F489071
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1051 | 559 | 2102 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100358001|Ga0070663_1003580012 |
| Length | 265 |
| Sequence | MYHSIFTQALFKDQVVIVTGGGSGIGRCAAHELATLGALVALVGRTPEKLAAVQAEIAQAGGRSDTYPCNIRDEEFPAPLKDISLKGWEAVLQTNLTGGFLMARECLNQAMAASGGAIVNIVADMWGGMPGMGHSGAARAGMVNFTESASFEWAQYGVRVNAVAPGYVASSGMDAYPPAMHETIRAFPQTVPMKRFGTEAEVSAAIVFLLSPAASFITGSTLRVDGGRPNVRPGMPMPAVRNPAAPLNGFHLATLPKILQDGGDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 197 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 198 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 199 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 200 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 201 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 202 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 203 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 221 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 237 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 238 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 239 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 240 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 241 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 242 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 243 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 244 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 245 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 246 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 247 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 248 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 249 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 250 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 251 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 252 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 258 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 259 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 260 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 261 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 262 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 362 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 363 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 364 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 365 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 368 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 369 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 411 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 412 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 413 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 418 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 421 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 422 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 423 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 425 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 428 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 430 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 431 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 434 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 435 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 436 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 437 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 438 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 439 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 440 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 441 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 442 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 443 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 444 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 445 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 446 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 447 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 448 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 449 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 450 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 451 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 452 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 453 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 454 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 455 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 456 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 457 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 458 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 459 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 460 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 461 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 462 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 463 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 464 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 465 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 466 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 467 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 468 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 469 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 470 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 471 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 472 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 473 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 474 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 475 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 476 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 477 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 478 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 479 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 480 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 481 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 482 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 483 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 484 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 485 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 486 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 487 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 488 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 489 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 490 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 491 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 492 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 493 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 494 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 495 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 496 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 497 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 498 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 499 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 500 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 501 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 502 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 503 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 504 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 505 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 506 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 507 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 508 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 509 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 510 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 511 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 512 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 513 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 514 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 515 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 516 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 517 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 518 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 519 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 520 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 521 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 522 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 523 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 524 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 525 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 526 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 527 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 528 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 529 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 530 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 531 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 532 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 533 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 534 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 535 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 536 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 537 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 538 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 539 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 540 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 541 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 542 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 543 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 544 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 545 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 546 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 547 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 548 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 549 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 550 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 551 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 552 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 553 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 554 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 555 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 556 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 557 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 558 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 559 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.73 |
| Metatranscriptomes | 0.29 |
| Isolates | 11.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.42 |
| Nodule | 2.57 |
| Rhizoplane | 3.33 |
| Rhizosphere | 71.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070663_100358001 | 3300005455 | Bacteria | 1183 |
| 2 | MRS2a_Contig_45 | 2124908027 | Bacteria | 78063 |
| 3 | JGI24741J21665_1000563 | 3300001915 | Bacteria | 11347 |
| 4 | JGI24740J21852_10003720 | 3300001979 | Bacteria | 6640 |
| 5 | JGI25156J39149_1001699 | 3300002705 | Bacteria | 8855 |
| 6 | JGI25162J39368_1000166 | 3300002737 | Bacteria | 72515 |
| 7 | JGI25163J39215_1000715 | 3300002771 | Bacteria | 8626 |
| 8 | JGI25164J39214_1000129 | 3300002772 | Bacteria | 72515 |
| 9 | JGI25151J46595_10030891 | 3300003187 | Bacteria | 2100 |
| 10 | JGI25165J46597_1000251 | 3300003214 | Bacteria | 72515 |
| 11 | rootH2_10054890 | 3300003320 | Bacteria | 1576 |
| 12 | JGI25160J50197_1024790 | 3300003354 | Bacteria | 1694 |
| 13 | Ga0006562J51391_1127201 | 3300003578 | Bacteria | 9680 |
| 14 | Ga0006562J51391_1133065 | 3300003578 | Bacteria | 3250 |
| 15 | Ga0006562J51391_1133066 | 3300003578 | Bacteria | 2570 |
| 16 | Ga0055538_1000405 | 3300003751 | Bacteria | 17180 |
| 17 | Ga0055538_1001223 | 3300003751 | Bacteria | 5348 |
| 18 | Ga0055538_1001224 | 3300003751 | Bacteria | 5345 |
| 19 | Ga0055539_1000185 | 3300003752 | Bacteria | 52003 |
| 20 | Ga0055539_1000397 | 3300003752 | Bacteria | 17180 |
| 21 | Ga0055533_1000398 | 3300003756 | Bacteria | 17180 |
| 22 | Ga0055533_1001284 | 3300003756 | Bacteria | 6833 |
| 23 | Ga0055532_1000006 | 3300003758 | Bacteria | 451244 |
| 24 | Ga0055532_1000498 | 3300003758 | Bacteria | 17180 |
| 25 | Ga0055525_1000501 | 3300003759 | Bacteria | 19691 |
| 26 | Ga0055525_1000553 | 3300003759 | Bacteria | 17180 |
| 27 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 28 | Ga0055529_1000273 | 3300003763 | Bacteria | 61443 |
| 29 | Ga0055526_1005404 | 3300003771 | Bacteria | 7351 |
| 30 | Ga0055526_1018471 | 3300003771 | Bacteria | 2600 |
| 31 | Ga0055537_1004515 | 3300003773 | Bacteria | 3965 |
| 32 | Ga0055536_1000239 | 3300003781 | Bacteria | 44007 |
| 33 | Ga0055536_1002621 | 3300003781 | Bacteria | 10016 |
| 34 | Ga0055534_1000600 | 3300003784 | Bacteria | 18687 |
| 35 | Ga0055530_10000289 | 3300003791 | Bacteria | 45948 |
| 36 | Ga0055530_10002048 | 3300003791 | Bacteria | 13578 |
| 37 | Ga0055540_1000105 | 3300003792 | Bacteria | 93593 |
| 38 | Ga0055531_10000081 | 3300003794 | Bacteria | 103600 |
| 39 | Ga0055531_10004735 | 3300003794 | Bacteria | 8140 |
| 40 | Ga0055541_1000284 | 3300003841 | Bacteria | 17180 |
| 41 | Ga0055541_1001906 | 3300003841 | Bacteria | 4329 |
| 42 | Ga0055541_1003832 | 3300003841 | Bacteria | 2786 |
| 43 | Ga0055543_1000305 | 3300004625 | Bacteria | 34343 |
| 44 | Ga0065165_1002126 | 3300005262 | Bacteria | 18020 |
| 45 | Ga0065165_1045245 | 3300005262 | Bacteria | 1283 |
| 46 | Ga0065714_10002480 | 3300005288 | Bacteria | 17144 |
| 47 | Ga0065714_10065498 | 3300005288 | Bacteria | 9734 |
| 48 | Ga0065714_10086658 | 3300005288 | Bacteria | 2074 |
| 49 | Ga0065714_10103566 | 3300005288 | Bacteria | 1601 |
| 50 | Ga0065712_10000845 | 3300005290 | Bacteria | 7983 |
| 51 | Ga0065715_10012261 | 3300005293 | Bacteria | 2254 |
| 52 | Ga0070676_10112978 | 3300005328 | Bacteria | 1694 |
| 53 | Ga0070676_10144881 | 3300005328 | Bacteria | 1515 |
| 54 | Ga0070670_100000224 | 3300005331 | Bacteria | 52252 |
| 55 | Ga0068868_100091992 | 3300005338 | Bacteria | 2445 |
| 56 | Ga0068868_100107647 | 3300005338 | Bacteria | 2262 |
| 57 | Ga0068868_100136496 | 3300005338 | Bacteria | 2011 |
| 58 | Ga0070689_100063076 | 3300005340 | Bacteria | 2884 |
| 59 | Ga0070661_100000336 | 3300005344 | Bacteria | 37535 |
| 60 | Ga0070661_100228619 | 3300005344 | Bacteria | 1429 |
| 61 | Ga0070669_100006480 | 3300005353 | Bacteria | 8428 |
| 62 | Ga0070671_100047273 | 3300005355 | Bacteria | 3579 |
| 63 | Ga0070671_100106756 | 3300005355 | Bacteria | 2351 |
| 64 | Ga0070673_100165583 | 3300005364 | Bacteria | 1883 |
| 65 | Ga0070688_100331366 | 3300005365 | Bacteria | 1109 |
| 66 | Ga0070705_100113686 | 3300005440 | Bacteria | 1735 |
| 67 | Ga0070663_100000246 | 3300005455 | Bacteria | 27518 |
| 68 | Ga0070663_100155007 | 3300005455 | Bacteria | 1759 |
| 69 | Ga0070663_100186749 | 3300005455 | Bacteria | 1611 |
| 70 | Ga0070678_100078656 | 3300005456 | Bacteria | 2492 |
| 71 | Ga0070662_100000056 | 3300005457 | Bacteria | 60234 |
| 72 | Ga0070697_100296058 | 3300005536 | Bacteria | 1391 |
| 73 | Ga0068853_100023937 | 3300005539 | Bacteria | 5118 |
| 74 | Ga0068853_100210067 | 3300005539 | Bacteria | 1774 |
| 75 | Ga0070686_100253765 | 3300005544 | Bacteria | 1286 |
| 76 | Ga0070695_100009160 | 3300005545 | Bacteria | 5885 |
| 77 | Ga0070696_100173698 | 3300005546 | Bacteria | 1594 |
| 78 | Ga0070665_100033455 | 3300005548 | Bacteria | 5172 |
| 79 | Ga0070704_100009794 | 3300005549 | Bacteria | 5811 |
| 80 | Ga0070704_100392120 | 3300005549 | Bacteria | 1183 |
| 81 | Ga0070664_100000122 | 3300005564 | Bacteria | 51758 |
| 82 | Ga0070664_100071994 | 3300005564 | Bacteria | 2964 |
| 83 | Ga0070664_100420602 | 3300005564 | Bacteria | 1224 |
| 84 | Ga0068854_100000121 | 3300005578 | Bacteria | 53603 |
| 85 | Ga0068854_100014586 | 3300005578 | Bacteria | 5185 |
| 86 | Ga0068854_100029670 | 3300005578 | Bacteria | 3788 |
| 87 | Ga0068856_100001446 | 3300005614 | Bacteria | 24888 |
| 88 | Ga0068856_100199475 | 3300005614 | Bacteria | 2016 |
| 89 | Ga0070702_100185214 | 3300005615 | Bacteria | 1366 |
| 90 | Ga0068859_100141340 | 3300005617 | Bacteria | 2481 |
| 91 | Ga0068859_100293899 | 3300005617 | Bacteria | 1718 |
| 92 | Ga0068864_100003161 | 3300005618 | Bacteria | 13614 |
| 93 | Ga0068861_100040406 | 3300005719 | Bacteria | 3489 |
| 94 | Ga0068861_100040594 | 3300005719 | Bacteria | 3482 |
| 95 | Ga0068851_10000028 | 3300005834 | Bacteria | 117106 |
| 96 | Ga0068863_100140768 | 3300005841 | Bacteria | 2306 |
| 97 | Ga0068863_100321234 | 3300005841 | Bacteria | 1504 |
| 98 | Ga0068863_100362306 | 3300005841 | Bacteria | 1413 |
| 99 | Ga0068860_100032977 | 3300005843 | Bacteria | 4973 |
| 100 | Ga0081540_1004812 | 3300005983 | Bacteria | 10173 |
| 101 | Ga0081540_1015156 | 3300005983 | Bacteria | 4892 |
| 102 | Ga0081539_10032068 | 3300005985 | Bacteria | 3224 |
| 103 | Ga0070717_10004861 | 3300006028 | Bacteria | 9772 |
| 104 | Ga0070717_10025882 | 3300006028 | Bacteria | 4675 |
| 105 | Ga0075365_10028979 | 3300006038 | Bacteria | 3533 |
| 106 | Ga0075365_10033580 | 3300006038 | Bacteria | 3308 |
| 107 | Ga0075368_10020265 | 3300006042 | Bacteria | 2516 |
| 108 | Ga0075432_10016974 | 3300006058 | Bacteria | 2485 |
| 109 | Ga0075367_10048532 | 3300006178 | Bacteria | 2501 |
| 110 | Ga0075367_10106909 | 3300006178 | Bacteria | 1715 |
| 111 | Ga0075366_10020174 | 3300006195 | Bacteria | 3864 |
| 112 | Ga0075366_10159319 | 3300006195 | Bacteria | 1368 |
| 113 | Ga0097621_100190550 | 3300006237 | Bacteria | 1776 |
| 114 | Ga0075370_10049297 | 3300006353 | Bacteria | 2387 |
| 115 | Ga0068871_100052556 | 3300006358 | Bacteria | 3300 |
| 116 | Ga0075428_100042245 | 3300006844 | Bacteria | 5014 |
| 117 | Ga0075428_100213784 | 3300006844 | Bacteria | 2083 |
| 118 | Ga0075428_100339326 | 3300006844 | Bacteria | 1614 |
| 119 | Ga0075430_100143969 | 3300006846 | Bacteria | 1985 |
| 120 | Ga0075430_100186936 | 3300006846 | Bacteria | 1723 |
| 121 | Ga0075431_100235557 | 3300006847 | Bacteria | 1864 |
| 122 | Ga0075429_100361443 | 3300006880 | Bacteria | 1271 |
| 123 | Ga0075436_100007551 | 3300006914 | Bacteria | 7427 |
| 124 | Ga0075436_100060272 | 3300006914 | Bacteria | 2621 |
| 125 | Ga0097620_100141338 | 3300006931 | Bacteria | 2481 |
| 126 | Ga0097620_100293900 | 3300006931 | Bacteria | 1718 |
| 127 | Ga0079104_1000124 | 3300006946 | Bacteria | 110752 |
| 128 | Ga0079104_1008588 | 3300006946 | Bacteria | 3553 |
| 129 | Ga0075435_100012311 | 3300007076 | Bacteria | 6329 |
| 130 | Ga0099794_10000175 | 3300007265 | Bacteria | 23393 |
| 131 | Ga0099794_10008266 | 3300007265 | Bacteria | 4313 |
| 132 | Ga0099795_10000165 | 3300007788 | Bacteria | 11089 |
| 133 | Ga0105251_10000346 | 3300009011 | Bacteria | 46116 |
| 134 | Ga0105251_10034727 | 3300009011 | Bacteria | 2493 |
| 135 | Ga0105244_10000322 | 3300009036 | Bacteria | 45812 |
| 136 | Ga0105250_10002492 | 3300009092 | Bacteria | 9232 |
| 137 | Ga0105250_10053842 | 3300009092 | Bacteria | 1614 |
| 138 | Ga0105240_10015691 | 3300009093 | Bacteria | 10283 |
| 139 | Ga0105240_10105334 | 3300009093 | Bacteria | 3424 |
| 140 | Ga0105240_10318109 | 3300009093 | Bacteria | 1775 |
| 141 | Ga0111539_10024343 | 3300009094 | Bacteria | 7431 |
| 142 | Ga0111539_10064464 | 3300009094 | Bacteria | 4334 |
| 143 | Ga0105245_10013885 | 3300009098 | Bacteria | 7016 |
| 144 | Ga0105245_10039587 | 3300009098 | Bacteria | 4196 |
| 145 | Ga0105245_10099935 | 3300009098 | Bacteria | 2683 |
| 146 | Ga0105245_10121680 | 3300009098 | Bacteria | 2439 |
| 147 | Ga0105245_10237725 | 3300009098 | Bacteria | 1764 |
| 148 | Ga0105247_10041933 | 3300009101 | Bacteria | 2801 |
| 149 | Ga0114129_10368819 | 3300009147 | Bacteria | 1898 |
| 150 | Ga0105243_10000103 | 3300009148 | Bacteria | 97091 |
| 151 | Ga0105241_10039449 | 3300009174 | Bacteria | 3562 |
| 152 | Ga0105248_10071469 | 3300009177 | Bacteria | 3898 |
| 153 | Ga0105248_10188843 | 3300009177 | Bacteria | 2322 |
| 154 | Ga0105238_10076260 | 3300009551 | Bacteria | 3344 |
| 155 | Ga0105249_10109781 | 3300009553 | Bacteria | 2606 |
| 156 | Ga0099796_10000071 | 3300010159 | Bacteria | 18016 |
| 157 | Ga0105246_10006736 | 3300011119 | Bacteria | 7025 |
| 158 | Ga0105246_10101796 | 3300011119 | Bacteria | 2093 |
| 159 | Ga0105246_10163692 | 3300011119 | Bacteria | 1697 |
| 160 | Ga0157345_1000009 | 3300012498 | Bacteria | 55332 |
| 161 | Ga0157373_10003474 | 3300013100 | Bacteria | 11913 |
| 162 | Ga0157373_10033971 | 3300013100 | Bacteria | 3664 |
| 163 | Ga0157373_10038079 | 3300013100 | Bacteria | 3447 |
| 164 | Ga0157373_10156321 | 3300013100 | Bacteria | 1604 |
| 165 | Ga0157371_10000072 | 3300013102 | Bacteria | 163917 |
| 166 | Ga0157371_10000306 | 3300013102 | Bacteria | 64149 |
| 167 | Ga0157371_10006322 | 3300013102 | Bacteria | 9807 |
| 168 | Ga0157371_10027785 | 3300013102 | Bacteria | 4100 |
| 169 | Ga0157370_10000031 | 3300013104 | Bacteria | 139879 |
| 170 | Ga0157370_10098156 | 3300013104 | Bacteria | 2747 |
| 171 | Ga0157370_10152759 | 3300013104 | Bacteria | 2148 |
| 172 | Ga0157369_10003537 | 3300013105 | Bacteria | 18566 |
| 173 | Ga0157369_10013154 | 3300013105 | Bacteria | 9364 |
| 174 | Ga0157369_10114886 | 3300013105 | Bacteria | 2858 |
| 175 | Ga0157369_10259065 | 3300013105 | Bacteria | 1814 |
| 176 | Ga0157374_10022608 | 3300013296 | Bacteria | 5610 |
| 177 | Ga0157378_10261127 | 3300013297 | Bacteria | 1662 |
| 178 | Ga0163162_10000072 | 3300013306 | Bacteria | 92818 |
| 179 | Ga0163162_10032056 | 3300013306 | Bacteria | 5217 |
| 180 | Ga0163162_10127391 | 3300013306 | Bacteria | 2653 |
| 181 | Ga0163162_10212141 | 3300013306 | Bacteria | 2066 |
| 182 | Ga0157372_10001411 | 3300013307 | Bacteria | 25934 |
| 183 | Ga0163163_10010321 | 3300014325 | Bacteria | 8396 |
| 184 | Ga0163163_10557829 | 3300014325 | Bacteria | 1208 |
| 185 | Ga0157380_10031465 | 3300014326 | Bacteria | 4073 |
| 186 | Ga0182008_10003577 | 3300014497 | Bacteria | 9313 |
| 187 | Ga0182008_10006269 | 3300014497 | Bacteria | 6679 |
| 188 | Ga0182008_10022716 | 3300014497 | Bacteria | 3211 |
| 189 | Ga0182008_10084256 | 3300014497 | Bacteria | 1565 |
| 190 | Ga0157379_10186184 | 3300014968 | Bacteria | 1876 |
| 191 | Ga0157379_10443523 | 3300014968 | Bacteria | 1197 |
| 192 | Ga0157376_10018698 | 3300014969 | Bacteria | 5321 |
| 193 | Ga0182006_1051303 | 3300015261 | Bacteria | 1587 |
| 194 | Ga0182006_1093032 | 3300015261 | Bacteria | 1082 |
| 195 | Ga0182005_1015952 | 3300015265 | Bacteria | 2092 |
| 196 | Ga0182005_1058996 | 3300015265 | Bacteria | 1047 |
| 197 | Ga0163161_10006408 | 3300017792 | Bacteria | 8151 |
| 198 | Ga0163161_10016557 | 3300017792 | Bacteria | 5148 |
| 199 | Ga0163161_10016783 | 3300017792 | Bacteria | 5118 |
| 200 | Ga0163161_10068832 | 3300017792 | Bacteria | 2587 |
| 201 | Ga0163161_10241643 | 3300017792 | Bacteria | 1404 |
| 202 | Ga0213872_10000489 | 3300021361 | Bacteria | 31637 |
| 203 | Ga0213872_10000610 | 3300021361 | Bacteria | 27068 |
| 204 | Ga0213872_10001402 | 3300021361 | Bacteria | 15883 |
| 205 | Ga0209435_100432 | 3300025206 | Bacteria | 8686 |
| 206 | Ga0209760_100043 | 3300025207 | Bacteria | 113964 |
| 207 | Ga0209436_100149 | 3300025208 | Bacteria | 33529 |
| 208 | Ga0209436_102498 | 3300025208 | Bacteria | 5492 |
| 209 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 210 | Ga0209784_100017 | 3300025224 | Bacteria | 472003 |
| 211 | Ga0209784_100391 | 3300025224 | Bacteria | 20022 |
| 212 | Ga0209784_100520 | 3300025224 | Bacteria | 14622 |
| 213 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 214 | Ga0209566_100014 | 3300025225 | Bacteria | 472003 |
| 215 | Ga0209566_103002 | 3300025225 | Bacteria | 2786 |
| 216 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 217 | Ga0209674_100028 | 3300025226 | Bacteria | 472003 |
| 218 | Ga0209674_100796 | 3300025226 | Bacteria | 10588 |
| 219 | Ga0209672_100448 | 3300025228 | Bacteria | 23309 |
| 220 | Ga0209672_100849 | 3300025228 | Bacteria | 14061 |
| 221 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 222 | Ga0209147_100038 | 3300025229 | Bacteria | 314497 |
| 223 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 224 | Ga0209563_100032 | 3300025230 | Bacteria | 472003 |
| 225 | Ga0207427_100047 | 3300025231 | Bacteria | 240409 |
| 226 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 227 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 228 | Ga0209258_100828 | 3300025242 | Bacteria | 17186 |
| 229 | Ga0207425_1000160 | 3300025245 | Bacteria | 57151 |
| 230 | Ga0207425_1000961 | 3300025245 | Bacteria | 13552 |
| 231 | Ga0209646_1000171 | 3300025246 | Bacteria | 84951 |
| 232 | Ga0209026_1002374 | 3300025250 | Bacteria | 7112 |
| 233 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 234 | Ga0209677_100018 | 3300025253 | Bacteria | 472003 |
| 235 | Ga0209759_1000926 | 3300025256 | Bacteria | 21318 |
| 236 | Ga0209759_1001154 | 3300025256 | Bacteria | 16779 |
| 237 | Ga0209129_1011559 | 3300025258 | Bacteria | 2097 |
| 238 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 239 | Ga0209233_1001245 | 3300025261 | Bacteria | 10239 |
| 240 | Ga0209565_1000664 | 3300025263 | Bacteria | 21943 |
| 241 | Ga0209565_1003248 | 3300025263 | Bacteria | 5359 |
| 242 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 243 | Ga0209673_1011371 | 3300025273 | Bacteria | 3675 |
| 244 | Ga0209673_1016051 | 3300025273 | Bacteria | 2816 |
| 245 | Ga0209130_1000624 | 3300025284 | Bacteria | 33738 |
| 246 | Ga0209130_1003920 | 3300025284 | Bacteria | 5963 |
| 247 | Ga0209675_1000467 | 3300025291 | Bacteria | 31046 |
| 248 | Ga0209675_1001555 | 3300025291 | Bacteria | 13032 |
| 249 | Ga0209675_1020112 | 3300025291 | Bacteria | 1818 |
| 250 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 251 | Ga0209676_1000646 | 3300025292 | Bacteria | 50033 |
| 252 | Ga0209676_1004434 | 3300025292 | Bacteria | 7832 |
| 253 | Ga0209676_1005348 | 3300025292 | Bacteria | 6757 |
| 254 | Ga0209025_1000718 | 3300025294 | Bacteria | 56292 |
| 255 | Ga0209564_1000088 | 3300025295 | Bacteria | 250268 |
| 256 | Ga0209564_1004515 | 3300025295 | Bacteria | 8472 |
| 257 | Ga0209564_1007989 | 3300025295 | Bacteria | 5316 |
| 258 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 259 | Ga0209050_1000363 | 3300025298 | Bacteria | 86923 |
| 260 | Ga0209050_1000430 | 3300025298 | Bacteria | 77008 |
| 261 | Ga0209050_1000535 | 3300025298 | Bacteria | 62996 |
| 262 | Ga0209050_1007738 | 3300025298 | Bacteria | 5929 |
| 263 | Ga0209256_1000560 | 3300025299 | Bacteria | 53201 |
| 264 | Ga0209256_1001254 | 3300025299 | Bacteria | 27951 |
| 265 | Ga0209256_1002634 | 3300025299 | Bacteria | 14142 |
| 266 | Ga0207426_1006486 | 3300025302 | Bacteria | 5079 |
| 267 | Ga0207426_1034679 | 3300025302 | Bacteria | 1617 |
| 268 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 269 | Ga0209051_1000185 | 3300025303 | Bacteria | 110195 |
| 270 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 271 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 272 | Ga0209257_1000157 | 3300025304 | Bacteria | 181004 |
| 273 | Ga0209257_1058303 | 3300025304 | Bacteria | 1059 |
| 274 | Ga0207656_10000056 | 3300025321 | Bacteria | 44124 |
| 275 | Ga0207696_1000193 | 3300025711 | Bacteria | 94161 |
| 276 | Ga0207696_1001821 | 3300025711 | Bacteria | 10979 |
| 277 | Ga0207655_1000505 | 3300025728 | Bacteria | 49919 |
| 278 | Ga0207655_1010484 | 3300025728 | Bacteria | 5613 |
| 279 | Ga0207655_1020359 | 3300025728 | Bacteria | 3414 |
| 280 | Ga0207655_1030332 | 3300025728 | Bacteria | 2516 |
| 281 | Ga0207713_1000386 | 3300025735 | Bacteria | 47877 |
| 282 | Ga0207713_1000431 | 3300025735 | Bacteria | 44260 |
| 283 | Ga0207713_1001314 | 3300025735 | Bacteria | 20391 |
| 284 | Ga0207713_1002492 | 3300025735 | Bacteria | 13378 |
| 285 | Ga0207713_1012230 | 3300025735 | Bacteria | 4608 |
| 286 | Ga0207713_1016633 | 3300025735 | Bacteria | 3726 |
| 287 | Ga0207647_10124892 | 3300025904 | Bacteria | 1515 |
| 288 | Ga0207699_10326536 | 3300025906 | Bacteria | 1078 |
| 289 | Ga0207645_10065700 | 3300025907 | Bacteria | 2319 |
| 290 | Ga0207654_10014283 | 3300025911 | Bacteria | 4102 |
| 291 | Ga0207695_10002542 | 3300025913 | Bacteria | 26794 |
| 292 | Ga0207671_10061555 | 3300025914 | Bacteria | 2785 |
| 293 | Ga0207693_10084413 | 3300025915 | Bacteria | 2488 |
| 294 | Ga0207649_10000449 | 3300025920 | Bacteria | 29607 |
| 295 | Ga0207681_10001738 | 3300025923 | Bacteria | 13982 |
| 296 | Ga0207681_10203679 | 3300025923 | Bacteria | 1521 |
| 297 | Ga0207650_10000291 | 3300025925 | Bacteria | 50791 |
| 298 | Ga0207687_10005746 | 3300025927 | Bacteria | 8211 |
| 299 | Ga0207687_10011264 | 3300025927 | Bacteria | 5842 |
| 300 | Ga0207644_10031910 | 3300025931 | Bacteria | 3674 |
| 301 | Ga0207644_10102053 | 3300025931 | Bacteria | 2157 |
| 302 | Ga0207644_10164695 | 3300025931 | Bacteria | 1726 |
| 303 | Ga0207706_10000445 | 3300025933 | Bacteria | 44135 |
| 304 | Ga0207706_10007508 | 3300025933 | Bacteria | 10086 |
| 305 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 306 | Ga0207670_10303073 | 3300025936 | Bacteria | 1252 |
| 307 | Ga0207669_10263229 | 3300025937 | Bacteria | 1291 |
| 308 | Ga0207691_10247796 | 3300025940 | Bacteria | 1539 |
| 309 | Ga0207711_10328351 | 3300025941 | Bacteria | 1414 |
| 310 | Ga0207689_10009277 | 3300025942 | Bacteria | 8506 |
| 311 | Ga0207679_10000007 | 3300025945 | Bacteria | 460140 |
| 312 | Ga0207679_10458960 | 3300025945 | Bacteria | 1131 |
| 313 | Ga0207667_10412081 | 3300025949 | Bacteria | 1375 |
| 314 | Ga0207651_10165626 | 3300025960 | Bacteria | 1738 |
| 315 | Ga0207651_10205169 | 3300025960 | Bacteria | 1583 |
| 316 | Ga0207668_10091720 | 3300025972 | Bacteria | 2234 |
| 317 | Ga0207640_10000107 | 3300025981 | Bacteria | 63143 |
| 318 | Ga0207640_10026064 | 3300025981 | Bacteria | 3546 |
| 319 | Ga0207658_10189908 | 3300025986 | Bacteria | 1707 |
| 320 | Ga0207677_10009786 | 3300026023 | Bacteria | 5402 |
| 321 | Ga0207677_10108219 | 3300026023 | Bacteria | 2063 |
| 322 | Ga0207639_10126991 | 3300026041 | Bacteria | 2105 |
| 323 | Ga0207639_10324051 | 3300026041 | Bacteria | 1369 |
| 324 | Ga0207678_10000207 | 3300026067 | Bacteria | 51939 |
| 325 | Ga0207678_10002939 | 3300026067 | Bacteria | 15441 |
| 326 | Ga0207702_10000260 | 3300026078 | Bacteria | 61036 |
| 327 | Ga0207641_10177909 | 3300026088 | Bacteria | 1946 |
| 328 | Ga0207641_10240258 | 3300026088 | Bacteria | 1687 |
| 329 | Ga0207648_10122901 | 3300026089 | Bacteria | 2283 |
| 330 | Ga0207676_10190227 | 3300026095 | Bacteria | 1805 |
| 331 | Ga0207675_100036501 | 3300026118 | Bacteria | 4584 |
| 332 | Ga0207675_100112511 | 3300026118 | Bacteria | 2569 |
| 333 | Ga0207675_100160586 | 3300026118 | Bacteria | 2143 |
| 334 | Ga0207683_10009292 | 3300026121 | Bacteria | 8378 |
| 335 | Ga0207698_10172974 | 3300026142 | Bacteria | 1904 |
| 336 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 337 | Ga0209281_1006210 | 3300027111 | Bacteria | 3155 |
| 338 | Ga0209179_1000643 | 3300027512 | Bacteria | 3720 |
| 339 | Ga0209179_1010378 | 3300027512 | Bacteria | 1622 |
| 340 | Ga0209588_1006727 | 3300027671 | Bacteria | 3358 |
| 341 | Ga0209588_1006757 | 3300027671 | Bacteria | 3352 |
| 342 | Ga0207428_10015756 | 3300027907 | Bacteria | 6527 |
| 343 | Ga0207428_10035452 | 3300027907 | Bacteria | 4078 |
| 344 | Ga0207428_10045233 | 3300027907 | Bacteria | 3547 |
| 345 | Ga0207428_10073411 | 3300027907 | Bacteria | 2684 |
| 346 | Ga0268266_10040831 | 3300028379 | Bacteria | 3955 |
| 347 | Ga0268266_10134411 | 3300028379 | Bacteria | 2214 |
| 348 | Ga0268264_10462527 | 3300028381 | Bacteria | 1231 |
| 349 | Ga0265318_10011277 | 3300028577 | Bacteria | 3854 |
| 350 | Ga0307515_10000208 | 3300028794 | Bacteria | 144484 |
| 351 | Ga0307515_10080725 | 3300028794 | Bacteria | 4236 |
| 352 | Ga0307511_10175496 | 3300030521 | Bacteria | 1167 |
| 353 | Ga0307512_10112371 | 3300030522 | Bacteria | 1788 |
| 354 | Ga0316177_1020845 | 3300030731 | Bacteria | 5959 |
| 355 | Ga0314311_1060215 | 3300030733 | Bacteria | 2732 |
| 356 | Ga0316178_1101239 | 3300030735 | Bacteria | 23092 |
| 357 | Ga0316183_1015378 | 3300030742 | Bacteria | 9501 |
| 358 | Ga0316181_1075075 | 3300030744 | Bacteria | 2452 |
| 359 | Ga0316181_1158467 | 3300030744 | Bacteria | 2152 |
| 360 | Ga0316182_1280847 | 3300030745 | Bacteria | 2052 |
| 361 | Ga0265330_10000076 | 3300031235 | Bacteria | 84642 |
| 362 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 363 | Ga0265325_10026911 | 3300031241 | Bacteria | 3112 |
| 364 | Ga0307513_10000090 | 3300031456 | Bacteria | 129750 |
| 365 | Ga0307513_10012431 | 3300031456 | Bacteria | 10506 |
| 366 | Ga0307513_10131489 | 3300031456 | Bacteria | 2447 |
| 367 | Ga0307513_10317661 | 3300031456 | Bacteria | 1317 |
| 368 | Ga0307509_10056371 | 3300031507 | Bacteria | 4171 |
| 369 | Ga0307408_100000115 | 3300031548 | Bacteria | 88580 |
| 370 | Ga0307408_100000125 | 3300031548 | Bacteria | 84749 |
| 371 | Ga0307408_100000895 | 3300031548 | Bacteria | 23425 |
| 372 | Ga0307408_100007259 | 3300031548 | Bacteria | 7331 |
| 373 | Ga0307408_100007580 | 3300031548 | Bacteria | 7173 |
| 374 | Ga0307408_100044798 | 3300031548 | Bacteria | 3155 |
| 375 | Ga0265314_10000066 | 3300031711 | Bacteria | 156399 |
| 376 | Ga0265314_10128062 | 3300031711 | Bacteria | 1588 |
| 377 | Ga0316576_10000405 | 3300031727 | Bacteria | 19893 |
| 378 | Ga0307516_10006050 | 3300031730 | Bacteria | 14298 |
| 379 | Ga0307405_10317636 | 3300031731 | Bacteria | 1188 |
| 380 | Ga0307413_10142044 | 3300031824 | Bacteria | 1660 |
| 381 | Ga0307413_10220092 | 3300031824 | Bacteria | 1386 |
| 382 | Ga0307406_10058978 | 3300031901 | Bacteria | 2468 |
| 383 | Ga0307406_10094923 | 3300031901 | Bacteria | 2017 |
| 384 | Ga0307406_10106872 | 3300031901 | Bacteria | 1918 |
| 385 | Ga0307412_10010358 | 3300031911 | Bacteria | 5367 |
| 386 | Ga0307412_10017587 | 3300031911 | Bacteria | 4281 |
| 387 | Ga0307412_10112378 | 3300031911 | Bacteria | 1947 |
| 388 | Ga0307412_10335631 | 3300031911 | Bacteria | 1208 |
| 389 | Ga0307409_100034446 | 3300031995 | Bacteria | 3698 |
| 390 | Ga0307416_100070969 | 3300032002 | Bacteria | 2891 |
| 391 | Ga0307416_100100216 | 3300032002 | Bacteria | 2518 |
| 392 | Ga0307416_100187721 | 3300032002 | Bacteria | 1945 |
| 393 | Ga0307416_100496800 | 3300032002 | Bacteria | 1283 |
| 394 | Ga0307414_10086753 | 3300032004 | Bacteria | 2310 |
| 395 | Ga0307414_10109249 | 3300032004 | Bacteria | 2100 |
| 396 | Ga0307414_10267957 | 3300032004 | Bacteria | 1429 |
| 397 | Ga0307510_10014599 | 3300033180 | Bacteria | 9297 |
| 398 | Ga0373923_0059551 | 3300035111 | Bacteria | 1619 |
| 399 | Ga0373936_0058574 | 3300035113 | Bacteria | 1568 |
| 400 | Ga0373945_0005853 | 3300035116 | Bacteria | 3946 |
| 401 | Ga0373954_0010190 | 3300035118 | Bacteria | 4143 |
| 402 | Ga0373955_0006435 | 3300035172 | Bacteria | 5350 |
| 403 | Ga0373924_0001251 | 3300035410 | Bacteria | 8137 |
| 404 | Ga0373935_0075239 | 3300035692 | Bacteria | 2184 |
| 405 | Ga0373927_0019954 | 3300035695 | Bacteria | 4395 |
| 406 | Ga0373927_0113034 | 3300035695 | Bacteria | 1770 |
| 407 | Ga0373933_0008240 | 3300035724 | Bacteria | 5688 |
| 408 | Ga0373947_0015164 | 3300035725 | Bacteria | 4424 |
| 409 | Ga0373947_0047205 | 3300035725 | Bacteria | 2580 |
| 410 | Ga0373937_0007858 | 3300036401 | Bacteria | 9246 |
| 411 | Ga0373925_0170037 | 3300037068 | Bacteria | 1720 |
| 412 | Ga0373925_0330040 | 3300037068 | Bacteria | 1236 |
| 413 | Ga0395900_0003101 | 3300037418 | Bacteria | 18047 |
| 414 | Ga0237819_04223 | 3300038705 | Bacteria | 2395 |
| 415 | Ga0436361_0324341 | 3300039447 | Bacteria | 73428 |
| 416 | Ga0436361_0729857 | 3300039447 | Bacteria | 22870 |
| 417 | Ga0436361_0922740 | 3300039447 | Bacteria | 2443 |
| 418 | Ga0436361_1103726 | 3300039447 | Bacteria | 27088 |
| 419 | Ga0439438_000117 | 3300041405 | Bacteria | 36333 |
| 420 | Ga0439438_016146 | 3300041405 | Bacteria | 2176 |
| 421 | Ga0439438_018549 | 3300041405 | Bacteria | 1979 |
| 422 | Ga0439447_000258 | 3300041407 | Bacteria | 18640 |
| 423 | Ga0439447_004731 | 3300041407 | Bacteria | 4637 |
| 424 | Ga0439466_0003476 | 3300041411 | Bacteria | 6105 |
| 425 | Ga0439466_0011397 | 3300041411 | Bacteria | 3288 |
| 426 | Ga0439466_0013472 | 3300041411 | Bacteria | 2992 |
| 427 | Ga0439466_0022658 | 3300041411 | Bacteria | 2214 |
| 428 | Ga0439466_0054731 | 3300041411 | Bacteria | 1298 |
| 429 | Ga0451839_1226771 | 3300041496 | Bacteria | 926 |
| 430 | Ga0439431_0041170 | 3300041997 | Bacteria | 1177 |
| 431 | Ga0439432_000381 | 3300042006 | Bacteria | 16378 |
| 432 | Ga0439432_005659 | 3300042006 | Bacteria | 4494 |
| 433 | Ga0439452_000091 | 3300042010 | Bacteria | 78007 |
| 434 | Ga0439452_000164 | 3300042010 | Bacteria | 49561 |
| 435 | Ga0439452_006049 | 3300042010 | Bacteria | 3827 |
| 436 | Ga0439452_009472 | 3300042010 | Bacteria | 2867 |
| 437 | Ga0439452_009980 | 3300042010 | Bacteria | 2777 |
| 438 | Ga0439452_023100 | 3300042010 | Bacteria | 1603 |
| 439 | Ga0439456_005828 | 3300042013 | Bacteria | 2506 |
| 440 | Ga0450911_000746 | 3300042115 | Bacteria | 9346 |
| 441 | Ga0450920_007188 | 3300042122 | Bacteria | 2014 |
| 442 | Ga0450896_003141 | 3300042133 | Bacteria | 2176 |
| 443 | Ga0450902_006117 | 3300042137 | Bacteria | 1836 |
| 444 | Ga0450903_001867 | 3300042138 | Bacteria | 3835 |
| 445 | Ga0450903_002715 | 3300042138 | Bacteria | 3116 |
| 446 | Ga0450904_001840 | 3300042139 | Bacteria | 2756 |
| 447 | Ga0450905_002056 | 3300042142 | Bacteria | 2568 |
| 448 | Ga0450905_012374 | 3300042142 | Bacteria | 1201 |
| 449 | Ga0450906_004872 | 3300042145 | Bacteria | 2791 |
| 450 | Ga0450907_000038 | 3300042146 | Bacteria | 57421 |
| 451 | Ga0450907_001262 | 3300042146 | Bacteria | 5666 |
| 452 | Ga0439446_0005711 | 3300042156 | Bacteria | 3212 |
| 453 | Ga0450909_000970 | 3300042185 | Bacteria | 3925 |
| 454 | Ga0439434_0000146 | 3300042435 | Bacteria | 18978 |
| 455 | Ga0439464_0026399 | 3300042439 | Bacteria | 1611 |
| 456 | Ga0439460_0000739 | 3300042461 | Bacteria | 7319 |
| 457 | Ga0439460_0004830 | 3300042461 | Bacteria | 3293 |
| 458 | Ga0450918_003063 | 3300042531 | Bacteria | 3125 |
| 459 | Ga0450893_0007396 | 3300042532 | Bacteria | 1784 |
| 460 | Ga0450901_001528 | 3300042533 | Bacteria | 2633 |
| 461 | Ga0439440_0000716 | 3300042993 | Bacteria | 5697 |
| 462 | Ga0466986_0214250 | 3300044650 | Bacteria | 1255 |
| 463 | Ga0453683_0071593 | 3300044673 | Bacteria | 2169 |
| 464 | Ga0451576_0007815 | 3300045051 | Bacteria | 12675 |
| 465 | Ga0466967_0019240 | 3300045976 | Bacteria | 5486 |
| 466 | Ga0495617_000309 | 3300046452 | Bacteria | 27418 |
| 467 | Ga0495617_002310 | 3300046452 | Bacteria | 7685 |
| 468 | Ga0495617_015897 | 3300046452 | Bacteria | 2546 |
| 469 | Ga0495617_085817 | 3300046452 | Bacteria | 1029 |
| 470 | Ga0495627_000785 | 3300046453 | Bacteria | 23415 |
| 471 | Ga0495627_002296 | 3300046453 | Bacteria | 9432 |
| 472 | Ga0495627_002700 | 3300046453 | Bacteria | 8295 |
| 473 | Ga0495627_007208 | 3300046453 | Bacteria | 4288 |
| 474 | Ga0495603_0016957 | 3300046455 | Bacteria | 4407 |
| 475 | Ga0495603_0022975 | 3300046455 | Bacteria | 3774 |
| 476 | Ga0495603_0037472 | 3300046455 | Bacteria | 2910 |
| 477 | Ga0495590_0000265 | 3300046457 | Bacteria | 28527 |
| 478 | Ga0495590_0008924 | 3300046457 | Bacteria | 3809 |
| 479 | Ga0495590_0012789 | 3300046457 | Bacteria | 3104 |
| 480 | Ga0495590_0035563 | 3300046457 | Bacteria | 1738 |
| 481 | Ga0495591_000114 | 3300046458 | Bacteria | 93304 |
| 482 | Ga0495591_000445 | 3300046458 | Bacteria | 33637 |
| 483 | Ga0495591_001195 | 3300046458 | Bacteria | 16934 |
| 484 | Ga0495591_004397 | 3300046458 | Bacteria | 6918 |
| 485 | Ga0495591_016254 | 3300046458 | Bacteria | 2599 |
| 486 | Ga0495638_0001380 | 3300046460 | Bacteria | 22144 |
| 487 | Ga0495638_0006818 | 3300046460 | Bacteria | 8245 |
| 488 | Ga0495638_0016469 | 3300046460 | Bacteria | 4951 |
| 489 | Ga0495638_0018041 | 3300046460 | Bacteria | 4695 |
| 490 | Ga0495638_0043694 | 3300046460 | Bacteria | 2825 |
| 491 | Ga0495638_0067457 | 3300046460 | Bacteria | 2196 |
| 492 | Ga0495638_0093891 | 3300046460 | Bacteria | 1803 |
| 493 | Ga0495641_0061637 | 3300046461 | Bacteria | 1693 |
| 494 | Ga0495653_0008254 | 3300046463 | Bacteria | 8536 |
| 495 | Ga0495653_0045047 | 3300046463 | Bacteria | 3421 |
| 496 | Ga0495653_0125903 | 3300046463 | Bacteria | 1820 |
| 497 | Ga0495653_0137805 | 3300046463 | Bacteria | 1719 |
| 498 | Ga0495653_0250158 | 3300046463 | Bacteria | 1176 |
| 499 | Ga0495650_0004067 | 3300046471 | Bacteria | 10231 |
| 500 | Ga0495650_0005308 | 3300046471 | Bacteria | 8427 |
| 501 | Ga0495650_0006574 | 3300046471 | Bacteria | 7224 |
| 502 | Ga0495650_0019510 | 3300046471 | Bacteria | 3333 |
| 503 | Ga0495650_0020296 | 3300046471 | Bacteria | 3243 |
| 504 | Ga0495650_0021261 | 3300046471 | Bacteria | 3142 |
| 505 | Ga0495650_0023776 | 3300046471 | Bacteria | 2909 |
| 506 | Ga0495650_0051426 | 3300046471 | Bacteria | 1697 |
| 507 | Ga0495580_0035117 | 3300046472 | Bacteria | 3605 |
| 508 | Ga0495582_0006023 | 3300046473 | Bacteria | 6760 |
| 509 | Ga0495605_0000309 | 3300046474 | Bacteria | 51425 |
| 510 | Ga0495605_0006838 | 3300046474 | Bacteria | 6517 |
| 511 | Ga0495605_0008079 | 3300046474 | Bacteria | 5955 |
| 512 | Ga0495605_0043267 | 3300046474 | Bacteria | 2233 |
| 513 | Ga0495605_0043460 | 3300046474 | Bacteria | 2227 |
| 514 | Ga0495605_0047189 | 3300046474 | Bacteria | 2113 |
| 515 | Ga0495639_0011124 | 3300046475 | Bacteria | 3878 |
| 516 | Ga0495639_0165555 | 3300046475 | Bacteria | 1072 |
| 517 | Ga0495664_0003593 | 3300046477 | Bacteria | 8456 |
| 518 | Ga0495584_0000217 | 3300046491 | Bacteria | 41596 |
| 519 | Ga0495584_0002031 | 3300046491 | Bacteria | 11633 |
| 520 | Ga0495584_0002563 | 3300046491 | Bacteria | 10249 |
| 521 | Ga0495584_0002853 | 3300046491 | Bacteria | 9652 |
| 522 | Ga0495584_0005652 | 3300046491 | Bacteria | 6608 |
| 523 | Ga0495584_0022627 | 3300046491 | Bacteria | 3188 |
| 524 | Ga0495584_0026694 | 3300046491 | Bacteria | 2926 |
| 525 | Ga0495584_0049159 | 3300046491 | Bacteria | 2125 |
| 526 | Ga0495584_0116231 | 3300046491 | Bacteria | 1354 |
| 527 | Ga0495585_0000228 | 3300046492 | Bacteria | 57922 |
| 528 | Ga0495585_0001137 | 3300046492 | Bacteria | 21805 |
| 529 | Ga0495585_0013961 | 3300046492 | Bacteria | 4690 |
| 530 | Ga0495585_0016331 | 3300046492 | Bacteria | 4301 |
| 531 | Ga0495585_0026568 | 3300046492 | Bacteria | 3307 |
| 532 | Ga0495585_0081529 | 3300046492 | Bacteria | 1752 |
| 533 | Ga0495594_0002102 | 3300046499 | Bacteria | 10368 |
| 534 | Ga0495594_0018587 | 3300046499 | Bacteria | 3684 |
| 535 | Ga0495594_0018919 | 3300046499 | Bacteria | 3655 |
| 536 | Ga0495594_0025710 | 3300046499 | Bacteria | 3165 |
| 537 | Ga0495596_0000107 | 3300046500 | Bacteria | 59095 |
| 538 | Ga0495596_0081682 | 3300046500 | Bacteria | 1255 |
| 539 | Ga0495607_0000159 | 3300046501 | Bacteria | 71580 |
| 540 | Ga0495607_0005431 | 3300046501 | Bacteria | 9129 |
| 541 | Ga0495607_0017665 | 3300046501 | Bacteria | 4571 |
| 542 | Ga0495607_0030429 | 3300046501 | Bacteria | 3314 |
| 543 | Ga0495607_0030914 | 3300046501 | Bacteria | 3281 |
| 544 | Ga0495607_0032508 | 3300046501 | Bacteria | 3183 |
| 545 | Ga0495607_0032518 | 3300046501 | Bacteria | 3183 |
| 546 | Ga0495607_0049590 | 3300046501 | Bacteria | 2447 |
| 547 | Ga0495583_0005717 | 3300046506 | Bacteria | 8349 |
| 548 | Ga0495583_0006667 | 3300046506 | Bacteria | 7486 |
| 549 | Ga0495606_0001649 | 3300046507 | Bacteria | 29053 |
| 550 | Ga0495606_0006186 | 3300046507 | Bacteria | 11140 |
| 551 | Ga0495606_0008665 | 3300046507 | Bacteria | 8769 |
| 552 | Ga0495606_0009531 | 3300046507 | Bacteria | 8199 |
| 553 | Ga0495606_0067050 | 3300046507 | Bacteria | 2273 |
| 554 | Ga0495610_0006283 | 3300046512 | Bacteria | 8226 |
| 555 | Ga0495610_0013703 | 3300046512 | Bacteria | 4802 |
| 556 | Ga0495610_0042373 | 3300046512 | Bacteria | 2277 |
| 557 | Ga0495610_0047414 | 3300046512 | Bacteria | 2113 |
| 558 | Ga0495610_0054393 | 3300046512 | Bacteria | 1934 |
| 559 | Ga0495610_0066359 | 3300046512 | Bacteria | 1699 |
| 560 | Ga0495616_0000784 | 3300046513 | Bacteria | 23206 |
| 561 | Ga0495616_0001395 | 3300046513 | Bacteria | 16838 |
| 562 | Ga0495616_0007013 | 3300046513 | Bacteria | 6780 |
| 563 | Ga0495616_0010643 | 3300046513 | Bacteria | 5314 |
| 564 | Ga0495616_0061958 | 3300046513 | Bacteria | 1833 |
| 565 | Ga0495616_0078062 | 3300046513 | Bacteria | 1588 |
| 566 | Ga0495618_0010007 | 3300046514 | Bacteria | 5735 |
| 567 | Ga0495620_0003338 | 3300046515 | Bacteria | 9208 |
| 568 | Ga0495620_0011242 | 3300046515 | Bacteria | 4677 |
| 569 | Ga0495620_0020374 | 3300046515 | Bacteria | 3239 |
| 570 | Ga0495628_0147763 | 3300046516 | Bacteria | 1791 |
| 571 | Ga0495628_0164081 | 3300046516 | Bacteria | 1687 |
| 572 | Ga0495630_0013745 | 3300046517 | Bacteria | 5887 |
| 573 | Ga0495630_0041268 | 3300046517 | Bacteria | 3445 |
| 574 | Ga0495631_0000020 | 3300046518 | Bacteria | 92958 |
| 575 | Ga0495631_0001259 | 3300046518 | Bacteria | 15668 |
| 576 | Ga0495631_0012134 | 3300046518 | Bacteria | 4218 |
| 577 | Ga0495631_0021789 | 3300046518 | Bacteria | 2982 |
| 578 | Ga0495632_0000436 | 3300046519 | Bacteria | 39746 |
| 579 | Ga0495632_0000587 | 3300046519 | Bacteria | 33746 |
| 580 | Ga0495632_0009113 | 3300046519 | Bacteria | 6003 |
| 581 | Ga0495632_0036455 | 3300046519 | Bacteria | 2501 |
| 582 | Ga0495632_0043736 | 3300046519 | Bacteria | 2237 |
| 583 | Ga0495632_0066478 | 3300046519 | Bacteria | 1739 |
| 584 | Ga0495637_0000447 | 3300046520 | Bacteria | 30138 |
| 585 | Ga0495637_0003645 | 3300046520 | Bacteria | 8157 |
| 586 | Ga0495637_0010835 | 3300046520 | Bacteria | 4394 |
| 587 | Ga0495637_0011026 | 3300046520 | Bacteria | 4353 |
| 588 | Ga0495637_0013087 | 3300046520 | Bacteria | 3947 |
| 589 | Ga0495637_0017482 | 3300046520 | Bacteria | 3340 |
| 590 | Ga0495637_0017509 | 3300046520 | Bacteria | 3336 |
| 591 | Ga0495637_0025356 | 3300046520 | Bacteria | 2672 |
| 592 | Ga0495637_0034713 | 3300046520 | Bacteria | 2206 |
| 593 | Ga0495643_0013102 | 3300046522 | Bacteria | 4979 |
| 594 | Ga0495643_0013270 | 3300046522 | Bacteria | 4937 |
| 595 | Ga0495643_0026473 | 3300046522 | Bacteria | 3273 |
| 596 | Ga0495643_0051925 | 3300046522 | Bacteria | 2203 |
| 597 | Ga0495644_0001885 | 3300046523 | Bacteria | 8443 |
| 598 | Ga0495644_0002346 | 3300046523 | Bacteria | 7547 |
| 599 | Ga0495644_0007004 | 3300046523 | Bacteria | 4362 |
| 600 | Ga0495644_0017843 | 3300046523 | Bacteria | 2711 |
| 601 | Ga0495648_0002549 | 3300046524 | Bacteria | 16696 |
| 602 | Ga0495648_0003472 | 3300046524 | Bacteria | 13848 |
| 603 | Ga0495648_0005540 | 3300046524 | Bacteria | 10471 |
| 604 | Ga0495648_0036039 | 3300046524 | Bacteria | 3199 |
| 605 | Ga0495648_0058583 | 3300046524 | Bacteria | 2302 |
| 606 | Ga0495648_0058762 | 3300046524 | Bacteria | 2297 |
| 607 | Ga0495648_0114056 | 3300046524 | Bacteria | 1464 |
| 608 | Ga0495648_0148613 | 3300046524 | Bacteria | 1224 |
| 609 | Ga0495666_0007185 | 3300046526 | Bacteria | 5590 |
| 610 | Ga0495666_0050335 | 3300046526 | Bacteria | 2002 |
| 611 | Ga0495666_0115221 | 3300046526 | Bacteria | 1261 |
| 612 | Ga0495642_0000033 | 3300046528 | Bacteria | 85849 |
| 613 | Ga0495642_0003997 | 3300046528 | Bacteria | 5762 |
| 614 | Ga0495642_0007333 | 3300046528 | Bacteria | 4232 |
| 615 | Ga0495642_0012253 | 3300046528 | Bacteria | 3304 |
| 616 | Ga0495654_0000324 | 3300046530 | Bacteria | 41969 |
| 617 | Ga0495654_0001457 | 3300046530 | Bacteria | 16202 |
| 618 | Ga0495654_0002179 | 3300046530 | Bacteria | 12729 |
| 619 | Ga0495654_0002442 | 3300046530 | Bacteria | 11957 |
| 620 | Ga0495654_0018170 | 3300046530 | Bacteria | 3688 |
| 621 | Ga0495654_0023880 | 3300046530 | Bacteria | 3163 |
| 622 | Ga0495654_0029567 | 3300046530 | Bacteria | 2793 |
| 623 | Ga0495654_0048816 | 3300046530 | Bacteria | 2075 |
| 624 | Ga0495654_0062265 | 3300046530 | Bacteria | 1789 |
| 625 | Ga0495654_0145907 | 3300046530 | Bacteria | 1050 |
| 626 | Ga0495665_0011303 | 3300046531 | Bacteria | 4831 |
| 627 | Ga0495640_0022970 | 3300046533 | Bacteria | 4554 |
| 628 | Ga0495586_0006584 | 3300046535 | Bacteria | 6207 |
| 629 | Ga0495587_0003070 | 3300046536 | Bacteria | 11155 |
| 630 | Ga0495587_0009581 | 3300046536 | Bacteria | 6200 |
| 631 | Ga0495609_0000405 | 3300046538 | Bacteria | 36116 |
| 632 | Ga0495609_0020986 | 3300046538 | Bacteria | 3014 |
| 633 | Ga0495609_0033359 | 3300046538 | Bacteria | 2337 |
| 634 | Ga0495597_0011731 | 3300046542 | Bacteria | 4244 |
| 635 | Ga0495597_0016052 | 3300046542 | Bacteria | 3540 |
| 636 | Ga0495597_0018166 | 3300046542 | Bacteria | 3302 |
| 637 | Ga0495597_0032715 | 3300046542 | Bacteria | 2358 |
| 638 | Ga0495597_0043568 | 3300046542 | Bacteria | 1998 |
| 639 | Ga0495645_0098176 | 3300046543 | Bacteria | 2085 |
| 640 | Ga0495622_0000775 | 3300046557 | Bacteria | 17829 |
| 641 | Ga0495622_0001094 | 3300046557 | Bacteria | 14169 |
| 642 | Ga0495622_0002578 | 3300046557 | Bacteria | 8749 |
| 643 | Ga0495622_0005904 | 3300046557 | Bacteria | 5686 |
| 644 | Ga0495622_0006370 | 3300046557 | Bacteria | 5479 |
| 645 | Ga0495622_0059423 | 3300046557 | Bacteria | 1770 |
| 646 | Ga0495622_0086941 | 3300046557 | Bacteria | 1437 |
| 647 | Ga0495633_0001444 | 3300046558 | Bacteria | 18478 |
| 648 | Ga0495633_0003372 | 3300046558 | Bacteria | 10700 |
| 649 | Ga0495633_0003895 | 3300046558 | Bacteria | 9734 |
| 650 | Ga0495633_0023821 | 3300046558 | Bacteria | 3030 |
| 651 | Ga0495668_0000568 | 3300046616 | Bacteria | 45426 |
| 652 | Ga0495668_0012847 | 3300046616 | Bacteria | 4959 |
| 653 | Ga0495668_0020910 | 3300046616 | Bacteria | 3758 |
| 654 | Ga0495634_0096292 | 3300046642 | Bacteria | 1916 |
| 655 | Ga0495611_0004442 | 3300046648 | Bacteria | 6071 |
| 656 | Ga0495611_0013170 | 3300046648 | Bacteria | 3518 |
| 657 | Ga0495625_0000136 | 3300046660 | Bacteria | 114576 |
| 658 | Ga0495625_0013373 | 3300046660 | Bacteria | 6596 |
| 659 | Ga0495625_0021444 | 3300046660 | Bacteria | 4976 |
| 660 | Ga0495625_0026162 | 3300046660 | Bacteria | 4412 |
| 661 | Ga0495625_0043881 | 3300046660 | Bacteria | 3240 |
| 662 | Ga0495625_0061946 | 3300046660 | Bacteria | 2645 |
| 663 | Ga0495625_0203618 | 3300046660 | Bacteria | 1304 |
| 664 | Ga0495635_0000856 | 3300046663 | Bacteria | 19937 |
| 665 | Ga0495635_0003406 | 3300046663 | Bacteria | 10990 |
| 666 | Ga0495635_0028386 | 3300046663 | Bacteria | 3889 |
| 667 | Ga0495659_0008916 | 3300046664 | Bacteria | 3195 |
| 668 | Ga0495661_0001179 | 3300046665 | Bacteria | 22716 |
| 669 | Ga0495661_0001607 | 3300046665 | Bacteria | 18526 |
| 670 | Ga0495661_0014015 | 3300046665 | Bacteria | 5374 |
| 671 | Ga0495661_0014963 | 3300046665 | Bacteria | 5186 |
| 672 | Ga0495661_0125253 | 3300046665 | Bacteria | 1414 |
| 673 | Ga0495588_0020285 | 3300046674 | Bacteria | 3264 |
| 674 | Ga0495588_0065219 | 3300046674 | Bacteria | 1889 |
| 675 | Ga0495657_0117295 | 3300046675 | Bacteria | 1680 |
| 676 | Ga0495623_0011490 | 3300046679 | Bacteria | 5732 |
| 677 | Ga0495646_0044646 | 3300046680 | Bacteria | 2709 |
| 678 | Ga0495658_0003833 | 3300046683 | Bacteria | 7442 |
| 679 | Ga0495669_0032844 | 3300046684 | Bacteria | 2282 |
| 680 | Ga0495613_0012404 | 3300046689 | Bacteria | 6333 |
| 681 | Ga0495624_0099652 | 3300046690 | Bacteria | 1789 |
| 682 | Ga0495670_0000548 | 3300046691 | Bacteria | 17887 |
| 683 | Ga0495670_0001711 | 3300046691 | Bacteria | 10798 |
| 684 | Ga0495670_0020139 | 3300046691 | Bacteria | 3288 |
| 685 | Ga0495670_0057332 | 3300046691 | Bacteria | 1955 |
| 686 | Ga0495670_0069267 | 3300046691 | Bacteria | 1783 |
| 687 | Ga0495670_0069573 | 3300046691 | Bacteria | 1780 |
| 688 | Ga0495670_0073397 | 3300046691 | Bacteria | 1734 |
| 689 | Ga0495671_0004328 | 3300046692 | Bacteria | 8529 |
| 690 | Ga0495671_0004525 | 3300046692 | Bacteria | 8290 |
| 691 | Ga0495671_0036458 | 3300046692 | Bacteria | 2490 |
| 692 | Ga0495671_0040446 | 3300046692 | Bacteria | 2351 |
| 693 | Ga0495671_0064534 | 3300046692 | Bacteria | 1802 |
| 694 | Ga0495671_0072438 | 3300046692 | Bacteria | 1691 |
| 695 | Ga0495671_0129869 | 3300046692 | Bacteria | 1228 |
| 696 | Ga0495649_0000201 | 3300046694 | Bacteria | 53035 |
| 697 | Ga0495649_0005892 | 3300046694 | Bacteria | 7691 |
| 698 | Ga0495649_0043434 | 3300046694 | Bacteria | 2453 |
| 699 | Ga0495649_0072974 | 3300046694 | Bacteria | 1839 |
| 700 | Ga0495649_0202439 | 3300046694 | Bacteria | 1030 |
| 701 | Ga0495589_0014529 | 3300046794 | Bacteria | 4052 |
| 702 | Ga0495589_0014663 | 3300046794 | Bacteria | 4032 |
| 703 | Ga0495589_0015429 | 3300046794 | Bacteria | 3931 |
| 704 | Ga0495589_0048323 | 3300046794 | Bacteria | 2106 |
| 705 | Ga0495600_0019348 | 3300046809 | Bacteria | 4347 |
| 706 | Ga0495600_0076451 | 3300046809 | Bacteria | 2186 |
| 707 | Ga0495660_0002421 | 3300046810 | Bacteria | 11890 |
| 708 | Ga0495660_0007901 | 3300046810 | Bacteria | 6246 |
| 709 | Ga0495660_0009749 | 3300046810 | Bacteria | 5596 |
| 710 | Ga0495660_0010336 | 3300046810 | Bacteria | 5426 |
| 711 | Ga0495660_0010495 | 3300046810 | Bacteria | 5388 |
| 712 | Ga0495660_0029941 | 3300046810 | Bacteria | 3068 |
| 713 | Ga0495660_0047141 | 3300046810 | Bacteria | 2361 |
| 714 | Ga0495660_0058609 | 3300046810 | Bacteria | 2073 |
| 715 | Ga0495660_0065298 | 3300046810 | Bacteria | 1943 |
| 716 | Ga0495660_0085028 | 3300046810 | Bacteria | 1653 |
| 717 | Ga0495660_0116418 | 3300046810 | Bacteria | 1358 |
| 718 | Ga0495660_0142719 | 3300046810 | Bacteria | 1189 |
| 719 | Ga0495604_0006513 | 3300047317 | Bacteria | 9253 |
| 720 | Ga0495604_0034282 | 3300047317 | Bacteria | 4016 |
| 721 | Ga0495604_0049990 | 3300047317 | Bacteria | 3247 |
| 722 | Ga0495604_0178343 | 3300047317 | Bacteria | 1488 |
| 723 | Ga0495636_0018420 | 3300047318 | Bacteria | 2801 |
| 724 | Ga0495636_0082294 | 3300047318 | Bacteria | 1388 |
| 725 | Ga0495674_0046526 | 3300047319 | Bacteria | 3850 |
| 726 | Ga0495672_0000540 | 3300047320 | Bacteria | 42937 |
| 727 | Ga0495672_0001849 | 3300047320 | Bacteria | 20188 |
| 728 | Ga0495672_0010364 | 3300047320 | Bacteria | 6650 |
| 729 | Ga0495672_0013564 | 3300047320 | Bacteria | 5616 |
| 730 | Ga0495672_0016147 | 3300047320 | Bacteria | 5044 |
| 731 | Ga0495672_0016365 | 3300047320 | Bacteria | 5000 |
| 732 | Ga0495672_0045374 | 3300047320 | Bacteria | 2629 |
| 733 | Ga0495672_0097133 | 3300047320 | Bacteria | 1605 |
| 734 | Ga0495672_0124929 | 3300047320 | Bacteria | 1362 |
| 735 | Ga0495676_0004979 | 3300047321 | Bacteria | 12178 |
| 736 | Ga0495680_0003260 | 3300047322 | Bacteria | 16097 |
| 737 | Ga0495680_0003948 | 3300047322 | Bacteria | 14338 |
| 738 | Ga0495680_0046655 | 3300047322 | Bacteria | 3414 |
| 739 | Ga0495683_0000085 | 3300047323 | Bacteria | 93009 |
| 740 | Ga0495683_0124330 | 3300047323 | Bacteria | 1221 |
| 741 | Ga0495683_0162291 | 3300047323 | Bacteria | 1032 |
| 742 | Ga0495687_000375 | 3300047443 | Bacteria | 55715 |
| 743 | Ga0495687_001884 | 3300047443 | Bacteria | 18100 |
| 744 | Ga0495675_0001382 | 3300047444 | Bacteria | 14712 |
| 745 | Ga0495675_0058267 | 3300047444 | Bacteria | 2449 |
| 746 | Ga0495677_0001038 | 3300047445 | Bacteria | 11154 |
| 747 | Ga0495677_0002605 | 3300047445 | Bacteria | 7054 |
| 748 | Ga0495677_0004443 | 3300047445 | Bacteria | 5385 |
| 749 | Ga0495679_030866 | 3300047446 | Bacteria | 1735 |
| 750 | Ga0495673_0000297 | 3300047469 | Bacteria | 66473 |
| 751 | Ga0495673_0000345 | 3300047469 | Bacteria | 58540 |
| 752 | Ga0495673_0000577 | 3300047469 | Bacteria | 36890 |
| 753 | Ga0495673_0005101 | 3300047469 | Bacteria | 8024 |
| 754 | Ga0495673_0007357 | 3300047469 | Bacteria | 6344 |
| 755 | Ga0495673_0012094 | 3300047469 | Bacteria | 4597 |
| 756 | Ga0495673_0013919 | 3300047469 | Bacteria | 4203 |
| 757 | Ga0495673_0038701 | 3300047469 | Bacteria | 2167 |
| 758 | Ga0495673_0039727 | 3300047469 | Bacteria | 2133 |
| 759 | Ga0495673_0065497 | 3300047469 | Bacteria | 1542 |
| 760 | Ga0495673_0089498 | 3300047469 | Bacteria | 1260 |
| 761 | Ga0495681_0000172 | 3300047470 | Bacteria | 54252 |
| 762 | Ga0495681_0000226 | 3300047470 | Bacteria | 47165 |
| 763 | Ga0495681_0000417 | 3300047470 | Bacteria | 32683 |
| 764 | Ga0495681_0000424 | 3300047470 | Bacteria | 32445 |
| 765 | Ga0495681_0000712 | 3300047470 | Bacteria | 25445 |
| 766 | Ga0495681_0002398 | 3300047470 | Bacteria | 13412 |
| 767 | Ga0495681_0012211 | 3300047470 | Bacteria | 5061 |
| 768 | Ga0495681_0034229 | 3300047470 | Bacteria | 2533 |
| 769 | Ga0495681_0051051 | 3300047470 | Bacteria | 1946 |
| 770 | Ga0495681_0061101 | 3300047470 | Bacteria | 1736 |
| 771 | Ga0495684_0028703 | 3300047471 | Bacteria | 4271 |
| 772 | Ga0495684_0045663 | 3300047471 | Bacteria | 3352 |
| 773 | Ga0495686_0003384 | 3300047472 | Bacteria | 13884 |
| 774 | Ga0495686_0229627 | 3300047472 | Bacteria | 1051 |
| 775 | Ga0495593_0011535 | 3300047673 | Bacteria | 5073 |
| 776 | Ga0495593_0034702 | 3300047673 | Bacteria | 2742 |
| 777 | Ga0495593_0035820 | 3300047673 | Bacteria | 2692 |
| 778 | Ga0495626_0000144 | 3300048091 | Bacteria | 89793 |
| 779 | Ga0495626_0000179 | 3300048091 | Bacteria | 77215 |
| 780 | Ga0495626_0000438 | 3300048091 | Bacteria | 42557 |
| 781 | Ga0495626_0020622 | 3300048091 | Bacteria | 3280 |
| 782 | Ga0495626_0021905 | 3300048091 | Bacteria | 3162 |
| 783 | Ga0495626_0044408 | 3300048091 | Bacteria | 2079 |
| 784 | Ga0495626_0099083 | 3300048091 | Bacteria | 1272 |
| 785 | Ga0496100_0039534 | 3300048903 | Bacteria | 2996 |
| 786 | Ga0496102_0000250 | 3300048905 | Bacteria | 70330 |
| 787 | Ga0496102_0043415 | 3300048905 | Bacteria | 4077 |
| 788 | Ga0496102_0046823 | 3300048905 | Bacteria | 3929 |
| 789 | Ga0496103_0027072 | 3300048906 | Bacteria | 3472 |
| 790 | Ga0496103_0155478 | 3300048906 | Bacteria | 1466 |
| 791 | Ga0496104_0263217 | 3300048907 | Bacteria | 1637 |
| 792 | Ga0496107_0105378 | 3300048910 | Bacteria | 2070 |
| 793 | Ga0496107_0229517 | 3300048910 | Bacteria | 1381 |
| 794 | Ga0496108_0022509 | 3300048911 | Bacteria | 5182 |
| 795 | Ga0496108_0527904 | 3300048911 | Bacteria | 1030 |
| 796 | Ga0496109_0100476 | 3300048912 | Bacteria | 2684 |
| 797 | Ga0496110_0012489 | 3300048913 | Bacteria | 6985 |
| 798 | Ga0496110_0022038 | 3300048913 | Bacteria | 5403 |
| 799 | Ga0496110_0094803 | 3300048913 | Bacteria | 2672 |
| 800 | Ga0496110_0104736 | 3300048913 | Bacteria | 2538 |
| 801 | Ga0496111_0027774 | 3300048914 | Bacteria | 4007 |
| 802 | Ga0496111_0211677 | 3300048914 | Bacteria | 1440 |
| 803 | Ga0496112_0005803 | 3300048915 | Bacteria | 10741 |
| 804 | Ga0496112_0332422 | 3300048915 | Bacteria | 1463 |
| 805 | Ga0496112_0345770 | 3300048915 | Bacteria | 1430 |
| 806 | Ga0496113_0244440 | 3300048916 | Bacteria | 1432 |
| 807 | Ga0496113_0246514 | 3300048916 | Bacteria | 1426 |
| 808 | Ga0496115_0197030 | 3300048918 | Bacteria | 1664 |
| 809 | Ga0496116_0000419 | 3300048919 | Bacteria | 60095 |
| 810 | Ga0496116_0028683 | 3300048919 | Bacteria | 4027 |
| 811 | Ga0496117_0008975 | 3300048920 | Bacteria | 9409 |
| 812 | Ga0496117_0030791 | 3300048920 | Bacteria | 4108 |
| 813 | Ga0496117_0229163 | 3300048920 | Bacteria | 1028 |
| 814 | Ga0496118_0013091 | 3300048921 | Bacteria | 7883 |
| 815 | Ga0496118_0019329 | 3300048921 | Bacteria | 6091 |
| 816 | Ga0496118_0137412 | 3300048921 | Bacteria | 1557 |
| 817 | Ga0496119_0028027 | 3300048922 | Bacteria | 3856 |
| 818 | Ga0496120_0005937 | 3300048923 | Bacteria | 9521 |
| 819 | Ga0496121_0183166 | 3300048924 | Bacteria | 1509 |
| 820 | Ga0496121_0210687 | 3300048924 | Bacteria | 1377 |
| 821 | Ga0496121_0297573 | 3300048924 | Bacteria | 1096 |
| 822 | Ga0496122_0114392 | 3300048925 | Bacteria | 1760 |
| 823 | Ga0496124_0009971 | 3300048927 | Bacteria | 9705 |
| 824 | Ga0496125_0001730 | 3300048928 | Bacteria | 30353 |
| 825 | Ga0496125_0003106 | 3300048928 | Bacteria | 20687 |
| 826 | Ga0496125_0010260 | 3300048928 | Bacteria | 9486 |
| 827 | Ga0496125_0011702 | 3300048928 | Bacteria | 8751 |
| 828 | Ga0496125_0050011 | 3300048928 | Bacteria | 3466 |
| 829 | Ga0496126_0039481 | 3300048929 | Bacteria | 4379 |
| 830 | Ga0496126_0169059 | 3300048929 | Bacteria | 1864 |
| 831 | Ga0496126_0275732 | 3300048929 | Bacteria | 1394 |
| 832 | Ga0496126_0420511 | 3300048929 | Bacteria | 1080 |
| 833 | Ga0495678_001726 | 3300049459 | Bacteria | 16327 |
| 834 | Ga0495678_001732 | 3300049459 | Bacteria | 16267 |
| 835 | Ga0495678_015989 | 3300049459 | Bacteria | 3444 |
| 836 | Ga0495678_016124 | 3300049459 | Bacteria | 3425 |
| 837 | Ga0495678_018095 | 3300049459 | Bacteria | 3176 |
| 838 | Ga0495678_018346 | 3300049459 | Bacteria | 3148 |
| 839 | Ga0495678_021073 | 3300049459 | Bacteria | 2875 |
| 840 | Ga0495678_066493 | 3300049459 | Bacteria | 1334 |
| 841 | Ga0495682_0001278 | 3300049460 | Bacteria | 14087 |
| 842 | Ga0495682_0007549 | 3300049460 | Bacteria | 4318 |
| 843 | Ga0495682_0013091 | 3300049460 | Bacteria | 3162 |
| 844 | Ga0495682_0013912 | 3300049460 | Bacteria | 3055 |
| 845 | Ga0501031_0007292 | 3300049568 | Bacteria | 7215 |
| 846 | Ga0501032_0072629 | 3300049569 | Bacteria | 2293 |
| 847 | Ga0501033_0037192 | 3300049570 | Bacteria | 3644 |
| 848 | Ga0501034_0120934 | 3300049571 | Bacteria | 2605 |
| 849 | Ga0501036_0156729 | 3300049572 | Bacteria | 1920 |
| 850 | Ga0501037_0080718 | 3300049573 | Bacteria | 2359 |
| 851 | Ga0501037_0234080 | 3300049573 | Bacteria | 1289 |
| 852 | Ga0501038_0005074 | 3300049574 | Bacteria | 12237 |
| 853 | Ga0501040_0075908 | 3300049576 | Bacteria | 2323 |
| 854 | Ga0501042_0168276 | 3300049578 | Bacteria | 1582 |
| 855 | Ga0501043_0000149 | 3300049579 | Bacteria | 65122 |
| 856 | Ga0501043_0034884 | 3300049579 | Bacteria | 3957 |
| 857 | Ga0501043_0054276 | 3300049579 | Bacteria | 3147 |
| 858 | Ga0501046_0000092 | 3300049580 | Bacteria | 97456 |
| 859 | Ga0501046_0121347 | 3300049580 | Bacteria | 1988 |
| 860 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 861 | Ga0501048_0000097 | 3300049582 | Bacteria | 47728 |
| 862 | Ga0501070_0069393 | 3300049586 | Bacteria | 2918 |
| 863 | Ga0501070_0158999 | 3300049586 | Bacteria | 1863 |
| 864 | Ga0501072_0238505 | 3300049588 | Bacteria | 1448 |
| 865 | Ga0501073_0252941 | 3300049589 | Bacteria | 1216 |
| 866 | Ga0501076_0396444 | 3300049592 | Bacteria | 1135 |
| 867 | Ga0501077_0144400 | 3300049593 | Bacteria | 1510 |
| 868 | Ga0501080_0211330 | 3300049742 | Bacteria | 1778 |
| 869 | Ga0501083_0005855 | 3300049744 | Bacteria | 8701 |
| 870 | Ga0501083_0107195 | 3300049744 | Bacteria | 1839 |
| 871 | Ga0501265_000611 | 3300049762 | Bacteria | 3847 |
| 872 | Ga0501281_02594 | 3300049777 | Bacteria | 1315 |
| 873 | Ga0501035_0000097 | 3300049822 | Bacteria | 110207 |
| 874 | Ga0501035_0034336 | 3300049822 | Bacteria | 4609 |
| 875 | Ga0501035_0212764 | 3300049822 | Bacteria | 1653 |
| 876 | Ga0501044_0115660 | 3300049823 | Bacteria | 2688 |
| 877 | Ga0501044_0290128 | 3300049823 | Bacteria | 1568 |
| 878 | Ga0501045_0084677 | 3300049824 | Bacteria | 2339 |
| 879 | nmdc:mga03683_15819_c2 | 3300050489 | Bacteria | 1698 |
| 880 | nmdc:mga03683_53059_c1 | 3300050489 | Bacteria | 1696 |
| 881 | nmdc:mga03n38_142688_c1 | 3300050490 | Bacteria | 1198 |
| 882 | nmdc:mga0yw44_24540_c1 | 3300050492 | Bacteria | 3414 |
| 883 | nmdc:mga0yw44_41142_c1 | 3300050492 | Bacteria | 2749 |
| 884 | nmdc:mga0yw44_69585_c1 | 3300050492 | Bacteria | 2180 |
| 885 | nmdc:mga06z11_51548_c1 | 3300050494 | Bacteria | 2107 |
| 886 | nmdc:mga07m45_7849_c1 | 3300050496 | Bacteria | 5462 |
| 887 | nmdc:mga0qj67_161599_c1 | 3300050509 | Bacteria | 1818 |
| 888 | nmdc:mga0qj67_37313_c1 | 3300050509 | Bacteria | 3806 |
| 889 | nmdc:mga06r32_38471_c1 | 3300050510 | Bacteria | 4533 |
| 890 | nmdc:mga08y16_31386_c1 | 3300050511 | Bacteria | 5587 |
| 891 | nmdc:mga0rr50_28353_c1 | 3300050513 | Bacteria | 3935 |
| 892 | nmdc:mga08x19_4_c1 | 3300050514 | Bacteria | 335979 |
| 893 | Ga0495601_0020874 | 3300053077 | Bacteria | 4005 |
| 894 | Ga0495612_0015318 | 3300053078 | Bacteria | 3074 |
| 895 | Ga0495612_0106840 | 3300053078 | Bacteria | 1196 |
| 896 | Ga0500610_0000333 | 3300053079 | Bacteria | 14189 |
| 897 | Ga0500643_000040 | 3300053087 | Bacteria | 168108 |
| 898 | Ga0500583_0006833 | 3300053092 | Bacteria | 3961 |
| 899 | Ga0500555_018422 | 3300053103 | Bacteria | 2013 |
| 900 | Ga0500556_0021194 | 3300053104 | Bacteria | 2091 |
| 901 | Ga0500562_002163 | 3300053108 | Bacteria | 4910 |
| 902 | Ga0500595_005376 | 3300053119 | Bacteria | 5602 |
| 903 | Ga0500642_0158907 | 3300053130 | Bacteria | 1060 |
| 904 | Ga0500658_0000447 | 3300053134 | Bacteria | 17605 |
| 905 | Ga0500658_0005140 | 3300053134 | Bacteria | 4872 |
| 906 | Ga0500658_0027236 | 3300053134 | Bacteria | 2208 |
| 907 | Ga0500561_0023655 | 3300053137 | Bacteria | 1475 |
| 908 | Ga0500568_0000920 | 3300053139 | Bacteria | 20303 |
| 909 | Ga0500577_0074452 | 3300053142 | Bacteria | 1339 |
| 910 | Ga0500589_140658 | 3300053147 | Bacteria | 995 |
| 911 | Ga0500616_0014979 | 3300053153 | Bacteria | 4444 |
| 912 | Ga0500622_0019177 | 3300053156 | Bacteria | 3633 |
| 913 | Ga0500627_0072984 | 3300053158 | Bacteria | 1522 |
| 914 | Ga0500633_0059167 | 3300053160 | Bacteria | 1344 |
| 915 | Ga0500634_0001992 | 3300053161 | Bacteria | 8359 |
| 916 | Ga0500634_0130047 | 3300053161 | Bacteria | 1210 |
| 917 | Ga0500639_029469 | 3300053163 | Bacteria | 2902 |
| 918 | Ga0500637_0010068 | 3300053178 | Bacteria | 4839 |
| 919 | Ga0500637_0093025 | 3300053178 | Bacteria | 1747 |
| 920 | Ga0500609_012070 | 3300053731 | Bacteria | 1169 |
| 921 | Ga0501084_0017222 | 3300054114 | Bacteria | 6002 |
| 922 | Ga0501084_0046041 | 3300054114 | Bacteria | 3653 |
| 923 | Ga0501082_0032761 | 3300060353 | Bacteria | 4483 |
| 924 | Ga0501082_0208887 | 3300060353 | Bacteria | 1698 |
| 925 | Ga0530510_0028461 | 3300061734 | Bacteria | 4007 |
| 926 | 2511243504 | 2511231002 | Bacteria | 5042903 |
| 927 | 2511275771 | 2511231008 | Bacteria | 6624100 |
| 928 | 2511290624 | 2511231010 | Bacteria | 6373152 |
| 929 | 2511298313 | 2511231011 | Bacteria | 6149768 |
| 930 | 2511301050 | 2511231012 | Bacteria | 6738011 |
| 931 | 2511315667 | 2511231014 | Bacteria | 6462302 |
| 932 | 2511326136 | 2511231016 | Bacteria | 6704427 |
| 933 | 2511333948 | 2511231017 | Bacteria | 6503007 |
| 934 | 2511338989 | 2511231018 | Bacteria | 6436256 |
| 935 | 2511347207 | 2511231019 | Bacteria | 6520662 |
| 936 | 2511349875 | 2511231020 | Bacteria | 6115223 |
| 937 | 2511357812 | 2511231021 | Bacteria | 7302637 |
| 938 | 2511372340 | 2511231023 | Bacteria | 6808468 |
| 939 | 2548499305 | 2547132374 | Bacteria | 5530232 |
| 940 | 2597032611 | 2596583598 | Bacteria | 5251611 |
| 941 | 2597865080 | 2597489888 | Bacteria | 6179543 |
| 942 | 2599400207 | 2599185167 | Bacteria | 6353609 |
| 943 | 2599447286 | 2599185178 | Bacteria | 5365746 |
| 944 | 2599451463 | 2599185179 | Bacteria | 6611171 |
| 945 | 2599509428 | 2599185189 | Bacteria | 5862825 |
| 946 | 2599512635 | 2599185190 | Bacteria | 6285678 |
| 947 | 2599519986 | 2599185191 | Bacteria | 6297582 |
| 948 | 2599891311 | 2599185290 | Bacteria | 6289611 |
| 949 | 2601689661 | 2600255296 | Bacteria | 5784754 |
| 950 | 2601796206 | 2600255318 | Bacteria | 6383414 |
| 951 | 2606073355 | 2603880185 | Bacteria | 6379190 |
| 952 | 2606126999 | 2603880199 | Bacteria | 6377649 |
| 953 | 2624481855 | 2623620443 | Bacteria | 6427864 |
| 954 | 2643789931 | 2643221554 | Bacteria | 6603920 |
| 955 | 2643845557 | 2643221565 | Bacteria | 6216018 |
| 956 | 2643866137 | 2643221570 | Bacteria | 5103772 |
| 957 | 2643874319 | 2643221571 | Bacteria | 6228673 |
| 958 | 2643956432 | 2643221589 | Bacteria | 6250934 |
| 959 | 2643994126 | 2643221596 | Bacteria | 5006805 |
| 960 | 2644025526 | 2643221602 | Bacteria | 6249926 |
| 961 | 2644160903 | 2643221628 | Bacteria | 5745828 |
| 962 | 2644187401 | 2643221633 | Bacteria | 6733554 |
| 963 | 2644214349 | 2643221638 | Bacteria | 6579467 |
| 964 | 2644292951 | 2643221652 | Bacteria | 5140275 |
| 965 | 2644621915 | 2643221713 | Bacteria | 6554480 |
| 966 | 2644647967 | 2643221717 | Bacteria | 5676132 |
| 967 | 2677899868 | 2675903420 | Bacteria | 6247433 |
| 968 | 2715751158 | 2713897148 | Bacteria | 5883533 |
| 969 | 2715758158 | 2713897149 | Bacteria | 6506249 |
| 970 | 2718635104 | 2718217725 | Bacteria | 5758958 |
| 971 | 2723249833 | 2721755607 | Bacteria | 5841722 |
| 972 | 2739201896 | 2738543004 | Bacteria | 6381073 |
| 973 | 2739259302 | 2738543015 | Bacteria | 6750701 |
| 974 | 2739314133 | 2738543025 | Bacteria | 6600348 |
| 975 | 2774123380 | 2773857670 | Bacteria | 6407454 |
| 976 | 2774132763 | 2773857673 | Bacteria | 6513460 |
| 977 | 2784263423 | 2784132063 | Bacteria | 6262788 |
| 978 | 2784316078 | 2784132072 | Bacteria | 6596533 |
| 979 | 2792837547 | 2791355137 | Bacteria | 9654227 |
| 980 | 2808930548 | 2808606377 | Bacteria | 6646337 |
| 981 | 2808952670 | 2808606381 | Bacteria | 6646461 |
| 982 | 2808957335 | 2808606382 | Bacteria | 6841132 |
| 983 | 2808977790 | 2808606385 | Bacteria | 6711065 |
| 984 | 2808993270 | 2808606388 | Bacteria | 6706662 |
| 985 | 2809218709 | 2808606445 | Bacteria | 6057339 |
| 986 | 2819655598 | 2818991456 | Bacteria | 6123676 |
| 987 | 2824672912 | 2824671348 | Bacteria | 8369588 |
| 988 | 2824689444 | 2824687955 | Bacteria | 8360029 |
| 989 | 2824705356 | 2824704595 | Bacteria | 9667483 |
| 990 | 2824755503 | 2824753945 | Bacteria | 9787441 |
| 991 | 2824763787 | 2824763712 | Bacteria | 9792355 |
| 992 | 2842682216 | 2842677519 | Bacteria | 5615038 |
| 993 | 2842827691 | 2842826826 | Bacteria | 5974129 |
| 994 | 2842836449 | 2842832357 | Bacteria | 5959113 |
| 995 | 2842841008 | 2842837860 | Bacteria | 6066181 |
| 996 | 2842844563 | 2842843487 | Bacteria | 6004777 |
| 997 | 2847935644 | 2847930680 | Bacteria | 9342022 |
| 998 | 2852662403 | 2852657418 | Bacteria | 6472974 |
| 999 | 2860340736 | 2860339153 | Bacteria | 6846989 |
| 1000 | 2878033839 | 2878029506 | Bacteria | 6418441 |
| 1001 | 2880234464 | 2880230671 | Bacteria | 6140320 |
| 1002 | 2881673396 | 2881665667 | Bacteria | 8175609 |
| 1003 | 2900582412 | 2900577576 | Bacteria | 5438534 |
| 1004 | 2904521397 | 2904518522 | Bacteria | 6068986 |
| 1005 | 2904555574 | 2904550169 | Bacteria | 6221258 |
| 1006 | 2904698552 | 2904690495 | Bacteria | 9412302 |
| 1007 | 2904716539 | 2904711408 | Bacteria | 9771557 |
| 1008 | 2908762437 | 2908756301 | Bacteria | 8864324 |
| 1009 | 2919068824 | 2919063839 | Bacteria | 6302690 |
| 1010 | 2919387931 | 2919385768 | Bacteria | 5897293 |
| 1011 | 2919461133 | 2919456309 | Bacteria | 6586567 |
| 1012 | 2919489886 | 2919487758 | Bacteria | 5929766 |
| 1013 | 2919706865 | 2919704043 | Bacteria | 5560311 |
| 1014 | 2928061011 | 2928058823 | Bacteria | 5520022 |
| 1015 | 2928070104 | 2928064002 | Bacteria | 7419480 |
| 1016 | 2929526598 | 2929520902 | Bacteria | 6765052 |
| 1017 | 2931394940 | 2931390751 | Bacteria | 6273349 |
| 1018 | 2931403289 | 2931396565 | Bacteria | 7251677 |
| 1019 | 2935678657 | 2935675223 | Bacteria | 9928132 |
| 1020 | 2935687852 | 2935684952 | Bacteria | 9590419 |
| 1021 | 2935714872 | 2935713505 | Bacteria | 9608509 |
| 1022 | 2935726563 | 2935722832 | Bacteria | 9608746 |
| 1023 | 2935733690 | 2935732158 | Bacteria | 9706831 |
| 1024 | 2935743069 | 2935741537 | Bacteria | 9707219 |
| 1025 | 2935754892 | 2935750917 | Bacteria | 9590372 |
| 1026 | 2940559731 | 2940556831 | Bacteria | 9590747 |
| 1027 | 2945950403 | 2945945610 | Bacteria | 5951079 |
| 1028 | 2945964996 | 2945961074 | Bacteria | 7342064 |
| 1029 | 2946008561 | 2946006987 | Bacteria | 6705746 |
| 1030 | 2946032089 | 2946027586 | Bacteria | 6049274 |
| 1031 | 2947238918 | 2947233263 | Bacteria | 6439278 |
| 1032 | 2969308614 | 2969304461 | Bacteria | 6601805 |
| 1033 | 2974290013 | 2974289157 | Bacteria | 6080362 |
| 1034 | 2990714192 | 2990710928 | Bacteria | 5002431 |
| 1035 | 2998143919 | 2998139840 | Bacteria | 6073514 |
| 1036 | 3001890424 | 3001889506 | Bacteria | 2975194 |
| 1037 | 3007515620 | 3007511990 | Bacteria | 6481491 |
| 1038 | 3007616933 | 3007614139 | Bacteria | 6053559 |
| 1039 | 3007625638 | 3007619802 | Bacteria | 6411688 |
| 1040 | 3007857825 | 3007855910 | Bacteria | 5637581 |
| 1041 | 3007865348 | 3007861166 | Bacteria | 6045338 |
| 1042 | 8029996958 | 8029995093 | Bacteria | 5990776 |
| 1043 | 8054350790 | 8054347763 | Bacteria | 5901107 |
| 1044 | 8054507450 | 8054503363 | Bacteria | 6101651 |
| 1045 | 8055822393 | 8055817908 | Bacteria | 6609162 |
| 1046 | 8056127639 | 8056125926 | Bacteria | 6228218 |
| 1047 | 8056135855 | 8056131705 | Bacteria | 6107031 |
| 1048 | 8056153174 | 8056148874 | Bacteria | 6479865 |
| 1049 | 8056167357 | 8056166840 | Bacteria | 5820959 |
| 1050 | 8056179536 | 8056177738 | Bacteria | 6748268 |
| 1051 | 8056692478 | 8056689827 | Bacteria | 6712655 |
| 1052 | Ga0070663_100358001 | |||
| 1053 | MRS2a_Contig_45 | |||
| 1054 | JGI24741J21665_1000563 | |||
| 1055 | JGI24740J21852_10003720 | |||
| 1056 | JGI25156J39149_1001699 | |||
| 1057 | JGI25162J39368_1000166 | |||
| 1058 | JGI25163J39215_1000715 | |||
| 1059 | JGI25164J39214_1000129 | |||
| 1060 | JGI25151J46595_10030891 | |||
| 1061 | JGI25165J46597_1000251 | |||
| 1062 | rootH2_10054890 | |||
| 1063 | JGI25160J50197_1024790 | |||
| 1064 | Ga0006562J51391_1127201 | |||
| 1065 | Ga0006562J51391_1133065 | |||
| 1066 | Ga0006562J51391_1133066 | |||
| 1067 | Ga0055538_1000405 | |||
| 1068 | Ga0055538_1001223 | |||
| 1069 | Ga0055538_1001224 | |||
| 1070 | Ga0055539_1000185 | |||
| 1071 | Ga0055539_1000397 | |||
| 1072 | Ga0055533_1000398 | |||
| 1073 | Ga0055533_1001284 | |||
| 1074 | Ga0055532_1000006 | |||
| 1075 | Ga0055532_1000498 | |||
| 1076 | Ga0055525_1000501 | |||
| 1077 | Ga0055525_1000553 | |||
| 1078 | Ga0055535_1000004 | |||
| 1079 | Ga0055529_1000273 | |||
| 1080 | Ga0055526_1005404 | |||
| 1081 | Ga0055526_1018471 | |||
| 1082 | Ga0055537_1004515 | |||
| 1083 | Ga0055536_1000239 | |||
| 1084 | Ga0055536_1002621 | |||
| 1085 | Ga0055534_1000600 | |||
| 1086 | Ga0055530_10000289 | |||
| 1087 | Ga0055530_10002048 | |||
| 1088 | Ga0055540_1000105 | |||
| 1089 | Ga0055531_10000081 | |||
| 1090 | Ga0055531_10004735 | |||
| 1091 | Ga0055541_1000284 | |||
| 1092 | Ga0055541_1001906 | |||
| 1093 | Ga0055541_1003832 | |||
| 1094 | Ga0055543_1000305 | |||
| 1095 | Ga0065165_1002126 | |||
| 1096 | Ga0065165_1045245 | |||
| 1097 | Ga0065714_10002480 | |||
| 1098 | Ga0065714_10065498 | |||
| 1099 | Ga0065714_10086658 | |||
| 1100 | Ga0065714_10103566 | |||
| 1101 | Ga0065712_10000845 | |||
| 1102 | Ga0065715_10012261 | |||
| 1103 | Ga0070676_10112978 | |||
| 1104 | Ga0070676_10144881 | |||
| 1105 | Ga0070670_100000224 | |||
| 1106 | Ga0068868_100091992 | |||
| 1107 | Ga0068868_100107647 | |||
| 1108 | Ga0068868_100136496 | |||
| 1109 | Ga0070689_100063076 | |||
| 1110 | Ga0070661_100000336 | |||
| 1111 | Ga0070661_100228619 | |||
| 1112 | Ga0070669_100006480 | |||
| 1113 | Ga0070671_100047273 | |||
| 1114 | Ga0070671_100106756 | |||
| 1115 | Ga0070673_100165583 | |||
| 1116 | Ga0070688_100331366 | |||
| 1117 | Ga0070705_100113686 | |||
| 1118 | Ga0070663_100000246 | |||
| 1119 | Ga0070663_100155007 | |||
| 1120 | Ga0070663_100186749 | |||
| 1121 | Ga0070678_100078656 | |||
| 1122 | Ga0070662_100000056 | |||
| 1123 | Ga0070697_100296058 | |||
| 1124 | Ga0068853_100023937 | |||
| 1125 | Ga0068853_100210067 | |||
| 1126 | Ga0070686_100253765 | |||
| 1127 | Ga0070695_100009160 | |||
| 1128 | Ga0070696_100173698 | |||
| 1129 | Ga0070665_100033455 | |||
| 1130 | Ga0070704_100009794 | |||
| 1131 | Ga0070704_100392120 | |||
| 1132 | Ga0070664_100000122 | |||
| 1133 | Ga0070664_100071994 | |||
| 1134 | Ga0070664_100420602 | |||
| 1135 | Ga0068854_100000121 | |||
| 1136 | Ga0068854_100014586 | |||
| 1137 | Ga0068854_100029670 | |||
| 1138 | Ga0068856_100001446 | |||
| 1139 | Ga0068856_100199475 | |||
| 1140 | Ga0070702_100185214 | |||
| 1141 | Ga0068859_100141340 | |||
| 1142 | Ga0068859_100293899 | |||
| 1143 | Ga0068864_100003161 | |||
| 1144 | Ga0068861_100040406 | |||
| 1145 | Ga0068861_100040594 | |||
| 1146 | Ga0068851_10000028 | |||
| 1147 | Ga0068863_100140768 | |||
| 1148 | Ga0068863_100321234 | |||
| 1149 | Ga0068863_100362306 | |||
| 1150 | Ga0068860_100032977 | |||
| 1151 | Ga0081540_1004812 | |||
| 1152 | Ga0081540_1015156 | |||
| 1153 | Ga0081539_10032068 | |||
| 1154 | Ga0070717_10004861 | |||
| 1155 | Ga0070717_10025882 | |||
| 1156 | Ga0075365_10028979 | |||
| 1157 | Ga0075365_10033580 | |||
| 1158 | Ga0075368_10020265 | |||
| 1159 | Ga0075432_10016974 | |||
| 1160 | Ga0075367_10048532 | |||
| 1161 | Ga0075367_10106909 | |||
| 1162 | Ga0075366_10020174 | |||
| 1163 | Ga0075366_10159319 | |||
| 1164 | Ga0097621_100190550 | |||
| 1165 | Ga0075370_10049297 | |||
| 1166 | Ga0068871_100052556 | |||
| 1167 | Ga0075428_100042245 | |||
| 1168 | Ga0075428_100213784 | |||
| 1169 | Ga0075428_100339326 | |||
| 1170 | Ga0075430_100143969 | |||
| 1171 | Ga0075430_100186936 | |||
| 1172 | Ga0075431_100235557 | |||
| 1173 | Ga0075429_100361443 | |||
| 1174 | Ga0075436_100007551 | |||
| 1175 | Ga0075436_100060272 | |||
| 1176 | Ga0097620_100141338 | |||
| 1177 | Ga0097620_100293900 | |||
| 1178 | Ga0079104_1000124 | |||
| 1179 | Ga0079104_1008588 | |||
| 1180 | Ga0075435_100012311 | |||
| 1181 | Ga0099794_10000175 | |||
| 1182 | Ga0099794_10008266 | |||
| 1183 | Ga0099795_10000165 | |||
| 1184 | Ga0105251_10000346 | |||
| 1185 | Ga0105251_10034727 | |||
| 1186 | Ga0105244_10000322 | |||
| 1187 | Ga0105250_10002492 | |||
| 1188 | Ga0105250_10053842 | |||
| 1189 | Ga0105240_10015691 | |||
| 1190 | Ga0105240_10105334 | |||
| 1191 | Ga0105240_10318109 | |||
| 1192 | Ga0111539_10024343 | |||
| 1193 | Ga0111539_10064464 | |||
| 1194 | Ga0105245_10013885 | |||
| 1195 | Ga0105245_10039587 | |||
| 1196 | Ga0105245_10099935 | |||
| 1197 | Ga0105245_10121680 | |||
| 1198 | Ga0105245_10237725 | |||
| 1199 | Ga0105247_10041933 | |||
| 1200 | Ga0114129_10368819 | |||
| 1201 | Ga0105243_10000103 | |||
| 1202 | Ga0105241_10039449 | |||
| 1203 | Ga0105248_10071469 | |||
| 1204 | Ga0105248_10188843 | |||
| 1205 | Ga0105238_10076260 | |||
| 1206 | Ga0105249_10109781 | |||
| 1207 | Ga0099796_10000071 | |||
| 1208 | Ga0105246_10006736 | |||
| 1209 | Ga0105246_10101796 | |||
| 1210 | Ga0105246_10163692 | |||
| 1211 | Ga0157345_1000009 | |||
| 1212 | Ga0157373_10003474 | |||
| 1213 | Ga0157373_10033971 | |||
| 1214 | Ga0157373_10038079 | |||
| 1215 | Ga0157373_10156321 | |||
| 1216 | Ga0157371_10000072 | |||
| 1217 | Ga0157371_10000306 | |||
| 1218 | Ga0157371_10006322 | |||
| 1219 | Ga0157371_10027785 | |||
| 1220 | Ga0157370_10000031 | |||
| 1221 | Ga0157370_10098156 | |||
| 1222 | Ga0157370_10152759 | |||
| 1223 | Ga0157369_10003537 | |||
| 1224 | Ga0157369_10013154 | |||
| 1225 | Ga0157369_10114886 | |||
| 1226 | Ga0157369_10259065 | |||
| 1227 | Ga0157374_10022608 | |||
| 1228 | Ga0157378_10261127 | |||
| 1229 | Ga0163162_10000072 | |||
| 1230 | Ga0163162_10032056 | |||
| 1231 | Ga0163162_10127391 | |||
| 1232 | Ga0163162_10212141 | |||
| 1233 | Ga0157372_10001411 | |||
| 1234 | Ga0163163_10010321 | |||
| 1235 | Ga0163163_10557829 | |||
| 1236 | Ga0157380_10031465 | |||
| 1237 | Ga0182008_10003577 | |||
| 1238 | Ga0182008_10006269 | |||
| 1239 | Ga0182008_10022716 | |||
| 1240 | Ga0182008_10084256 | |||
| 1241 | Ga0157379_10186184 | |||
| 1242 | Ga0157379_10443523 | |||
| 1243 | Ga0157376_10018698 | |||
| 1244 | Ga0182006_1051303 | |||
| 1245 | Ga0182006_1093032 | |||
| 1246 | Ga0182005_1015952 | |||
| 1247 | Ga0182005_1058996 | |||
| 1248 | Ga0163161_10006408 | |||
| 1249 | Ga0163161_10016557 | |||
| 1250 | Ga0163161_10016783 | |||
| 1251 | Ga0163161_10068832 | |||
| 1252 | Ga0163161_10241643 | |||
| 1253 | Ga0213872_10000489 | |||
| 1254 | Ga0213872_10000610 | |||
| 1255 | Ga0213872_10001402 | |||
| 1256 | Ga0209435_100432 | |||
| 1257 | Ga0209760_100043 | |||
| 1258 | Ga0209436_100149 | |||
| 1259 | Ga0209436_102498 | |||
| 1260 | Ga0209784_100006 | |||
| 1261 | Ga0209784_100017 | |||
| 1262 | Ga0209784_100391 | |||
| 1263 | Ga0209784_100520 | |||
| 1264 | Ga0209566_100002 | |||
| 1265 | Ga0209566_100014 | |||
| 1266 | Ga0209566_103002 | |||
| 1267 | Ga0209674_100010 | |||
| 1268 | Ga0209674_100028 | |||
| 1269 | Ga0209674_100796 | |||
| 1270 | Ga0209672_100448 | |||
| 1271 | Ga0209672_100849 | |||
| 1272 | Ga0209147_100015 | |||
| 1273 | Ga0209147_100038 | |||
| 1274 | Ga0209563_100004 | |||
| 1275 | Ga0209563_100032 | |||
| 1276 | Ga0207427_100047 | |||
| 1277 | Ga0209437_100009 | |||
| 1278 | Ga0209258_100021 | |||
| 1279 | Ga0209258_100828 | |||
| 1280 | Ga0207425_1000160 | |||
| 1281 | Ga0207425_1000961 | |||
| 1282 | Ga0209646_1000171 | |||
| 1283 | Ga0209026_1002374 | |||
| 1284 | Ga0209677_100007 | |||
| 1285 | Ga0209677_100018 | |||
| 1286 | Ga0209759_1000926 | |||
| 1287 | Ga0209759_1001154 | |||
| 1288 | Ga0209129_1011559 | |||
| 1289 | Ga0209233_1000032 | |||
| 1290 | Ga0209233_1001245 | |||
| 1291 | Ga0209565_1000664 | |||
| 1292 | Ga0209565_1003248 | |||
| 1293 | Ga0209455_1000028 | |||
| 1294 | Ga0209673_1011371 | |||
| 1295 | Ga0209673_1016051 | |||
| 1296 | Ga0209130_1000624 | |||
| 1297 | Ga0209130_1003920 | |||
| 1298 | Ga0209675_1000467 | |||
| 1299 | Ga0209675_1001555 | |||
| 1300 | Ga0209675_1020112 | |||
| 1301 | Ga0209676_1000010 | |||
| 1302 | Ga0209676_1000646 | |||
| 1303 | Ga0209676_1004434 | |||
| 1304 | Ga0209676_1005348 | |||
| 1305 | Ga0209025_1000718 | |||
| 1306 | Ga0209564_1000088 | |||
| 1307 | Ga0209564_1004515 | |||
| 1308 | Ga0209564_1007989 | |||
| 1309 | Ga0209050_1000081 | |||
| 1310 | Ga0209050_1000363 | |||
| 1311 | Ga0209050_1000430 | |||
| 1312 | Ga0209050_1000535 | |||
| 1313 | Ga0209050_1007738 | |||
| 1314 | Ga0209256_1000560 | |||
| 1315 | Ga0209256_1001254 | |||
| 1316 | Ga0209256_1002634 | |||
| 1317 | Ga0207426_1006486 | |||
| 1318 | Ga0207426_1034679 | |||
| 1319 | Ga0209051_1000025 | |||
| 1320 | Ga0209051_1000185 | |||
| 1321 | Ga0209257_1000039 | |||
| 1322 | Ga0209257_1000040 | |||
| 1323 | Ga0209257_1000157 | |||
| 1324 | Ga0209257_1058303 | |||
| 1325 | Ga0207656_10000056 | |||
| 1326 | Ga0207696_1000193 | |||
| 1327 | Ga0207696_1001821 | |||
| 1328 | Ga0207655_1000505 | |||
| 1329 | Ga0207655_1010484 | |||
| 1330 | Ga0207655_1020359 | |||
| 1331 | Ga0207655_1030332 | |||
| 1332 | Ga0207713_1000386 | |||
| 1333 | Ga0207713_1000431 | |||
| 1334 | Ga0207713_1001314 | |||
| 1335 | Ga0207713_1002492 | |||
| 1336 | Ga0207713_1012230 | |||
| 1337 | Ga0207713_1016633 | |||
| 1338 | Ga0207647_10124892 | |||
| 1339 | Ga0207699_10326536 | |||
| 1340 | Ga0207645_10065700 | |||
| 1341 | Ga0207654_10014283 | |||
| 1342 | Ga0207695_10002542 | |||
| 1343 | Ga0207671_10061555 | |||
| 1344 | Ga0207693_10084413 | |||
| 1345 | Ga0207649_10000449 | |||
| 1346 | Ga0207681_10001738 | |||
| 1347 | Ga0207681_10203679 | |||
| 1348 | Ga0207650_10000291 | |||
| 1349 | Ga0207687_10005746 | |||
| 1350 | Ga0207687_10011264 | |||
| 1351 | Ga0207644_10031910 | |||
| 1352 | Ga0207644_10102053 | |||
| 1353 | Ga0207644_10164695 | |||
| 1354 | Ga0207706_10000445 | |||
| 1355 | Ga0207706_10007508 | |||
| 1356 | Ga0207709_10000035 | |||
| 1357 | Ga0207670_10303073 | |||
| 1358 | Ga0207669_10263229 | |||
| 1359 | Ga0207691_10247796 | |||
| 1360 | Ga0207711_10328351 | |||
| 1361 | Ga0207689_10009277 | |||
| 1362 | Ga0207679_10000007 | |||
| 1363 | Ga0207679_10458960 | |||
| 1364 | Ga0207667_10412081 | |||
| 1365 | Ga0207651_10165626 | |||
| 1366 | Ga0207651_10205169 | |||
| 1367 | Ga0207668_10091720 | |||
| 1368 | Ga0207640_10000107 | |||
| 1369 | Ga0207640_10026064 | |||
| 1370 | Ga0207658_10189908 | |||
| 1371 | Ga0207677_10009786 | |||
| 1372 | Ga0207677_10108219 | |||
| 1373 | Ga0207639_10126991 | |||
| 1374 | Ga0207639_10324051 | |||
| 1375 | Ga0207678_10000207 | |||
| 1376 | Ga0207678_10002939 | |||
| 1377 | Ga0207702_10000260 | |||
| 1378 | Ga0207641_10177909 | |||
| 1379 | Ga0207641_10240258 | |||
| 1380 | Ga0207648_10122901 | |||
| 1381 | Ga0207676_10190227 | |||
| 1382 | Ga0207675_100036501 | |||
| 1383 | Ga0207675_100112511 | |||
| 1384 | Ga0207675_100160586 | |||
| 1385 | Ga0207683_10009292 | |||
| 1386 | Ga0207698_10172974 | |||
| 1387 | Ga0209281_1000077 | |||
| 1388 | Ga0209281_1006210 | |||
| 1389 | Ga0209179_1000643 | |||
| 1390 | Ga0209179_1010378 | |||
| 1391 | Ga0209588_1006727 | |||
| 1392 | Ga0209588_1006757 | |||
| 1393 | Ga0207428_10015756 | |||
| 1394 | Ga0207428_10035452 | |||
| 1395 | Ga0207428_10045233 | |||
| 1396 | Ga0207428_10073411 | |||
| 1397 | Ga0268266_10040831 | |||
| 1398 | Ga0268266_10134411 | |||
| 1399 | Ga0268264_10462527 | |||
| 1400 | Ga0265318_10011277 | |||
| 1401 | Ga0307515_10000208 | |||
| 1402 | Ga0307515_10080725 | |||
| 1403 | Ga0307511_10175496 | |||
| 1404 | Ga0307512_10112371 | |||
| 1405 | Ga0316177_1020845 | |||
| 1406 | Ga0314311_1060215 | |||
| 1407 | Ga0316178_1101239 | |||
| 1408 | Ga0316183_1015378 | |||
| 1409 | Ga0316181_1075075 | |||
| 1410 | Ga0316181_1158467 | |||
| 1411 | Ga0316182_1280847 | |||
| 1412 | Ga0265330_10000076 | |||
| 1413 | Ga0265332_10000002 | |||
| 1414 | Ga0265325_10026911 | |||
| 1415 | Ga0307513_10000090 | |||
| 1416 | Ga0307513_10012431 | |||
| 1417 | Ga0307513_10131489 | |||
| 1418 | Ga0307513_10317661 | |||
| 1419 | Ga0307509_10056371 | |||
| 1420 | Ga0307408_100000115 | |||
| 1421 | Ga0307408_100000125 | |||
| 1422 | Ga0307408_100000895 | |||
| 1423 | Ga0307408_100007259 | |||
| 1424 | Ga0307408_100007580 | |||
| 1425 | Ga0307408_100044798 | |||
| 1426 | Ga0265314_10000066 | |||
| 1427 | Ga0265314_10128062 | |||
| 1428 | Ga0316576_10000405 | |||
| 1429 | Ga0307516_10006050 | |||
| 1430 | Ga0307405_10317636 | |||
| 1431 | Ga0307413_10142044 | |||
| 1432 | Ga0307413_10220092 | |||
| 1433 | Ga0307406_10058978 | |||
| 1434 | Ga0307406_10094923 | |||
| 1435 | Ga0307406_10106872 | |||
| 1436 | Ga0307412_10010358 | |||
| 1437 | Ga0307412_10017587 | |||
| 1438 | Ga0307412_10112378 | |||
| 1439 | Ga0307412_10335631 | |||
| 1440 | Ga0307409_100034446 | |||
| 1441 | Ga0307416_100070969 | |||
| 1442 | Ga0307416_100100216 | |||
| 1443 | Ga0307416_100187721 | |||
| 1444 | Ga0307416_100496800 | |||
| 1445 | Ga0307414_10086753 | |||
| 1446 | Ga0307414_10109249 | |||
| 1447 | Ga0307414_10267957 | |||
| 1448 | Ga0307510_10014599 | |||
| 1449 | Ga0373923_0059551 | |||
| 1450 | Ga0373936_0058574 | |||
| 1451 | Ga0373945_0005853 | |||
| 1452 | Ga0373954_0010190 | |||
| 1453 | Ga0373955_0006435 | |||
| 1454 | Ga0373924_0001251 | |||
| 1455 | Ga0373935_0075239 | |||
| 1456 | Ga0373927_0019954 | |||
| 1457 | Ga0373927_0113034 | |||
| 1458 | Ga0373933_0008240 | |||
| 1459 | Ga0373947_0015164 | |||
| 1460 | Ga0373947_0047205 | |||
| 1461 | Ga0373937_0007858 | |||
| 1462 | Ga0373925_0170037 | |||
| 1463 | Ga0373925_0330040 | |||
| 1464 | Ga0395900_0003101 | |||
| 1465 | Ga0237819_04223 | |||
| 1466 | Ga0436361_0324341 | |||
| 1467 | Ga0436361_0729857 | |||
| 1468 | Ga0436361_0922740 | |||
| 1469 | Ga0436361_1103726 | |||
| 1470 | Ga0439438_000117 | |||
| 1471 | Ga0439438_016146 | |||
| 1472 | Ga0439438_018549 | |||
| 1473 | Ga0439447_000258 | |||
| 1474 | Ga0439447_004731 | |||
| 1475 | Ga0439466_0003476 | |||
| 1476 | Ga0439466_0011397 | |||
| 1477 | Ga0439466_0013472 | |||
| 1478 | Ga0439466_0022658 | |||
| 1479 | Ga0439466_0054731 | |||
| 1480 | Ga0451839_1226771 | |||
| 1481 | Ga0439431_0041170 | |||
| 1482 | Ga0439432_000381 | |||
| 1483 | Ga0439432_005659 | |||
| 1484 | Ga0439452_000091 | |||
| 1485 | Ga0439452_000164 | |||
| 1486 | Ga0439452_006049 | |||
| 1487 | Ga0439452_009472 | |||
| 1488 | Ga0439452_009980 | |||
| 1489 | Ga0439452_023100 | |||
| 1490 | Ga0439456_005828 | |||
| 1491 | Ga0450911_000746 | |||
| 1492 | Ga0450920_007188 | |||
| 1493 | Ga0450896_003141 | |||
| 1494 | Ga0450902_006117 | |||
| 1495 | Ga0450903_001867 | |||
| 1496 | Ga0450903_002715 | |||
| 1497 | Ga0450904_001840 | |||
| 1498 | Ga0450905_002056 | |||
| 1499 | Ga0450905_012374 | |||
| 1500 | Ga0450906_004872 | |||
| 1501 | Ga0450907_000038 | |||
| 1502 | Ga0450907_001262 | |||
| 1503 | Ga0439446_0005711 | |||
| 1504 | Ga0450909_000970 | |||
| 1505 | Ga0439434_0000146 | |||
| 1506 | Ga0439464_0026399 | |||
| 1507 | Ga0439460_0000739 | |||
| 1508 | Ga0439460_0004830 | |||
| 1509 | Ga0450918_003063 | |||
| 1510 | Ga0450893_0007396 | |||
| 1511 | Ga0450901_001528 | |||
| 1512 | Ga0439440_0000716 | |||
| 1513 | Ga0466986_0214250 | |||
| 1514 | Ga0453683_0071593 | |||
| 1515 | Ga0451576_0007815 | |||
| 1516 | Ga0466967_0019240 | |||
| 1517 | Ga0495617_000309 | |||
| 1518 | Ga0495617_002310 | |||
| 1519 | Ga0495617_015897 | |||
| 1520 | Ga0495617_085817 | |||
| 1521 | Ga0495627_000785 | |||
| 1522 | Ga0495627_002296 | |||
| 1523 | Ga0495627_002700 | |||
| 1524 | Ga0495627_007208 | |||
| 1525 | Ga0495603_0016957 | |||
| 1526 | Ga0495603_0022975 | |||
| 1527 | Ga0495603_0037472 | |||
| 1528 | Ga0495590_0000265 | |||
| 1529 | Ga0495590_0008924 | |||
| 1530 | Ga0495590_0012789 | |||
| 1531 | Ga0495590_0035563 | |||
| 1532 | Ga0495591_000114 | |||
| 1533 | Ga0495591_000445 | |||
| 1534 | Ga0495591_001195 | |||
| 1535 | Ga0495591_004397 | |||
| 1536 | Ga0495591_016254 | |||
| 1537 | Ga0495638_0001380 | |||
| 1538 | Ga0495638_0006818 | |||
| 1539 | Ga0495638_0016469 | |||
| 1540 | Ga0495638_0018041 | |||
| 1541 | Ga0495638_0043694 | |||
| 1542 | Ga0495638_0067457 | |||
| 1543 | Ga0495638_0093891 | |||
| 1544 | Ga0495641_0061637 | |||
| 1545 | Ga0495653_0008254 | |||
| 1546 | Ga0495653_0045047 | |||
| 1547 | Ga0495653_0125903 | |||
| 1548 | Ga0495653_0137805 | |||
| 1549 | Ga0495653_0250158 | |||
| 1550 | Ga0495650_0004067 | |||
| 1551 | Ga0495650_0005308 | |||
| 1552 | Ga0495650_0006574 | |||
| 1553 | Ga0495650_0019510 | |||
| 1554 | Ga0495650_0020296 | |||
| 1555 | Ga0495650_0021261 | |||
| 1556 | Ga0495650_0023776 | |||
| 1557 | Ga0495650_0051426 | |||
| 1558 | Ga0495580_0035117 | |||
| 1559 | Ga0495582_0006023 | |||
| 1560 | Ga0495605_0000309 | |||
| 1561 | Ga0495605_0006838 | |||
| 1562 | Ga0495605_0008079 | |||
| 1563 | Ga0495605_0043267 | |||
| 1564 | Ga0495605_0043460 | |||
| 1565 | Ga0495605_0047189 | |||
| 1566 | Ga0495639_0011124 | |||
| 1567 | Ga0495639_0165555 | |||
| 1568 | Ga0495664_0003593 | |||
| 1569 | Ga0495584_0000217 | |||
| 1570 | Ga0495584_0002031 | |||
| 1571 | Ga0495584_0002563 | |||
| 1572 | Ga0495584_0002853 | |||
| 1573 | Ga0495584_0005652 | |||
| 1574 | Ga0495584_0022627 | |||
| 1575 | Ga0495584_0026694 | |||
| 1576 | Ga0495584_0049159 | |||
| 1577 | Ga0495584_0116231 | |||
| 1578 | Ga0495585_0000228 | |||
| 1579 | Ga0495585_0001137 | |||
| 1580 | Ga0495585_0013961 | |||
| 1581 | Ga0495585_0016331 | |||
| 1582 | Ga0495585_0026568 | |||
| 1583 | Ga0495585_0081529 | |||
| 1584 | Ga0495594_0002102 | |||
| 1585 | Ga0495594_0018587 | |||
| 1586 | Ga0495594_0018919 | |||
| 1587 | Ga0495594_0025710 | |||
| 1588 | Ga0495596_0000107 | |||
| 1589 | Ga0495596_0081682 | |||
| 1590 | Ga0495607_0000159 | |||
| 1591 | Ga0495607_0005431 | |||
| 1592 | Ga0495607_0017665 | |||
| 1593 | Ga0495607_0030429 | |||
| 1594 | Ga0495607_0030914 | |||
| 1595 | Ga0495607_0032508 | |||
| 1596 | Ga0495607_0032518 | |||
| 1597 | Ga0495607_0049590 | |||
| 1598 | Ga0495583_0005717 | |||
| 1599 | Ga0495583_0006667 | |||
| 1600 | Ga0495606_0001649 | |||
| 1601 | Ga0495606_0006186 | |||
| 1602 | Ga0495606_0008665 | |||
| 1603 | Ga0495606_0009531 | |||
| 1604 | Ga0495606_0067050 | |||
| 1605 | Ga0495610_0006283 | |||
| 1606 | Ga0495610_0013703 | |||
| 1607 | Ga0495610_0042373 | |||
| 1608 | Ga0495610_0047414 | |||
| 1609 | Ga0495610_0054393 | |||
| 1610 | Ga0495610_0066359 | |||
| 1611 | Ga0495616_0000784 | |||
| 1612 | Ga0495616_0001395 | |||
| 1613 | Ga0495616_0007013 | |||
| 1614 | Ga0495616_0010643 | |||
| 1615 | Ga0495616_0061958 | |||
| 1616 | Ga0495616_0078062 | |||
| 1617 | Ga0495618_0010007 | |||
| 1618 | Ga0495620_0003338 | |||
| 1619 | Ga0495620_0011242 | |||
| 1620 | Ga0495620_0020374 | |||
| 1621 | Ga0495628_0147763 | |||
| 1622 | Ga0495628_0164081 | |||
| 1623 | Ga0495630_0013745 | |||
| 1624 | Ga0495630_0041268 | |||
| 1625 | Ga0495631_0000020 | |||
| 1626 | Ga0495631_0001259 | |||
| 1627 | Ga0495631_0012134 | |||
| 1628 | Ga0495631_0021789 | |||
| 1629 | Ga0495632_0000436 | |||
| 1630 | Ga0495632_0000587 | |||
| 1631 | Ga0495632_0009113 | |||
| 1632 | Ga0495632_0036455 | |||
| 1633 | Ga0495632_0043736 | |||
| 1634 | Ga0495632_0066478 | |||
| 1635 | Ga0495637_0000447 | |||
| 1636 | Ga0495637_0003645 | |||
| 1637 | Ga0495637_0010835 | |||
| 1638 | Ga0495637_0011026 | |||
| 1639 | Ga0495637_0013087 | |||
| 1640 | Ga0495637_0017482 | |||
| 1641 | Ga0495637_0017509 | |||
| 1642 | Ga0495637_0025356 | |||
| 1643 | Ga0495637_0034713 | |||
| 1644 | Ga0495643_0013102 | |||
| 1645 | Ga0495643_0013270 | |||
| 1646 | Ga0495643_0026473 | |||
| 1647 | Ga0495643_0051925 | |||
| 1648 | Ga0495644_0001885 | |||
| 1649 | Ga0495644_0002346 | |||
| 1650 | Ga0495644_0007004 | |||
| 1651 | Ga0495644_0017843 | |||
| 1652 | Ga0495648_0002549 | |||
| 1653 | Ga0495648_0003472 | |||
| 1654 | Ga0495648_0005540 | |||
| 1655 | Ga0495648_0036039 | |||
| 1656 | Ga0495648_0058583 | |||
| 1657 | Ga0495648_0058762 | |||
| 1658 | Ga0495648_0114056 | |||
| 1659 | Ga0495648_0148613 | |||
| 1660 | Ga0495666_0007185 | |||
| 1661 | Ga0495666_0050335 | |||
| 1662 | Ga0495666_0115221 | |||
| 1663 | Ga0495642_0000033 | |||
| 1664 | Ga0495642_0003997 | |||
| 1665 | Ga0495642_0007333 | |||
| 1666 | Ga0495642_0012253 | |||
| 1667 | Ga0495654_0000324 | |||
| 1668 | Ga0495654_0001457 | |||
| 1669 | Ga0495654_0002179 | |||
| 1670 | Ga0495654_0002442 | |||
| 1671 | Ga0495654_0018170 | |||
| 1672 | Ga0495654_0023880 | |||
| 1673 | Ga0495654_0029567 | |||
| 1674 | Ga0495654_0048816 | |||
| 1675 | Ga0495654_0062265 | |||
| 1676 | Ga0495654_0145907 | |||
| 1677 | Ga0495665_0011303 | |||
| 1678 | Ga0495640_0022970 | |||
| 1679 | Ga0495586_0006584 | |||
| 1680 | Ga0495587_0003070 | |||
| 1681 | Ga0495587_0009581 | |||
| 1682 | Ga0495609_0000405 | |||
| 1683 | Ga0495609_0020986 | |||
| 1684 | Ga0495609_0033359 | |||
| 1685 | Ga0495597_0011731 | |||
| 1686 | Ga0495597_0016052 | |||
| 1687 | Ga0495597_0018166 | |||
| 1688 | Ga0495597_0032715 | |||
| 1689 | Ga0495597_0043568 | |||
| 1690 | Ga0495645_0098176 | |||
| 1691 | Ga0495622_0000775 | |||
| 1692 | Ga0495622_0001094 | |||
| 1693 | Ga0495622_0002578 | |||
| 1694 | Ga0495622_0005904 | |||
| 1695 | Ga0495622_0006370 | |||
| 1696 | Ga0495622_0059423 | |||
| 1697 | Ga0495622_0086941 | |||
| 1698 | Ga0495633_0001444 | |||
| 1699 | Ga0495633_0003372 | |||
| 1700 | Ga0495633_0003895 | |||
| 1701 | Ga0495633_0023821 | |||
| 1702 | Ga0495668_0000568 | |||
| 1703 | Ga0495668_0012847 | |||
| 1704 | Ga0495668_0020910 | |||
| 1705 | Ga0495634_0096292 | |||
| 1706 | Ga0495611_0004442 | |||
| 1707 | Ga0495611_0013170 | |||
| 1708 | Ga0495625_0000136 | |||
| 1709 | Ga0495625_0013373 | |||
| 1710 | Ga0495625_0021444 | |||
| 1711 | Ga0495625_0026162 | |||
| 1712 | Ga0495625_0043881 | |||
| 1713 | Ga0495625_0061946 | |||
| 1714 | Ga0495625_0203618 | |||
| 1715 | Ga0495635_0000856 | |||
| 1716 | Ga0495635_0003406 | |||
| 1717 | Ga0495635_0028386 | |||
| 1718 | Ga0495659_0008916 | |||
| 1719 | Ga0495661_0001179 | |||
| 1720 | Ga0495661_0001607 | |||
| 1721 | Ga0495661_0014015 | |||
| 1722 | Ga0495661_0014963 | |||
| 1723 | Ga0495661_0125253 | |||
| 1724 | Ga0495588_0020285 | |||
| 1725 | Ga0495588_0065219 | |||
| 1726 | Ga0495657_0117295 | |||
| 1727 | Ga0495623_0011490 | |||
| 1728 | Ga0495646_0044646 | |||
| 1729 | Ga0495658_0003833 | |||
| 1730 | Ga0495669_0032844 | |||
| 1731 | Ga0495613_0012404 | |||
| 1732 | Ga0495624_0099652 | |||
| 1733 | Ga0495670_0000548 | |||
| 1734 | Ga0495670_0001711 | |||
| 1735 | Ga0495670_0020139 | |||
| 1736 | Ga0495670_0057332 | |||
| 1737 | Ga0495670_0069267 | |||
| 1738 | Ga0495670_0069573 | |||
| 1739 | Ga0495670_0073397 | |||
| 1740 | Ga0495671_0004328 | |||
| 1741 | Ga0495671_0004525 | |||
| 1742 | Ga0495671_0036458 | |||
| 1743 | Ga0495671_0040446 | |||
| 1744 | Ga0495671_0064534 | |||
| 1745 | Ga0495671_0072438 | |||
| 1746 | Ga0495671_0129869 | |||
| 1747 | Ga0495649_0000201 | |||
| 1748 | Ga0495649_0005892 | |||
| 1749 | Ga0495649_0043434 | |||
| 1750 | Ga0495649_0072974 | |||
| 1751 | Ga0495649_0202439 | |||
| 1752 | Ga0495589_0014529 | |||
| 1753 | Ga0495589_0014663 | |||
| 1754 | Ga0495589_0015429 | |||
| 1755 | Ga0495589_0048323 | |||
| 1756 | Ga0495600_0019348 | |||
| 1757 | Ga0495600_0076451 | |||
| 1758 | Ga0495660_0002421 | |||
| 1759 | Ga0495660_0007901 | |||
| 1760 | Ga0495660_0009749 | |||
| 1761 | Ga0495660_0010336 | |||
| 1762 | Ga0495660_0010495 | |||
| 1763 | Ga0495660_0029941 | |||
| 1764 | Ga0495660_0047141 | |||
| 1765 | Ga0495660_0058609 | |||
| 1766 | Ga0495660_0065298 | |||
| 1767 | Ga0495660_0085028 | |||
| 1768 | Ga0495660_0116418 | |||
| 1769 | Ga0495660_0142719 | |||
| 1770 | Ga0495604_0006513 | |||
| 1771 | Ga0495604_0034282 | |||
| 1772 | Ga0495604_0049990 | |||
| 1773 | Ga0495604_0178343 | |||
| 1774 | Ga0495636_0018420 | |||
| 1775 | Ga0495636_0082294 | |||
| 1776 | Ga0495674_0046526 | |||
| 1777 | Ga0495672_0000540 | |||
| 1778 | Ga0495672_0001849 | |||
| 1779 | Ga0495672_0010364 | |||
| 1780 | Ga0495672_0013564 | |||
| 1781 | Ga0495672_0016147 | |||
| 1782 | Ga0495672_0016365 | |||
| 1783 | Ga0495672_0045374 | |||
| 1784 | Ga0495672_0097133 | |||
| 1785 | Ga0495672_0124929 | |||
| 1786 | Ga0495676_0004979 | |||
| 1787 | Ga0495680_0003260 | |||
| 1788 | Ga0495680_0003948 | |||
| 1789 | Ga0495680_0046655 | |||
| 1790 | Ga0495683_0000085 | |||
| 1791 | Ga0495683_0124330 | |||
| 1792 | Ga0495683_0162291 | |||
| 1793 | Ga0495687_000375 | |||
| 1794 | Ga0495687_001884 | |||
| 1795 | Ga0495675_0001382 | |||
| 1796 | Ga0495675_0058267 | |||
| 1797 | Ga0495677_0001038 | |||
| 1798 | Ga0495677_0002605 | |||
| 1799 | Ga0495677_0004443 | |||
| 1800 | Ga0495679_030866 | |||
| 1801 | Ga0495673_0000297 | |||
| 1802 | Ga0495673_0000345 | |||
| 1803 | Ga0495673_0000577 | |||
| 1804 | Ga0495673_0005101 | |||
| 1805 | Ga0495673_0007357 | |||
| 1806 | Ga0495673_0012094 | |||
| 1807 | Ga0495673_0013919 | |||
| 1808 | Ga0495673_0038701 | |||
| 1809 | Ga0495673_0039727 | |||
| 1810 | Ga0495673_0065497 | |||
| 1811 | Ga0495673_0089498 | |||
| 1812 | Ga0495681_0000172 | |||
| 1813 | Ga0495681_0000226 | |||
| 1814 | Ga0495681_0000417 | |||
| 1815 | Ga0495681_0000424 | |||
| 1816 | Ga0495681_0000712 | |||
| 1817 | Ga0495681_0002398 | |||
| 1818 | Ga0495681_0012211 | |||
| 1819 | Ga0495681_0034229 | |||
| 1820 | Ga0495681_0051051 | |||
| 1821 | Ga0495681_0061101 | |||
| 1822 | Ga0495684_0028703 | |||
| 1823 | Ga0495684_0045663 | |||
| 1824 | Ga0495686_0003384 | |||
| 1825 | Ga0495686_0229627 | |||
| 1826 | Ga0495593_0011535 | |||
| 1827 | Ga0495593_0034702 | |||
| 1828 | Ga0495593_0035820 | |||
| 1829 | Ga0495626_0000144 | |||
| 1830 | Ga0495626_0000179 | |||
| 1831 | Ga0495626_0000438 | |||
| 1832 | Ga0495626_0020622 | |||
| 1833 | Ga0495626_0021905 | |||
| 1834 | Ga0495626_0044408 | |||
| 1835 | Ga0495626_0099083 | |||
| 1836 | Ga0496100_0039534 | |||
| 1837 | Ga0496102_0000250 | |||
| 1838 | Ga0496102_0043415 | |||
| 1839 | Ga0496102_0046823 | |||
| 1840 | Ga0496103_0027072 | |||
| 1841 | Ga0496103_0155478 | |||
| 1842 | Ga0496104_0263217 | |||
| 1843 | Ga0496107_0105378 | |||
| 1844 | Ga0496107_0229517 | |||
| 1845 | Ga0496108_0022509 | |||
| 1846 | Ga0496108_0527904 | |||
| 1847 | Ga0496109_0100476 | |||
| 1848 | Ga0496110_0012489 | |||
| 1849 | Ga0496110_0022038 | |||
| 1850 | Ga0496110_0094803 | |||
| 1851 | Ga0496110_0104736 | |||
| 1852 | Ga0496111_0027774 | |||
| 1853 | Ga0496111_0211677 | |||
| 1854 | Ga0496112_0005803 | |||
| 1855 | Ga0496112_0332422 | |||
| 1856 | Ga0496112_0345770 | |||
| 1857 | Ga0496113_0244440 | |||
| 1858 | Ga0496113_0246514 | |||
| 1859 | Ga0496115_0197030 | |||
| 1860 | Ga0496116_0000419 | |||
| 1861 | Ga0496116_0028683 | |||
| 1862 | Ga0496117_0008975 | |||
| 1863 | Ga0496117_0030791 | |||
| 1864 | Ga0496117_0229163 | |||
| 1865 | Ga0496118_0013091 | |||
| 1866 | Ga0496118_0019329 | |||
| 1867 | Ga0496118_0137412 | |||
| 1868 | Ga0496119_0028027 | |||
| 1869 | Ga0496120_0005937 | |||
| 1870 | Ga0496121_0183166 | |||
| 1871 | Ga0496121_0210687 | |||
| 1872 | Ga0496121_0297573 | |||
| 1873 | Ga0496122_0114392 | |||
| 1874 | Ga0496124_0009971 | |||
| 1875 | Ga0496125_0001730 | |||
| 1876 | Ga0496125_0003106 | |||
| 1877 | Ga0496125_0010260 | |||
| 1878 | Ga0496125_0011702 | |||
| 1879 | Ga0496125_0050011 | |||
| 1880 | Ga0496126_0039481 | |||
| 1881 | Ga0496126_0169059 | |||
| 1882 | Ga0496126_0275732 | |||
| 1883 | Ga0496126_0420511 | |||
| 1884 | Ga0495678_001726 | |||
| 1885 | Ga0495678_001732 | |||
| 1886 | Ga0495678_015989 | |||
| 1887 | Ga0495678_016124 | |||
| 1888 | Ga0495678_018095 | |||
| 1889 | Ga0495678_018346 | |||
| 1890 | Ga0495678_021073 | |||
| 1891 | Ga0495678_066493 | |||
| 1892 | Ga0495682_0001278 | |||
| 1893 | Ga0495682_0007549 | |||
| 1894 | Ga0495682_0013091 | |||
| 1895 | Ga0495682_0013912 | |||
| 1896 | Ga0501031_0007292 | |||
| 1897 | Ga0501032_0072629 | |||
| 1898 | Ga0501033_0037192 | |||
| 1899 | Ga0501034_0120934 | |||
| 1900 | Ga0501036_0156729 | |||
| 1901 | Ga0501037_0080718 | |||
| 1902 | Ga0501037_0234080 | |||
| 1903 | Ga0501038_0005074 | |||
| 1904 | Ga0501040_0075908 | |||
| 1905 | Ga0501042_0168276 | |||
| 1906 | Ga0501043_0000149 | |||
| 1907 | Ga0501043_0034884 | |||
| 1908 | Ga0501043_0054276 | |||
| 1909 | Ga0501046_0000092 | |||
| 1910 | Ga0501046_0121347 | |||
| 1911 | Ga0501047_0000028 | |||
| 1912 | Ga0501048_0000097 | |||
| 1913 | Ga0501070_0069393 | |||
| 1914 | Ga0501070_0158999 | |||
| 1915 | Ga0501072_0238505 | |||
| 1916 | Ga0501073_0252941 | |||
| 1917 | Ga0501076_0396444 | |||
| 1918 | Ga0501077_0144400 | |||
| 1919 | Ga0501080_0211330 | |||
| 1920 | Ga0501083_0005855 | |||
| 1921 | Ga0501083_0107195 | |||
| 1922 | Ga0501265_000611 | |||
| 1923 | Ga0501281_02594 | |||
| 1924 | Ga0501035_0000097 | |||
| 1925 | Ga0501035_0034336 | |||
| 1926 | Ga0501035_0212764 | |||
| 1927 | Ga0501044_0115660 | |||
| 1928 | Ga0501044_0290128 | |||
| 1929 | Ga0501045_0084677 | |||
| 1930 | nmdc:mga03683_15819_c2 | |||
| 1931 | nmdc:mga03683_53059_c1 | |||
| 1932 | nmdc:mga03n38_142688_c1 | |||
| 1933 | nmdc:mga0yw44_24540_c1 | |||
| 1934 | nmdc:mga0yw44_41142_c1 | |||
| 1935 | nmdc:mga0yw44_69585_c1 | |||
| 1936 | nmdc:mga06z11_51548_c1 | |||
| 1937 | nmdc:mga07m45_7849_c1 | |||
| 1938 | nmdc:mga0qj67_161599_c1 | |||
| 1939 | nmdc:mga0qj67_37313_c1 | |||
| 1940 | nmdc:mga06r32_38471_c1 | |||
| 1941 | nmdc:mga08y16_31386_c1 | |||
| 1942 | nmdc:mga0rr50_28353_c1 | |||
| 1943 | nmdc:mga08x19_4_c1 | |||
| 1944 | Ga0495601_0020874 | |||
| 1945 | Ga0495612_0015318 | |||
| 1946 | Ga0495612_0106840 | |||
| 1947 | Ga0500610_0000333 | |||
| 1948 | Ga0500643_000040 | |||
| 1949 | Ga0500583_0006833 | |||
| 1950 | Ga0500555_018422 | |||
| 1951 | Ga0500556_0021194 | |||
| 1952 | Ga0500562_002163 | |||
| 1953 | Ga0500595_005376 | |||
| 1954 | Ga0500642_0158907 | |||
| 1955 | Ga0500658_0000447 | |||
| 1956 | Ga0500658_0005140 | |||
| 1957 | Ga0500658_0027236 | |||
| 1958 | Ga0500561_0023655 | |||
| 1959 | Ga0500568_0000920 | |||
| 1960 | Ga0500577_0074452 | |||
| 1961 | Ga0500589_140658 | |||
| 1962 | Ga0500616_0014979 | |||
| 1963 | Ga0500622_0019177 | |||
| 1964 | Ga0500627_0072984 | |||
| 1965 | Ga0500633_0059167 | |||
| 1966 | Ga0500634_0001992 | |||
| 1967 | Ga0500634_0130047 | |||
| 1968 | Ga0500639_029469 | |||
| 1969 | Ga0500637_0010068 | |||
| 1970 | Ga0500637_0093025 | |||
| 1971 | Ga0500609_012070 | |||
| 1972 | Ga0501084_0017222 | |||
| 1973 | Ga0501084_0046041 | |||
| 1974 | Ga0501082_0032761 | |||
| 1975 | Ga0501082_0208887 | |||
| 1976 | Ga0530510_0028461 | |||
| 1977 | 2511243504 | |||
| 1978 | 2511275771 | |||
| 1979 | 2511290624 | |||
| 1980 | 2511298313 | |||
| 1981 | 2511301050 | |||
| 1982 | 2511315667 | |||
| 1983 | 2511326136 | |||
| 1984 | 2511333948 | |||
| 1985 | 2511338989 | |||
| 1986 | 2511347207 | |||
| 1987 | 2511349875 | |||
| 1988 | 2511357812 | |||
| 1989 | 2511372340 | |||
| 1990 | 2548499305 | |||
| 1991 | 2597032611 | |||
| 1992 | 2597865080 | |||
| 1993 | 2599400207 | |||
| 1994 | 2599447286 | |||
| 1995 | 2599451463 | |||
| 1996 | 2599509428 | |||
| 1997 | 2599512635 | |||
| 1998 | 2599519986 | |||
| 1999 | 2599891311 | |||
| 2000 | 2601689661 | |||
| 2001 | 2601796206 | |||
| 2002 | 2606073355 | |||
| 2003 | 2606126999 | |||
| 2004 | 2624481855 | |||
| 2005 | 2643789931 | |||
| 2006 | 2643845557 | |||
| 2007 | 2643866137 | |||
| 2008 | 2643874319 | |||
| 2009 | 2643956432 | |||
| 2010 | 2643994126 | |||
| 2011 | 2644025526 | |||
| 2012 | 2644160903 | |||
| 2013 | 2644187401 | |||
| 2014 | 2644214349 | |||
| 2015 | 2644292951 | |||
| 2016 | 2644621915 | |||
| 2017 | 2644647967 | |||
| 2018 | 2677899868 | |||
| 2019 | 2715751158 | |||
| 2020 | 2715758158 | |||
| 2021 | 2718635104 | |||
| 2022 | 2723249833 | |||
| 2023 | 2739201896 | |||
| 2024 | 2739259302 | |||
| 2025 | 2739314133 | |||
| 2026 | 2774123380 | |||
| 2027 | 2774132763 | |||
| 2028 | 2784263423 | |||
| 2029 | 2784316078 | |||
| 2030 | 2792837547 | |||
| 2031 | 2808930548 | |||
| 2032 | 2808952670 | |||
| 2033 | 2808957335 | |||
| 2034 | 2808977790 | |||
| 2035 | 2808993270 | |||
| 2036 | 2809218709 | |||
| 2037 | 2819655598 | |||
| 2038 | 2824672912 | |||
| 2039 | 2824689444 | |||
| 2040 | 2824705356 | |||
| 2041 | 2824755503 | |||
| 2042 | 2824763787 | |||
| 2043 | 2842682216 | |||
| 2044 | 2842827691 | |||
| 2045 | 2842836449 | |||
| 2046 | 2842841008 | |||
| 2047 | 2842844563 | |||
| 2048 | 2847935644 | |||
| 2049 | 2852662403 | |||
| 2050 | 2860340736 | |||
| 2051 | 2878033839 | |||
| 2052 | 2880234464 | |||
| 2053 | 2881673396 | |||
| 2054 | 2900582412 | |||
| 2055 | 2904521397 | |||
| 2056 | 2904555574 | |||
| 2057 | 2904698552 | |||
| 2058 | 2904716539 | |||
| 2059 | 2908762437 | |||
| 2060 | 2919068824 | |||
| 2061 | 2919387931 | |||
| 2062 | 2919461133 | |||
| 2063 | 2919489886 | |||
| 2064 | 2919706865 | |||
| 2065 | 2928061011 | |||
| 2066 | 2928070104 | |||
| 2067 | 2929526598 | |||
| 2068 | 2931394940 | |||
| 2069 | 2931403289 | |||
| 2070 | 2935678657 | |||
| 2071 | 2935687852 | |||
| 2072 | 2935714872 | |||
| 2073 | 2935726563 | |||
| 2074 | 2935733690 | |||
| 2075 | 2935743069 | |||
| 2076 | 2935754892 | |||
| 2077 | 2940559731 | |||
| 2078 | 2945950403 | |||
| 2079 | 2945964996 | |||
| 2080 | 2946008561 | |||
| 2081 | 2946032089 | |||
| 2082 | 2947238918 | |||
| 2083 | 2969308614 | |||
| 2084 | 2974290013 | |||
| 2085 | 2990714192 | |||
| 2086 | 2998143919 | |||
| 2087 | 3001890424 | |||
| 2088 | 3007515620 | |||
| 2089 | 3007616933 | |||
| 2090 | 3007625638 | |||
| 2091 | 3007857825 | |||
| 2092 | 3007865348 | |||
| 2093 | 8029996958 | |||
| 2094 | 8054350790 | |||
| 2095 | 8054507450 | |||
| 2096 | 8055822393 | |||
| 2097 | 8056127639 | |||
| 2098 | 8056135855 | |||
| 2099 | 8056153174 | |||
| 2100 | 8056167357 | |||
| 2101 | 8056179536 | |||
| 2102 | 8056692478 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y98-assembly1.cif.gz_A | crystal structure of ligd-apo form from sphingobium sp. strain syk-6 | 0.9608 | 12 | 192 |
| 1yxm-assembly1.cif.gz_D | crystal structure of peroxisomal trans 2-enoyl coa reductase | 0.957 | 4 | 274 |
| 1ae1-assembly1.cif.gz_B | tropinone reductase-i complex with nadp | 0.9564 | 13 | 258 |
| 7djs-assembly1.cif.gz_B | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.9552 | 15 | 256 |
| 6lln-assembly1.cif.gz_A | citronellol catabolism dehydrogenase (atub) [pseudomonas aeruginosa pao1] | 0.9543 | 3 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4y98A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9608 | 12 | 192 | 3.40.50.720 |
| 1yxmD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.957 | 4 | 274 | 3.40.50.720 |
| 1zemG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.95 | 12 | 252 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.949 | 10 | 256 | 3.40.50.720 |
| 5jc8D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9486 | 9 | 258 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A835ZEV5-F1-model_v4 | Uncharacterized protein | 0.9695 | 40 | 249 |
GO:0005313
GO:0005509 GO:0005743 GO:0015183 GO:0043490 |
| AF-A0A7V4JF01-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9636 | 12 | 191 |
GO:0016616
GO:0030497 |
| AF-A0A383B9X5-F1-model_v4 | Uncharacterized protein | 0.9624 | 13 | 131 |
GO:0016616
|
| AF-A0A559M6V2-F1-model_v4 | Putative oxidoreductase | 0.962 | 13 | 103 |
GO:0016491
|
| AF-A0A7W1NW92-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9616 | 10 | 134 |
|