3300047320 Bacteria 2629
733 Ga0495672_0097133 3300047320 Bacteria 1605
734 Ga0495672_0124929 3300047320 Bacteria 1362
735 Ga0495676_0004979 3300047321 Bacteria 12178
736 Ga0495680_0003260 3300047322 Bacteria 16097
737 Ga0495680_0003948 3300047322 Bacteria 14338
738 Ga0495680_0046655 3300047322 Bacteria 3414
739 Ga0495683_0000085 3300047323 Bacteria 93009
740 Ga0495683_0124330 3300047323 Bacteria 1221
741 Ga0495683_0162291 3300047323 Bacteria 1032
742 Ga0495687_000375 3300047443 Bacteria 55715
743 Ga0495687_001884 3300047443 Bacteria 18100
744 Ga0495675_0001382 3300047444 Bacteria 14712
745 Ga0495675_0058267 3300047444 Bacteria 2449
746 Ga0495677_0001038 3300047445 Bacteria 11154
747 Ga0495677_0002605 3300047445 Bacteria 7054
748 Ga0495677_0004443 3300047445 Bacteria 5385
749 Ga0495679_030866 3300047446 Bacteria 1735
750 Ga0495673_0000297 3300047469 Bacteria 66473
751 Ga0495673_0000345 3300047469 Bacteria 58540
752 Ga0495673_0000577 3300047469 Bacteria 36890
753 Ga0495673_0005101 3300047469 Bacteria 8024
754 Ga0495673_0007357 3300047469 Bacteria 6344
755 Ga0495673_0012094 3300047469 Bacteria 4597
756 Ga0495673_0013919 3300047469 Bacteria 4203
757 Ga0495673_0038701 3300047469 Bacteria 2167
758 Ga0495673_0039727 3300047469 Bacteria 2133
759 Ga0495673_0065497 3300047469 Bacteria 1542
760 Ga0495673_0089498 3300047469 Bacteria 1260
761 Ga0495681_0000172 3300047470 Bacteria 54252
762 Ga0495681_0000226 3300047470 Bacteria 47165
763 Ga0495681_0000417 3300047470 Bacteria 32683
764 Ga0495681_0000424 3300047470 Bacteria 32445
765 Ga0495681_0000712 3300047470 Bacteria 25445
766 Ga0495681_0002398 3300047470 Bacteria 13412
767 Ga0495681_0012211 3300047470 Bacteria 5061
768 Ga0495681_0034229 3300047470 Bacteria 2533
769 Ga0495681_0051051 3300047470 Bacteria 1946
770 Ga0495681_0061101 3300047470 Bacteria 1736
771 Ga0495684_0028703 3300047471 Bacteria 4271
772 Ga0495684_0045663 3300047471 Bacteria 3352
773 Ga0495686_0003384 3300047472 Bacteria 13884
774 Ga0495686_0229627 3300047472 Bacteria 1051
775 Ga0495593_0011535 3300047673 Bacteria 5073
776 Ga0495593_0034702 3300047673 Bacteria 2742
777 Ga0495593_0035820 3300047673 Bacteria 2692
778 Ga0495626_0000144 3300048091 Bacteria 89793
779 Ga0495626_0000179 3300048091 Bacteria 77215
780 Ga0495626_0000438 3300048091 Bacteria 42557
781 Ga0495626_0020622 3300048091 Bacteria 3280
782 Ga0495626_0021905 3300048091 Bacteria 3162
783 Ga0495626_0044408 3300048091 Bacteria 2079
784 Ga0495626_0099083 3300048091 Bacteria 1272
785 Ga0496100_0039534 3300048903 Bacteria 2996
786 Ga0496102_0000250 3300048905 Bacteria 70330
787 Ga0496102_0043415 3300048905 Bacteria 4077
788 Ga0496102_0046823 3300048905 Bacteria 3929
789 Ga0496103_0027072 3300048906 Bacteria 3472
790 Ga0496103_0155478 3300048906 Bacteria 1466
791 Ga0496104_0263217 3300048907 Bacteria 1637
792 Ga0496107_0105378 3300048910 Bacteria 2070
793 Ga0496107_0229517 3300048910 Bacteria 1381
794 Ga0496108_0022509 3300048911 Bacteria 5182
795 Ga0496108_0527904 3300048911 Bacteria 1030
796 Ga0496109_0100476 3300048912 Bacteria 2684
797 Ga0496110_0012489 3300048913 Bacteria 6985
798 Ga0496110_0022038 3300048913 Bacteria 5403
799 Ga0496110_0094803 3300048913 Bacteria 2672
800 Ga0496110_0104736 3300048913 Bacteria 2538
801 Ga0496111_0027774 3300048914 Bacteria 4007
802 Ga0496111_0211677 3300048914 Bacteria 1440
803 Ga0496112_0005803 3300048915 Bacteria 10741
804 Ga0496112_0332422 3300048915 Bacteria 1463
805 Ga0496112_0345770 3300048915 Bacteria 1430
806 Ga0496113_0244440 3300048916 Bacteria 1432
807 Ga0496113_0246514 3300048916 Bacteria 1426
808 Ga0496115_0197030 3300048918 Bacteria 1664
809 Ga0496116_0000419 3300048919 Bacteria 60095
810 Ga0496116_0028683 3300048919 Bacteria 4027
811 Ga0496117_0008975 3300048920 Bacteria 9409
812 Ga0496117_0030791 3300048920 Bacteria 4108
813 Ga0496117_0229163 3300048920 Bacteria 1028
814 Ga0496118_0013091 3300048921 Bacteria 7883
815 Ga0496118_0019329 3300048921 Bacteria 6091
816 Ga0496118_0137412 3300048921 Bacteria 1557
817 Ga0496119_0028027 3300048922 Bacteria 3856
818 Ga0496120_0005937 3300048923 Bacteria 9521
819 Ga0496121_0183166 3300048924 Bacteria 1509
820 Ga0496121_0210687 3300048924 Bacteria 1377
821 Ga0496121_0297573 3300048924 Bacteria 1096
822 Ga0496122_0114392 3300048925 Bacteria 1760
823 Ga0496124_0009971 3300048927 Bacteria 9705
824 Ga0496125_0001730 3300048928 Bacteria 30353
825 Ga0496125_0003106 3300048928 Bacteria 20687
826 Ga0496125_0010260 3300048928 Bacteria 9486
827 Ga0496125_0011702 3300048928 Bacteria 8751
828 Ga0496125_0050011 3300048928 Bacteria 3466
829 Ga0496126_0039481 3300048929 Bacteria 4379
830 Ga0496126_0169059 3300048929 Bacteria 1864
831 Ga0496126_0275732 3300048929 Bacteria 1394
832 Ga0496126_0420511 3300048929 Bacteria 1080
833 Ga0495678_001726 3300049459 Bacteria 16327
834 Ga0495678_001732 3300049459 Bacteria 16267
835 Ga0495678_015989 3300049459 Bacteria 3444
836 Ga0495678_016124 3300049459 Bacteria 3425
837 Ga0495678_018095 3300049459 Bacteria 3176
838 Ga0495678_018346 3300049459 Bacteria 3148
839 Ga0495678_021073 3300049459 Bacteria 2875
840 Ga0495678_066493 3300049459 Bacteria 1334
841 Ga0495682_0001278 3300049460 Bacteria 14087
842 Ga0495682_0007549 3300049460 Bacteria 4318
843 Ga0495682_0013091 3300049460 Bacteria 3162
844 Ga0495682_0013912 3300049460 Bacteria 3055
845 Ga0501031_0007292 3300049568 Bacteria 7215
846 Ga0501032_0072629 3300049569 Bacteria 2293
847 Ga0501033_0037192 3300049570 Bacteria 3644
848 Ga0501034_0120934 3300049571 Bacteria 2605
849 Ga0501036_0156729 3300049572 Bacteria 1920
850 Ga0501037_0080718 3300049573 Bacteria 2359
851 Ga0501037_0234080 3300049573 Bacteria 1289
852 Ga0501038_0005074 3300049574 Bacteria 12237
853 Ga0501040_0075908 3300049576 Bacteria 2323
854 Ga0501042_0168276 3300049578 Bacteria 1582
855 Ga0501043_0000149 3300049579 Bacteria 65122
856 Ga0501043_0034884 3300049579 Bacteria 3957
857 Ga0501043_0054276 3300049579 Bacteria 3147
858 Ga0501046_0000092 3300049580 Bacteria 97456
859 Ga0501046_0121347 3300049580 Bacteria 1988
860 Ga0501047_0000028 3300049581 Bacteria 220279
861 Ga0501048_0000097 3300049582 Bacteria 47728
862 Ga0501070_0069393 3300049586 Bacteria 2918
863 Ga0501070_0158999 3300049586 Bacteria 1863
864 Ga0501072_0238505 3300049588 Bacteria 1448
865 Ga0501073_0252941 3300049589 Bacteria 1216
866 Ga0501076_0396444 3300049592 Bacteria 1135
867 Ga0501077_0144400 3300049593 Bacteria 1510
868 Ga0501080_0211330 3300049742 Bacteria 1778
869 Ga0501083_0005855 3300049744 Bacteria 8701
870 Ga0501083_0107195 3300049744 Bacteria 1839
871 Ga0501265_000611 3300049762 Bacteria 3847
872 Ga0501281_02594 3300049777 Bacteria 1315
873 Ga0501035_0000097 3300049822 Bacteria 110207
874 Ga0501035_0034336 3300049822 Bacteria 4609
875 Ga0501035_0212764 3300049822 Bacteria 1653
876 Ga0501044_0115660 3300049823 Bacteria 2688
877 Ga0501044_0290128 3300049823 Bacteria 1568
878 Ga0501045_0084677 3300049824 Bacteria 2339
879 nmdc:mga03683_15819_c2 3300050489 Bacteria 1698
880 nmdc:mga03683_53059_c1 3300050489 Bacteria 1696
881 nmdc:mga03n38_142688_c1 3300050490 Bacteria 1198
882 nmdc:mga0yw44_24540_c1 3300050492 Bacteria 3414
883 nmdc:mga0yw44_41142_c1 3300050492 Bacteria 2749
884 nmdc:mga0yw44_69585_c1 3300050492 Bacteria 2180
885 nmdc:mga06z11_51548_c1 3300050494 Bacteria 2107
886 nmdc:mga07m45_7849_c1 3300050496 Bacteria 5462
887 nmdc:mga0qj67_161599_c1 3300050509 Bacteria 1818
888 nmdc:mga0qj67_37313_c1 3300050509 Bacteria 3806
889 nmdc:mga06r32_38471_c1 3300050510 Bacteria 4533
890 nmdc:mga08y16_31386_c1 3300050511 Bacteria 5587
891 nmdc:mga0rr50_28353_c1 3300050513 Bacteria 3935
892 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
893 Ga0495601_0020874 3300053077 Bacteria 4005
894 Ga0495612_0015318 3300053078 Bacteria 3074
895 Ga0495612_0106840 3300053078 Bacteria 1196
896 Ga0500610_0000333 3300053079 Bacteria 14189
897 Ga0500643_000040 3300053087 Bacteria 168108
898 Ga0500583_0006833 3300053092 Bacteria 3961
899 Ga0500555_018422 3300053103 Bacteria 2013
900 Ga0500556_0021194 3300053104 Bacteria 2091
901 Ga0500562_002163 3300053108 Bacteria 4910
902 Ga0500595_005376 3300053119 Bacteria 5602
903 Ga0500642_0158907 3300053130 Bacteria 1060
904 Ga0500658_0000447 3300053134 Bacteria 17605
905 Ga0500658_0005140 3300053134 Bacteria 4872
906 Ga0500658_0027236 3300053134 Bacteria 2208
907 Ga0500561_0023655 3300053137 Bacteria 1475
908 Ga0500568_0000920 3300053139 Bacteria 20303
909 Ga0500577_0074452 3300053142 Bacteria 1339
910 Ga0500589_140658 3300053147 Bacteria 995
911 Ga0500616_0014979 3300053153 Bacteria 4444
912 Ga0500622_0019177 3300053156 Bacteria 3633
913 Ga0500627_0072984 3300053158 Bacteria 1522
914 Ga0500633_0059167 3300053160 Bacteria 1344
915 Ga0500634_0001992 3300053161 Bacteria 8359
916 Ga0500634_0130047 3300053161 Bacteria 1210
917 Ga0500639_029469 3300053163 Bacteria 2902
918 Ga0500637_0010068 3300053178 Bacteria 4839
919 Ga0500637_0093025 3300053178 Bacteria 1747
920 Ga0500609_012070 3300053731 Bacteria 1169
921 Ga0501084_0017222 3300054114 Bacteria 6002
922 Ga0501084_0046041 3300054114 Bacteria 3653
923 Ga0501082_0032761 3300060353 Bacteria 4483
924 Ga0501082_0208887 3300060353 Bacteria 1698
925 Ga0530510_0028461 3300061734 Bacteria 4007
926 2511243504 2511231002 Bacteria 5042903
927 2511275771 2511231008 Bacteria 6624100
928 2511290624 2511231010 Bacteria 6373152
929 2511298313 2511231011 Bacteria 6149768
930 2511301050 2511231012 Bacteria 6738011
931 2511315667 2511231014 Bacteria 6462302
932 2511326136 2511231016 Bacteria 6704427
933 2511333948 2511231017 Bacteria 6503007
934 2511338989 2511231018 Bacteria 6436256
935 2511347207 2511231019 Bacteria 6520662
936 2511349875 2511231020 Bacteria 6115223
937 2511357812 2511231021 Bacteria 7302637
938 2511372340 2511231023 Bacteria 6808468
939 2548499305 2547132374 Bacteria 5530232
940 2597032611 2596583598 Bacteria 5251611
941 2597865080 2597489888 Bacteria 6179543
942 2599400207 2599185167 Bacteria 6353609
943 2599447286 2599185178 Bacteria 5365746
944 2599451463 2599185179 Bacteria 6611171
945 2599509428 2599185189 Bacteria 5862825
946 2599512635 2599185190 Bacteria 6285678
947 2599519986 2599185191 Bacteria 6297582
948 2599891311 2599185290 Bacteria 6289611
949 2601689661 2600255296 Bacteria 5784754
950 2601796206 2600255318 Bacteria 6383414
951 2606073355 2603880185 Bacteria 6379190
952 2606126999 2603880199 Bacteria 6377649
953 2624481855 2623620443 Bacteria 6427864
954 2643789931 2643221554 Bacteria 6603920
955 2643845557 2643221565 Bacteria 6216018
956 2643866137 2643221570 Bacteria 5103772
957 2643874319 2643221571 Bacteria 6228673
958 2643956432 2643221589 Bacteria 6250934
959 2643994126 2643221596 Bacteria 5006805
960 2644025526 2643221602 Bacteria 6249926
961 2644160903 2643221628 Bacteria 5745828
962 2644187401 2643221633 Bacteria 6733554
963 2644214349 2643221638 Bacteria 6579467
964 2644292951 2643221652 Bacteria 5140275
965 2644621915 2643221713 Bacteria 6554480
966 2644647967 2643221717 Bacteria 5676132
967 2677899868 2675903420 Bacteria 6247433
968 2715751158 2713897148 Bacteria 5883533
969 2715758158 2713897149 Bacteria 6506249
970 2718635104 2718217725 Bacteria 5758958
971 2723249833 2721755607 Bacteria 5841722
972 2739201896 2738543004 Bacteria 6381073
973 2739259302 2738543015 Bacteria 6750701
974 2739314133 2738543025 Bacteria 6600348
975 2774123380 2773857670 Bacteria 6407454
976 2774132763 2773857673 Bacteria 6513460
977 2784263423 2784132063 Bacteria 6262788
978 2784316078 2784132072 Bacteria 6596533
979 2792837547 2791355137 Bacteria 9654227
980 2808930548 2808606377 Bacteria 6646337
981 2808952670 2808606381 Bacteria 6646461
982 2808957335 2808606382 Bacteria 6841132
983 2808977790 2808606385 Bacteria 6711065
984 2808993270 2808606388 Bacteria 6706662
985 2809218709 2808606445 Bacteria 6057339
986 2819655598 2818991456 Bacteria 6123676
987 2824672912 2824671348 Bacteria 8369588
988 2824689444 2824687955 Bacteria 8360029
989 2824705356 2824704595 Bacteria 9667483
990 2824755503 2824753945 Bacteria 9787441
991 2824763787 2824763712 Bacteria 9792355
992 2842682216 2842677519 Bacteria 5615038
993 2842827691 2842826826 Bacteria 5974129
994 2842836449 2842832357 Bacteria 5959113
995 2842841008 2842837860 Bacteria 6066181
996 2842844563 2842843487 Bacteria 6004777
997 2847935644 2847930680 Bacteria 9342022
998 2852662403 2852657418 Bacteria 6472974
999 2860340736 2860339153 Bacteria 6846989
1000 2878033839 2878029506 Bacteria 6418441
1001 2880234464 2880230671 Bacteria 6140320
1002 2881673396 2881665667 Bacteria 8175609
1003 2900582412 2900577576 Bacteria 5438534
1004 2904521397 2904518522 Bacteria 6068986
1005 2904555574 2904550169 Bacteria 6221258
1006 2904698552 2904690495 Bacteria 9412302
1007 2904716539 2904711408 Bacteria 9771557
1008 2908762437 2908756301 Bacteria 8864324
1009 2919068824 2919063839 Bacteria 6302690
1010 2919387931 2919385768 Bacteria 5897293
1011 2919461133 2919456309 Bacteria 6586567
1012 2919489886 2919487758 Bacteria 5929766
1013 2919706865 2919704043 Bacteria 5560311
1014 2928061011 2928058823 Bacteria 5520022
1015 2928070104 2928064002 Bacteria 7419480
1016 2929526598 2929520902 Bacteria 6765052
1017 2931394940 2931390751 Bacteria 6273349
1018 2931403289 2931396565 Bacteria 7251677
1019 2935678657 2935675223 Bacteria 9928132
1020 2935687852 2935684952 Bacteria 9590419
1021 2935714872 2935713505 Bacteria 9608509
1022 2935726563 2935722832 Bacteria 9608746
1023 2935733690 2935732158 Bacteria 9706831
1024 2935743069 2935741537 Bacteria 9707219
1025 2935754892 2935750917 Bacteria 9590372
1026 2940559731 2940556831 Bacteria 9590747
1027 2945950403 2945945610 Bacteria 5951079
1028 2945964996 2945961074 Bacteria 7342064
1029 2946008561 2946006987 Bacteria 6705746
1030 2946032089 2946027586 Bacteria 6049274
1031 2947238918 2947233263 Bacteria 6439278
1032 2969308614 2969304461 Bacteria 6601805
1033 2974290013 2974289157 Bacteria 6080362
1034 2990714192 2990710928 Bacteria 5002431
1035 2998143919 2998139840 Bacteria 6073514
1036 3001890424 3001889506 Bacteria 2975194
1037 3007515620 3007511990 Bacteria 6481491
1038 3007616933 3007614139 Bacteria 6053559
1039 3007625638 3007619802 Bacteria 6411688
1040 3007857825 3007855910 Bacteria 5637581
1041 3007865348 3007861166 Bacteria 6045338
1042 8029996958 8029995093 Bacteria 5990776
1043 8054350790 8054347763 Bacteria 5901107
1044 8054507450 8054503363 Bacteria 6101651
1045 8055822393 8055817908 Bacteria 6609162
1046 8056127639 8056125926 Bacteria 6228218
1047 8056135855 8056131705 Bacteria 6107031
1048 8056153174 8056148874 Bacteria 6479865
1049 8056167357 8056166840 Bacteria 5820959
1050 8056179536 8056177738 Bacteria 6748268
1051 8056692478 8056689827 Bacteria 6712655
1052 Ga0070663_100358001
1053 MRS2a_Contig_45
1054 JGI24741J21665_1000563
1055 JGI24740J21852_10003720
1056 JGI25156J39149_1001699
1057 JGI25162J39368_1000166
1058 JGI25163J39215_1000715
1059 JGI25164J39214_1000129
1060 JGI25151J46595_10030891
1061 JGI25165J46597_1000251
1062 rootH2_10054890
1063 JGI25160J50197_1024790
1064 Ga0006562J51391_1127201
1065 Ga0006562J51391_1133065
1066 Ga0006562J51391_1133066
1067 Ga0055538_1000405
1068 Ga0055538_1001223
1069 Ga0055538_1001224
1070 Ga0055539_1000185
1071 Ga0055539_1000397
1072 Ga0055533_1000398
1073 Ga0055533_1001284
1074 Ga0055532_1000006
1075 Ga0055532_1000498
1076 Ga0055525_1000501
1077 Ga0055525_1000553
1078 Ga0055535_1000004
1079 Ga0055529_1000273
1080 Ga0055526_1005404
1081 Ga0055526_1018471
1082 Ga0055537_1004515
1083 Ga0055536_1000239
1084 Ga0055536_1002621
1085 Ga0055534_1000600
1086 Ga0055530_10000289
1087 Ga0055530_10002048
1088 Ga0055540_1000105
1089 Ga0055531_10000081
1090 Ga0055531_10004735
1091 Ga0055541_1000284
1092 Ga0055541_1001906
1093 Ga0055541_1003832
1094 Ga0055543_1000305
1095 Ga0065165_1002126
1096 Ga0065165_1045245
1097 Ga0065714_10002480
1098 Ga0065714_10065498
1099 Ga0065714_10086658
1100 Ga0065714_10103566
1101 Ga0065712_10000845
1102 Ga0065715_10012261
1103 Ga0070676_10112978
1104 Ga0070676_10144881
1105 Ga0070670_100000224
1106 Ga0068868_100091992
1107 Ga0068868_100107647
1108 Ga0068868_100136496
1109 Ga0070689_100063076
1110 Ga0070661_100000336
1111 Ga0070661_100228619
1112 Ga0070669_100006480
1113 Ga0070671_100047273
1114 Ga0070671_100106756
1115 Ga0070673_100165583
1116 Ga0070688_100331366
1117 Ga0070705_100113686
1118 Ga0070663_100000246
1119 Ga0070663_100155007
1120 Ga0070663_100186749
1121 Ga0070678_100078656
1122 Ga0070662_100000056
1123 Ga0070697_100296058
1124 Ga0068853_100023937
1125 Ga0068853_100210067
1126 Ga0070686_100253765
1127 Ga0070695_100009160
1128 Ga0070696_100173698
1129 Ga0070665_100033455
1130 Ga0070704_100009794
1131 Ga0070704_100392120
1132 Ga0070664_100000122
1133 Ga0070664_100071994
1134 Ga0070664_100420602
1135 Ga0068854_100000121
1136 Ga0068854_100014586
1137 Ga0068854_100029670
1138 Ga0068856_100001446
1139 Ga0068856_100199475
1140 Ga0070702_100185214
1141 Ga0068859_100141340
1142 Ga0068859_100293899
1143 Ga0068864_100003161
1144 Ga0068861_100040406
1145 Ga0068861_100040594
1146 Ga0068851_10000028
1147 Ga0068863_100140768
1148 Ga0068863_100321234
1149 Ga0068863_100362306
1150 Ga0068860_100032977
1151 Ga0081540_1004812
1152 Ga0081540_1015156
1153 Ga0081539_10032068
1154 Ga0070717_10004861
1155 Ga0070717_10025882
1156 Ga0075365_10028979
1157 Ga0075365_10033580
1158 Ga0075368_10020265
1159 Ga0075432_10016974
1160 Ga0075367_10048532
1161 Ga0075367_10106909
1162 Ga0075366_10020174
1163 Ga0075366_10159319
1164 Ga0097621_100190550
1165 Ga0075370_10049297
1166 Ga0068871_100052556
1167 Ga0075428_100042245
1168 Ga0075428_100213784
1169 Ga0075428_100339326
1170 Ga0075430_100143969
1171 Ga0075430_100186936
1172 Ga0075431_100235557
1173 Ga0075429_100361443
1174 Ga0075436_100007551
1175 Ga0075436_100060272
1176 Ga0097620_100141338
1177 Ga0097620_100293900
1178 Ga0079104_1000124
1179 Ga0079104_1008588
1180 Ga0075435_100012311
1181 Ga0099794_10000175
1182 Ga0099794_10008266
1183 Ga0099795_10000165
1184 Ga0105251_10000346
1185 Ga0105251_10034727
1186 Ga0105244_10000322
1187 Ga0105250_10002492
1188 Ga0105250_10053842
1189 Ga0105240_10015691
1190 Ga0105240_10105334
1191 Ga0105240_10318109
1192 Ga0111539_10024343
1193 Ga0111539_10064464
1194 Ga0105245_10013885
1195 Ga0105245_10039587
1196 Ga0105245_10099935
1197 Ga0105245_10121680
1198 Ga0105245_10237725
1199 Ga0105247_10041933
1200 Ga0114129_10368819
1201 Ga0105243_10000103
1202 Ga0105241_10039449
1203 Ga0105248_10071469
1204 Ga0105248_10188843
1205 Ga0105238_10076260
1206 Ga0105249_10109781
1207 Ga0099796_10000071
1208 Ga0105246_10006736
1209 Ga0105246_10101796
1210 Ga0105246_10163692
1211 Ga0157345_1000009
1212 Ga0157373_10003474
1213 Ga0157373_10033971
1214 Ga0157373_10038079
1215 Ga0157373_10156321
1216 Ga0157371_10000072
1217 Ga0157371_10000306
1218 Ga0157371_10006322
1219 Ga0157371_10027785
1220 Ga0157370_10000031
1221 Ga0157370_10098156
1222 Ga0157370_10152759
1223 Ga0157369_10003537
1224 Ga0157369_10013154
1225 Ga0157369_10114886
1226 Ga0157369_10259065
1227 Ga0157374_10022608
1228 Ga0157378_10261127
1229 Ga0163162_10000072
1230 Ga0163162_10032056
1231 Ga0163162_10127391
1232 Ga0163162_10212141
1233 Ga0157372_10001411
1234 Ga0163163_10010321
1235 Ga0163163_10557829
1236 Ga0157380_10031465
1237 Ga0182008_10003577
1238 Ga0182008_10006269
1239 Ga0182008_10022716
1240 Ga0182008_10084256
1241 Ga0157379_10186184
1242 Ga0157379_10443523
1243 Ga0157376_10018698
1244 Ga0182006_1051303
1245 Ga0182006_1093032
1246 Ga0182005_1015952
1247 Ga0182005_1058996
1248 Ga0163161_10006408
1249 Ga0163161_10016557
1250 Ga0163161_10016783
1251 Ga0163161_10068832
1252 Ga0163161_10241643
1253 Ga0213872_10000489
1254 Ga0213872_10000610
1255 Ga0213872_10001402
1256 Ga0209435_100432
1257 Ga0209760_100043
1258 Ga0209436_100149
1259 Ga0209436_102498
1260 Ga0209784_100006
1261 Ga0209784_100017
1262 Ga0209784_100391
1263 Ga0209784_100520
1264 Ga0209566_100002
1265 Ga0209566_100014
1266 Ga0209566_103002
1267 Ga0209674_100010
1268 Ga0209674_100028
1269 Ga0209674_100796
1270 Ga0209672_100448
1271 Ga0209672_100849
1272 Ga0209147_100015
1273 Ga0209147_100038
1274 Ga0209563_100004
1275 Ga0209563_100032
1276 Ga0207427_100047
1277 Ga0209437_100009
1278 Ga0209258_100021
1279 Ga0209258_100828
1280 Ga0207425_1000160
1281 Ga0207425_1000961
1282 Ga0209646_1000171
1283 Ga0209026_1002374
1284 Ga0209677_100007
1285 Ga0209677_100018
1286 Ga0209759_1000926
1287 Ga0209759_1001154
1288 Ga0209129_1011559
1289 Ga0209233_1000032
1290 Ga0209233_1001245
1291 Ga0209565_1000664
1292 Ga0209565_1003248
1293 Ga0209455_1000028
1294 Ga0209673_1011371
1295 Ga0209673_1016051
1296 Ga0209130_1000624
1297 Ga0209130_1003920
1298 Ga0209675_1000467
1299 Ga0209675_1001555
1300 Ga0209675_1020112
1301 Ga0209676_1000010
1302 Ga0209676_1000646
1303 Ga0209676_1004434
1304 Ga0209676_1005348
1305 Ga0209025_1000718
1306 Ga0209564_1000088
1307 Ga0209564_1004515
1308 Ga0209564_1007989
1309 Ga0209050_1000081
1310 Ga0209050_1000363
1311 Ga0209050_1000430
1312 Ga0209050_1000535
1313 Ga0209050_1007738
1314 Ga0209256_1000560
1315 Ga0209256_1001254
1316 Ga0209256_1002634
1317 Ga0207426_1006486
1318 Ga0207426_1034679
1319 Ga0209051_1000025
1320 Ga0209051_1000185
1321 Ga0209257_1000039
1322 Ga0209257_1000040
1323 Ga0209257_1000157
1324 Ga0209257_1058303
1325 Ga0207656_10000056
1326 Ga0207696_1000193
1327 Ga0207696_1001821
1328 Ga0207655_1000505
1329 Ga0207655_1010484
1330 Ga0207655_1020359
1331 Ga0207655_1030332
1332 Ga0207713_1000386
1333 Ga0207713_1000431
1334 Ga0207713_1001314
1335 Ga0207713_1002492
1336 Ga0207713_1012230
1337 Ga0207713_1016633
1338 Ga0207647_10124892
1339 Ga0207699_10326536
1340 Ga0207645_10065700
1341 Ga0207654_10014283
1342 Ga0207695_10002542
1343 Ga0207671_10061555
1344 Ga0207693_10084413
1345 Ga0207649_10000449
1346 Ga0207681_10001738
1347 Ga0207681_10203679
1348 Ga0207650_10000291
1349 Ga0207687_10005746
1350 Ga0207687_10011264
1351 Ga0207644_10031910
1352 Ga0207644_10102053
1353 Ga0207644_10164695
1354 Ga0207706_10000445
1355 Ga0207706_10007508
1356 Ga0207709_10000035
1357 Ga0207670_10303073
1358 Ga0207669_10263229
1359 Ga0207691_10247796
1360 Ga0207711_10328351
1361 Ga0207689_10009277
1362 Ga0207679_10000007
1363 Ga0207679_10458960
1364 Ga0207667_10412081
1365 Ga0207651_10165626
1366 Ga0207651_10205169
1367 Ga0207668_10091720
1368 Ga0207640_10000107
1369 Ga0207640_10026064
1370 Ga0207658_10189908
1371 Ga0207677_10009786
1372 Ga0207677_10108219
1373 Ga0207639_10126991
1374 Ga0207639_10324051
1375 Ga0207678_10000207
1376 Ga0207678_10002939
1377 Ga0207702_10000260
1378 Ga0207641_10177909
1379 Ga0207641_10240258
1380 Ga0207648_10122901
1381 Ga0207676_10190227
1382 Ga0207675_100036501
1383 Ga0207675_100112511
1384 Ga0207675_100160586
1385 Ga0207683_10009292
1386 Ga0207698_10172974
1387 Ga0209281_1000077
1388 Ga0209281_1006210
1389 Ga0209179_1000643
1390 Ga0209179_1010378
1391 Ga0209588_1006727
1392 Ga0209588_1006757
1393 Ga0207428_10015756
1394 Ga0207428_10035452
1395 Ga0207428_10045233
1396 Ga0207428_10073411
1397 Ga0268266_10040831
1398 Ga0268266_10134411
1399 Ga0268264_10462527
1400 Ga0265318_10011277
1401 Ga0307515_10000208
1402 Ga0307515_10080725
1403 Ga0307511_10175496
1404 Ga0307512_10112371
1405 Ga0316177_1020845
1406 Ga0314311_1060215
1407 Ga0316178_1101239
1408 Ga0316183_1015378
1409 Ga0316181_1075075
1410 Ga0316181_1158467
1411 Ga0316182_1280847
1412 Ga0265330_10000076
1413 Ga0265332_10000002
1414 Ga0265325_10026911
1415 Ga0307513_10000090
1416 Ga0307513_10012431
1417 Ga0307513_10131489
1418 Ga0307513_10317661
1419 Ga0307509_10056371
1420 Ga0307408_100000115
1421 Ga0307408_100000125
1422 Ga0307408_100000895
1423 Ga0307408_100007259
1424 Ga0307408_100007580
1425 Ga0307408_100044798
1426 Ga0265314_10000066
1427 Ga0265314_10128062
1428 Ga0316576_10000405
1429 Ga0307516_10006050
1430 Ga0307405_10317636
1431 Ga0307413_10142044
1432 Ga0307413_10220092
1433 Ga0307406_10058978
1434 Ga0307406_10094923
1435 Ga0307406_10106872
1436 Ga0307412_10010358
1437 Ga0307412_10017587
1438 Ga0307412_10112378
1439 Ga0307412_10335631
1440 Ga0307409_100034446
1441 Ga0307416_100070969
1442 Ga0307416_100100216
1443 Ga0307416_100187721
1444 Ga0307416_100496800
1445 Ga0307414_10086753
1446 Ga0307414_10109249
1447 Ga0307414_10267957
1448 Ga0307510_10014599
1449 Ga0373923_0059551
1450 Ga0373936_0058574
1451 Ga0373945_0005853
1452 Ga0373954_0010190
1453 Ga0373955_0006435
1454 Ga0373924_0001251
1455 Ga0373935_0075239
1456 Ga0373927_0019954
1457 Ga0373927_0113034
1458 Ga0373933_0008240
1459 Ga0373947_0015164
1460 Ga0373947_0047205
1461 Ga0373937_0007858
1462 Ga0373925_0170037
1463 Ga0373925_0330040
1464 Ga0395900_0003101
1465 Ga0237819_04223
1466 Ga0436361_0324341
1467 Ga0436361_0729857
1468 Ga0436361_0922740
1469 Ga0436361_1103726
1470 Ga0439438_000117
1471 Ga0439438_016146
1472 Ga0439438_018549
1473 Ga0439447_000258
1474 Ga0439447_004731
1475 Ga0439466_0003476
1476 Ga0439466_0011397
1477 Ga0439466_0013472
1478 Ga0439466_0022658
1479 Ga0439466_0054731
1480 Ga0451839_1226771
1481 Ga0439431_0041170
1482 Ga0439432_000381
1483 Ga0439432_005659
1484 Ga0439452_000091
1485 Ga0439452_000164
1486 Ga0439452_006049
1487 Ga0439452_009472
1488 Ga0439452_009980
1489 Ga0439452_023100
1490 Ga0439456_005828
1491 Ga0450911_000746
1492 Ga0450920_007188
1493 Ga0450896_003141
1494 Ga0450902_006117
1495 Ga0450903_001867
1496 Ga0450903_002715
1497 Ga0450904_001840
1498 Ga0450905_002056
1499 Ga0450905_012374
1500 Ga0450906_004872
1501 Ga0450907_000038
1502 Ga0450907_001262
1503 Ga0439446_0005711
1504 Ga0450909_000970
1505 Ga0439434_0000146
1506 Ga0439464_0026399
1507 Ga0439460_0000739
1508 Ga0439460_0004830
1509 Ga0450918_003063
1510 Ga0450893_0007396
1511 Ga0450901_001528
1512 Ga0439440_0000716
1513 Ga0466986_0214250
1514 Ga0453683_0071593
1515 Ga0451576_0007815
1516 Ga0466967_0019240
1517 Ga0495617_000309
1518 Ga0495617_002310
1519 Ga0495617_015897
1520 Ga0495617_085817
1521 Ga0495627_000785
1522 Ga0495627_002296
1523 Ga0495627_002700
1524 Ga0495627_007208
1525 Ga0495603_0016957
1526 Ga0495603_0022975
1527 Ga0495603_0037472
1528 Ga0495590_0000265
1529 Ga0495590_0008924
1530 Ga0495590_0012789
1531 Ga0495590_0035563
1532 Ga0495591_000114
1533 Ga0495591_000445
1534 Ga0495591_001195
1535 Ga0495591_004397
1536 Ga0495591_016254
1537 Ga0495638_0001380
1538 Ga0495638_0006818
1539 Ga0495638_0016469
1540 Ga0495638_0018041
1541 Ga0495638_0043694
1542 Ga0495638_0067457
1543 Ga0495638_0093891
1544 Ga0495641_0061637
1545 Ga0495653_0008254
1546 Ga0495653_0045047
1547 Ga0495653_0125903
1548 Ga0495653_0137805
1549 Ga0495653_0250158
1550 Ga0495650_0004067
1551 Ga0495650_0005308
1552 Ga0495650_0006574
1553 Ga0495650_0019510
1554 Ga0495650_0020296
1555 Ga0495650_0021261
1556 Ga0495650_0023776
1557 Ga0495650_0051426
1558 Ga0495580_0035117
1559 Ga0495582_0006023
1560 Ga0495605_0000309
1561 Ga0495605_0006838
1562 Ga0495605_0008079
1563 Ga0495605_0043267
1564 Ga0495605_0043460
1565 Ga0495605_0047189
1566 Ga0495639_0011124
1567 Ga0495639_0165555
1568 Ga0495664_0003593
1569 Ga0495584_0000217
1570 Ga0495584_0002031
1571 Ga0495584_0002563
1572 Ga0495584_0002853
1573 Ga0495584_0005652
1574 Ga0495584_0022627
1575 Ga0495584_0026694
1576 Ga0495584_0049159
1577 Ga0495584_0116231
1578 Ga0495585_0000228
1579 Ga0495585_0001137
1580 Ga0495585_0013961
1581 Ga0495585_0016331
1582 Ga0495585_0026568
1583 Ga0495585_0081529
1584 Ga0495594_0002102
1585 Ga0495594_0018587
1586 Ga0495594_0018919
1587 Ga0495594_0025710
1588 Ga0495596_0000107
1589 Ga0495596_0081682
1590 Ga0495607_0000159
1591 Ga0495607_0005431
1592 Ga0495607_0017665
1593 Ga0495607_0030429
1594 Ga0495607_0030914
1595 Ga0495607_0032508
1596 Ga0495607_0032518
1597 Ga0495607_0049590
1598 Ga0495583_0005717
1599 Ga0495583_0006667
1600 Ga0495606_0001649
1601 Ga0495606_0006186
1602 Ga0495606_0008665
1603 Ga0495606_0009531
1604 Ga0495606_0067050
1605 Ga0495610_0006283
1606 Ga0495610_0013703
1607 Ga0495610_0042373
1608 Ga0495610_0047414
1609 Ga0495610_0054393
1610 Ga0495610_0066359
1611 Ga0495616_0000784
1612 Ga0495616_0001395
1613 Ga0495616_0007013
1614 Ga0495616_0010643
1615 Ga0495616_0061958
1616 Ga0495616_0078062
1617 Ga0495618_0010007
1618 Ga0495620_0003338
1619 Ga0495620_0011242
1620 Ga0495620_0020374
1621 Ga0495628_0147763
1622 Ga0495628_0164081
1623 Ga0495630_0013745
1624 Ga0495630_0041268
1625 Ga0495631_0000020
1626 Ga0495631_0001259
1627 Ga0495631_0012134
1628 Ga0495631_0021789
1629 Ga0495632_0000436
1630 Ga0495632_0000587
1631 Ga0495632_0009113
1632 Ga0495632_0036455
1633 Ga0495632_0043736
1634 Ga0495632_0066478
1635 Ga0495637_0000447
1636 Ga0495637_0003645
1637 Ga0495637_0010835
1638 Ga0495637_0011026
1639 Ga0495637_0013087
1640 Ga0495637_0017482
1641 Ga0495637_0017509
1642 Ga0495637_0025356
1643 Ga0495637_0034713
1644 Ga0495643_0013102
1645 Ga0495643_0013270
1646 Ga0495643_0026473
1647 Ga0495643_0051925
1648 Ga0495644_0001885
1649 Ga0495644_0002346
1650 Ga0495644_0007004
1651 Ga0495644_0017843
1652 Ga0495648_0002549
1653 Ga0495648_0003472
1654 Ga0495648_0005540
1655 Ga0495648_0036039
1656 Ga0495648_0058583
1657 Ga0495648_0058762
1658 Ga0495648_0114056
1659 Ga0495648_0148613
1660 Ga0495666_0007185
1661 Ga0495666_0050335
1662 Ga0495666_0115221
1663 Ga0495642_0000033
1664 Ga0495642_0003997
1665 Ga0495642_0007333
1666 Ga0495642_0012253
1667 Ga0495654_0000324
1668 Ga0495654_0001457
1669 Ga0495654_0002179
1670 Ga0495654_0002442
1671 Ga0495654_0018170
1672 Ga0495654_0023880
1673 Ga0495654_0029567
1674 Ga0495654_0048816
1675 Ga0495654_0062265
1676 Ga0495654_0145907
1677 Ga0495665_0011303
1678 Ga0495640_0022970
1679 Ga0495586_0006584
1680 Ga0495587_0003070
1681 Ga0495587_0009581
1682 Ga0495609_0000405
1683 Ga0495609_0020986
1684 Ga0495609_0033359
1685 Ga0495597_0011731
1686 Ga0495597_0016052
1687 Ga0495597_0018166
1688 Ga0495597_0032715
1689 Ga0495597_0043568
1690 Ga0495645_0098176
1691 Ga0495622_0000775
1692 Ga0495622_0001094
1693 Ga0495622_0002578
1694 Ga0495622_0005904
1695 Ga0495622_0006370
1696 Ga0495622_0059423
1697 Ga0495622_0086941
1698 Ga0495633_0001444
1699 Ga0495633_0003372
1700 Ga0495633_0003895
1701 Ga0495633_0023821
1702 Ga0495668_0000568
1703 Ga0495668_0012847
1704 Ga0495668_0020910
1705 Ga0495634_0096292
1706 Ga0495611_0004442
1707 Ga0495611_0013170
1708 Ga0495625_0000136
1709 Ga0495625_0013373
1710 Ga0495625_0021444
1711 Ga0495625_0026162
1712 Ga0495625_0043881
1713 Ga0495625_0061946
1714 Ga0495625_0203618
1715 Ga0495635_0000856
1716 Ga0495635_0003406
1717 Ga0495635_0028386
1718 Ga0495659_0008916
1719 Ga0495661_0001179
1720 Ga0495661_0001607
1721 Ga0495661_0014015
1722 Ga0495661_0014963
1723 Ga0495661_0125253
1724 Ga0495588_0020285
1725 Ga0495588_0065219
1726 Ga0495657_0117295
1727 Ga0495623_0011490
1728 Ga0495646_0044646
1729 Ga0495658_0003833
1730 Ga0495669_0032844
1731 Ga0495613_0012404
1732 Ga0495624_0099652
1733 Ga0495670_0000548
1734 Ga0495670_0001711
1735 Ga0495670_0020139
1736 Ga0495670_0057332
1737 Ga0495670_0069267
1738 Ga0495670_0069573
1739 Ga0495670_0073397
1740 Ga0495671_0004328
1741 Ga0495671_0004525
1742 Ga0495671_0036458
1743 Ga0495671_0040446
1744 Ga0495671_0064534
1745 Ga0495671_0072438
1746 Ga0495671_0129869
1747 Ga0495649_0000201
1748 Ga0495649_0005892
1749 Ga0495649_0043434
1750 Ga0495649_0072974
1751 Ga0495649_0202439
1752 Ga0495589_0014529
1753 Ga0495589_0014663
1754 Ga0495589_0015429
1755 Ga0495589_0048323
1756 Ga0495600_0019348
1757 Ga0495600_0076451
1758 Ga0495660_0002421
1759 Ga0495660_0007901
1760 Ga0495660_0009749
1761 Ga0495660_0010336
1762 Ga0495660_0010495
1763 Ga0495660_0029941
1764 Ga0495660_0047141
1765 Ga0495660_0058609
1766 Ga0495660_0065298
1767 Ga0495660_0085028
1768 Ga0495660_0116418
1769 Ga0495660_0142719
1770 Ga0495604_0006513
1771 Ga0495604_0034282
1772 Ga0495604_0049990
1773 Ga0495604_0178343
1774 Ga0495636_0018420
1775 Ga0495636_0082294
1776 Ga0495674_0046526
1777 Ga0495672_0000540
1778 Ga0495672_0001849
1779 Ga0495672_0010364
1780 Ga0495672_0013564
1781 Ga0495672_0016147
1782 Ga0495672_0016365
1783 Ga0495672_0045374
1784 Ga0495672_0097133
1785 Ga0495672_0124929
1786 Ga0495676_0004979
1787 Ga0495680_0003260
1788 Ga0495680_0003948
1789 Ga0495680_0046655
1790 Ga0495683_0000085
1791 Ga0495683_0124330
1792 Ga0495683_0162291
1793 Ga0495687_000375
1794 Ga0495687_001884
1795 Ga0495675_0001382
1796 Ga0495675_0058267
1797 Ga0495677_0001038
1798 Ga0495677_0002605
1799 Ga0495677_0004443
1800 Ga0495679_030866
1801 Ga0495673_0000297
1802 Ga0495673_0000345
1803 Ga0495673_0000577
1804 Ga0495673_0005101
1805 Ga0495673_0007357
1806 Ga0495673_0012094
1807 Ga0495673_0013919
1808 Ga0495673_0038701
1809 Ga0495673_0039727
1810 Ga0495673_0065497
1811 Ga0495673_0089498
1812 Ga0495681_0000172
1813 Ga0495681_0000226
1814 Ga0495681_0000417
1815 Ga0495681_0000424
1816 Ga0495681_0000712
1817 Ga0495681_0002398
1818 Ga0495681_0012211
1819 Ga0495681_0034229
1820 Ga0495681_0051051
1821 Ga0495681_0061101
1822 Ga0495684_0028703
1823 Ga0495684_0045663
1824 Ga0495686_0003384
1825 Ga0495686_0229627
1826 Ga0495593_0011535
1827 Ga0495593_0034702
1828 Ga0495593_0035820
1829 Ga0495626_0000144
1830 Ga0495626_0000179
1831 Ga0495626_0000438
1832 Ga0495626_0020622
1833 Ga0495626_0021905
1834 Ga0495626_0044408
1835 Ga0495626_0099083
1836 Ga0496100_0039534
1837 Ga0496102_0000250
1838 Ga0496102_0043415
1839 Ga0496102_0046823
1840 Ga0496103_0027072
1841 Ga0496103_0155478
1842 Ga0496104_0263217
1843 Ga0496107_0105378
1844 Ga0496107_0229517
1845 Ga0496108_0022509
1846 Ga0496108_0527904
1847 Ga0496109_0100476
1848 Ga0496110_0012489
1849 Ga0496110_0022038
1850 Ga0496110_0094803
1851 Ga0496110_0104736
1852 Ga0496111_0027774
1853 Ga0496111_0211677
1854 Ga0496112_0005803
1855 Ga0496112_0332422
1856 Ga0496112_0345770
1857 Ga0496113_0244440
1858 Ga0496113_0246514
1859 Ga0496115_0197030
1860 Ga0496116_0000419
1861 Ga0496116_0028683
1862 Ga0496117_0008975
1863 Ga0496117_0030791
1864 Ga0496117_0229163
1865 Ga0496118_0013091
1866 Ga0496118_0019329
1867 Ga0496118_0137412
1868 Ga0496119_0028027
1869 Ga0496120_0005937
1870 Ga0496121_0183166
1871 Ga0496121_0210687
1872 Ga0496121_0297573
1873 Ga0496122_0114392
1874 Ga0496124_0009971
1875 Ga0496125_0001730
1876 Ga0496125_0003106
1877 Ga0496125_0010260
1878 Ga0496125_0011702
1879 Ga0496125_0050011
1880 Ga0496126_0039481
1881 Ga0496126_0169059
1882 Ga0496126_0275732
1883 Ga0496126_0420511
1884 Ga0495678_001726
1885 Ga0495678_001732
1886 Ga0495678_015989
1887 Ga0495678_016124
1888 Ga0495678_018095
1889 Ga0495678_018346
1890 Ga0495678_021073
1891 Ga0495678_066493
1892 Ga0495682_0001278
1893 Ga0495682_0007549
1894 Ga0495682_0013091
1895 Ga0495682_0013912
1896 Ga0501031_0007292
1897 Ga0501032_0072629
1898 Ga0501033_0037192
1899 Ga0501034_0120934
1900 Ga0501036_0156729
1901 Ga0501037_0080718
1902 Ga0501037_0234080
1903 Ga0501038_0005074
1904 Ga0501040_0075908
1905 Ga0501042_0168276
1906 Ga0501043_0000149
1907 Ga0501043_0034884
1908 Ga0501043_0054276
1909 Ga0501046_0000092
1910 Ga0501046_0121347
1911 Ga0501047_0000028
1912 Ga0501048_0000097
1913 Ga0501070_0069393
1914 Ga0501070_0158999
1915 Ga0501072_0238505
1916 Ga0501073_0252941
1917 Ga0501076_0396444
1918 Ga0501077_0144400
1919 Ga0501080_0211330
1920 Ga0501083_0005855
1921 Ga0501083_0107195
1922 Ga0501265_000611
1923 Ga0501281_02594
1924 Ga0501035_0000097
1925 Ga0501035_0034336
1926 Ga0501035_0212764
1927 Ga0501044_0115660
1928 Ga0501044_0290128
1929 Ga0501045_0084677
1930 nmdc:mga03683_15819_c2
1931 nmdc:mga03683_53059_c1
1932 nmdc:mga03n38_142688_c1
1933 nmdc:mga0yw44_24540_c1
1934 nmdc:mga0yw44_41142_c1
1935 nmdc:mga0yw44_69585_c1
1936 nmdc:mga06z11_51548_c1
1937 nmdc:mga07m45_7849_c1
1938 nmdc:mga0qj67_161599_c1
1939 nmdc:mga0qj67_37313_c1
1940 nmdc:mga06r32_38471_c1
1941 nmdc:mga08y16_31386_c1
1942 nmdc:mga0rr50_28353_c1
1943 nmdc:mga08x19_4_c1
1944 Ga0495601_0020874
1945 Ga0495612_0015318
1946 Ga0495612_0106840
1947 Ga0500610_0000333
1948 Ga0500643_000040
1949 Ga0500583_0006833
1950 Ga0500555_018422
1951 Ga0500556_0021194
1952 Ga0500562_002163
1953 Ga0500595_005376
1954 Ga0500642_0158907
1955 Ga0500658_0000447
1956 Ga0500658_0005140
1957 Ga0500658_0027236
1958 Ga0500561_0023655
1959 Ga0500568_0000920
1960 Ga0500577_0074452
1961 Ga0500589_140658
1962 Ga0500616_0014979
1963 Ga0500622_0019177
1964 Ga0500627_0072984
1965 Ga0500633_0059167
1966 Ga0500634_0001992
1967 Ga0500634_0130047
1968 Ga0500639_029469
1969 Ga0500637_0010068
1970 Ga0500637_0093025
1971 Ga0500609_012070
1972 Ga0501084_0017222
1973 Ga0501084_0046041
1974 Ga0501082_0032761
1975 Ga0501082_0208887
1976 Ga0530510_0028461
1977 2511243504
1978 2511275771
1979 2511290624
1980 2511298313
1981 2511301050
1982 2511315667
1983 2511326136
1984 2511333948
1985 2511338989
1986 2511347207
1987 2511349875
1988 2511357812
1989 2511372340
1990 2548499305
1991 2597032611
1992 2597865080
1993 2599400207
1994 2599447286
1995 2599451463
1996 2599509428
1997 2599512635
1998 2599519986
1999 2599891311
2000 2601689661
2001 2601796206
2002 2606073355
2003 2606126999
2004 2624481855
2005 2643789931
2006 2643845557
2007 2643866137
2008 2643874319
2009 2643956432
2010 2643994126
2011 2644025526
2012 2644160903
2013 2644187401
2014 2644214349
2015 2644292951
2016 2644621915
2017 2644647967
2018 2677899868
2019 2715751158
2020 2715758158
2021 2718635104
2022 2723249833
2023 2739201896
2024 2739259302
2025 2739314133
2026 2774123380
2027 2774132763
2028 2784263423
2029 2784316078
2030 2792837547
2031 2808930548
2032 2808952670
2033 2808957335
2034 2808977790
2035 2808993270
2036 2809218709
2037 2819655598
2038 2824672912
2039 2824689444
2040 2824705356
2041 2824755503
2042 2824763787
2043 2842682216
2044 2842827691
2045 2842836449
2046 2842841008
2047 2842844563
2048 2847935644
2049 2852662403
2050 2860340736
2051 2878033839
2052 2880234464
2053 2881673396
2054 2900582412
2055 2904521397
2056 2904555574
2057 2904698552
2058 2904716539
2059 2908762437
2060 2919068824
2061 2919387931
2062 2919461133
2063 2919489886
2064 2919706865
2065 2928061011
2066 2928070104
2067 2929526598
2068 2931394940
2069 2931403289
2070 2935678657
2071 2935687852
2072 2935714872
2073 2935726563
2074 2935733690
2075 2935743069
2076 2935754892
2077 2940559731
2078 2945950403
2079 2945964996
2080 2946008561
2081 2946032089
2082 2947238918
2083 2969308614
2084 2974290013
2085 2990714192
2086 2998143919
2087 3001890424
2088 3007515620
2089 3007616933
2090 3007625638
2091 3007857825
2092 3007865348
2093 8029996958
2094 8054350790
2095 8054507450
2096 8055822393
2097 8056127639
2098 8056135855
2099 8056153174
2100 8056167357
2101 8056179536
2102 8056692478

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

14

78

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

75

228

0.93

PF00106

adh_short

short chain dehydrogenase

75

180

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9608 12 192
1yxm-assembly1.cif.gz_D crystal structure of peroxisomal trans 2-enoyl coa reductase 0.957 4 274
1ae1-assembly1.cif.gz_B tropinone reductase-i complex with nadp 0.9564 13 258
7djs-assembly1.cif.gz_B crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9552 15 256
6lln-assembly1.cif.gz_A citronellol catabolism dehydrogenase (atub) [pseudomonas aeruginosa pao1] 0.9543 3 255
ID Description Score Start End Superfamily
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9608 12 192 3.40.50.720
1yxmD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.957 4 274 3.40.50.720
1zemG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.95 12 252 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.949 10 256 3.40.50.720
5jc8D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 9 258 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A835ZEV5-F1-model_v4 Uncharacterized protein 0.9695 40 249 GO:0005313
GO:0005509
GO:0005743
GO:0015183
GO:0043490
AF-A0A7V4JF01-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9636 12 191 GO:0016616
GO:0030497
AF-A0A383B9X5-F1-model_v4 Uncharacterized protein 0.9624 13 131 GO:0016616
AF-A0A559M6V2-F1-model_v4 Putative oxidoreductase 0.962 13 103 GO:0016491
AF-A0A7W1NW92-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9616 10 134

Map