F489091
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1052 | 427 | 1044 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100747762|Ga0070694_1007477621 |
| Length | 142 |
| Sequence | MLTKRIQGLNKDKDNIMARIQGVDIPDNKRGEISLTYIYGIGRRRAQQILTKAGVNWDKKAKDWNDEESNAIRSIISESFKVEGTLRSEVQLSIKRLMDIGSYRGLRHRKGLPVRGQTTKNNARTRKGKRKTVANKKKVTKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 3 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 4 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 5 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 6 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 7 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 8 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 89 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 107 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 181 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 184 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 198 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 199 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 214 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 220 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 227 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 228 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 237 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 239 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 240 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 241 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 242 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 243 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 244 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 245 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 246 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 249 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 250 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 251 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 254 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 255 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 256 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 257 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 258 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 306 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 307 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 308 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 356 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 357 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 358 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 359 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 360 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 361 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 364 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 365 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 366 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 367 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 368 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 369 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 370 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 375 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 376 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 380 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 381 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 391 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 393 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 395 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 397 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 402 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300060244 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.1 |
| Metatranscriptomes | 24.14 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.8 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 87.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10080733 | 3300003316 | Bacteria | 3504 |
| 2 | rootH1_10114576 | 3300003316 | Bacteria | 1636 |
| 3 | rootL2_10010167 | 3300003322 | Bacteria | 22542 |
| 4 | rootL2_10023239 | 3300003322 | Bacteria | 4007 |
| 5 | rootL2_10094850 | 3300003322 | Bacteria | 2750 |
| 6 | rootL2_10101710 | 3300003322 | Bacteria | 4114 |
| 7 | rootH1_10006036 | 3300003323 | Bacteria | 32132 |
| 8 | rootH1_10006987 | 3300003323 | Bacteria | 3526 |
| 9 | rootH1_10006988 | 3300003323 | Bacteria | 47616 |
| 10 | rootH1_10012787 | 3300003323 | Bacteria | 4305 |
| 11 | Ga0007417J51691_1057812 | 3300003544 | Bacteria | 1952 |
| 12 | Ga0055536_1001261 | 3300003781 | Bacteria | 15585 |
| 13 | Ga0055531_10000409 | 3300003794 | Bacteria | 41322 |
| 14 | Ga0055543_1051443 | 3300004625 | Bacteria | 674 |
| 15 | Ga0058859_10072763 | 3300004798 | Bacteria | 813 |
| 16 | Ga0058859_11480586 | 3300004798 | Bacteria | 2098 |
| 17 | Ga0058860_10016344 | 3300004801 | Bacteria | 1770 |
| 18 | Ga0058860_11946433 | 3300004801 | Bacteria | 984 |
| 19 | Ga0065165_1000131 | 3300005262 | Bacteria | 128880 |
| 20 | Ga0065165_1000831 | 3300005262 | Bacteria | 40595 |
| 21 | Ga0065714_10024660 | 3300005288 | Bacteria | 1118 |
| 22 | Ga0065704_10124782 | 3300005289 | Bacteria | 1712 |
| 23 | Ga0065712_10322046 | 3300005290 | Bacteria | 814 |
| 24 | Ga0065712_10399976 | 3300005290 | Bacteria | 732 |
| 25 | Ga0065715_10088958 | 3300005293 | Bacteria | 20336 |
| 26 | Ga0065707_10148021 | 3300005295 | Bacteria | 1690 |
| 27 | Ga0070658_10099188 | 3300005327 | Bacteria | 2407 |
| 28 | Ga0070658_10141402 | 3300005327 | Bacteria | 2011 |
| 29 | Ga0070683_100094294 | 3300005329 | Bacteria | 2813 |
| 30 | Ga0070683_101602232 | 3300005329 | Bacteria | 626 |
| 31 | Ga0070670_100203096 | 3300005331 | Bacteria | 1722 |
| 32 | Ga0070670_101702085 | 3300005331 | Bacteria | 580 |
| 33 | Ga0070677_10102463 | 3300005333 | Bacteria | 1264 |
| 34 | Ga0070677_10938540 | 3300005333 | Bacteria | 502 |
| 35 | Ga0068869_100672086 | 3300005334 | Bacteria | 881 |
| 36 | Ga0068869_100682944 | 3300005334 | Bacteria | 874 |
| 37 | Ga0068869_101312662 | 3300005334 | Bacteria | 638 |
| 38 | Ga0070682_100181774 | 3300005337 | Bacteria | 1470 |
| 39 | Ga0070682_101095219 | 3300005337 | Bacteria | 667 |
| 40 | Ga0070682_101996772 | 3300005337 | Bacteria | 510 |
| 41 | Ga0070682_102062090 | 3300005337 | Bacteria | 503 |
| 42 | Ga0068868_100118877 | 3300005338 | Bacteria | 2154 |
| 43 | Ga0068868_101200705 | 3300005338 | Bacteria | 701 |
| 44 | Ga0068868_101554126 | 3300005338 | Bacteria | 621 |
| 45 | Ga0070660_100106781 | 3300005339 | Bacteria | 2224 |
| 46 | Ga0070689_100197354 | 3300005340 | Bacteria | 1641 |
| 47 | Ga0070689_100456971 | 3300005340 | Bacteria | 1087 |
| 48 | Ga0070689_100805392 | 3300005340 | Bacteria | 826 |
| 49 | Ga0070689_101892379 | 3300005340 | Bacteria | 545 |
| 50 | Ga0070687_100503723 | 3300005343 | Bacteria | 815 |
| 51 | Ga0070661_101086899 | 3300005344 | Bacteria | 666 |
| 52 | Ga0070661_101753018 | 3300005344 | Bacteria | 527 |
| 53 | Ga0070692_10481297 | 3300005345 | Bacteria | 800 |
| 54 | Ga0070692_10517558 | 3300005345 | Bacteria | 776 |
| 55 | Ga0070692_11402868 | 3300005345 | Bacteria | 504 |
| 56 | Ga0070669_100236924 | 3300005353 | Bacteria | 1448 |
| 57 | Ga0070669_100399931 | 3300005353 | Bacteria | 1123 |
| 58 | Ga0070669_100691635 | 3300005353 | Bacteria | 860 |
| 59 | Ga0070669_100852054 | 3300005353 | Bacteria | 777 |
| 60 | Ga0070675_100098425 | 3300005354 | Bacteria | 2460 |
| 61 | Ga0070675_100589660 | 3300005354 | Bacteria | 1007 |
| 62 | Ga0070675_100849389 | 3300005354 | Bacteria | 835 |
| 63 | Ga0070674_100584487 | 3300005356 | Bacteria | 941 |
| 64 | Ga0070673_100139381 | 3300005364 | Bacteria | 2044 |
| 65 | Ga0070688_100455218 | 3300005365 | Bacteria | 957 |
| 66 | Ga0070659_100004313 | 3300005366 | Bacteria | 10156 |
| 67 | Ga0070667_101250206 | 3300005367 | Bacteria | 695 |
| 68 | Ga0070700_100869580 | 3300005441 | Bacteria | 731 |
| 69 | Ga0070694_100747762 | 3300005444 | Bacteria | 798 |
| 70 | Ga0070678_100169113 | 3300005456 | Bacteria | 1778 |
| 71 | Ga0070662_100723238 | 3300005457 | Bacteria | 843 |
| 72 | Ga0068867_100422091 | 3300005459 | Bacteria | 1130 |
| 73 | Ga0068867_100751649 | 3300005459 | Bacteria | 865 |
| 74 | Ga0068867_101203509 | 3300005459 | Bacteria | 696 |
| 75 | Ga0070685_10190454 | 3300005466 | Bacteria | 1326 |
| 76 | Ga0070685_10535775 | 3300005466 | Bacteria | 834 |
| 77 | Ga0070698_100226337 | 3300005471 | Bacteria | 1803 |
| 78 | Ga0070679_100029815 | 3300005530 | Bacteria | 5383 |
| 79 | Ga0070684_100251908 | 3300005535 | Bacteria | 1614 |
| 80 | Ga0068853_100205382 | 3300005539 | Bacteria | 1794 |
| 81 | Ga0068853_100771141 | 3300005539 | Bacteria | 920 |
| 82 | Ga0070672_100147361 | 3300005543 | Bacteria | 1945 |
| 83 | Ga0070686_100028804 | 3300005544 | Bacteria | 3371 |
| 84 | Ga0070665_100000442 | 3300005548 | Bacteria | 60619 |
| 85 | Ga0070665_100215306 | 3300005548 | Bacteria | 1922 |
| 86 | Ga0068855_100071240 | 3300005563 | Bacteria | 4043 |
| 87 | Ga0068855_100279474 | 3300005563 | Bacteria | 1854 |
| 88 | Ga0068855_100690901 | 3300005563 | Bacteria | 1093 |
| 89 | Ga0068855_100922798 | 3300005563 | Bacteria | 921 |
| 90 | Ga0068855_101481603 | 3300005563 | Bacteria | 697 |
| 91 | Ga0068855_101984854 | 3300005563 | Bacteria | 588 |
| 92 | Ga0070664_100586946 | 3300005564 | Bacteria | 1033 |
| 93 | Ga0068857_100062430 | 3300005577 | Bacteria | 3312 |
| 94 | Ga0068857_100809874 | 3300005577 | Bacteria | 895 |
| 95 | Ga0068857_102140696 | 3300005577 | Bacteria | 549 |
| 96 | Ga0068854_100877885 | 3300005578 | Bacteria | 787 |
| 97 | Ga0068854_101620838 | 3300005578 | Bacteria | 590 |
| 98 | Ga0068856_100147792 | 3300005614 | Bacteria | 2358 |
| 99 | Ga0068856_100340133 | 3300005614 | Bacteria | 1519 |
| 100 | Ga0068856_100414628 | 3300005614 | Bacteria | 1367 |
| 101 | Ga0068856_101392516 | 3300005614 | Bacteria | 716 |
| 102 | Ga0068852_100113127 | 3300005616 | Bacteria | 2471 |
| 103 | Ga0068852_100372550 | 3300005616 | Bacteria | 1399 |
| 104 | Ga0068852_100898449 | 3300005616 | Bacteria | 903 |
| 105 | Ga0068852_101144888 | 3300005616 | Bacteria | 799 |
| 106 | Ga0068852_101328805 | 3300005616 | Bacteria | 741 |
| 107 | Ga0068859_100254340 | 3300005617 | Bacteria | 1847 |
| 108 | Ga0068859_101280075 | 3300005617 | Bacteria | 808 |
| 109 | Ga0068859_102629967 | 3300005617 | Bacteria | 553 |
| 110 | Ga0068864_100016890 | 3300005618 | Bacteria | 6082 |
| 111 | Ga0068864_100610733 | 3300005618 | Bacteria | 1059 |
| 112 | Ga0068861_100005628 | 3300005719 | Bacteria | 8500 |
| 113 | Ga0068861_100572872 | 3300005719 | Bacteria | 1032 |
| 114 | Ga0068861_101591346 | 3300005719 | Bacteria | 643 |
| 115 | Ga0068870_10241879 | 3300005840 | Bacteria | 1114 |
| 116 | Ga0068863_100288457 | 3300005841 | Bacteria | 1591 |
| 117 | Ga0068863_100949786 | 3300005841 | Bacteria | 861 |
| 118 | Ga0068858_100805855 | 3300005842 | Bacteria | 916 |
| 119 | Ga0068858_101795383 | 3300005842 | Bacteria | 606 |
| 120 | Ga0068862_100264784 | 3300005844 | Bacteria | 1570 |
| 121 | Ga0070715_10765109 | 3300006163 | Bacteria | 583 |
| 122 | Ga0070715_10877222 | 3300006163 | Bacteria | 550 |
| 123 | Ga0075366_10025131 | 3300006195 | Bacteria | 3477 |
| 124 | Ga0075366_10160154 | 3300006195 | Unclassified | 1364 |
| 125 | Ga0097621_100015405 | 3300006237 | Bacteria | 5751 |
| 126 | Ga0097621_100250778 | 3300006237 | Bacteria | 1550 |
| 127 | Ga0097621_101183439 | 3300006237 | Bacteria | 719 |
| 128 | Ga0075370_10041721 | 3300006353 | Bacteria | 2591 |
| 129 | Ga0068871_100000354 | 3300006358 | Bacteria | 31915 |
| 130 | Ga0068871_101258025 | 3300006358 | Bacteria | 695 |
| 131 | Ga0075428_100022554 | 3300006844 | Bacteria | 6969 |
| 132 | Ga0075428_100327241 | 3300006844 | Bacteria | 1646 |
| 133 | Ga0075430_100102450 | 3300006846 | Bacteria | 2390 |
| 134 | Ga0075430_100867684 | 3300006846 | Bacteria | 744 |
| 135 | Ga0075431_101009177 | 3300006847 | Bacteria | 799 |
| 136 | Ga0068865_101004942 | 3300006881 | Bacteria | 730 |
| 137 | Ga0097620_100254354 | 3300006931 | Bacteria | 1847 |
| 138 | Ga0097620_101280234 | 3300006931 | Bacteria | 808 |
| 139 | Ga0097620_102629975 | 3300006931 | Bacteria | 553 |
| 140 | Ga0105240_10043033 | 3300009093 | Bacteria | 5750 |
| 141 | Ga0111539_10001098 | 3300009094 | Bacteria | 35755 |
| 142 | Ga0111539_10066150 | 3300009094 | Bacteria | 4269 |
| 143 | Ga0111539_10184231 | 3300009094 | Bacteria | 2438 |
| 144 | Ga0111539_10587329 | 3300009094 | Bacteria | 1297 |
| 145 | Ga0111539_11801897 | 3300009094 | Bacteria | 710 |
| 146 | Ga0111539_12006044 | 3300009094 | Bacteria | 671 |
| 147 | Ga0114129_11333703 | 3300009147 | Bacteria | 888 |
| 148 | Ga0105243_11926519 | 3300009148 | Bacteria | 624 |
| 149 | Ga0105242_10196886 | 3300009176 | Bacteria | 1787 |
| 150 | Ga0105242_10541980 | 3300009176 | Bacteria | 1114 |
| 151 | Ga0105242_11752146 | 3300009176 | Bacteria | 658 |
| 152 | Ga0105237_10078649 | 3300009545 | Bacteria | 3287 |
| 153 | Ga0105237_10126608 | 3300009545 | Bacteria | 2549 |
| 154 | Ga0105237_10417718 | 3300009545 | Bacteria | 1347 |
| 155 | Ga0105238_10207266 | 3300009551 | Bacteria | 1936 |
| 156 | Ga0105238_11801165 | 3300009551 | Bacteria | 644 |
| 157 | Ga0105249_10005625 | 3300009553 | Bacteria | 10842 |
| 158 | Ga0105249_11257557 | 3300009553 | Bacteria | 812 |
| 159 | Ga0105249_11533657 | 3300009553 | Bacteria | 739 |
| 160 | Ga0105239_10176868 | 3300010375 | Bacteria | 2387 |
| 161 | Ga0105239_10722488 | 3300010375 | Bacteria | 1139 |
| 162 | Ga0105239_12227894 | 3300010375 | Bacteria | 637 |
| 163 | Ga0157337_1035664 | 3300012483 | Bacteria | 529 |
| 164 | Ga0157315_1052551 | 3300012508 | Bacteria | 552 |
| 165 | Ga0157373_10059430 | 3300013100 | Bacteria | 2709 |
| 166 | Ga0157373_10065390 | 3300013100 | Bacteria | 2573 |
| 167 | Ga0157373_10075797 | 3300013100 | Bacteria | 2373 |
| 168 | Ga0157373_10161673 | 3300013100 | Bacteria | 1576 |
| 169 | Ga0157371_10035324 | 3300013102 | Bacteria | 3582 |
| 170 | Ga0157371_10407032 | 3300013102 | Bacteria | 996 |
| 171 | Ga0157371_10491410 | 3300013102 | Bacteria | 906 |
| 172 | Ga0157371_10586614 | 3300013102 | Bacteria | 828 |
| 173 | Ga0157371_10610722 | 3300013102 | Bacteria | 812 |
| 174 | Ga0157371_10766457 | 3300013102 | Bacteria | 725 |
| 175 | Ga0157370_10054126 | 3300013104 | Bacteria | 3826 |
| 176 | Ga0157370_10085830 | 3300013104 | Bacteria | 2957 |
| 177 | Ga0157370_10209209 | 3300013104 | Bacteria | 1808 |
| 178 | Ga0157370_10217664 | 3300013104 | Bacteria | 1769 |
| 179 | Ga0157370_10476306 | 3300013104 | Bacteria | 1147 |
| 180 | Ga0157370_10749305 | 3300013104 | Bacteria | 890 |
| 181 | Ga0157370_11101024 | 3300013104 | Bacteria | 718 |
| 182 | Ga0157370_11918181 | 3300013104 | Bacteria | 531 |
| 183 | Ga0157369_10062018 | 3300013105 | Bacteria | 4030 |
| 184 | Ga0157369_10235969 | 3300013105 | Bacteria | 1911 |
| 185 | Ga0157369_10292053 | 3300013105 | Bacteria | 1697 |
| 186 | Ga0157369_10340301 | 3300013105 | Bacteria | 1558 |
| 187 | Ga0157369_10408180 | 3300013105 | Bacteria | 1409 |
| 188 | Ga0157369_11515515 | 3300013105 | Bacteria | 682 |
| 189 | Ga0157369_11822901 | 3300013105 | Bacteria | 618 |
| 190 | Ga0157374_10103611 | 3300013296 | Bacteria | 2730 |
| 191 | Ga0157374_10320265 | 3300013296 | Bacteria | 1536 |
| 192 | Ga0157374_10395088 | 3300013296 | Bacteria | 1379 |
| 193 | Ga0157374_11848062 | 3300013296 | Bacteria | 630 |
| 194 | Ga0157378_10000333 | 3300013297 | Bacteria | 46410 |
| 195 | Ga0157378_10515618 | 3300013297 | Bacteria | 1196 |
| 196 | Ga0163162_10000525 | 3300013306 | Bacteria | 35526 |
| 197 | Ga0163162_10004198 | 3300013306 | Bacteria | 13853 |
| 198 | Ga0163162_10272120 | 3300013306 | Bacteria | 1826 |
| 199 | Ga0163162_10752406 | 3300013306 | Bacteria | 1094 |
| 200 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 201 | Ga0157372_10033754 | 3300013307 | Bacteria | 5623 |
| 202 | Ga0157372_10052106 | 3300013307 | Bacteria | 4556 |
| 203 | Ga0157372_10124074 | 3300013307 | Bacteria | 2969 |
| 204 | Ga0157372_10217417 | 3300013307 | Bacteria | 2215 |
| 205 | Ga0157372_10417423 | 3300013307 | Bacteria | 1564 |
| 206 | Ga0157372_11136247 | 3300013307 | Bacteria | 903 |
| 207 | Ga0157372_11235425 | 3300013307 | Bacteria | 863 |
| 208 | Ga0157375_10174959 | 3300013308 | Bacteria | 2296 |
| 209 | Ga0157375_11000068 | 3300013308 | Bacteria | 976 |
| 210 | Ga0163163_10812204 | 3300014325 | Bacteria | 999 |
| 211 | Ga0163163_11617325 | 3300014325 | Bacteria | 709 |
| 212 | Ga0163163_13033058 | 3300014325 | Bacteria | 524 |
| 213 | Ga0157380_10231312 | 3300014326 | Bacteria | 1660 |
| 214 | Ga0157380_10816156 | 3300014326 | Bacteria | 951 |
| 215 | Ga0157377_10445935 | 3300014745 | Bacteria | 892 |
| 216 | Ga0157377_11187804 | 3300014745 | Bacteria | 590 |
| 217 | Ga0157377_11213655 | 3300014745 | Bacteria | 585 |
| 218 | Ga0157379_10078252 | 3300014968 | Bacteria | 2961 |
| 219 | Ga0157379_10604201 | 3300014968 | Bacteria | 1024 |
| 220 | Ga0157379_10648015 | 3300014968 | Bacteria | 989 |
| 221 | Ga0157379_11096619 | 3300014968 | Bacteria | 762 |
| 222 | Ga0157376_10018195 | 3300014969 | Bacteria | 5379 |
| 223 | Ga0157376_10076734 | 3300014969 | Bacteria | 2856 |
| 224 | Ga0157376_10630720 | 3300014969 | Bacteria | 1070 |
| 225 | Ga0157376_10669329 | 3300014969 | Bacteria | 1040 |
| 226 | Ga0157376_11507598 | 3300014969 | Bacteria | 705 |
| 227 | Ga0163161_10031164 | 3300017792 | Bacteria | 3798 |
| 228 | Ga0163161_10997712 | 3300017792 | Bacteria | 715 |
| 229 | Ga0163161_11060844 | 3300017792 | Bacteria | 695 |
| 230 | Ga0206356_10977936 | 3300020070 | Bacteria | 874 |
| 231 | Ga0206356_11894588 | 3300020070 | Bacteria | 1147 |
| 232 | Ga0206355_1245730 | 3300020076 | Bacteria | 516 |
| 233 | Ga0206351_10875467 | 3300020077 | Bacteria | 922 |
| 234 | Ga0206352_10531954 | 3300020078 | Unclassified | 1143 |
| 235 | Ga0206352_10833769 | 3300020078 | Bacteria | 946 |
| 236 | Ga0206354_10045676 | 3300020081 | Bacteria | 965 |
| 237 | Ga0206354_10659544 | 3300020081 | Bacteria | 896 |
| 238 | Ga0206354_10881077 | 3300020081 | Bacteria | 1179 |
| 239 | Ga0213876_10044608 | 3300021384 | Bacteria | 2343 |
| 240 | Ga0224712_10000155 | 3300022467 | Bacteria | 11497 |
| 241 | Ga0207666_1015241 | 3300025271 | Bacteria | 1092 |
| 242 | Ga0209455_1001884 | 3300025272 | Bacteria | 8718 |
| 243 | Ga0209676_1000332 | 3300025292 | Bacteria | 90798 |
| 244 | Ga0209050_1002964 | 3300025298 | Bacteria | 13262 |
| 245 | Ga0209050_1033615 | 3300025298 | Bacteria | 1551 |
| 246 | Ga0209050_1046505 | 3300025298 | Bacteria | 1140 |
| 247 | Ga0207426_1099924 | 3300025302 | Bacteria | 751 |
| 248 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 249 | Ga0209257_1012184 | 3300025304 | Bacteria | 4017 |
| 250 | Ga0207697_10026925 | 3300025315 | Bacteria | 2351 |
| 251 | Ga0207682_10066073 | 3300025893 | Bacteria | 1524 |
| 252 | Ga0207682_10075858 | 3300025893 | Bacteria | 1432 |
| 253 | Ga0207688_10887863 | 3300025901 | Bacteria | 564 |
| 254 | Ga0207647_10000054 | 3300025904 | Bacteria | 86704 |
| 255 | Ga0207647_10019623 | 3300025904 | Bacteria | 4544 |
| 256 | Ga0207645_10035476 | 3300025907 | Bacteria | 3202 |
| 257 | Ga0207643_10005441 | 3300025908 | Bacteria | 6810 |
| 258 | Ga0207684_11040652 | 3300025910 | Bacteria | 683 |
| 259 | Ga0207695_10005702 | 3300025913 | Bacteria | 16420 |
| 260 | Ga0207671_10000030 | 3300025914 | Bacteria | 248197 |
| 261 | Ga0207671_10335610 | 3300025914 | Bacteria | 1197 |
| 262 | Ga0207671_10437008 | 3300025914 | Bacteria | 1042 |
| 263 | Ga0207660_10885820 | 3300025917 | Bacteria | 728 |
| 264 | Ga0207662_10030041 | 3300025918 | Bacteria | 3152 |
| 265 | Ga0207662_10917504 | 3300025918 | Bacteria | 620 |
| 266 | Ga0207649_10906369 | 3300025920 | Bacteria | 691 |
| 267 | Ga0207652_10059424 | 3300025921 | Bacteria | 3295 |
| 268 | Ga0207652_11015828 | 3300025921 | Bacteria | 728 |
| 269 | Ga0207646_10734576 | 3300025922 | Bacteria | 881 |
| 270 | Ga0207681_10185717 | 3300025923 | Bacteria | 1587 |
| 271 | Ga0207681_11017919 | 3300025923 | Bacteria | 695 |
| 272 | Ga0207681_11187502 | 3300025923 | Bacteria | 641 |
| 273 | Ga0207694_10175224 | 3300025924 | Bacteria | 1738 |
| 274 | Ga0207650_10325652 | 3300025925 | Bacteria | 1259 |
| 275 | Ga0207650_11114176 | 3300025925 | Bacteria | 672 |
| 276 | Ga0207650_11790085 | 3300025925 | Bacteria | 520 |
| 277 | Ga0207659_10242738 | 3300025926 | Bacteria | 1458 |
| 278 | Ga0207644_10264422 | 3300025931 | Bacteria | 1377 |
| 279 | Ga0207690_10003583 | 3300025932 | Bacteria | 9247 |
| 280 | Ga0207686_10292818 | 3300025934 | Bacteria | 1206 |
| 281 | Ga0207670_10032455 | 3300025936 | Bacteria | 3358 |
| 282 | Ga0207670_10698976 | 3300025936 | Bacteria | 839 |
| 283 | Ga0207669_11178282 | 3300025937 | Bacteria | 649 |
| 284 | Ga0207704_10327458 | 3300025938 | Bacteria | 1184 |
| 285 | Ga0207691_10036749 | 3300025940 | Bacteria | 4538 |
| 286 | Ga0207691_10477200 | 3300025940 | Bacteria | 1060 |
| 287 | Ga0207689_10008845 | 3300025942 | Bacteria | 8745 |
| 288 | Ga0207689_10643383 | 3300025942 | Bacteria | 893 |
| 289 | Ga0207689_10770109 | 3300025942 | Bacteria | 812 |
| 290 | Ga0207661_10064144 | 3300025944 | Bacteria | 2977 |
| 291 | Ga0207661_10073534 | 3300025944 | Bacteria | 2800 |
| 292 | Ga0207661_11118965 | 3300025944 | Bacteria | 725 |
| 293 | Ga0207679_10437629 | 3300025945 | Bacteria | 1157 |
| 294 | Ga0207679_11086121 | 3300025945 | Bacteria | 734 |
| 295 | Ga0207679_11510420 | 3300025945 | Bacteria | 616 |
| 296 | Ga0207667_10163214 | 3300025949 | Bacteria | 2291 |
| 297 | Ga0207667_10265903 | 3300025949 | Bacteria | 1753 |
| 298 | Ga0207667_10379268 | 3300025949 | Bacteria | 1441 |
| 299 | Ga0207651_10363737 | 3300025960 | Bacteria | 1222 |
| 300 | Ga0207712_10035246 | 3300025961 | Bacteria | 3398 |
| 301 | Ga0207712_10294118 | 3300025961 | Bacteria | 1330 |
| 302 | Ga0207668_11180269 | 3300025972 | Bacteria | 688 |
| 303 | Ga0207668_11900150 | 3300025972 | Bacteria | 537 |
| 304 | Ga0207640_10371855 | 3300025981 | Bacteria | 1155 |
| 305 | Ga0207640_11470767 | 3300025981 | Bacteria | 612 |
| 306 | Ga0207640_11472386 | 3300025981 | Bacteria | 611 |
| 307 | Ga0207677_10140375 | 3300026023 | Bacteria | 1849 |
| 308 | Ga0207677_10483948 | 3300026023 | Bacteria | 1067 |
| 309 | Ga0207677_11143544 | 3300026023 | Bacteria | 711 |
| 310 | Ga0207703_11270456 | 3300026035 | Bacteria | 708 |
| 311 | Ga0207703_11292834 | 3300026035 | Bacteria | 701 |
| 312 | Ga0207639_10486623 | 3300026041 | Bacteria | 1125 |
| 313 | Ga0207639_10537802 | 3300026041 | Bacteria | 1072 |
| 314 | Ga0207639_10771704 | 3300026041 | Bacteria | 895 |
| 315 | Ga0207639_11085442 | 3300026041 | Bacteria | 750 |
| 316 | Ga0207678_10089854 | 3300026067 | Bacteria | 2625 |
| 317 | Ga0207678_10125218 | 3300026067 | Bacteria | 2192 |
| 318 | Ga0207708_10085358 | 3300026075 | Bacteria | 2428 |
| 319 | Ga0207708_11156814 | 3300026075 | Bacteria | 676 |
| 320 | Ga0207702_10068465 | 3300026078 | Bacteria | 3050 |
| 321 | Ga0207702_10217569 | 3300026078 | Bacteria | 1779 |
| 322 | Ga0207702_10318830 | 3300026078 | Bacteria | 1480 |
| 323 | Ga0207702_11601103 | 3300026078 | Bacteria | 645 |
| 324 | Ga0207702_11973600 | 3300026078 | Bacteria | 574 |
| 325 | Ga0207641_11393968 | 3300026088 | Bacteria | 702 |
| 326 | Ga0207641_11467465 | 3300026088 | Bacteria | 683 |
| 327 | Ga0207648_10077148 | 3300026089 | Bacteria | 2904 |
| 328 | Ga0207648_10636761 | 3300026089 | Bacteria | 985 |
| 329 | Ga0207648_10662195 | 3300026089 | Bacteria | 965 |
| 330 | Ga0207648_10787707 | 3300026089 | Bacteria | 884 |
| 331 | Ga0207676_10561767 | 3300026095 | Bacteria | 1091 |
| 332 | Ga0207676_10905614 | 3300026095 | Bacteria | 865 |
| 333 | Ga0207674_10071461 | 3300026116 | Bacteria | 3487 |
| 334 | Ga0207674_10084524 | 3300026116 | Bacteria | 3171 |
| 335 | Ga0207674_10090260 | 3300026116 | Bacteria | 3055 |
| 336 | Ga0207674_10560319 | 3300026116 | Bacteria | 1104 |
| 337 | Ga0207674_10857040 | 3300026116 | Bacteria | 876 |
| 338 | Ga0207675_100515504 | 3300026118 | Bacteria | 1191 |
| 339 | Ga0207675_101921344 | 3300026118 | Bacteria | 610 |
| 340 | Ga0207683_11340189 | 3300026121 | Bacteria | 662 |
| 341 | Ga0207698_10163778 | 3300026142 | Bacteria | 1949 |
| 342 | Ga0207698_10254961 | 3300026142 | Bacteria | 1608 |
| 343 | Ga0207698_10545686 | 3300026142 | Bacteria | 1135 |
| 344 | Ga0207698_11312354 | 3300026142 | Bacteria | 738 |
| 345 | Ga0209995_1014936 | 3300027471 | Bacteria | 1273 |
| 346 | Ga0209970_1022004 | 3300027614 | Bacteria | 1081 |
| 347 | Ga0207428_10019856 | 3300027907 | Bacteria | 5724 |
| 348 | Ga0207428_10823469 | 3300027907 | Bacteria | 659 |
| 349 | Ga0268266_10000845 | 3300028379 | Bacteria | 39924 |
| 350 | Ga0268265_10470075 | 3300028380 | Bacteria | 1179 |
| 351 | Ga0268265_11101547 | 3300028380 | Bacteria | 788 |
| 352 | Ga0268264_10006248 | 3300028381 | Bacteria | 10050 |
| 353 | Ga0265334_10025950 | 3300028573 | Bacteria | 2369 |
| 354 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 355 | Ga0307515_10112100 | 3300028794 | Bacteria | 3175 |
| 356 | Ga0307515_10713857 | 3300028794 | Bacteria | 619 |
| 357 | Ga0265338_10357708 | 3300028800 | Bacteria | 1048 |
| 358 | Ga0265324_10081379 | 3300029957 | Bacteria | 1101 |
| 359 | Ga0265325_10462389 | 3300031241 | Bacteria | 552 |
| 360 | Ga0265327_10000026 | 3300031251 | Bacteria | 379288 |
| 361 | Ga0265327_10000146 | 3300031251 | Bacteria | 154436 |
| 362 | Ga0265327_10000370 | 3300031251 | Bacteria | 84921 |
| 363 | Ga0265327_10004316 | 3300031251 | Bacteria | 12681 |
| 364 | Ga0265327_10090034 | 3300031251 | Bacteria | 1498 |
| 365 | Ga0265327_10117506 | 3300031251 | Bacteria | 1264 |
| 366 | Ga0265327_10141793 | 3300031251 | Bacteria | 1123 |
| 367 | Ga0265327_10145841 | 3300031251 | Bacteria | 1102 |
| 368 | Ga0265316_10363451 | 3300031344 | Bacteria | 1046 |
| 369 | Ga0307513_10045434 | 3300031456 | Bacteria | 4801 |
| 370 | Ga0307513_10045488 | 3300031456 | Bacteria | 4797 |
| 371 | Ga0307509_10104738 | 3300031507 | Bacteria | 2852 |
| 372 | Ga0307509_10368690 | 3300031507 | Bacteria | 1153 |
| 373 | Ga0307408_100133847 | 3300031548 | Bacteria | 1937 |
| 374 | Ga0307408_100349403 | 3300031548 | Bacteria | 1254 |
| 375 | Ga0307408_100682910 | 3300031548 | Bacteria | 921 |
| 376 | Ga0307408_100817856 | 3300031548 | Bacteria | 847 |
| 377 | Ga0307514_10233533 | 3300031649 | Bacteria | 1111 |
| 378 | Ga0316579_10126698 | 3300031691 | Bacteria | 1229 |
| 379 | Ga0265342_10069939 | 3300031712 | Bacteria | 2049 |
| 380 | Ga0316576_10001081 | 3300031727 | Bacteria | 14158 |
| 381 | Ga0316576_10017698 | 3300031727 | Bacteria | 4849 |
| 382 | Ga0316576_10018128 | 3300031727 | Bacteria | 4799 |
| 383 | Ga0316576_10021761 | 3300031727 | Bacteria | 4440 |
| 384 | Ga0316576_10027616 | 3300031727 | Bacteria | 3992 |
| 385 | Ga0316576_10032421 | 3300031727 | Bacteria | 3713 |
| 386 | Ga0316576_10039513 | 3300031727 | Bacteria | 3387 |
| 387 | Ga0316576_10048308 | 3300031727 | Unclassified | 3086 |
| 388 | Ga0316576_10109448 | 3300031727 | Bacteria | 2070 |
| 389 | Ga0316576_10146107 | 3300031727 | Bacteria | 1781 |
| 390 | Ga0316576_10152932 | 3300031727 | Bacteria | 1739 |
| 391 | Ga0316576_10332258 | 3300031727 | Bacteria | 1133 |
| 392 | Ga0316576_10754560 | 3300031727 | Bacteria | 702 |
| 393 | Ga0316578_10004394 | 3300031728 | Bacteria | 6652 |
| 394 | Ga0316578_10023848 | 3300031728 | Bacteria | 3427 |
| 395 | Ga0316578_10042897 | 3300031728 | Bacteria | 2625 |
| 396 | Ga0316578_10081543 | 3300031728 | Bacteria | 1925 |
| 397 | Ga0316578_10312557 | 3300031728 | Bacteria | 939 |
| 398 | Ga0307405_10015203 | 3300031731 | Bacteria | 4161 |
| 399 | Ga0316577_10022920 | 3300031733 | Bacteria | 3468 |
| 400 | Ga0307413_10577032 | 3300031824 | Bacteria | 917 |
| 401 | Ga0307410_10235600 | 3300031852 | Bacteria | 1416 |
| 402 | Ga0307410_10701487 | 3300031852 | Bacteria | 853 |
| 403 | Ga0307406_10857065 | 3300031901 | Bacteria | 771 |
| 404 | Ga0307407_10024117 | 3300031903 | Bacteria | 3185 |
| 405 | Ga0307412_10925627 | 3300031911 | Bacteria | 765 |
| 406 | Ga0307412_11489309 | 3300031911 | Bacteria | 615 |
| 407 | Ga0307409_100169562 | 3300031995 | Bacteria | 1920 |
| 408 | Ga0307409_102713699 | 3300031995 | Unclassified | 523 |
| 409 | Ga0307409_102865106 | 3300031995 | Bacteria | 510 |
| 410 | Ga0307416_100000249 | 3300032002 | Bacteria | 28628 |
| 411 | Ga0307416_100904686 | 3300032002 | Bacteria | 983 |
| 412 | Ga0307416_100938564 | 3300032002 | Bacteria | 967 |
| 413 | Ga0307416_101115206 | 3300032002 | Bacteria | 894 |
| 414 | Ga0307414_10014085 | 3300032004 | Bacteria | 4779 |
| 415 | Ga0307414_10039831 | 3300032004 | Bacteria | 3169 |
| 416 | Ga0307414_10168572 | 3300032004 | Bacteria | 1748 |
| 417 | Ga0307414_10281684 | 3300032004 | Bacteria | 1397 |
| 418 | Ga0307414_10531834 | 3300032004 | Bacteria | 1045 |
| 419 | Ga0307411_10001861 | 3300032005 | Bacteria | 8973 |
| 420 | Ga0307411_10496548 | 3300032005 | Bacteria | 1031 |
| 421 | Ga0307415_100002166 | 3300032126 | Bacteria | 9736 |
| 422 | Ga0307415_100439468 | 3300032126 | Bacteria | 1125 |
| 423 | Ga0307415_100560677 | 3300032126 | Bacteria | 1010 |
| 424 | Ga0316585_10053022 | 3300032137 | Bacteria | 1304 |
| 425 | Ga0316580_10031872 | 3300032139 | Bacteria | 1632 |
| 426 | Ga0316593_10000201 | 3300032168 | Bacteria | 9314 |
| 427 | Ga0316593_10003954 | 3300032168 | Bacteria | 3746 |
| 428 | Ga0316593_10040978 | 3300032168 | Bacteria | 1540 |
| 429 | Ga0316593_10094169 | 3300032168 | Bacteria | 1057 |
| 430 | Ga0316593_10165963 | 3300032168 | Bacteria | 808 |
| 431 | Ga0316593_10191908 | 3300032168 | Bacteria | 753 |
| 432 | Ga0316593_10193777 | 3300032168 | Bacteria | 750 |
| 433 | Ga0316593_10284069 | 3300032168 | Bacteria | 624 |
| 434 | Ga0316592_1000945 | 3300033524 | Bacteria | 4451 |
| 435 | Ga0316592_1014787 | 3300033524 | Bacteria | 1621 |
| 436 | Ga0316592_1064916 | 3300033524 | Bacteria | 822 |
| 437 | Ga0316592_1078447 | 3300033524 | Bacteria | 750 |
| 438 | Ga0316586_1108850 | 3300033527 | Bacteria | 534 |
| 439 | Ga0316588_1028900 | 3300033528 | Bacteria | 1295 |
| 440 | Ga0316588_1049774 | 3300033528 | Bacteria | 1015 |
| 441 | Ga0316588_1103022 | 3300033528 | Bacteria | 715 |
| 442 | Ga0316588_1127486 | 3300033528 | Bacteria | 646 |
| 443 | Ga0316596_1000575 | 3300033541 | Bacteria | 6430 |
| 444 | Ga0316596_1002512 | 3300033541 | Bacteria | 3927 |
| 445 | Ga0316596_1003747 | 3300033541 | Bacteria | 3360 |
| 446 | Ga0316596_1003898 | 3300033541 | Bacteria | 3305 |
| 447 | Ga0316596_1004236 | 3300033541 | Bacteria | 3203 |
| 448 | Ga0316596_1007610 | 3300033541 | Bacteria | 2565 |
| 449 | Ga0316596_1015736 | 3300033541 | Bacteria | 1888 |
| 450 | Ga0316596_1031647 | 3300033541 | Bacteria | 1375 |
| 451 | Ga0316596_1037945 | 3300033541 | Bacteria | 1261 |
| 452 | Ga0316596_1052248 | 3300033541 | Bacteria | 1083 |
| 453 | Ga0316596_1086653 | 3300033541 | Bacteria | 843 |
| 454 | Ga0316596_1131683 | 3300033541 | Bacteria | 683 |
| 455 | Ga0316596_1133994 | 3300033541 | Bacteria | 677 |
| 456 | Ga0316596_1155611 | 3300033541 | Bacteria | 628 |
| 457 | Ga0316596_1178508 | 3300033541 | Unclassified | 587 |
| 458 | Ga0316596_1216739 | 3300033541 | Bacteria | 535 |
| 459 | Ga0316596_1230401 | 3300033541 | Bacteria | 520 |
| 460 | Ga0316596_1246828 | 3300033541 | Bacteria | 503 |
| 461 | Ga0373939_0155015 | 3300035114 | Bacteria | 837 |
| 462 | Ga0373953_0213853 | 3300035117 | Bacteria | 835 |
| 463 | Ga0373946_0450082 | 3300035171 | Bacteria | 656 |
| 464 | Ga0373955_0173310 | 3300035172 | Bacteria | 1278 |
| 465 | Ga0373955_0398680 | 3300035172 | Bacteria | 836 |
| 466 | Ga0316574_0027184 | 3300035398 | Bacteria | 3445 |
| 467 | Ga0316574_0070134 | 3300035398 | Bacteria | 2213 |
| 468 | Ga0316574_0879146 | 3300035398 | Bacteria | 543 |
| 469 | Ga0373931_0120868 | 3300035691 | Bacteria | 1497 |
| 470 | Ga0373931_1163690 | 3300035691 | Bacteria | 527 |
| 471 | Ga0373935_0060159 | 3300035692 | Bacteria | 2430 |
| 472 | Ga0373927_0079676 | 3300035695 | Bacteria | 2122 |
| 473 | Ga0373937_0037881 | 3300036401 | Bacteria | 4395 |
| 474 | Ga0373937_0568783 | 3300036401 | Bacteria | 1077 |
| 475 | Ga0373937_1744908 | 3300036401 | Unclassified | 569 |
| 476 | Ga0373937_1862027 | 3300036401 | Bacteria | 548 |
| 477 | Ga0316582_0014930 | 3300036647 | Bacteria | 4424 |
| 478 | Ga0316582_0063175 | 3300036647 | Bacteria | 2379 |
| 479 | Ga0316582_0345011 | 3300036647 | Bacteria | 1024 |
| 480 | Ga0316582_0384732 | 3300036647 | Bacteria | 966 |
| 481 | Ga0316582_0402713 | 3300036647 | Bacteria | 943 |
| 482 | Ga0316582_0474089 | 3300036647 | Bacteria | 863 |
| 483 | Ga0316584_0005378 | 3300036712 | Bacteria | 8592 |
| 484 | Ga0316584_0007005 | 3300036712 | Bacteria | 7674 |
| 485 | Ga0316584_0021141 | 3300036712 | Bacteria | 4725 |
| 486 | Ga0316584_0087726 | 3300036712 | Bacteria | 2329 |
| 487 | Ga0316584_0228188 | 3300036712 | Bacteria | 1366 |
| 488 | Ga0316584_0284516 | 3300036712 | Bacteria | 1201 |
| 489 | Ga0316584_0333907 | 3300036712 | Bacteria | 1091 |
| 490 | Ga0316584_0469360 | 3300036712 | Bacteria | 888 |
| 491 | Ga0316584_0762991 | 3300036712 | Bacteria | 659 |
| 492 | Ga0395899_0172428 | 3300037312 | Bacteria | 1523 |
| 493 | Ga0395899_0437442 | 3300037312 | Unclassified | 859 |
| 494 | Ga0395900_0009171 | 3300037418 | Bacteria | 10139 |
| 495 | Ga0395900_0208359 | 3300037418 | Bacteria | 1975 |
| 496 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 497 | Ga0395905_0006283 | 3300037471 | Bacteria | 11982 |
| 498 | Ga0395905_0277254 | 3300037471 | Bacteria | 1563 |
| 499 | Ga0395905_0607028 | 3300037471 | Bacteria | 996 |
| 500 | Ga0395901_0000654 | 3300038443 | Bacteria | 39925 |
| 501 | Ga0395901_0003122 | 3300038443 | Bacteria | 16635 |
| 502 | Ga0400483_035362 | 3300039062 | Bacteria | 41412 |
| 503 | Ga0400489_18980 | 3300039093 | Bacteria | 1041 |
| 504 | Ga0436365_0305539 | 3300039437 | Bacteria | 1622 |
| 505 | Ga0436365_0676798 | 3300039437 | Bacteria | 1215 |
| 506 | Ga0436365_0968552 | 3300039437 | Unclassified | 596 |
| 507 | Ga0436365_1194723 | 3300039437 | Bacteria | 3001 |
| 508 | Ga0436363_0513489 | 3300039450 | Bacteria | 576 |
| 509 | Ga0439465_0094319 | 3300041413 | Bacteria | 1027 |
| 510 | Ga0439465_0289974 | 3300041413 | Bacteria | 611 |
| 511 | Ga0451787_079098 | 3300041441 | Bacteria | 799 |
| 512 | Ga0451789_1092803 | 3300041443 | Bacteria | 548 |
| 513 | Ga0451790_13840 | 3300041444 | Bacteria | 1039 |
| 514 | Ga0451790_41939 | 3300041444 | Bacteria | 779 |
| 515 | Ga0451790_47771 | 3300041444 | Bacteria | 576 |
| 516 | Ga0451794_03323 | 3300041446 | Bacteria | 681 |
| 517 | Ga0451794_06250 | 3300041446 | Bacteria | 577 |
| 518 | Ga0451791_0115989 | 3300041451 | Bacteria | 766 |
| 519 | Ga0451793_0885796 | 3300041452 | Bacteria | 673 |
| 520 | Ga0451793_1886256 | 3300041452 | Bacteria | 896 |
| 521 | Ga0451797_1262852 | 3300041453 | Bacteria | 515 |
| 522 | Ga0451795_0000788 | 3300041456 | Bacteria | 1628 |
| 523 | Ga0451795_0069802 | 3300041456 | Bacteria | 1163 |
| 524 | Ga0451795_0271097 | 3300041456 | Bacteria | 779 |
| 525 | Ga0451795_0389135 | 3300041456 | Bacteria | 1028 |
| 526 | Ga0451795_0817895 | 3300041456 | Bacteria | 1398 |
| 527 | Ga0451795_1033178 | 3300041456 | Bacteria | 565 |
| 528 | Ga0451795_1256897 | 3300041456 | Bacteria | 766 |
| 529 | Ga0451798_0431874 | 3300041458 | Bacteria | 589 |
| 530 | Ga0451800_0749243 | 3300041459 | Bacteria | 1308 |
| 531 | Ga0451802_0357152 | 3300041460 | Bacteria | 773 |
| 532 | Ga0451802_2183209 | 3300041460 | Bacteria | 592 |
| 533 | Ga0451804_0982978 | 3300041463 | Bacteria | 1166 |
| 534 | Ga0451808_28645 | 3300041464 | Bacteria | 510 |
| 535 | Ga0451807_1052428 | 3300041486 | Bacteria | 681 |
| 536 | Ga0451807_1974311 | 3300041486 | Bacteria | 1133 |
| 537 | Ga0451833_0948996 | 3300041491 | Bacteria | 621 |
| 538 | Ga0451837_0557409 | 3300041494 | Bacteria | 579 |
| 539 | Ga0451837_0757746 | 3300041494 | Bacteria | 709 |
| 540 | Ga0451841_0481137 | 3300041498 | Bacteria | 644 |
| 541 | Ga0451846_24529 | 3300041502 | Bacteria | 589 |
| 542 | Ga0451847_0304467 | 3300041503 | Bacteria | 901 |
| 543 | Ga0451849_1019517 | 3300041505 | Bacteria | 586 |
| 544 | Ga0451851_0610101 | 3300041507 | Bacteria | 1231 |
| 545 | Ga0451851_1332631 | 3300041507 | Bacteria | 854 |
| 546 | Ga0451852_09946 | 3300041508 | Bacteria | 554 |
| 547 | Ga0451852_13332 | 3300041508 | Bacteria | 9060 |
| 548 | Ga0451852_38882 | 3300041508 | Bacteria | 1616 |
| 549 | Ga0451855_0171797 | 3300041511 | Bacteria | 551 |
| 550 | Ga0451855_0427028 | 3300041511 | Bacteria | 630 |
| 551 | Ga0451855_0484682 | 3300041511 | Bacteria | 851 |
| 552 | Ga0451855_0497909 | 3300041511 | Bacteria | 3019 |
| 553 | Ga0451855_0824732 | 3300041511 | Bacteria | 1060 |
| 554 | Ga0451855_0918148 | 3300041511 | Bacteria | 580 |
| 555 | Ga0451855_1038422 | 3300041511 | Bacteria | 786 |
| 556 | Ga0451855_1240003 | 3300041511 | Bacteria | 2272 |
| 557 | Ga0451855_1928680 | 3300041511 | Bacteria | 536 |
| 558 | Ga0451853_0182524 | 3300041512 | Bacteria | 1259 |
| 559 | Ga0451853_3993765 | 3300041512 | Bacteria | 780 |
| 560 | Ga0439431_0118691 | 3300041997 | Bacteria | 737 |
| 561 | Ga0439441_030480 | 3300042001 | Bacteria | 1043 |
| 562 | Ga0439445_0003220 | 3300042004 | Bacteria | 3659 |
| 563 | Ga0439449_0002213 | 3300042007 | Bacteria | 7655 |
| 564 | Ga0439449_0067389 | 3300042007 | Bacteria | 1320 |
| 565 | Ga0439462_0257479 | 3300042015 | Bacteria | 503 |
| 566 | Ga0450890_042374 | 3300042127 | Bacteria | 677 |
| 567 | Ga0439446_0167257 | 3300042156 | Bacteria | 730 |
| 568 | Ga0439458_0210270 | 3300042157 | Bacteria | 534 |
| 569 | Ga0439434_0110484 | 3300042435 | Bacteria | 890 |
| 570 | Ga0439444_0062706 | 3300042437 | Bacteria | 780 |
| 571 | Ga0450893_0001114 | 3300042532 | Bacteria | 4056 |
| 572 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 573 | Ga0451577_0000433 | 3300042876 | Bacteria | 74789 |
| 574 | Ga0451577_0000690 | 3300042876 | Bacteria | 52905 |
| 575 | Ga0451577_0005144 | 3300042876 | Bacteria | 13458 |
| 576 | Ga0451577_0009644 | 3300042876 | Bacteria | 9267 |
| 577 | Ga0451577_0022022 | 3300042876 | Bacteria | 5823 |
| 578 | Ga0451577_0023389 | 3300042876 | Bacteria | 5637 |
| 579 | Ga0451577_0024955 | 3300042876 | Bacteria | 5429 |
| 580 | Ga0451577_0025303 | 3300042876 | Bacteria | 5388 |
| 581 | Ga0451577_0026335 | 3300042876 | Bacteria | 5268 |
| 582 | Ga0451577_0047949 | 3300042876 | Bacteria | 3818 |
| 583 | Ga0451577_0107299 | 3300042876 | Bacteria | 2496 |
| 584 | Ga0451577_0179508 | 3300042876 | Bacteria | 1908 |
| 585 | Ga0451577_0258725 | 3300042876 | Bacteria | 1576 |
| 586 | Ga0451577_0262956 | 3300042876 | Bacteria | 1562 |
| 587 | Ga0451577_0300325 | 3300042876 | Bacteria | 1455 |
| 588 | Ga0451577_0350301 | 3300042876 | Bacteria | 1340 |
| 589 | Ga0451577_0389652 | 3300042876 | Bacteria | 1264 |
| 590 | Ga0451577_0476389 | 3300042876 | Bacteria | 1133 |
| 591 | Ga0451577_0480707 | 3300042876 | Unclassified | 1128 |
| 592 | Ga0451577_0812103 | 3300042876 | Bacteria | 844 |
| 593 | Ga0451577_0931162 | 3300042876 | Bacteria | 782 |
| 594 | Ga0451577_1253466 | 3300042876 | Bacteria | 660 |
| 595 | Ga0451577_1631566 | 3300042876 | Bacteria | 568 |
| 596 | Ga0466972_0276976 | 3300044658 | Bacteria | 784 |
| 597 | Ga0453683_0000055 | 3300044673 | Bacteria | 192588 |
| 598 | Ga0453683_0000066 | 3300044673 | Bacteria | 164788 |
| 599 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 600 | Ga0453683_0005928 | 3300044673 | Bacteria | 8435 |
| 601 | Ga0453683_0006727 | 3300044673 | Bacteria | 7859 |
| 602 | Ga0453683_0010256 | 3300044673 | Bacteria | 6213 |
| 603 | Ga0453683_0015630 | 3300044673 | Bacteria | 4912 |
| 604 | Ga0453683_0019499 | 3300044673 | Bacteria | 4342 |
| 605 | Ga0453683_0044943 | 3300044673 | Bacteria | 2770 |
| 606 | Ga0453683_0099173 | 3300044673 | Bacteria | 1829 |
| 607 | Ga0453683_0114221 | 3300044673 | Bacteria | 1699 |
| 608 | Ga0453683_0118753 | 3300044673 | Bacteria | 1664 |
| 609 | Ga0453683_0138833 | 3300044673 | Bacteria | 1533 |
| 610 | Ga0453683_0139064 | 3300044673 | Bacteria | 1532 |
| 611 | Ga0453683_0162196 | 3300044673 | Bacteria | 1414 |
| 612 | Ga0453683_0215687 | 3300044673 | Bacteria | 1219 |
| 613 | Ga0453683_0216051 | 3300044673 | Bacteria | 1218 |
| 614 | Ga0453683_0336710 | 3300044673 | Bacteria | 968 |
| 615 | Ga0453684_0000440 | 3300044712 | Bacteria | 169397 |
| 616 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 617 | Ga0453684_0001121 | 3300044712 | Bacteria | 83919 |
| 618 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 619 | Ga0453684_0001382 | 3300044712 | Bacteria | 70292 |
| 620 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 621 | Ga0453684_0002895 | 3300044712 | Bacteria | 40244 |
| 622 | Ga0453684_0004492 | 3300044712 | Bacteria | 29332 |
| 623 | Ga0453684_0009769 | 3300044712 | Bacteria | 16659 |
| 624 | Ga0453684_0012002 | 3300044712 | Bacteria | 14406 |
| 625 | Ga0453684_0012437 | 3300044712 | Bacteria | 14033 |
| 626 | Ga0453684_0012544 | 3300044712 | Bacteria | 13952 |
| 627 | Ga0453684_0012598 | 3300044712 | Bacteria | 13911 |
| 628 | Ga0453684_0024288 | 3300044712 | Bacteria | 8867 |
| 629 | Ga0453684_0035092 | 3300044712 | Bacteria | 6941 |
| 630 | Ga0453684_0049674 | 3300044712 | Bacteria | 5527 |
| 631 | Ga0453684_0057385 | 3300044712 | Bacteria | 5039 |
| 632 | Ga0453684_0064505 | 3300044712 | Bacteria | 4678 |
| 633 | Ga0453684_0076172 | 3300044712 | Bacteria | 4212 |
| 634 | Ga0453684_0104626 | 3300044712 | Bacteria | 3455 |
| 635 | Ga0453684_0122847 | 3300044712 | Bacteria | 3132 |
| 636 | Ga0453684_0133450 | 3300044712 | Bacteria | 2976 |
| 637 | Ga0453684_0143337 | 3300044712 | Bacteria | 2849 |
| 638 | Ga0453684_0145941 | 3300044712 | Bacteria | 2819 |
| 639 | Ga0453684_0200799 | 3300044712 | Bacteria | 2324 |
| 640 | Ga0453684_0213872 | 3300044712 | Bacteria | 2238 |
| 641 | Ga0453684_0267728 | 3300044712 | Bacteria | 1954 |
| 642 | Ga0453684_0322460 | 3300044712 | Bacteria | 1749 |
| 643 | Ga0453684_0385184 | 3300044712 | Bacteria | 1573 |
| 644 | Ga0453684_0431129 | 3300044712 | Bacteria | 1471 |
| 645 | Ga0453684_0494236 | 3300044712 | Bacteria | 1355 |
| 646 | Ga0453684_0577897 | 3300044712 | Bacteria | 1234 |
| 647 | Ga0453684_0601526 | 3300044712 | Bacteria | 1205 |
| 648 | Ga0453684_0719378 | 3300044712 | Bacteria | 1083 |
| 649 | Ga0453684_0897059 | 3300044712 | Bacteria | 950 |
| 650 | Ga0453684_0992680 | 3300044712 | Bacteria | 893 |
| 651 | Ga0453684_1318108 | 3300044712 | Bacteria | 752 |
| 652 | Ga0453684_1428135 | 3300044712 | Bacteria | 716 |
| 653 | Ga0453684_1815219 | 3300044712 | Bacteria | 619 |
| 654 | Ga0466957_0664174 | 3300044842 | Bacteria | 734 |
| 655 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 656 | Ga0451576_0000204 | 3300045051 | Bacteria | 149459 |
| 657 | Ga0451576_0000689 | 3300045051 | Bacteria | 68784 |
| 658 | Ga0451576_0000783 | 3300045051 | Bacteria | 62485 |
| 659 | Ga0451576_0003461 | 3300045051 | Bacteria | 21644 |
| 660 | Ga0451576_0003652 | 3300045051 | Bacteria | 20883 |
| 661 | Ga0451576_0011102 | 3300045051 | Bacteria | 10274 |
| 662 | Ga0451576_0012395 | 3300045051 | Bacteria | 9577 |
| 663 | Ga0451576_0013908 | 3300045051 | Bacteria | 8986 |
| 664 | Ga0451576_0047592 | 3300045051 | Bacteria | 4507 |
| 665 | Ga0451576_0083654 | 3300045051 | Bacteria | 3319 |
| 666 | Ga0451576_0088919 | 3300045051 | Bacteria | 3212 |
| 667 | Ga0451576_0121529 | 3300045051 | Bacteria | 2719 |
| 668 | Ga0451576_0124949 | 3300045051 | Bacteria | 2680 |
| 669 | Ga0451576_0133725 | 3300045051 | Bacteria | 2586 |
| 670 | Ga0451576_0165783 | 3300045051 | Bacteria | 2306 |
| 671 | Ga0451576_0176056 | 3300045051 | Bacteria | 2233 |
| 672 | Ga0451576_0277421 | 3300045051 | Bacteria | 1753 |
| 673 | Ga0451576_0291923 | 3300045051 | Bacteria | 1705 |
| 674 | Ga0451576_0374307 | 3300045051 | Bacteria | 1492 |
| 675 | Ga0451576_0848375 | 3300045051 | Bacteria | 959 |
| 676 | Ga0451576_0937455 | 3300045051 | Bacteria | 908 |
| 677 | Ga0451576_0996934 | 3300045051 | Bacteria | 878 |
| 678 | Ga0451576_1432327 | 3300045051 | Bacteria | 718 |
| 679 | Ga0451576_1466520 | 3300045051 | Unclassified | 709 |
| 680 | Ga0451576_1772569 | 3300045051 | Bacteria | 638 |
| 681 | Ga0495592_0841048 | 3300046454 | Bacteria | 543 |
| 682 | Ga0495638_0000040 | 3300046460 | Bacteria | 241883 |
| 683 | Ga0495580_0138723 | 3300046472 | Bacteria | 1686 |
| 684 | Ga0495639_0292676 | 3300046475 | Bacteria | 811 |
| 685 | Ga0495662_0337290 | 3300046476 | Bacteria | 741 |
| 686 | Ga0495664_0720892 | 3300046477 | Bacteria | 589 |
| 687 | Ga0495608_0369474 | 3300046511 | Bacteria | 881 |
| 688 | Ga0495618_0449267 | 3300046514 | Bacteria | 783 |
| 689 | Ga0495628_0963096 | 3300046516 | Bacteria | 589 |
| 690 | Ga0495630_0252558 | 3300046517 | Bacteria | 1347 |
| 691 | Ga0495586_0205973 | 3300046535 | Bacteria | 1116 |
| 692 | Ga0495586_0641382 | 3300046535 | Bacteria | 614 |
| 693 | Ga0495645_0077970 | 3300046543 | Bacteria | 2382 |
| 694 | Ga0495625_0719846 | 3300046660 | Bacteria | 588 |
| 695 | Ga0495659_0354380 | 3300046664 | Bacteria | 628 |
| 696 | Ga0495661_0107289 | 3300046665 | Bacteria | 1561 |
| 697 | Ga0495588_0196215 | 3300046674 | Bacteria | 1066 |
| 698 | Ga0495588_0386751 | 3300046674 | Bacteria | 735 |
| 699 | Ga0495657_0227691 | 3300046675 | Bacteria | 1129 |
| 700 | Ga0495646_0348904 | 3300046680 | Bacteria | 776 |
| 701 | Ga0495658_0714549 | 3300046683 | Bacteria | 642 |
| 702 | Ga0495670_0002356 | 3300046691 | Bacteria | 9299 |
| 703 | Ga0495670_0242597 | 3300046691 | Bacteria | 959 |
| 704 | Ga0495670_0353582 | 3300046691 | Bacteria | 791 |
| 705 | Ga0495649_0152895 | 3300046694 | Bacteria | 1212 |
| 706 | Ga0495600_0686773 | 3300046809 | Bacteria | 617 |
| 707 | Ga0495581_0823918 | 3300047315 | Bacteria | 532 |
| 708 | Ga0495636_0000049 | 3300047318 | Bacteria | 51760 |
| 709 | Ga0495636_0396842 | 3300047318 | Bacteria | 657 |
| 710 | Ga0495674_0504313 | 3300047319 | Bacteria | 968 |
| 711 | Ga0495677_0280987 | 3300047445 | Bacteria | 653 |
| 712 | Ga0495677_0445352 | 3300047445 | Bacteria | 513 |
| 713 | Ga0495615_0157670 | 3300048090 | Bacteria | 680 |
| 714 | Ga0496105_0895376 | 3300048908 | Bacteria | 669 |
| 715 | Ga0496114_0165201 | 3300048917 | Bacteria | 1927 |
| 716 | Ga0496114_0836726 | 3300048917 | Bacteria | 800 |
| 717 | Ga0496115_0213459 | 3300048918 | Bacteria | 1594 |
| 718 | Ga0496115_1277852 | 3300048918 | Bacteria | 548 |
| 719 | Ga0496122_0443410 | 3300048925 | Bacteria | 646 |
| 720 | Ga0501306_000044 | 3300049127 | Bacteria | 6530 |
| 721 | Ga0501306_000698 | 3300049127 | Bacteria | 2749 |
| 722 | Ga0501306_004708 | 3300049127 | Bacteria | 1539 |
| 723 | Ga0501306_037461 | 3300049127 | Bacteria | 742 |
| 724 | Ga0501306_048747 | 3300049127 | Bacteria | 675 |
| 725 | Ga0501306_049046 | 3300049127 | Bacteria | 673 |
| 726 | Ga0501306_054487 | 3300049127 | Bacteria | 648 |
| 727 | Ga0501308_000036 | 3300049128 | Bacteria | 5406 |
| 728 | Ga0501308_001435 | 3300049128 | Bacteria | 1902 |
| 729 | Ga0501308_011162 | 3300049128 | Bacteria | 1008 |
| 730 | Ga0501308_019380 | 3300049128 | Bacteria | 839 |
| 731 | Ga0501308_028121 | 3300049128 | Bacteria | 742 |
| 732 | Ga0501308_028905 | 3300049128 | Bacteria | 735 |
| 733 | Ga0501308_029073 | 3300049128 | Bacteria | 733 |
| 734 | Ga0501308_060046 | 3300049128 | Bacteria | 572 |
| 735 | Ga0501309_000005 | 3300049129 | Bacteria | 11119 |
| 736 | Ga0501309_000848 | 3300049129 | Bacteria | 2726 |
| 737 | Ga0501309_001731 | 3300049129 | Bacteria | 2218 |
| 738 | Ga0501309_007200 | 3300049129 | Bacteria | 1374 |
| 739 | Ga0501309_036750 | 3300049129 | Bacteria | 738 |
| 740 | Ga0501309_054456 | 3300049129 | Bacteria | 634 |
| 741 | Ga0501309_073816 | 3300049129 | Bacteria | 564 |
| 742 | Ga0501310_001746 | 3300049130 | Bacteria | 2006 |
| 743 | Ga0501310_003848 | 3300049130 | Bacteria | 1482 |
| 744 | Ga0501310_004031 | 3300049130 | Bacteria | 1458 |
| 745 | Ga0501310_006036 | 3300049130 | Bacteria | 1260 |
| 746 | Ga0501310_023135 | 3300049130 | Bacteria | 789 |
| 747 | Ga0501310_081016 | 3300049130 | Bacteria | 510 |
| 748 | Ga0501341_08052 | 3300049131 | Bacteria | 668 |
| 749 | Ga0501343_001105 | 3300049132 | Bacteria | 1770 |
| 750 | Ga0501343_001931 | 3300049132 | Bacteria | 1446 |
| 751 | Ga0501343_002495 | 3300049132 | Bacteria | 1312 |
| 752 | Ga0501343_012079 | 3300049132 | Bacteria | 715 |
| 753 | Ga0501304_000029 | 3300049160 | Bacteria | 5401 |
| 754 | Ga0501304_002473 | 3300049160 | Bacteria | 1287 |
| 755 | Ga0501304_004835 | 3300049160 | Bacteria | 1035 |
| 756 | Ga0501304_010524 | 3300049160 | Bacteria | 810 |
| 757 | Ga0501305_000041 | 3300049161 | Bacteria | 7353 |
| 758 | Ga0501305_000239 | 3300049161 | Bacteria | 4036 |
| 759 | Ga0501305_004857 | 3300049161 | Bacteria | 1601 |
| 760 | Ga0501305_008405 | 3300049161 | Bacteria | 1335 |
| 761 | Ga0501305_014049 | 3300049161 | Bacteria | 1116 |
| 762 | Ga0501305_017070 | 3300049161 | Bacteria | 1041 |
| 763 | Ga0501305_019261 | 3300049161 | Bacteria | 994 |
| 764 | Ga0501305_041091 | 3300049161 | Bacteria | 752 |
| 765 | Ga0501305_051691 | 3300049161 | Bacteria | 691 |
| 766 | Ga0501307_000237 | 3300049162 | Bacteria | 3276 |
| 767 | Ga0501307_001795 | 3300049162 | Bacteria | 1896 |
| 768 | Ga0501307_006763 | 3300049162 | Bacteria | 1248 |
| 769 | Ga0501307_015091 | 3300049162 | Bacteria | 951 |
| 770 | Ga0501307_024105 | 3300049162 | Bacteria | 810 |
| 771 | Ga0501307_030240 | 3300049162 | Bacteria | 748 |
| 772 | Ga0501307_037960 | 3300049162 | Bacteria | 691 |
| 773 | Ga0501307_050062 | 3300049162 | Bacteria | 626 |
| 774 | Ga0501307_075905 | 3300049162 | Bacteria | 542 |
| 775 | Ga0501296_064433 | 3300049519 | Bacteria | 559 |
| 776 | Ga0501298_036258 | 3300049521 | Bacteria | 986 |
| 777 | Ga0501303_026218 | 3300049526 | Bacteria | 653 |
| 778 | Ga0501311_002954 | 3300049527 | Bacteria | 1686 |
| 779 | Ga0501311_004120 | 3300049527 | Bacteria | 1531 |
| 780 | Ga0501311_008889 | 3300049527 | Bacteria | 1189 |
| 781 | Ga0501311_010378 | 3300049527 | Bacteria | 1129 |
| 782 | Ga0501311_037809 | 3300049527 | Bacteria | 722 |
| 783 | Ga0501312_000008 | 3300049528 | Bacteria | 9722 |
| 784 | Ga0501312_000783 | 3300049528 | Bacteria | 2791 |
| 785 | Ga0501312_002894 | 3300049528 | Bacteria | 1894 |
| 786 | Ga0501312_032285 | 3300049528 | Bacteria | 826 |
| 787 | Ga0501312_036971 | 3300049528 | Bacteria | 786 |
| 788 | Ga0501312_039745 | 3300049528 | Bacteria | 765 |
| 789 | Ga0501312_044814 | 3300049528 | Bacteria | 732 |
| 790 | Ga0501312_073382 | 3300049528 | Bacteria | 610 |
| 791 | Ga0501312_077700 | 3300049528 | Bacteria | 597 |
| 792 | Ga0501312_097565 | 3300049528 | Bacteria | 548 |
| 793 | Ga0501312_103276 | 3300049528 | Bacteria | 537 |
| 794 | Ga0501312_116958 | 3300049528 | Bacteria | 513 |
| 795 | Ga0501313_000046 | 3300049529 | Bacteria | 5461 |
| 796 | Ga0501313_001256 | 3300049529 | Bacteria | 2140 |
| 797 | Ga0501313_007305 | 3300049529 | Bacteria | 1215 |
| 798 | Ga0501313_017356 | 3300049529 | Bacteria | 869 |
| 799 | Ga0501313_025790 | 3300049529 | Bacteria | 745 |
| 800 | Ga0501313_028145 | 3300049529 | Bacteria | 720 |
| 801 | Ga0501314_000536 | 3300049530 | Bacteria | 2398 |
| 802 | Ga0501314_005375 | 3300049530 | Bacteria | 1089 |
| 803 | Ga0501314_008115 | 3300049530 | Bacteria | 943 |
| 804 | Ga0501314_021975 | 3300049530 | Bacteria | 669 |
| 805 | Ga0501315_000039 | 3300049531 | Bacteria | 5463 |
| 806 | Ga0501315_000148 | 3300049531 | Bacteria | 3959 |
| 807 | Ga0501315_004361 | 3300049531 | Bacteria | 1475 |
| 808 | Ga0501315_004396 | 3300049531 | Bacteria | 1473 |
| 809 | Ga0501315_005480 | 3300049531 | Bacteria | 1375 |
| 810 | Ga0501315_022209 | 3300049531 | Bacteria | 864 |
| 811 | Ga0501315_035949 | 3300049531 | Bacteria | 733 |
| 812 | Ga0501315_038649 | 3300049531 | Bacteria | 715 |
| 813 | Ga0501315_061908 | 3300049531 | Bacteria | 607 |
| 814 | Ga0501315_067059 | 3300049531 | Bacteria | 589 |
| 815 | Ga0501315_077734 | 3300049531 | Bacteria | 559 |
| 816 | Ga0501315_091022 | 3300049531 | Bacteria | 529 |
| 817 | Ga0501316_001307 | 3300049532 | Bacteria | 2085 |
| 818 | Ga0501316_003657 | 3300049532 | Bacteria | 1507 |
| 819 | Ga0501316_005326 | 3300049532 | Bacteria | 1330 |
| 820 | Ga0501316_008595 | 3300049532 | Bacteria | 1131 |
| 821 | Ga0501316_016604 | 3300049532 | Bacteria | 896 |
| 822 | Ga0501316_047169 | 3300049532 | Bacteria | 613 |
| 823 | Ga0501316_049777 | 3300049532 | Bacteria | 601 |
| 824 | Ga0501316_057040 | 3300049532 | Bacteria | 572 |
| 825 | Ga0501317_001819 | 3300049533 | Bacteria | 1918 |
| 826 | Ga0501317_004254 | 3300049533 | Bacteria | 1480 |
| 827 | Ga0501317_006292 | 3300049533 | Bacteria | 1301 |
| 828 | Ga0501317_045213 | 3300049533 | Bacteria | 684 |
| 829 | Ga0501317_049914 | 3300049533 | Bacteria | 662 |
| 830 | Ga0501318_059368 | 3300049534 | Bacteria | 584 |
| 831 | Ga0501319_011072 | 3300049535 | Bacteria | 725 |
| 832 | Ga0501320_000271 | 3300049536 | Bacteria | 2794 |
| 833 | Ga0501320_001656 | 3300049536 | Bacteria | 1674 |
| 834 | Ga0501320_007328 | 3300049536 | Bacteria | 1059 |
| 835 | Ga0501320_011441 | 3300049536 | Bacteria | 919 |
| 836 | Ga0501320_012555 | 3300049536 | Bacteria | 893 |
| 837 | Ga0501320_023233 | 3300049536 | Bacteria | 732 |
| 838 | Ga0501320_025490 | 3300049536 | Bacteria | 709 |
| 839 | Ga0501320_027114 | 3300049536 | Bacteria | 695 |
| 840 | Ga0501320_060048 | 3300049536 | Bacteria | 533 |
| 841 | Ga0501321_001022 | 3300049537 | Bacteria | 2090 |
| 842 | Ga0501321_012051 | 3300049537 | Bacteria | 974 |
| 843 | Ga0501321_051689 | 3300049537 | Bacteria | 602 |
| 844 | Ga0501322_022094 | 3300049538 | Bacteria | 564 |
| 845 | Ga0501323_000022 | 3300049539 | Bacteria | 7278 |
| 846 | Ga0501323_000041 | 3300049539 | Bacteria | 6045 |
| 847 | Ga0501323_002898 | 3300049539 | Bacteria | 1707 |
| 848 | Ga0501323_034152 | 3300049539 | Bacteria | 725 |
| 849 | Ga0501323_037123 | 3300049539 | Bacteria | 703 |
| 850 | Ga0501324_001820 | 3300049540 | Bacteria | 1477 |
| 851 | Ga0501324_007058 | 3300049540 | Bacteria | 961 |
| 852 | Ga0501324_033942 | 3300049540 | Bacteria | 565 |
| 853 | Ga0501325_000253 | 3300049541 | Bacteria | 2263 |
| 854 | Ga0501325_001123 | 3300049541 | Bacteria | 1559 |
| 855 | Ga0501325_019707 | 3300049541 | Bacteria | 702 |
| 856 | Ga0501325_035921 | 3300049541 | Bacteria | 586 |
| 857 | Ga0501326_00213 | 3300049542 | Bacteria | 2132 |
| 858 | Ga0501326_08315 | 3300049542 | Bacteria | 602 |
| 859 | Ga0501327_02818 | 3300049543 | Bacteria | 924 |
| 860 | Ga0501328_00317 | 3300049544 | Bacteria | 1542 |
| 861 | Ga0501329_00473 | 3300049545 | Bacteria | 1426 |
| 862 | Ga0501331_01387 | 3300049547 | Bacteria | 1173 |
| 863 | Ga0501334_14375 | 3300049550 | Bacteria | 600 |
| 864 | Ga0501335_003359 | 3300049551 | Bacteria | 1353 |
| 865 | Ga0501335_003643 | 3300049551 | Bacteria | 1314 |
| 866 | Ga0501335_017583 | 3300049551 | Bacteria | 743 |
| 867 | Ga0501335_023649 | 3300049551 | Bacteria | 667 |
| 868 | Ga0501336_000198 | 3300049552 | Bacteria | 2598 |
| 869 | Ga0501336_002156 | 3300049552 | Bacteria | 1247 |
| 870 | Ga0501336_009102 | 3300049552 | Bacteria | 779 |
| 871 | Ga0501337_015435 | 3300049553 | Bacteria | 590 |
| 872 | Ga0501338_04356 | 3300049554 | Bacteria | 857 |
| 873 | Ga0501340_002246 | 3300049556 | Bacteria | 1105 |
| 874 | Ga0501031_0026756 | 3300049568 | Bacteria | 3760 |
| 875 | Ga0501032_0007271 | 3300049569 | Bacteria | 8100 |
| 876 | Ga0501032_0030328 | 3300049569 | Bacteria | 3710 |
| 877 | Ga0501032_0048968 | 3300049569 | Bacteria | 2852 |
| 878 | Ga0501033_0000011 | 3300049570 | Bacteria | 259130 |
| 879 | Ga0501034_0001265 | 3300049571 | Bacteria | 34324 |
| 880 | Ga0501034_0019142 | 3300049571 | Bacteria | 7009 |
| 881 | Ga0501034_0036199 | 3300049571 | Bacteria | 5001 |
| 882 | Ga0501034_0178660 | 3300049571 | Bacteria | 2088 |
| 883 | Ga0501036_0014424 | 3300049572 | Bacteria | 6581 |
| 884 | Ga0501036_0019659 | 3300049572 | Bacteria | 5670 |
| 885 | Ga0501037_0013217 | 3300049573 | Bacteria | 6084 |
| 886 | Ga0501037_0249427 | 3300049573 | Bacteria | 1242 |
| 887 | Ga0501038_0002395 | 3300049574 | Bacteria | 17463 |
| 888 | Ga0501038_0028118 | 3300049574 | Bacteria | 4995 |
| 889 | Ga0501038_0075723 | 3300049574 | Bacteria | 2844 |
| 890 | Ga0501039_0012686 | 3300049575 | Bacteria | 6441 |
| 891 | Ga0501039_0023075 | 3300049575 | Bacteria | 4773 |
| 892 | Ga0501039_0263075 | 3300049575 | Bacteria | 1356 |
| 893 | Ga0501042_0210143 | 3300049578 | Bacteria | 1404 |
| 894 | Ga0501042_0503317 | 3300049578 | Bacteria | 880 |
| 895 | Ga0501043_0021084 | 3300049579 | Bacteria | 5108 |
| 896 | Ga0501043_0024223 | 3300049579 | Bacteria | 4762 |
| 897 | Ga0501043_0040531 | 3300049579 | Bacteria | 3661 |
| 898 | Ga0501043_0183873 | 3300049579 | Bacteria | 1628 |
| 899 | Ga0501046_0099565 | 3300049580 | Bacteria | 2231 |
| 900 | Ga0501046_0150637 | 3300049580 | Bacteria | 1755 |
| 901 | Ga0501047_0036558 | 3300049581 | Bacteria | 4747 |
| 902 | Ga0501047_0288271 | 3300049581 | Bacteria | 1485 |
| 903 | Ga0501048_0015730 | 3300049582 | Bacteria | 5582 |
| 904 | Ga0501067_0006402 | 3300049583 | Bacteria | 6522 |
| 905 | Ga0501067_0009218 | 3300049583 | Bacteria | 5466 |
| 906 | Ga0501068_0014823 | 3300049584 | Bacteria | 4463 |
| 907 | Ga0501068_0052122 | 3300049584 | Bacteria | 2476 |
| 908 | Ga0501069_0015284 | 3300049585 | Bacteria | 4113 |
| 909 | Ga0501070_0036727 | 3300049586 | Bacteria | 4092 |
| 910 | Ga0501070_0078325 | 3300049586 | Bacteria | 2735 |
| 911 | Ga0501070_0092295 | 3300049586 | Bacteria | 2506 |
| 912 | Ga0501071_0060047 | 3300049587 | Bacteria | 2752 |
| 913 | Ga0501072_0260586 | 3300049588 | Bacteria | 1380 |
| 914 | Ga0501073_0008802 | 3300049589 | Bacteria | 7464 |
| 915 | Ga0501073_0011829 | 3300049589 | Bacteria | 6369 |
| 916 | Ga0501073_0322131 | 3300049589 | Bacteria | 1067 |
| 917 | Ga0501074_0019774 | 3300049590 | Bacteria | 4891 |
| 918 | Ga0501199_036884 | 3300049650 | Bacteria | 622 |
| 919 | Ga0501202_044391 | 3300049652 | Bacteria | 969 |
| 920 | Ga0501210_015241 | 3300049657 | Bacteria | 671 |
| 921 | Ga0501217_009364 | 3300049661 | Bacteria | 2129 |
| 922 | Ga0501222_037300 | 3300049662 | Bacteria | 682 |
| 923 | Ga0501235_015899 | 3300049669 | Bacteria | 1660 |
| 924 | Ga0501235_110303 | 3300049669 | Bacteria | 680 |
| 925 | Ga0501236_000641 | 3300049670 | Bacteria | 3894 |
| 926 | Ga0501238_004543 | 3300049671 | Bacteria | 1739 |
| 927 | Ga0501238_022494 | 3300049671 | Bacteria | 896 |
| 928 | Ga0501242_003494 | 3300049674 | Bacteria | 1703 |
| 929 | Ga0501242_073008 | 3300049674 | Bacteria | 540 |
| 930 | Ga0501247_000354 | 3300049677 | Bacteria | 3467 |
| 931 | Ga0501249_005609 | 3300049679 | Bacteria | 2565 |
| 932 | Ga0501253_082739 | 3300049683 | Bacteria | 727 |
| 933 | Ga0501257_000897 | 3300049686 | Bacteria | 6014 |
| 934 | Ga0501257_020542 | 3300049686 | Bacteria | 1552 |
| 935 | Ga0501257_145355 | 3300049686 | Bacteria | 650 |
| 936 | Ga0501257_272815 | 3300049686 | Bacteria | 507 |
| 937 | Ga0501259_033220 | 3300049688 | Bacteria | 984 |
| 938 | Ga0501261_033831 | 3300049690 | Bacteria | 782 |
| 939 | Ga0501225_0012695 | 3300049705 | Bacteria | 2364 |
| 940 | Ga0501225_0047951 | 3300049705 | Bacteria | 1186 |
| 941 | Ga0501225_0082868 | 3300049705 | Bacteria | 922 |
| 942 | Ga0501225_0227145 | 3300049705 | Bacteria | 604 |
| 943 | Ga0501225_0261741 | 3300049705 | Bacteria | 573 |
| 944 | Ga0501079_0053196 | 3300049741 | Bacteria | 3124 |
| 945 | Ga0501079_0097817 | 3300049741 | Bacteria | 2275 |
| 946 | Ga0501080_0074958 | 3300049742 | Bacteria | 3147 |
| 947 | Ga0501080_0286986 | 3300049742 | Bacteria | 1495 |
| 948 | Ga0501080_0440282 | 3300049742 | Bacteria | 1169 |
| 949 | Ga0501080_0492962 | 3300049742 | Bacteria | 1095 |
| 950 | Ga0501083_0014034 | 3300049744 | Bacteria | 5600 |
| 951 | Ga0501083_0062854 | 3300049744 | Bacteria | 2476 |
| 952 | Ga0501264_003325 | 3300049761 | Bacteria | 1465 |
| 953 | Ga0501264_014282 | 3300049761 | Bacteria | 793 |
| 954 | Ga0501270_028395 | 3300049767 | Bacteria | 906 |
| 955 | Ga0501035_0004622 | 3300049822 | Bacteria | 13050 |
| 956 | Ga0501035_0019838 | 3300049822 | Bacteria | 6176 |
| 957 | Ga0501035_0776913 | 3300049822 | Bacteria | 767 |
| 958 | Ga0501044_0003551 | 3300049823 | Bacteria | 17548 |
| 959 | Ga0501044_0023913 | 3300049823 | Bacteria | 6493 |
| 960 | Ga0501044_0097266 | 3300049823 | Bacteria | 2965 |
| 961 | Ga0501044_0514802 | 3300049823 | Bacteria | 1097 |
| 962 | Ga0501045_0000053 | 3300049824 | Bacteria | 51403 |
| 963 | Ga0501045_1051520 | 3300049824 | Bacteria | 596 |
| 964 | Ga0501204_016306 | 3300049850 | Bacteria | 930 |
| 965 | Ga0501226_015397 | 3300049853 | Bacteria | 843 |
| 966 | nmdc:mga0k408_198900_c1 | 3300050493 | Unclassified | 1196 |
| 967 | nmdc:mga0k408_57809_c2 | 3300050493 | Bacteria | 1481 |
| 968 | nmdc:mga0k408_693703_c1 | 3300050493 | Bacteria | 597 |
| 969 | nmdc:mga07m45_126657_c1 | 3300050496 | Bacteria | 1477 |
| 970 | nmdc:mga07m45_89113_c1 | 3300050496 | Bacteria | 1766 |
| 971 | nmdc:mga05p37_1510320_c1 | 3300050507 | Bacteria | 668 |
| 972 | nmdc:mga0qj67_114691_c1 | 3300050509 | Bacteria | 2176 |
| 973 | nmdc:mga0qj67_1383749_c1 | 3300050509 | Bacteria | 543 |
| 974 | nmdc:mga06r32_83968_c1 | 3300050510 | Bacteria | 3103 |
| 975 | nmdc:mga08y16_19020_c1 | 3300050511 | Bacteria | 7234 |
| 976 | nmdc:mga08y16_21751_c1 | 3300050511 | Bacteria | 6769 |
| 977 | nmdc:mga08y16_267433_c1 | 3300050511 | Bacteria | 1765 |
| 978 | nmdc:mga08y16_283195_c1 | 3300050511 | Bacteria | 1709 |
| 979 | nmdc:mga08y16_836450_c1 | 3300050511 | Bacteria | 911 |
| 980 | nmdc:mga0a205_923548_c1 | 3300050515 | Bacteria | 719 |
| 981 | Ga0500578_0086448 | 3300053086 | Bacteria | 1992 |
| 982 | Ga0500644_0304785 | 3300053088 | Bacteria | 682 |
| 983 | Ga0500646_0190358 | 3300053090 | Bacteria | 699 |
| 984 | Ga0500556_0058888 | 3300053104 | Bacteria | 1410 |
| 985 | Ga0500655_007182 | 3300053133 | Bacteria | 2003 |
| 986 | Ga0500658_0385412 | 3300053134 | Bacteria | 642 |
| 987 | Ga0500573_0037721 | 3300053140 | Bacteria | 2793 |
| 988 | Ga0500577_0247767 | 3300053142 | Bacteria | 774 |
| 989 | Ga0500604_0010471 | 3300053151 | Bacteria | 2482 |
| 990 | Ga0500604_0245055 | 3300053151 | Bacteria | 620 |
| 991 | Ga0500616_0000013 | 3300053153 | Bacteria | 674172 |
| 992 | Ga0500616_0032309 | 3300053153 | Bacteria | 2862 |
| 993 | Ga0500616_0036710 | 3300053153 | Bacteria | 2658 |
| 994 | Ga0500622_0000416 | 3300053156 | Bacteria | 40603 |
| 995 | Ga0500622_0000433 | 3300053156 | Bacteria | 39766 |
| 996 | Ga0500622_0017657 | 3300053156 | Bacteria | 3797 |
| 997 | Ga0500622_0027590 | 3300053156 | Bacteria | 2993 |
| 998 | Ga0500645_134453 | 3300053730 | Bacteria | 686 |
| 999 | Ga0501084_0024661 | 3300054114 | Bacteria | 5019 |
| 1000 | Ga0501084_0071249 | 3300054114 | Bacteria | 2910 |
| 1001 | Ga0500661_007999 | 3300055283 | Bacteria | 1948 |
| 1002 | Ga0587070_000157 | 3300059491 | Bacteria | 4307 |
| 1003 | Ga0587070_085573 | 3300059491 | Bacteria | 700 |
| 1004 | Ga0587077_000755 | 3300059493 | Bacteria | 3065 |
| 1005 | Ga0587077_147639 | 3300059493 | Bacteria | 611 |
| 1006 | Ga0587077_166700 | 3300059493 | Bacteria | 587 |
| 1007 | Ga0587083_0013391 | 3300059505 | Bacteria | 1396 |
| 1008 | Ga0587083_0127591 | 3300059505 | Bacteria | 664 |
| 1009 | Ga0587085_013261 | 3300059506 | Bacteria | 1144 |
| 1010 | Ga0587088_011252 | 3300059508 | Bacteria | 1329 |
| 1011 | Ga0587090_014198 | 3300059510 | Bacteria | 1162 |
| 1012 | Ga0587090_144679 | 3300059510 | Bacteria | 534 |
| 1013 | Ga0587091_035053 | 3300059511 | Bacteria | 963 |
| 1014 | Ga0587092_008459 | 3300059512 | Bacteria | 1359 |
| 1015 | Ga0587092_142144 | 3300059512 | Bacteria | 530 |
| 1016 | Ga0587094_097366 | 3300059513 | Bacteria | 564 |
| 1017 | Ga0587094_117389 | 3300059513 | Bacteria | 530 |
| 1018 | Ga0587109_000421 | 3300059624 | Bacteria | 3954 |
| 1019 | Ga0587109_014349 | 3300059624 | Bacteria | 1328 |
| 1020 | Ga0587109_180781 | 3300059624 | Bacteria | 539 |
| 1021 | Ga0587115_106058 | 3300059626 | Bacteria | 526 |
| 1022 | Ga0587117_003203 | 3300059627 | Bacteria | 1611 |
| 1023 | Ga0587117_051852 | 3300059627 | Bacteria | 683 |
| 1024 | Ga0587128_076086 | 3300059630 | Bacteria | 663 |
| 1025 | Ga0587062_000132 | 3300059639 | Bacteria | 3952 |
| 1026 | Ga0587062_007071 | 3300059639 | Bacteria | 1297 |
| 1027 | Ga0587067_067187 | 3300059640 | Bacteria | 766 |
| 1028 | Ga0587068_000547 | 3300059641 | Bacteria | 3540 |
| 1029 | Ga0587068_042947 | 3300059641 | Bacteria | 824 |
| 1030 | Ga0587068_060734 | 3300059641 | Bacteria | 726 |
| 1031 | Ga0587068_173251 | 3300059641 | Bacteria | 500 |
| 1032 | Ga0587069_002452 | 3300059642 | Bacteria | 1871 |
| 1033 | Ga0587072_014962 | 3300059643 | Bacteria | 1312 |
| 1034 | Ga0587075_109458 | 3300059644 | Bacteria | 560 |
| 1035 | Ga0587076_003883 | 3300059645 | Bacteria | 1822 |
| 1036 | Ga0587076_016950 | 3300059645 | Bacteria | 1156 |
| 1037 | Ga0587076_063331 | 3300059645 | Bacteria | 751 |
| 1038 | Ga0587079_243368 | 3300059647 | Bacteria | 509 |
| 1039 | Ga0587108_016180 | 3300059653 | Bacteria | 676 |
| 1040 | Ga0587124_018699 | 3300059660 | Bacteria | 692 |
| 1041 | Ga0587061_00333 | 3300060244 | Bacteria | 1540 |
| 1042 | Ga0587081_05693 | 3300060246 | Bacteria | 831 |
| 1043 | Ga0587111_0000249 | 3300060346 | Bacteria | 4487 |
| 1044 | Ga0587111_0061165 | 3300060346 | Bacteria | 857 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005544 | Ga0070686_100028804 | Ga0070686_1000288045 | 115 |
| 2 | 3300032004 | Ga0307414_10039831 | Ga0307414_100398312 | 115 |
| 3 | 3300049536 | Ga0501320_011441 | Ga0501320_011441_137_517 | 115 |
| 4 | 3300003322 | rootL2_10101710 | rootL2_101017106 | 116 |
| 5 | 3300041505 | Ga0451849_1019517 | Ga0451849_1019517_114_494 | 116 |
| 6 | 3300049661 | Ga0501217_009364 | Ga0501217_009364_1269_1619 | 116 |
| 7 | 3300059511 | Ga0587091_035053 | Ga0587091_035053_238_618 | 118 |
| 8 | 3300005842 | Ga0068858_100805855 | Ga0068858_1008058552 | 119 |
| 9 | 3300013297 | Ga0157378_10000333 | Ga0157378_100003332 | 119 |
| 10 | 3300041464 | Ga0451808_28645 | Ga0451808_28645_41_421 | 119 |
| 11 | 3300049160 | Ga0501304_004835 | Ga0501304_004835_547_927 | 119 |
| 12 | 3300049162 | Ga0501307_015091 | Ga0501307_015091_391_771 | 119 |
| 13 | 3300049551 | Ga0501335_003643 | Ga0501335_003643_82_462 | 119 |
| 14 | 3300050510 | nmdc:mga06r32_83968_c1 | nmdc:mga06r32_83968_c1_2369_2752 | 119 |
| 15 | 3300014969 | Ga0157376_11507598 | Ga0157376_115075982 | 120 |
| 16 | 3300049132 | Ga0501343_012079 | Ga0501343_012079_312_692 | 120 |
| 17 | 3300049532 | Ga0501316_057040 | Ga0501316_057040_93_473 | 120 |
| 18 | iso_pu_bacteria | 2522125168 | 2522549437 | 121 |
| 19 | iso_pu_bacteria | 2739367866 | 2740031480 | 121 |
| 20 | iso_pu_bacteria | 2818991444 | 2819590934 | 121 |
| 21 | iso_pu_bacteria | 2839989709 | 2839990104 | 121 |
| 22 | iso_pu_bacteria | 2910245624 | 2910249737 | 121 |
| 23 | iso_pu_bacteria | 2911138879 | 2911143807 | 121 |
| 24 | iso_pu_bacteria | 2914759650 | 2914763356 | 121 |
| 25 | iso_pu_bacteria | 2929154850 | 2929156053 | 121 |
| 26 | 3300025926 | Ga0207659_10242738 | Ga0207659_102427384 | 122 |
| 27 | 3300032168 | Ga0316593_10000201 | Ga0316593_1000020119 | 122 |
| 28 | 3300032168 | Ga0316593_10193777 | Ga0316593_101937771 | 122 |
| 29 | 3300033541 | Ga0316596_1133994 | Ga0316596_11339942 | 122 |
| 30 | 3300005563 | Ga0068855_101481603 | Ga0068855_1014816032 | 124 |
| 31 | 3300032005 | Ga0307411_10001861 | Ga0307411_100018614 | 124 |
| 32 | 3300033528 | Ga0316588_1127486 | Ga0316588_11274861 | 124 |
| 33 | 3300042876 | Ga0451577_0300325 | Ga0451577_0300325_535_909 | 124 |
| 34 | 3300044712 | Ga0453684_0009769 | Ga0453684_0009769_10522_10896 | 124 |
| 35 | 3300059624 | Ga0587109_000421 | Ga0587109_000421_2445_2819 | 124 |
| 36 | 3300003316 | rootH1_10080733 | rootH1_100807334 | 125 |
| 37 | 3300003316 | rootH1_10114576 | rootH1_101145763 | 125 |
| 38 | 3300003322 | rootL2_10010167 | rootL2_100101675 | 125 |
| 39 | 3300003322 | rootL2_10023239 | rootL2_100232395 | 125 |
| 40 | 3300003322 | rootL2_10094850 | rootL2_100948505 | 125 |
| 41 | 3300003323 | rootH1_10006036 | rootH1_100060362 | 125 |
| 42 | 3300003323 | rootH1_10006987 | rootH1_100069874 | 125 |
| 43 | 3300003323 | rootH1_10006988 | rootH1_1000698842 | 125 |
| 44 | 3300003323 | rootH1_10012787 | rootH1_100127873 | 125 |
| 45 | 3300003544 | Ga0007417J51691_1057812 | Ga0007417J51691_10578123 | 125 |
| 46 | 3300003781 | Ga0055536_1001261 | Ga0055536_100126111 | 125 |
| 47 | 3300003794 | Ga0055531_10000409 | Ga0055531_1000040933 | 125 |
| 48 | 3300004625 | Ga0055543_1051443 | Ga0055543_10514432 | 125 |
| 49 | 3300004798 | Ga0058859_10072763 | Ga0058859_100727631 | 125 |
| 50 | 3300004798 | Ga0058859_11480586 | Ga0058859_114805862 | 125 |
| 51 | 3300004801 | Ga0058860_10016344 | Ga0058860_100163443 | 125 |
| 52 | 3300004801 | Ga0058860_11946433 | Ga0058860_119464332 | 125 |
| 53 | 3300005262 | Ga0065165_1000131 | Ga0065165_100013163 | 125 |
| 54 | 3300005262 | Ga0065165_1000831 | Ga0065165_100083127 | 125 |
| 55 | 3300005288 | Ga0065714_10024660 | Ga0065714_100246603 | 125 |
| 56 | 3300005289 | Ga0065704_10124782 | Ga0065704_101247824 | 125 |
| 57 | 3300005290 | Ga0065712_10322046 | Ga0065712_103220461 | 125 |
| 58 | 3300005290 | Ga0065712_10399976 | Ga0065712_103999761 | 125 |
| 59 | 3300005293 | Ga0065715_10088958 | Ga0065715_100889589 | 125 |
| 60 | 3300005295 | Ga0065707_10148021 | Ga0065707_101480212 | 125 |
| 61 | 3300005327 | Ga0070658_10099188 | Ga0070658_100991883 | 125 |
| 62 | 3300005327 | Ga0070658_10141402 | Ga0070658_101414023 | 125 |
| 63 | 3300005329 | Ga0070683_100094294 | Ga0070683_1000942943 | 125 |
| 64 | 3300005329 | Ga0070683_101602232 | Ga0070683_1016022321 | 125 |
| 65 | 3300005331 | Ga0070670_100203096 | Ga0070670_1002030962 | 125 |
| 66 | 3300005331 | Ga0070670_101702085 | Ga0070670_1017020851 | 125 |
| 67 | 3300005333 | Ga0070677_10102463 | Ga0070677_101024632 | 125 |
| 68 | 3300005333 | Ga0070677_10938540 | Ga0070677_109385401 | 125 |
| 69 | 3300005334 | Ga0068869_100672086 | Ga0068869_1006720861 | 125 |
| 70 | 3300005334 | Ga0068869_100682944 | Ga0068869_1006829441 | 125 |
| 71 | 3300005334 | Ga0068869_101312662 | Ga0068869_1013126621 | 125 |
| 72 | 3300005337 | Ga0070682_100181774 | Ga0070682_1001817743 | 125 |
| 73 | 3300005337 | Ga0070682_101095219 | Ga0070682_1010952191 | 125 |
| 74 | 3300005337 | Ga0070682_101996772 | Ga0070682_1019967721 | 125 |
| 75 | 3300005337 | Ga0070682_102062090 | Ga0070682_1020620901 | 125 |
| 76 | 3300005338 | Ga0068868_100118877 | Ga0068868_1001188772 | 125 |
| 77 | 3300005338 | Ga0068868_101200705 | Ga0068868_1012007052 | 125 |
| 78 | 3300005338 | Ga0068868_101554126 | Ga0068868_1015541261 | 125 |
| 79 | 3300005339 | Ga0070660_100106781 | Ga0070660_1001067811 | 125 |
| 80 | 3300005340 | Ga0070689_100197354 | Ga0070689_1001973543 | 125 |
| 81 | 3300005340 | Ga0070689_100456971 | Ga0070689_1004569712 | 125 |
| 82 | 3300005340 | Ga0070689_100805392 | Ga0070689_1008053922 | 125 |
| 83 | 3300005340 | Ga0070689_101892379 | Ga0070689_1018923792 | 125 |
| 84 | 3300005343 | Ga0070687_100503723 | Ga0070687_1005037232 | 125 |
| 85 | 3300005344 | Ga0070661_101086899 | Ga0070661_1010868992 | 125 |
| 86 | 3300005344 | Ga0070661_101753018 | Ga0070661_1017530181 | 125 |
| 87 | 3300005345 | Ga0070692_10481297 | Ga0070692_104812972 | 125 |
| 88 | 3300005345 | Ga0070692_10517558 | Ga0070692_105175581 | 125 |
| 89 | 3300005345 | Ga0070692_11402868 | Ga0070692_114028681 | 125 |
| 90 | 3300005353 | Ga0070669_100236924 | Ga0070669_1002369244 | 125 |
| 91 | 3300005353 | Ga0070669_100399931 | Ga0070669_1003999312 | 125 |
| 92 | 3300005353 | Ga0070669_100691635 | Ga0070669_1006916351 | 125 |
| 93 | 3300005353 | Ga0070669_100852054 | Ga0070669_1008520541 | 125 |
| 94 | 3300005354 | Ga0070675_100098425 | Ga0070675_1000984253 | 125 |
| 95 | 3300005354 | Ga0070675_100589660 | Ga0070675_1005896601 | 125 |
| 96 | 3300005354 | Ga0070675_100849389 | Ga0070675_1008493891 | 125 |
| 97 | 3300005356 | Ga0070674_100584487 | Ga0070674_1005844871 | 125 |
| 98 | 3300005364 | Ga0070673_100139381 | Ga0070673_1001393812 | 125 |
| 99 | 3300005365 | Ga0070688_100455218 | Ga0070688_1004552181 | 125 |
| 100 | 3300005366 | Ga0070659_100004313 | Ga0070659_10000431313 | 125 |
| 101 | 3300005367 | Ga0070667_101250206 | Ga0070667_1012502061 | 125 |
| 102 | 3300005441 | Ga0070700_100869580 | Ga0070700_1008695802 | 125 |
| 103 | 3300005444 | Ga0070694_100747762 | Ga0070694_1007477621 | 125 |
| 104 | 3300005456 | Ga0070678_100169113 | Ga0070678_1001691132 | 125 |
| 105 | 3300005457 | Ga0070662_100723238 | Ga0070662_1007232381 | 125 |
| 106 | 3300005459 | Ga0068867_100422091 | Ga0068867_1004220911 | 125 |
| 107 | 3300005459 | Ga0068867_100751649 | Ga0068867_1007516491 | 125 |
| 108 | 3300005459 | Ga0068867_101203509 | Ga0068867_1012035092 | 125 |
| 109 | 3300005466 | Ga0070685_10190454 | Ga0070685_101904541 | 125 |
| 110 | 3300005466 | Ga0070685_10535775 | Ga0070685_105357752 | 125 |
| 111 | 3300005471 | Ga0070698_100226337 | Ga0070698_1002263372 | 125 |
| 112 | 3300005530 | Ga0070679_100029815 | Ga0070679_1000298156 | 125 |
| 113 | 3300005535 | Ga0070684_100251908 | Ga0070684_1002519082 | 125 |
| 114 | 3300005539 | Ga0068853_100205382 | Ga0068853_1002053822 | 125 |
| 115 | 3300005539 | Ga0068853_100771141 | Ga0068853_1007711411 | 125 |
| 116 | 3300005543 | Ga0070672_100147361 | Ga0070672_1001473613 | 125 |
| 117 | 3300005548 | Ga0070665_100000442 | Ga0070665_10000044231 | 125 |
| 118 | 3300005548 | Ga0070665_100215306 | Ga0070665_1002153063 | 125 |
| 119 | 3300005563 | Ga0068855_100071240 | Ga0068855_1000712407 | 125 |
| 120 | 3300005563 | Ga0068855_100279474 | Ga0068855_1002794742 | 125 |
| 121 | 3300005563 | Ga0068855_100690901 | Ga0068855_1006909012 | 125 |
| 122 | 3300005563 | Ga0068855_100922798 | Ga0068855_1009227982 | 125 |
| 123 | 3300005563 | Ga0068855_101984854 | Ga0068855_1019848542 | 125 |
| 124 | 3300005564 | Ga0070664_100586946 | Ga0070664_1005869462 | 125 |
| 125 | 3300005577 | Ga0068857_100062430 | Ga0068857_1000624302 | 125 |
| 126 | 3300005577 | Ga0068857_100809874 | Ga0068857_1008098741 | 125 |
| 127 | 3300005577 | Ga0068857_102140696 | Ga0068857_1021406961 | 125 |
| 128 | 3300005578 | Ga0068854_100877885 | Ga0068854_1008778851 | 125 |
| 129 | 3300005578 | Ga0068854_101620838 | Ga0068854_1016208381 | 125 |
| 130 | 3300005614 | Ga0068856_100147792 | Ga0068856_1001477923 | 125 |
| 131 | 3300005614 | Ga0068856_100340133 | Ga0068856_1003401332 | 125 |
| 132 | 3300005614 | Ga0068856_100414628 | Ga0068856_1004146283 | 125 |
| 133 | 3300005614 | Ga0068856_101392516 | Ga0068856_1013925161 | 125 |
| 134 | 3300005616 | Ga0068852_100113127 | Ga0068852_1001131273 | 125 |
| 135 | 3300005616 | Ga0068852_100372550 | Ga0068852_1003725502 | 125 |
| 136 | 3300005616 | Ga0068852_100898449 | Ga0068852_1008984492 | 125 |
| 137 | 3300005616 | Ga0068852_101144888 | Ga0068852_1011448881 | 125 |
| 138 | 3300005616 | Ga0068852_101328805 | Ga0068852_1013288052 | 125 |
| 139 | 3300005617 | Ga0068859_100254340 | Ga0068859_1002543402 | 125 |
| 140 | 3300005617 | Ga0068859_101280075 | Ga0068859_1012800752 | 125 |
| 141 | 3300005617 | Ga0068859_102629967 | Ga0068859_1026299672 | 125 |
| 142 | 3300005618 | Ga0068864_100016890 | Ga0068864_1000168905 | 125 |
| 143 | 3300005618 | Ga0068864_100610733 | Ga0068864_1006107332 | 125 |
| 144 | 3300005719 | Ga0068861_100005628 | Ga0068861_1000056287 | 125 |
| 145 | 3300005719 | Ga0068861_100572872 | Ga0068861_1005728722 | 125 |
| 146 | 3300005719 | Ga0068861_101591346 | Ga0068861_1015913461 | 125 |
| 147 | 3300005840 | Ga0068870_10241879 | Ga0068870_102418792 | 125 |
| 148 | 3300005841 | Ga0068863_100288457 | Ga0068863_1002884573 | 125 |
| 149 | 3300005841 | Ga0068863_100949786 | Ga0068863_1009497862 | 125 |
| 150 | 3300005842 | Ga0068858_101795383 | Ga0068858_1017953831 | 125 |
| 151 | 3300005844 | Ga0068862_100264784 | Ga0068862_1002647842 | 125 |
| 152 | 3300006163 | Ga0070715_10765109 | Ga0070715_107651091 | 125 |
| 153 | 3300006163 | Ga0070715_10877222 | Ga0070715_108772221 | 125 |
| 154 | 3300006195 | Ga0075366_10025131 | Ga0075366_100251314 | 125 |
| 155 | 3300006195 | Ga0075366_10160154 | Ga0075366_101601542 | 125 |
| 156 | 3300006237 | Ga0097621_100015405 | Ga0097621_1000154054 | 125 |
| 157 | 3300006237 | Ga0097621_100250778 | Ga0097621_1002507782 | 125 |
| 158 | 3300006237 | Ga0097621_101183439 | Ga0097621_1011834392 | 125 |
| 159 | 3300006353 | Ga0075370_10041721 | Ga0075370_100417214 | 125 |
| 160 | 3300006358 | Ga0068871_100000354 | Ga0068871_10000035427 | 125 |
| 161 | 3300006358 | Ga0068871_101258025 | Ga0068871_1012580252 | 125 |
| 162 | 3300006844 | Ga0075428_100022554 | Ga0075428_1000225547 | 125 |
| 163 | 3300006844 | Ga0075428_100327241 | Ga0075428_1003272413 | 125 |
| 164 | 3300006846 | Ga0075430_100102450 | Ga0075430_1001024503 | 125 |
| 165 | 3300006846 | Ga0075430_100867684 | Ga0075430_1008676842 | 125 |
| 166 | 3300006847 | Ga0075431_101009177 | Ga0075431_1010091773 | 125 |
| 167 | 3300006881 | Ga0068865_101004942 | Ga0068865_1010049422 | 125 |
| 168 | 3300006931 | Ga0097620_100254354 | Ga0097620_1002543542 | 125 |
| 169 | 3300006931 | Ga0097620_101280234 | Ga0097620_1012802341 | 125 |
| 170 | 3300006931 | Ga0097620_102629975 | Ga0097620_1026299752 | 125 |
| 171 | 3300009093 | Ga0105240_10043033 | Ga0105240_100430338 | 125 |
| 172 | 3300009094 | Ga0111539_10001098 | Ga0111539_100010984 | 125 |
| 173 | 3300009094 | Ga0111539_10066150 | Ga0111539_100661506 | 125 |
| 174 | 3300009094 | Ga0111539_10184231 | Ga0111539_101842311 | 125 |
| 175 | 3300009094 | Ga0111539_10587329 | Ga0111539_105873293 | 125 |
| 176 | 3300009094 | Ga0111539_11801897 | Ga0111539_118018971 | 125 |
| 177 | 3300009094 | Ga0111539_12006044 | Ga0111539_120060442 | 125 |
| 178 | 3300009147 | Ga0114129_11333703 | Ga0114129_113337031 | 125 |
| 179 | 3300009148 | Ga0105243_11926519 | Ga0105243_119265191 | 125 |
| 180 | 3300009176 | Ga0105242_10196886 | Ga0105242_101968863 | 125 |
| 181 | 3300009176 | Ga0105242_10541980 | Ga0105242_105419803 | 125 |
| 182 | 3300009176 | Ga0105242_11752146 | Ga0105242_117521461 | 125 |
| 183 | 3300009545 | Ga0105237_10078649 | Ga0105237_100786492 | 125 |
| 184 | 3300009545 | Ga0105237_10126608 | Ga0105237_101266084 | 125 |
| 185 | 3300009545 | Ga0105237_10417718 | Ga0105237_104177183 | 125 |
| 186 | 3300009551 | Ga0105238_10207266 | Ga0105238_102072663 | 125 |
| 187 | 3300009551 | Ga0105238_11801165 | Ga0105238_118011651 | 125 |
| 188 | 3300009553 | Ga0105249_10005625 | Ga0105249_100056256 | 125 |
| 189 | 3300009553 | Ga0105249_11257557 | Ga0105249_112575571 | 125 |
| 190 | 3300009553 | Ga0105249_11533657 | Ga0105249_115336572 | 125 |
| 191 | 3300010375 | Ga0105239_10176868 | Ga0105239_101768683 | 125 |
| 192 | 3300010375 | Ga0105239_10722488 | Ga0105239_107224882 | 125 |
| 193 | 3300010375 | Ga0105239_12227894 | Ga0105239_122278941 | 125 |
| 194 | 3300012483 | Ga0157337_1035664 | Ga0157337_10356641 | 125 |
| 195 | 3300012508 | Ga0157315_1052551 | Ga0157315_10525511 | 125 |
| 196 | 3300013100 | Ga0157373_10059430 | Ga0157373_100594302 | 125 |
| 197 | 3300013100 | Ga0157373_10065390 | Ga0157373_100653903 | 125 |
| 198 | 3300013100 | Ga0157373_10075797 | Ga0157373_100757972 | 125 |
| 199 | 3300013100 | Ga0157373_10161673 | Ga0157373_101616732 | 125 |
| 200 | 3300013102 | Ga0157371_10035324 | Ga0157371_100353242 | 125 |
| 201 | 3300013102 | Ga0157371_10407032 | Ga0157371_104070323 | 125 |
| 202 | 3300013102 | Ga0157371_10491410 | Ga0157371_104914102 | 125 |
| 203 | 3300013102 | Ga0157371_10586614 | Ga0157371_105866142 | 125 |
| 204 | 3300013102 | Ga0157371_10610722 | Ga0157371_106107222 | 125 |
| 205 | 3300013102 | Ga0157371_10766457 | Ga0157371_107664572 | 125 |
| 206 | 3300013104 | Ga0157370_10054126 | Ga0157370_100541265 | 125 |
| 207 | 3300013104 | Ga0157370_10085830 | Ga0157370_100858304 | 125 |
| 208 | 3300013104 | Ga0157370_10209209 | Ga0157370_102092093 | 125 |
| 209 | 3300013104 | Ga0157370_10217664 | Ga0157370_102176644 | 125 |
| 210 | 3300013104 | Ga0157370_10476306 | Ga0157370_104763062 | 125 |
| 211 | 3300013104 | Ga0157370_10749305 | Ga0157370_107493052 | 125 |
| 212 | 3300013104 | Ga0157370_11101024 | Ga0157370_111010241 | 125 |
| 213 | 3300013104 | Ga0157370_11918181 | Ga0157370_119181811 | 125 |
| 214 | 3300013105 | Ga0157369_10062018 | Ga0157369_100620186 | 125 |
| 215 | 3300013105 | Ga0157369_10235969 | Ga0157369_102359692 | 125 |
| 216 | 3300013105 | Ga0157369_10292053 | Ga0157369_102920531 | 125 |
| 217 | 3300013105 | Ga0157369_10340301 | Ga0157369_103403012 | 125 |
| 218 | 3300013105 | Ga0157369_10408180 | Ga0157369_104081802 | 125 |
| 219 | 3300013105 | Ga0157369_11515515 | Ga0157369_115155151 | 125 |
| 220 | 3300013105 | Ga0157369_11822901 | Ga0157369_118229011 | 125 |
| 221 | 3300013296 | Ga0157374_10103611 | Ga0157374_101036114 | 125 |
| 222 | 3300013296 | Ga0157374_10320265 | Ga0157374_103202652 | 125 |
| 223 | 3300013296 | Ga0157374_10395088 | Ga0157374_103950882 | 125 |
| 224 | 3300013296 | Ga0157374_11848062 | Ga0157374_118480621 | 125 |
| 225 | 3300013297 | Ga0157378_10515618 | Ga0157378_105156181 | 125 |
| 226 | 3300013306 | Ga0163162_10000525 | Ga0163162_1000052514 | 125 |
| 227 | 3300013306 | Ga0163162_10004198 | Ga0163162_1000419811 | 125 |
| 228 | 3300013306 | Ga0163162_10272120 | Ga0163162_102721204 | 125 |
| 229 | 3300013306 | Ga0163162_10752406 | Ga0163162_107524062 | 125 |
| 230 | 3300013307 | Ga0157372_10000332 | Ga0157372_1000033212 | 125 |
| 231 | 3300013307 | Ga0157372_10033754 | Ga0157372_100337545 | 125 |
| 232 | 3300013307 | Ga0157372_10052106 | Ga0157372_100521064 | 125 |
| 233 | 3300013307 | Ga0157372_10124074 | Ga0157372_101240744 | 125 |
| 234 | 3300013307 | Ga0157372_10217417 | Ga0157372_102174171 | 125 |
| 235 | 3300013307 | Ga0157372_10417423 | Ga0157372_104174231 | 125 |
| 236 | 3300013307 | Ga0157372_11136247 | Ga0157372_111362472 | 125 |
| 237 | 3300013307 | Ga0157372_11235425 | Ga0157372_112354252 | 125 |
| 238 | 3300013308 | Ga0157375_10174959 | Ga0157375_101749592 | 125 |
| 239 | 3300013308 | Ga0157375_11000068 | Ga0157375_110000682 | 125 |
| 240 | 3300014325 | Ga0163163_10812204 | Ga0163163_108122041 | 125 |
| 241 | 3300014325 | Ga0163163_11617325 | Ga0163163_116173251 | 125 |
| 242 | 3300014325 | Ga0163163_13033058 | Ga0163163_130330581 | 125 |
| 243 | 3300014326 | Ga0157380_10231312 | Ga0157380_102313123 | 125 |
| 244 | 3300014326 | Ga0157380_10816156 | Ga0157380_108161564 | 125 |
| 245 | 3300014745 | Ga0157377_10445935 | Ga0157377_104459352 | 125 |
| 246 | 3300014745 | Ga0157377_11187804 | Ga0157377_111878041 | 125 |
| 247 | 3300014745 | Ga0157377_11213655 | Ga0157377_112136552 | 125 |
| 248 | 3300014968 | Ga0157379_10078252 | Ga0157379_100782525 | 125 |
| 249 | 3300014968 | Ga0157379_10604201 | Ga0157379_106042012 | 125 |
| 250 | 3300014968 | Ga0157379_10648015 | Ga0157379_106480153 | 125 |
| 251 | 3300014968 | Ga0157379_11096619 | Ga0157379_110966192 | 125 |
| 252 | 3300014969 | Ga0157376_10018195 | Ga0157376_100181952 | 125 |
| 253 | 3300014969 | Ga0157376_10076734 | Ga0157376_100767343 | 125 |
| 254 | 3300014969 | Ga0157376_10630720 | Ga0157376_106307201 | 125 |
| 255 | 3300014969 | Ga0157376_10669329 | Ga0157376_106693292 | 125 |
| 256 | 3300017792 | Ga0163161_10031164 | Ga0163161_100311645 | 125 |
| 257 | 3300017792 | Ga0163161_10997712 | Ga0163161_109977121 | 125 |
| 258 | 3300017792 | Ga0163161_11060844 | Ga0163161_110608441 | 125 |
| 259 | 3300020070 | Ga0206356_10977936 | Ga0206356_109779362 | 125 |
| 260 | 3300020070 | Ga0206356_11894588 | Ga0206356_118945882 | 125 |
| 261 | 3300020076 | Ga0206355_1245730 | Ga0206355_12457301 | 125 |
| 262 | 3300020077 | Ga0206351_10875467 | Ga0206351_108754672 | 125 |
| 263 | 3300020078 | Ga0206352_10531954 | Ga0206352_105319542 | 125 |
| 264 | 3300020078 | Ga0206352_10833769 | Ga0206352_108337692 | 125 |
| 265 | 3300020081 | Ga0206354_10045676 | Ga0206354_100456761 | 125 |
| 266 | 3300020081 | Ga0206354_10659544 | Ga0206354_106595441 | 125 |
| 267 | 3300020081 | Ga0206354_10881077 | Ga0206354_108810772 | 125 |
| 268 | 3300021384 | Ga0213876_10044608 | Ga0213876_100446083 | 125 |
| 269 | 3300022467 | Ga0224712_10000155 | Ga0224712_100001555 | 125 |
| 270 | 3300025271 | Ga0207666_1015241 | Ga0207666_10152412 | 125 |
| 271 | 3300025272 | Ga0209455_1001884 | Ga0209455_100188418 | 125 |
| 272 | 3300025292 | Ga0209676_1000332 | Ga0209676_100033257 | 125 |
| 273 | 3300025298 | Ga0209050_1002964 | Ga0209050_100296417 | 125 |
| 274 | 3300025298 | Ga0209050_1033615 | Ga0209050_10336152 | 125 |
| 275 | 3300025298 | Ga0209050_1046505 | Ga0209050_10465053 | 125 |
| 276 | 3300025302 | Ga0207426_1099924 | Ga0207426_10999241 | 125 |
| 277 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007318 | 125 |
| 278 | 3300025304 | Ga0209257_1012184 | Ga0209257_10121842 | 125 |
| 279 | 3300025315 | Ga0207697_10026925 | Ga0207697_100269253 | 125 |
| 280 | 3300025893 | Ga0207682_10066073 | Ga0207682_100660732 | 125 |
| 281 | 3300025893 | Ga0207682_10075858 | Ga0207682_100758582 | 125 |
| 282 | 3300025901 | Ga0207688_10887863 | Ga0207688_108878631 | 125 |
| 283 | 3300025904 | Ga0207647_10000054 | Ga0207647_1000005413 | 125 |
| 284 | 3300025904 | Ga0207647_10019623 | Ga0207647_100196237 | 125 |
| 285 | 3300025907 | Ga0207645_10035476 | Ga0207645_100354764 | 125 |
| 286 | 3300025908 | Ga0207643_10005441 | Ga0207643_100054415 | 125 |
| 287 | 3300025910 | Ga0207684_11040652 | Ga0207684_110406521 | 125 |
| 288 | 3300025913 | Ga0207695_10005702 | Ga0207695_1000570215 | 125 |
| 289 | 3300025914 | Ga0207671_10000030 | Ga0207671_1000003055 | 125 |
| 290 | 3300025914 | Ga0207671_10335610 | Ga0207671_103356103 | 125 |
| 291 | 3300025914 | Ga0207671_10437008 | Ga0207671_104370082 | 125 |
| 292 | 3300025917 | Ga0207660_10885820 | Ga0207660_108858201 | 125 |
| 293 | 3300025918 | Ga0207662_10030041 | Ga0207662_100300413 | 125 |
| 294 | 3300025918 | Ga0207662_10917504 | Ga0207662_109175041 | 125 |
| 295 | 3300025920 | Ga0207649_10906369 | Ga0207649_109063692 | 125 |
| 296 | 3300025921 | Ga0207652_10059424 | Ga0207652_100594242 | 125 |
| 297 | 3300025921 | Ga0207652_11015828 | Ga0207652_110158282 | 125 |
| 298 | 3300025922 | Ga0207646_10734576 | Ga0207646_107345761 | 125 |
| 299 | 3300025923 | Ga0207681_10185717 | Ga0207681_101857174 | 125 |
| 300 | 3300025923 | Ga0207681_11017919 | Ga0207681_110179192 | 125 |
| 301 | 3300025923 | Ga0207681_11187502 | Ga0207681_111875021 | 125 |
| 302 | 3300025924 | Ga0207694_10175224 | Ga0207694_101752244 | 125 |
| 303 | 3300025925 | Ga0207650_10325652 | Ga0207650_103256522 | 125 |
| 304 | 3300025925 | Ga0207650_11114176 | Ga0207650_111141761 | 125 |
| 305 | 3300025925 | Ga0207650_11790085 | Ga0207650_117900851 | 125 |
| 306 | 3300025931 | Ga0207644_10264422 | Ga0207644_102644222 | 125 |
| 307 | 3300025932 | Ga0207690_10003583 | Ga0207690_1000358310 | 125 |
| 308 | 3300025934 | Ga0207686_10292818 | Ga0207686_102928183 | 125 |
| 309 | 3300025936 | Ga0207670_10032455 | Ga0207670_100324556 | 125 |
| 310 | 3300025936 | Ga0207670_10698976 | Ga0207670_106989762 | 125 |
| 311 | 3300025937 | Ga0207669_11178282 | Ga0207669_111782821 | 125 |
| 312 | 3300025938 | Ga0207704_10327458 | Ga0207704_103274582 | 125 |
| 313 | 3300025940 | Ga0207691_10036749 | Ga0207691_100367495 | 125 |
| 314 | 3300025940 | Ga0207691_10477200 | Ga0207691_104772002 | 125 |
| 315 | 3300025942 | Ga0207689_10008845 | Ga0207689_100088451 | 125 |
| 316 | 3300025942 | Ga0207689_10643383 | Ga0207689_106433831 | 125 |
| 317 | 3300025942 | Ga0207689_10770109 | Ga0207689_107701091 | 125 |
| 318 | 3300025944 | Ga0207661_10064144 | Ga0207661_100641444 | 125 |
| 319 | 3300025944 | Ga0207661_10073534 | Ga0207661_100735344 | 125 |
| 320 | 3300025944 | Ga0207661_11118965 | Ga0207661_111189652 | 125 |
| 321 | 3300025945 | Ga0207679_10437629 | Ga0207679_104376291 | 125 |
| 322 | 3300025945 | Ga0207679_11086121 | Ga0207679_110861211 | 125 |
| 323 | 3300025945 | Ga0207679_11510420 | Ga0207679_115104202 | 125 |
| 324 | 3300025949 | Ga0207667_10163214 | Ga0207667_101632144 | 125 |
| 325 | 3300025949 | Ga0207667_10265903 | Ga0207667_102659032 | 125 |
| 326 | 3300025949 | Ga0207667_10379268 | Ga0207667_103792682 | 125 |
| 327 | 3300025960 | Ga0207651_10363737 | Ga0207651_103637372 | 125 |
| 328 | 3300025961 | Ga0207712_10035246 | Ga0207712_100352463 | 125 |
| 329 | 3300025961 | Ga0207712_10294118 | Ga0207712_102941182 | 125 |
| 330 | 3300025972 | Ga0207668_11180269 | Ga0207668_111802691 | 125 |
| 331 | 3300025972 | Ga0207668_11900150 | Ga0207668_119001501 | 125 |
| 332 | 3300025981 | Ga0207640_10371855 | Ga0207640_103718552 | 125 |
| 333 | 3300025981 | Ga0207640_11470767 | Ga0207640_114707671 | 125 |
| 334 | 3300025981 | Ga0207640_11472386 | Ga0207640_114723861 | 125 |
| 335 | 3300026023 | Ga0207677_10140375 | Ga0207677_101403753 | 125 |
| 336 | 3300026023 | Ga0207677_10483948 | Ga0207677_104839481 | 125 |
| 337 | 3300026023 | Ga0207677_11143544 | Ga0207677_111435441 | 125 |
| 338 | 3300026035 | Ga0207703_11270456 | Ga0207703_112704562 | 125 |
| 339 | 3300026035 | Ga0207703_11292834 | Ga0207703_112928341 | 125 |
| 340 | 3300026041 | Ga0207639_10486623 | Ga0207639_104866232 | 125 |
| 341 | 3300026041 | Ga0207639_10537802 | Ga0207639_105378022 | 125 |
| 342 | 3300026041 | Ga0207639_10771704 | Ga0207639_107717043 | 125 |
| 343 | 3300026041 | Ga0207639_11085442 | Ga0207639_110854421 | 125 |
| 344 | 3300026067 | Ga0207678_10089854 | Ga0207678_100898544 | 125 |
| 345 | 3300026067 | Ga0207678_10125218 | Ga0207678_101252182 | 125 |
| 346 | 3300026075 | Ga0207708_10085358 | Ga0207708_100853582 | 125 |
| 347 | 3300026075 | Ga0207708_11156814 | Ga0207708_111568141 | 125 |
| 348 | 3300026078 | Ga0207702_10068465 | Ga0207702_100684653 | 125 |
| 349 | 3300026078 | Ga0207702_10217569 | Ga0207702_102175693 | 125 |
| 350 | 3300026078 | Ga0207702_10318830 | Ga0207702_103188302 | 125 |
| 351 | 3300026078 | Ga0207702_11601103 | Ga0207702_116011031 | 125 |
| 352 | 3300026078 | Ga0207702_11973600 | Ga0207702_119736001 | 125 |
| 353 | 3300026088 | Ga0207641_11393968 | Ga0207641_113939681 | 125 |
| 354 | 3300026088 | Ga0207641_11467465 | Ga0207641_114674652 | 125 |
| 355 | 3300026089 | Ga0207648_10077148 | Ga0207648_100771484 | 125 |
| 356 | 3300026089 | Ga0207648_10636761 | Ga0207648_106367612 | 125 |
| 357 | 3300026089 | Ga0207648_10662195 | Ga0207648_106621952 | 125 |
| 358 | 3300026089 | Ga0207648_10787707 | Ga0207648_107877072 | 125 |
| 359 | 3300026095 | Ga0207676_10561767 | Ga0207676_105617672 | 125 |
| 360 | 3300026095 | Ga0207676_10905614 | Ga0207676_109056141 | 125 |
| 361 | 3300026116 | Ga0207674_10071461 | Ga0207674_100714614 | 125 |
| 362 | 3300026116 | Ga0207674_10084524 | Ga0207674_100845244 | 125 |
| 363 | 3300026116 | Ga0207674_10090260 | Ga0207674_100902602 | 125 |
| 364 | 3300026116 | Ga0207674_10560319 | Ga0207674_105603192 | 125 |
| 365 | 3300026116 | Ga0207674_10857040 | Ga0207674_108570403 | 125 |
| 366 | 3300026118 | Ga0207675_100515504 | Ga0207675_1005155042 | 125 |
| 367 | 3300026118 | Ga0207675_101921344 | Ga0207675_1019213441 | 125 |
| 368 | 3300026121 | Ga0207683_11340189 | Ga0207683_113401891 | 125 |
| 369 | 3300026142 | Ga0207698_10163778 | Ga0207698_101637782 | 125 |
| 370 | 3300026142 | Ga0207698_10254961 | Ga0207698_102549612 | 125 |
| 371 | 3300026142 | Ga0207698_10545686 | Ga0207698_105456862 | 125 |
| 372 | 3300026142 | Ga0207698_11312354 | Ga0207698_113123541 | 125 |
| 373 | 3300027471 | Ga0209995_1014936 | Ga0209995_10149362 | 125 |
| 374 | 3300027614 | Ga0209970_1022004 | Ga0209970_10220042 | 125 |
| 375 | 3300027907 | Ga0207428_10019856 | Ga0207428_100198563 | 125 |
| 376 | 3300027907 | Ga0207428_10823469 | Ga0207428_108234692 | 125 |
| 377 | 3300028379 | Ga0268266_10000845 | Ga0268266_100008459 | 125 |
| 378 | 3300028380 | Ga0268265_10470075 | Ga0268265_104700752 | 125 |
| 379 | 3300028380 | Ga0268265_11101547 | Ga0268265_111015472 | 125 |
| 380 | 3300028381 | Ga0268264_10006248 | Ga0268264_1000624813 | 125 |
| 381 | 3300028573 | Ga0265334_10025950 | Ga0265334_100259504 | 125 |
| 382 | 3300028794 | Ga0307515_10000009 | Ga0307515_10000009379 | 125 |
| 383 | 3300028794 | Ga0307515_10112100 | Ga0307515_101121005 | 125 |
| 384 | 3300028794 | Ga0307515_10713857 | Ga0307515_107138571 | 125 |
| 385 | 3300028800 | Ga0265338_10357708 | Ga0265338_103577082 | 125 |
| 386 | 3300029957 | Ga0265324_10081379 | Ga0265324_100813791 | 125 |
| 387 | 3300031241 | Ga0265325_10462389 | Ga0265325_104623891 | 125 |
| 388 | 3300031251 | Ga0265327_10000026 | Ga0265327_10000026244 | 125 |
| 389 | 3300031251 | Ga0265327_10000146 | Ga0265327_1000014686 | 125 |
| 390 | 3300031251 | Ga0265327_10000370 | Ga0265327_1000037054 | 125 |
| 391 | 3300031251 | Ga0265327_10004316 | Ga0265327_1000431612 | 125 |
| 392 | 3300031251 | Ga0265327_10090034 | Ga0265327_100900342 | 125 |
| 393 | 3300031251 | Ga0265327_10117506 | Ga0265327_101175064 | 125 |
| 394 | 3300031251 | Ga0265327_10141793 | Ga0265327_101417932 | 125 |
| 395 | 3300031251 | Ga0265327_10145841 | Ga0265327_101458413 | 125 |
| 396 | 3300031344 | Ga0265316_10363451 | Ga0265316_103634512 | 125 |
| 397 | 3300031456 | Ga0307513_10045434 | Ga0307513_100454342 | 125 |
| 398 | 3300031456 | Ga0307513_10045488 | Ga0307513_100454885 | 125 |
| 399 | 3300031507 | Ga0307509_10104738 | Ga0307509_101047382 | 125 |
| 400 | 3300031507 | Ga0307509_10368690 | Ga0307509_103686903 | 125 |
| 401 | 3300031548 | Ga0307408_100133847 | Ga0307408_1001338474 | 125 |
| 402 | 3300031548 | Ga0307408_100349403 | Ga0307408_1003494033 | 125 |
| 403 | 3300031548 | Ga0307408_100682910 | Ga0307408_1006829102 | 125 |
| 404 | 3300031548 | Ga0307408_100817856 | Ga0307408_1008178561 | 125 |
| 405 | 3300031649 | Ga0307514_10233533 | Ga0307514_102335332 | 125 |
| 406 | 3300031691 | Ga0316579_10126698 | Ga0316579_101266982 | 125 |
| 407 | 3300031712 | Ga0265342_10069939 | Ga0265342_100699394 | 125 |
| 408 | 3300031727 | Ga0316576_10001081 | Ga0316576_1000108126 | 125 |
| 409 | 3300031727 | Ga0316576_10017698 | Ga0316576_100176984 | 125 |
| 410 | 3300031727 | Ga0316576_10018128 | Ga0316576_100181284 | 125 |
| 411 | 3300031727 | Ga0316576_10021761 | Ga0316576_100217614 | 125 |
| 412 | 3300031727 | Ga0316576_10027616 | Ga0316576_100276166 | 125 |
| 413 | 3300031727 | Ga0316576_10032421 | Ga0316576_100324216 | 125 |
| 414 | 3300031727 | Ga0316576_10039513 | Ga0316576_100395135 | 125 |
| 415 | 3300031727 | Ga0316576_10048308 | Ga0316576_100483084 | 125 |
| 416 | 3300031727 | Ga0316576_10109448 | Ga0316576_101094484 | 125 |
| 417 | 3300031727 | Ga0316576_10146107 | Ga0316576_101461072 | 125 |
| 418 | 3300031727 | Ga0316576_10152932 | Ga0316576_101529321 | 125 |
| 419 | 3300031727 | Ga0316576_10332258 | Ga0316576_103322584 | 125 |
| 420 | 3300031727 | Ga0316576_10754560 | Ga0316576_107545601 | 125 |
| 421 | 3300031728 | Ga0316578_10004394 | Ga0316578_100043944 | 125 |
| 422 | 3300031728 | Ga0316578_10023848 | Ga0316578_100238481 | 125 |
| 423 | 3300031728 | Ga0316578_10042897 | Ga0316578_100428974 | 125 |
| 424 | 3300031728 | Ga0316578_10081543 | Ga0316578_100815434 | 125 |
| 425 | 3300031728 | Ga0316578_10312557 | Ga0316578_103125573 | 125 |
| 426 | 3300031731 | Ga0307405_10015203 | Ga0307405_100152036 | 125 |
| 427 | 3300031733 | Ga0316577_10022920 | Ga0316577_100229204 | 125 |
| 428 | 3300031824 | Ga0307413_10577032 | Ga0307413_105770322 | 125 |
| 429 | 3300031852 | Ga0307410_10235600 | Ga0307410_102356001 | 125 |
| 430 | 3300031852 | Ga0307410_10701487 | Ga0307410_107014872 | 125 |
| 431 | 3300031901 | Ga0307406_10857065 | Ga0307406_108570651 | 125 |
| 432 | 3300031903 | Ga0307407_10024117 | Ga0307407_100241174 | 125 |
| 433 | 3300031911 | Ga0307412_10925627 | Ga0307412_109256271 | 125 |
| 434 | 3300031911 | Ga0307412_11489309 | Ga0307412_114893092 | 125 |
| 435 | 3300031995 | Ga0307409_100169562 | Ga0307409_1001695622 | 125 |
| 436 | 3300031995 | Ga0307409_102713699 | Ga0307409_1027136991 | 125 |
| 437 | 3300031995 | Ga0307409_102865106 | Ga0307409_1028651061 | 125 |
| 438 | 3300032002 | Ga0307416_100000249 | Ga0307416_1000002498 | 125 |
| 439 | 3300032002 | Ga0307416_100904686 | Ga0307416_1009046862 | 125 |
| 440 | 3300032002 | Ga0307416_100938564 | Ga0307416_1009385641 | 125 |
| 441 | 3300032002 | Ga0307416_101115206 | Ga0307416_1011152061 | 125 |
| 442 | 3300032004 | Ga0307414_10014085 | Ga0307414_100140852 | 125 |
| 443 | 3300032004 | Ga0307414_10168572 | Ga0307414_101685723 | 125 |
| 444 | 3300032004 | Ga0307414_10281684 | Ga0307414_102816843 | 125 |
| 445 | 3300032004 | Ga0307414_10531834 | Ga0307414_105318342 | 125 |
| 446 | 3300032005 | Ga0307411_10496548 | Ga0307411_104965483 | 125 |
| 447 | 3300032126 | Ga0307415_100002166 | Ga0307415_10000216613 | 125 |
| 448 | 3300032126 | Ga0307415_100439468 | Ga0307415_1004394683 | 125 |
| 449 | 3300032126 | Ga0307415_100560677 | Ga0307415_1005606773 | 125 |
| 450 | 3300032137 | Ga0316585_10053022 | Ga0316585_100530223 | 125 |
| 451 | 3300032139 | Ga0316580_10031872 | Ga0316580_100318721 | 125 |
| 452 | 3300032168 | Ga0316593_10003954 | Ga0316593_100039545 | 125 |
| 453 | 3300032168 | Ga0316593_10040978 | Ga0316593_100409784 | 125 |
| 454 | 3300032168 | Ga0316593_10094169 | Ga0316593_100941692 | 125 |
| 455 | 3300032168 | Ga0316593_10165963 | Ga0316593_101659631 | 125 |
| 456 | 3300032168 | Ga0316593_10191908 | Ga0316593_101919082 | 125 |
| 457 | 3300032168 | Ga0316593_10284069 | Ga0316593_102840691 | 125 |
| 458 | 3300033524 | Ga0316592_1000945 | Ga0316592_10009454 | 125 |
| 459 | 3300033524 | Ga0316592_1014787 | Ga0316592_10147872 | 125 |
| 460 | 3300033524 | Ga0316592_1064916 | Ga0316592_10649162 | 125 |
| 461 | 3300033524 | Ga0316592_1078447 | Ga0316592_10784472 | 125 |
| 462 | 3300033527 | Ga0316586_1108850 | Ga0316586_11088502 | 125 |
| 463 | 3300033528 | Ga0316588_1028900 | Ga0316588_10289002 | 125 |
| 464 | 3300033528 | Ga0316588_1049774 | Ga0316588_10497743 | 125 |
| 465 | 3300033528 | Ga0316588_1103022 | Ga0316588_11030222 | 125 |
| 466 | 3300033541 | Ga0316596_1000575 | Ga0316596_10005758 | 125 |
| 467 | 3300033541 | Ga0316596_1002512 | Ga0316596_10025124 | 125 |
| 468 | 3300033541 | Ga0316596_1003747 | Ga0316596_10037472 | 125 |
| 469 | 3300033541 | Ga0316596_1003898 | Ga0316596_10038985 | 125 |
| 470 | 3300033541 | Ga0316596_1004236 | Ga0316596_10042367 | 125 |
| 471 | 3300033541 | Ga0316596_1007610 | Ga0316596_10076104 | 125 |
| 472 | 3300033541 | Ga0316596_1015736 | Ga0316596_10157364 | 125 |
| 473 | 3300033541 | Ga0316596_1031647 | Ga0316596_10316473 | 125 |
| 474 | 3300033541 | Ga0316596_1037945 | Ga0316596_10379452 | 125 |
| 475 | 3300033541 | Ga0316596_1052248 | Ga0316596_10522482 | 125 |
| 476 | 3300033541 | Ga0316596_1086653 | Ga0316596_10866531 | 125 |
| 477 | 3300033541 | Ga0316596_1131683 | Ga0316596_11316832 | 125 |
| 478 | 3300033541 | Ga0316596_1155611 | Ga0316596_11556112 | 125 |
| 479 | 3300033541 | Ga0316596_1178508 | Ga0316596_11785082 | 125 |
| 480 | 3300033541 | Ga0316596_1216739 | Ga0316596_12167391 | 125 |
| 481 | 3300033541 | Ga0316596_1230401 | Ga0316596_12304011 | 125 |
| 482 | 3300033541 | Ga0316596_1246828 | Ga0316596_12468281 | 125 |
| 483 | 3300035114 | Ga0373939_0155015 | Ga0373939_0155015_445_825 | 125 |
| 484 | 3300035117 | Ga0373953_0213853 | Ga0373953_0213853_379_759 | 125 |
| 485 | 3300035171 | Ga0373946_0450082 | Ga0373946_0450082_88_468 | 125 |
| 486 | 3300035172 | Ga0373955_0173310 | Ga0373955_0173310_493_873 | 125 |
| 487 | 3300035172 | Ga0373955_0398680 | Ga0373955_0398680_420_800 | 125 |
| 488 | 3300035398 | Ga0316574_0027184 | Ga0316574_0027184_1328_1705 | 125 |
| 489 | 3300035398 | Ga0316574_0070134 | Ga0316574_0070134_1631_2008 | 125 |
| 490 | 3300035398 | Ga0316574_0879146 | Ga0316574_0879146_35_412 | 125 |
| 491 | 3300035691 | Ga0373931_0120868 | Ga0373931_0120868_533_913 | 125 |
| 492 | 3300035691 | Ga0373931_1163690 | Ga0373931_1163690_112_492 | 125 |
| 493 | 3300035692 | Ga0373935_0060159 | Ga0373935_0060159_1962_2342 | 125 |
| 494 | 3300035695 | Ga0373927_0079676 | Ga0373927_0079676_643_1023 | 125 |
| 495 | 3300036401 | Ga0373937_0037881 | Ga0373937_0037881_2858_3238 | 125 |
| 496 | 3300036401 | Ga0373937_0568783 | Ga0373937_0568783_610_990 | 125 |
| 497 | 3300036401 | Ga0373937_1744908 | Ga0373937_1744908_101_481 | 125 |
| 498 | 3300036401 | Ga0373937_1862027 | Ga0373937_1862027_40_420 | 125 |
| 499 | 3300036647 | Ga0316582_0014930 | Ga0316582_0014930_3082_3459 | 125 |
| 500 | 3300036647 | Ga0316582_0063175 | Ga0316582_0063175_1682_2059 | 125 |
| 501 | 3300036647 | Ga0316582_0345011 | Ga0316582_0345011_120_497 | 125 |
| 502 | 3300036647 | Ga0316582_0384732 | Ga0316582_0384732_360_737 | 125 |
| 503 | 3300036647 | Ga0316582_0402713 | Ga0316582_0402713_101_478 | 125 |
| 504 | 3300036647 | Ga0316582_0474089 | Ga0316582_0474089_79_456 | 125 |
| 505 | 3300036712 | Ga0316584_0005378 | Ga0316584_0005378_5298_5675 | 125 |
| 506 | 3300036712 | Ga0316584_0007005 | Ga0316584_0007005_2315_2692 | 125 |
| 507 | 3300036712 | Ga0316584_0021141 | Ga0316584_0021141_251_628 | 125 |
| 508 | 3300036712 | Ga0316584_0087726 | Ga0316584_0087726_1749_2126 | 125 |
| 509 | 3300036712 | Ga0316584_0228188 | Ga0316584_0228188_587_964 | 125 |
| 510 | 3300036712 | Ga0316584_0284516 | Ga0316584_0284516_16_393 | 125 |
| 511 | 3300036712 | Ga0316584_0333907 | Ga0316584_0333907_306_683 | 125 |
| 512 | 3300036712 | Ga0316584_0469360 | Ga0316584_0469360_318_695 | 125 |
| 513 | 3300036712 | Ga0316584_0762991 | Ga0316584_0762991_78_458 | 125 |
| 514 | 3300037312 | Ga0395899_0172428 | Ga0395899_0172428_759_1136 | 125 |
| 515 | 3300037312 | Ga0395899_0437442 | Ga0395899_0437442_211_588 | 125 |
| 516 | 3300037418 | Ga0395900_0009171 | Ga0395900_0009171_2151_2531 | 125 |
| 517 | 3300037418 | Ga0395900_0208359 | Ga0395900_0208359_1186_1563 | 125 |
| 518 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_263652_264029 | 125 |
| 519 | 3300037471 | Ga0395905_0006283 | Ga0395905_0006283_2875_3255 | 125 |
| 520 | 3300037471 | Ga0395905_0277254 | Ga0395905_0277254_600_980 | 125 |
| 521 | 3300037471 | Ga0395905_0607028 | Ga0395905_0607028_471_851 | 125 |
| 522 | 3300038443 | Ga0395901_0000654 | Ga0395901_0000654_27172_27549 | 125 |
| 523 | 3300038443 | Ga0395901_0003122 | Ga0395901_0003122_1677_2054 | 125 |
| 524 | 3300039062 | Ga0400483_035362 | Ga0400483_035362_11989_12366 | 125 |
| 525 | 3300039093 | Ga0400489_18980 | Ga0400489_18980_35_412 | 125 |
| 526 | 3300039437 | Ga0436365_0305539 | Ga0436365_0305539_1021_1401 | 125 |
| 527 | 3300039437 | Ga0436365_0676798 | Ga0436365_0676798_57_437 | 125 |
| 528 | 3300039437 | Ga0436365_0968552 | Ga0436365_0968552_126_506 | 125 |
| 529 | 3300039437 | Ga0436365_1194723 | Ga0436365_1194723_1663_2043 | 125 |
| 530 | 3300039450 | Ga0436363_0513489 | Ga0436363_0513489_30_410 | 125 |
| 531 | 3300041413 | Ga0439465_0094319 | Ga0439465_0094319_233_613 | 125 |
| 532 | 3300041413 | Ga0439465_0289974 | Ga0439465_0289974_123_503 | 125 |
| 533 | 3300041441 | Ga0451787_079098 | Ga0451787_079098_150_527 | 125 |
| 534 | 3300041443 | Ga0451789_1092803 | Ga0451789_1092803_111_491 | 125 |
| 535 | 3300041444 | Ga0451790_13840 | Ga0451790_13840_210_590 | 125 |
| 536 | 3300041444 | Ga0451790_41939 | Ga0451790_41939_168_545 | 125 |
| 537 | 3300041444 | Ga0451790_47771 | Ga0451790_47771_70_450 | 125 |
| 538 | 3300041446 | Ga0451794_03323 | Ga0451794_03323_94_474 | 125 |
| 539 | 3300041446 | Ga0451794_06250 | Ga0451794_06250_127_507 | 125 |
| 540 | 3300041451 | Ga0451791_0115989 | Ga0451791_0115989_197_577 | 125 |
| 541 | 3300041452 | Ga0451793_0885796 | Ga0451793_0885796_124_504 | 125 |
| 542 | 3300041452 | Ga0451793_1886256 | Ga0451793_1886256_403_783 | 125 |
| 543 | 3300041453 | Ga0451797_1262852 | Ga0451797_1262852_47_427 | 125 |
| 544 | 3300041456 | Ga0451795_0000788 | Ga0451795_0000788_733_1113 | 125 |
| 545 | 3300041456 | Ga0451795_0069802 | Ga0451795_0069802_74_454 | 125 |
| 546 | 3300041456 | Ga0451795_0271097 | Ga0451795_0271097_386_763 | 125 |
| 547 | 3300041456 | Ga0451795_0389135 | Ga0451795_0389135_106_486 | 125 |
| 548 | 3300041456 | Ga0451795_0817895 | Ga0451795_0817895_886_1266 | 125 |
| 549 | 3300041456 | Ga0451795_1033178 | Ga0451795_1033178_58_438 | 125 |
| 550 | 3300041456 | Ga0451795_1256897 | Ga0451795_1256897_306_686 | 125 |
| 551 | 3300041458 | Ga0451798_0431874 | Ga0451798_0431874_16_396 | 125 |
| 552 | 3300041459 | Ga0451800_0749243 | Ga0451800_0749243_278_658 | 125 |
| 553 | 3300041460 | Ga0451802_0357152 | Ga0451802_0357152_349_729 | 125 |
| 554 | 3300041460 | Ga0451802_2183209 | Ga0451802_2183209_124_504 | 125 |
| 555 | 3300041463 | Ga0451804_0982978 | Ga0451804_0982978_55_435 | 125 |
| 556 | 3300041486 | Ga0451807_1052428 | Ga0451807_1052428_99_479 | 125 |
| 557 | 3300041486 | Ga0451807_1974311 | Ga0451807_1974311_167_547 | 125 |
| 558 | 3300041491 | Ga0451833_0948996 | Ga0451833_0948996_187_567 | 125 |
| 559 | 3300041494 | Ga0451837_0557409 | Ga0451837_0557409_189_569 | 125 |
| 560 | 3300041494 | Ga0451837_0757746 | Ga0451837_0757746_195_572 | 125 |
| 561 | 3300041498 | Ga0451841_0481137 | Ga0451841_0481137_198_575 | 125 |
| 562 | 3300041502 | Ga0451846_24529 | Ga0451846_24529_22_402 | 125 |
| 563 | 3300041503 | Ga0451847_0304467 | Ga0451847_0304467_185_562 | 125 |
| 564 | 3300041507 | Ga0451851_0610101 | Ga0451851_0610101_177_557 | 125 |
| 565 | 3300041507 | Ga0451851_1332631 | Ga0451851_1332631_16_396 | 125 |
| 566 | 3300041508 | Ga0451852_09946 | Ga0451852_09946_157_537 | 125 |
| 567 | 3300041508 | Ga0451852_13332 | Ga0451852_13332_2659_3039 | 125 |
| 568 | 3300041508 | Ga0451852_38882 | Ga0451852_38882_303_683 | 125 |
| 569 | 3300041511 | Ga0451855_0171797 | Ga0451855_0171797_18_398 | 125 |
| 570 | 3300041511 | Ga0451855_0427028 | Ga0451855_0427028_147_527 | 125 |
| 571 | 3300041511 | Ga0451855_0484682 | Ga0451855_0484682_449_826 | 125 |
| 572 | 3300041511 | Ga0451855_0497909 | Ga0451855_0497909_981_1358 | 125 |
| 573 | 3300041511 | Ga0451855_0824732 | Ga0451855_0824732_443_823 | 125 |
| 574 | 3300041511 | Ga0451855_0918148 | Ga0451855_0918148_94_471 | 125 |
| 575 | 3300041511 | Ga0451855_1038422 | Ga0451855_1038422_251_631 | 125 |
| 576 | 3300041511 | Ga0451855_1240003 | Ga0451855_1240003_615_992 | 125 |
| 577 | 3300041511 | Ga0451855_1928680 | Ga0451855_1928680_27_407 | 125 |
| 578 | 3300041512 | Ga0451853_0182524 | Ga0451853_0182524_260_640 | 125 |
| 579 | 3300041512 | Ga0451853_3993765 | Ga0451853_3993765_32_412 | 125 |
| 580 | 3300041997 | Ga0439431_0118691 | Ga0439431_0118691_274_654 | 125 |
| 581 | 3300042001 | Ga0439441_030480 | Ga0439441_030480_363_743 | 125 |
| 582 | 3300042004 | Ga0439445_0003220 | Ga0439445_0003220_2693_3073 | 125 |
| 583 | 3300042007 | Ga0439449_0002213 | Ga0439449_0002213_6303_6683 | 125 |
| 584 | 3300042007 | Ga0439449_0067389 | Ga0439449_0067389_691_1068 | 125 |
| 585 | 3300042015 | Ga0439462_0257479 | Ga0439462_0257479_68_448 | 125 |
| 586 | 3300042127 | Ga0450890_042374 | Ga0450890_042374_210_590 | 125 |
| 587 | 3300042156 | Ga0439446_0167257 | Ga0439446_0167257_322_702 | 125 |
| 588 | 3300042157 | Ga0439458_0210270 | Ga0439458_0210270_16_396 | 125 |
| 589 | 3300042435 | Ga0439434_0110484 | Ga0439434_0110484_324_704 | 125 |
| 590 | 3300042437 | Ga0439444_0062706 | Ga0439444_0062706_218_598 | 125 |
| 591 | 3300042532 | Ga0450893_0001114 | Ga0450893_0001114_2635_3015 | 125 |
| 592 | 3300042876 | Ga0451577_0000092 | Ga0451577_0000092_140947_141324 | 125 |
| 593 | 3300042876 | Ga0451577_0000433 | Ga0451577_0000433_65785_66162 | 125 |
| 594 | 3300042876 | Ga0451577_0000690 | Ga0451577_0000690_4569_4946 | 125 |
| 595 | 3300042876 | Ga0451577_0005144 | Ga0451577_0005144_5429_5806 | 125 |
| 596 | 3300042876 | Ga0451577_0009644 | Ga0451577_0009644_25_402 | 125 |
| 597 | 3300042876 | Ga0451577_0022022 | Ga0451577_0022022_2056_2433 | 125 |
| 598 | 3300042876 | Ga0451577_0023389 | Ga0451577_0023389_1312_1689 | 125 |
| 599 | 3300042876 | Ga0451577_0024955 | Ga0451577_0024955_2825_3202 | 125 |
| 600 | 3300042876 | Ga0451577_0025303 | Ga0451577_0025303_106_483 | 125 |
| 601 | 3300042876 | Ga0451577_0026335 | Ga0451577_0026335_4402_4782 | 125 |
| 602 | 3300042876 | Ga0451577_0047949 | Ga0451577_0047949_73_450 | 125 |
| 603 | 3300042876 | Ga0451577_0107299 | Ga0451577_0107299_1044_1421 | 125 |
| 604 | 3300042876 | Ga0451577_0179508 | Ga0451577_0179508_1430_1810 | 125 |
| 605 | 3300042876 | Ga0451577_0258725 | Ga0451577_0258725_1098_1475 | 125 |
| 606 | 3300042876 | Ga0451577_0262956 | Ga0451577_0262956_570_950 | 125 |
| 607 | 3300042876 | Ga0451577_0350301 | Ga0451577_0350301_534_914 | 125 |
| 608 | 3300042876 | Ga0451577_0389652 | Ga0451577_0389652_808_1185 | 125 |
| 609 | 3300042876 | Ga0451577_0476389 | Ga0451577_0476389_14_391 | 125 |
| 610 | 3300042876 | Ga0451577_0480707 | Ga0451577_0480707_234_611 | 125 |
| 611 | 3300042876 | Ga0451577_0812103 | Ga0451577_0812103_170_547 | 125 |
| 612 | 3300042876 | Ga0451577_0931162 | Ga0451577_0931162_263_643 | 125 |
| 613 | 3300042876 | Ga0451577_1253466 | Ga0451577_1253466_198_575 | 125 |
| 614 | 3300042876 | Ga0451577_1631566 | Ga0451577_1631566_148_525 | 125 |
| 615 | 3300044658 | Ga0466972_0276976 | Ga0466972_0276976_350_730 | 125 |
| 616 | 3300044673 | Ga0453683_0000055 | Ga0453683_0000055_66996_67373 | 125 |
| 617 | 3300044673 | Ga0453683_0000066 | Ga0453683_0000066_164397_164774 | 125 |
| 618 | 3300044673 | Ga0453683_0000522 | Ga0453683_0000522_18307_18684 | 125 |
| 619 | 3300044673 | Ga0453683_0005928 | Ga0453683_0005928_8025_8402 | 125 |
| 620 | 3300044673 | Ga0453683_0006727 | Ga0453683_0006727_2168_2545 | 125 |
| 621 | 3300044673 | Ga0453683_0010256 | Ga0453683_0010256_3946_4323 | 125 |
| 622 | 3300044673 | Ga0453683_0015630 | Ga0453683_0015630_2218_2598 | 125 |
| 623 | 3300044673 | Ga0453683_0019499 | Ga0453683_0019499_947_1324 | 125 |
| 624 | 3300044673 | Ga0453683_0044943 | Ga0453683_0044943_125_505 | 125 |
| 625 | 3300044673 | Ga0453683_0099173 | Ga0453683_0099173_1095_1472 | 125 |
| 626 | 3300044673 | Ga0453683_0114221 | Ga0453683_0114221_153_533 | 125 |
| 627 | 3300044673 | Ga0453683_0118753 | Ga0453683_0118753_1028_1405 | 125 |
| 628 | 3300044673 | Ga0453683_0138833 | Ga0453683_0138833_13_390 | 125 |
| 629 | 3300044673 | Ga0453683_0139064 | Ga0453683_0139064_579_956 | 125 |
| 630 | 3300044673 | Ga0453683_0162196 | Ga0453683_0162196_924_1301 | 125 |
| 631 | 3300044673 | Ga0453683_0215687 | Ga0453683_0215687_385_762 | 125 |
| 632 | 3300044673 | Ga0453683_0216051 | Ga0453683_0216051_15_392 | 125 |
| 633 | 3300044673 | Ga0453683_0336710 | Ga0453683_0336710_392_772 | 125 |
| 634 | 3300044712 | Ga0453684_0000440 | Ga0453684_0000440_96648_97025 | 125 |
| 635 | 3300044712 | Ga0453684_0000506 | Ga0453684_0000506_10820_11197 | 125 |
| 636 | 3300044712 | Ga0453684_0001121 | Ga0453684_0001121_46080_46457 | 125 |
| 637 | 3300044712 | Ga0453684_0001193 | Ga0453684_0001193_62169_62546 | 125 |
| 638 | 3300044712 | Ga0453684_0001382 | Ga0453684_0001382_10731_11108 | 125 |
| 639 | 3300044712 | Ga0453684_0001549 | Ga0453684_0001549_42327_42704 | 125 |
| 640 | 3300044712 | Ga0453684_0002895 | Ga0453684_0002895_4755_5132 | 125 |
| 641 | 3300044712 | Ga0453684_0004492 | Ga0453684_0004492_3100_3477 | 125 |
| 642 | 3300044712 | Ga0453684_0012002 | Ga0453684_0012002_11755_12132 | 125 |
| 643 | 3300044712 | Ga0453684_0012437 | Ga0453684_0012437_8768_9145 | 125 |
| 644 | 3300044712 | Ga0453684_0012544 | Ga0453684_0012544_6828_7208 | 125 |
| 645 | 3300044712 | Ga0453684_0012598 | Ga0453684_0012598_7937_8314 | 125 |
| 646 | 3300044712 | Ga0453684_0024288 | Ga0453684_0024288_4861_5238 | 125 |
| 647 | 3300044712 | Ga0453684_0035092 | Ga0453684_0035092_1329_1706 | 125 |
| 648 | 3300044712 | Ga0453684_0049674 | Ga0453684_0049674_2561_2938 | 125 |
| 649 | 3300044712 | Ga0453684_0057385 | Ga0453684_0057385_188_565 | 125 |
| 650 | 3300044712 | Ga0453684_0064505 | Ga0453684_0064505_2142_2519 | 125 |
| 651 | 3300044712 | Ga0453684_0076172 | Ga0453684_0076172_3025_3402 | 125 |
| 652 | 3300044712 | Ga0453684_0104626 | Ga0453684_0104626_2728_3108 | 125 |
| 653 | 3300044712 | Ga0453684_0122847 | Ga0453684_0122847_2524_2901 | 125 |
| 654 | 3300044712 | Ga0453684_0133450 | Ga0453684_0133450_739_1119 | 125 |
| 655 | 3300044712 | Ga0453684_0143337 | Ga0453684_0143337_214_591 | 125 |
| 656 | 3300044712 | Ga0453684_0145941 | Ga0453684_0145941_1912_2289 | 125 |
| 657 | 3300044712 | Ga0453684_0200799 | Ga0453684_0200799_722_1102 | 125 |
| 658 | 3300044712 | Ga0453684_0213872 | Ga0453684_0213872_1126_1503 | 125 |
| 659 | 3300044712 | Ga0453684_0267728 | Ga0453684_0267728_1124_1501 | 125 |
| 660 | 3300044712 | Ga0453684_0322460 | Ga0453684_0322460_352_729 | 125 |
| 661 | 3300044712 | Ga0453684_0385184 | Ga0453684_0385184_525_902 | 125 |
| 662 | 3300044712 | Ga0453684_0431129 | Ga0453684_0431129_367_744 | 125 |
| 663 | 3300044712 | Ga0453684_0494236 | Ga0453684_0494236_436_813 | 125 |
| 664 | 3300044712 | Ga0453684_0577897 | Ga0453684_0577897_505_882 | 125 |
| 665 | 3300044712 | Ga0453684_0601526 | Ga0453684_0601526_33_410 | 125 |
| 666 | 3300044712 | Ga0453684_0719378 | Ga0453684_0719378_650_1027 | 125 |
| 667 | 3300044712 | Ga0453684_0897059 | Ga0453684_0897059_198_578 | 125 |
| 668 | 3300044712 | Ga0453684_0992680 | Ga0453684_0992680_362_739 | 125 |
| 669 | 3300044712 | Ga0453684_1318108 | Ga0453684_1318108_73_450 | 125 |
| 670 | 3300044712 | Ga0453684_1428135 | Ga0453684_1428135_140_517 | 125 |
| 671 | 3300044712 | Ga0453684_1815219 | Ga0453684_1815219_196_573 | 125 |
| 672 | 3300044842 | Ga0466957_0664174 | Ga0466957_0664174_52_432 | 125 |
| 673 | 3300045051 | Ga0451576_0000113 | Ga0451576_0000113_181728_182105 | 125 |
| 674 | 3300045051 | Ga0451576_0000204 | Ga0451576_0000204_140947_141324 | 125 |
| 675 | 3300045051 | Ga0451576_0000689 | Ga0451576_0000689_4741_5118 | 125 |
| 676 | 3300045051 | Ga0451576_0000783 | Ga0451576_0000783_15_392 | 125 |
| 677 | 3300045051 | Ga0451576_0003461 | Ga0451576_0003461_7183_7560 | 125 |
| 678 | 3300045051 | Ga0451576_0003652 | Ga0451576_0003652_4055_4432 | 125 |
| 679 | 3300045051 | Ga0451576_0011102 | Ga0451576_0011102_6518_6895 | 125 |
| 680 | 3300045051 | Ga0451576_0012395 | Ga0451576_0012395_4933_5313 | 125 |
| 681 | 3300045051 | Ga0451576_0013908 | Ga0451576_0013908_5632_6009 | 125 |
| 682 | 3300045051 | Ga0451576_0047592 | Ga0451576_0047592_3054_3434 | 125 |
| 683 | 3300045051 | Ga0451576_0083654 | Ga0451576_0083654_15_392 | 125 |
| 684 | 3300045051 | Ga0451576_0088919 | Ga0451576_0088919_1036_1413 | 125 |
| 685 | 3300045051 | Ga0451576_0121529 | Ga0451576_0121529_788_1165 | 125 |
| 686 | 3300045051 | Ga0451576_0124949 | Ga0451576_0124949_363_740 | 125 |
| 687 | 3300045051 | Ga0451576_0133725 | Ga0451576_0133725_433_813 | 125 |
| 688 | 3300045051 | Ga0451576_0165783 | Ga0451576_0165783_1104_1484 | 125 |
| 689 | 3300045051 | Ga0451576_0176056 | Ga0451576_0176056_194_571 | 125 |
| 690 | 3300045051 | Ga0451576_0277421 | Ga0451576_0277421_780_1157 | 125 |
| 691 | 3300045051 | Ga0451576_0291923 | Ga0451576_0291923_607_984 | 125 |
| 692 | 3300045051 | Ga0451576_0374307 | Ga0451576_0374307_56_436 | 125 |
| 693 | 3300045051 | Ga0451576_0848375 | Ga0451576_0848375_24_404 | 125 |
| 694 | 3300045051 | Ga0451576_0937455 | Ga0451576_0937455_423_800 | 125 |
| 695 | 3300045051 | Ga0451576_0996934 | Ga0451576_0996934_439_816 | 125 |
| 696 | 3300045051 | Ga0451576_1432327 | Ga0451576_1432327_289_666 | 125 |
| 697 | 3300045051 | Ga0451576_1466520 | Ga0451576_1466520_205_582 | 125 |
| 698 | 3300045051 | Ga0451576_1772569 | Ga0451576_1772569_232_609 | 125 |
| 699 | 3300046454 | Ga0495592_0841048 | Ga0495592_0841048_47_427 | 125 |
| 700 | 3300046460 | Ga0495638_0000040 | Ga0495638_0000040_127373_127753 | 125 |
| 701 | 3300046472 | Ga0495580_0138723 | Ga0495580_0138723_31_411 | 125 |
| 702 | 3300046475 | Ga0495639_0292676 | Ga0495639_0292676_192_572 | 125 |
| 703 | 3300046476 | Ga0495662_0337290 | Ga0495662_0337290_128_508 | 125 |
| 704 | 3300046477 | Ga0495664_0720892 | Ga0495664_0720892_173_553 | 125 |
| 705 | 3300046511 | Ga0495608_0369474 | Ga0495608_0369474_202_582 | 125 |
| 706 | 3300046514 | Ga0495618_0449267 | Ga0495618_0449267_351_731 | 125 |
| 707 | 3300046516 | Ga0495628_0963096 | Ga0495628_0963096_133_513 | 125 |
| 708 | 3300046517 | Ga0495630_0252558 | Ga0495630_0252558_652_1032 | 125 |
| 709 | 3300046535 | Ga0495586_0205973 | Ga0495586_0205973_485_865 | 125 |
| 710 | 3300046535 | Ga0495586_0641382 | Ga0495586_0641382_210_590 | 125 |
| 711 | 3300046543 | Ga0495645_0077970 | Ga0495645_0077970_1223_1603 | 125 |
| 712 | 3300046660 | Ga0495625_0719846 | Ga0495625_0719846_75_455 | 125 |
| 713 | 3300046664 | Ga0495659_0354380 | Ga0495659_0354380_138_518 | 125 |
| 714 | 3300046665 | Ga0495661_0107289 | Ga0495661_0107289_525_902 | 125 |
| 715 | 3300046674 | Ga0495588_0196215 | Ga0495588_0196215_385_765 | 125 |
| 716 | 3300046674 | Ga0495588_0386751 | Ga0495588_0386751_247_627 | 125 |
| 717 | 3300046675 | Ga0495657_0227691 | Ga0495657_0227691_700_1080 | 125 |
| 718 | 3300046680 | Ga0495646_0348904 | Ga0495646_0348904_99_479 | 125 |
| 719 | 3300046683 | Ga0495658_0714549 | Ga0495658_0714549_155_535 | 125 |
| 720 | 3300046691 | Ga0495670_0002356 | Ga0495670_0002356_4918_5298 | 125 |
| 721 | 3300046691 | Ga0495670_0242597 | Ga0495670_0242597_382_762 | 125 |
| 722 | 3300046691 | Ga0495670_0353582 | Ga0495670_0353582_256_633 | 125 |
| 723 | 3300046694 | Ga0495649_0152895 | Ga0495649_0152895_176_556 | 125 |
| 724 | 3300046809 | Ga0495600_0686773 | Ga0495600_0686773_58_438 | 125 |
| 725 | 3300047315 | Ga0495581_0823918 | Ga0495581_0823918_44_424 | 125 |
| 726 | 3300047318 | Ga0495636_0000049 | Ga0495636_0000049_31459_31839 | 125 |
| 727 | 3300047318 | Ga0495636_0396842 | Ga0495636_0396842_222_602 | 125 |
| 728 | 3300047319 | Ga0495674_0504313 | Ga0495674_0504313_354_734 | 125 |
| 729 | 3300047445 | Ga0495677_0280987 | Ga0495677_0280987_50_430 | 125 |
| 730 | 3300047445 | Ga0495677_0445352 | Ga0495677_0445352_85_465 | 125 |
| 731 | 3300048090 | Ga0495615_0157670 | Ga0495615_0157670_138_518 | 125 |
| 732 | 3300048908 | Ga0496105_0895376 | Ga0496105_0895376_33_413 | 125 |
| 733 | 3300048917 | Ga0496114_0165201 | Ga0496114_0165201_170_550 | 125 |
| 734 | 3300048917 | Ga0496114_0836726 | Ga0496114_0836726_334_714 | 125 |
| 735 | 3300048918 | Ga0496115_0213459 | Ga0496115_0213459_127_507 | 125 |
| 736 | 3300048918 | Ga0496115_1277852 | Ga0496115_1277852_55_435 | 125 |
| 737 | 3300048925 | Ga0496122_0443410 | Ga0496122_0443410_168_545 | 125 |
| 738 | 3300049127 | Ga0501306_000044 | Ga0501306_000044_2656_3036 | 125 |
| 739 | 3300049127 | Ga0501306_000698 | Ga0501306_000698_490_870 | 125 |
| 740 | 3300049127 | Ga0501306_004708 | Ga0501306_004708_554_931 | 125 |
| 741 | 3300049127 | Ga0501306_037461 | Ga0501306_037461_228_605 | 125 |
| 742 | 3300049127 | Ga0501306_048747 | Ga0501306_048747_141_521 | 125 |
| 743 | 3300049127 | Ga0501306_049046 | Ga0501306_049046_155_532 | 125 |
| 744 | 3300049127 | Ga0501306_054487 | Ga0501306_054487_163_543 | 125 |
| 745 | 3300049128 | Ga0501308_000036 | Ga0501308_000036_3615_3995 | 125 |
| 746 | 3300049128 | Ga0501308_001435 | Ga0501308_001435_1301_1678 | 125 |
| 747 | 3300049128 | Ga0501308_011162 | Ga0501308_011162_144_521 | 125 |
| 748 | 3300049128 | Ga0501308_019380 | Ga0501308_019380_292_672 | 125 |
| 749 | 3300049128 | Ga0501308_028121 | Ga0501308_028121_59_436 | 125 |
| 750 | 3300049128 | Ga0501308_028905 | Ga0501308_028905_230_610 | 125 |
| 751 | 3300049128 | Ga0501308_029073 | Ga0501308_029073_188_565 | 125 |
| 752 | 3300049128 | Ga0501308_060046 | Ga0501308_060046_166_546 | 125 |
| 753 | 3300049129 | Ga0501309_000005 | Ga0501309_000005_8103_8483 | 125 |
| 754 | 3300049129 | Ga0501309_000848 | Ga0501309_000848_1677_2057 | 125 |
| 755 | 3300049129 | Ga0501309_001731 | Ga0501309_001731_1193_1570 | 125 |
| 756 | 3300049129 | Ga0501309_007200 | Ga0501309_007200_901_1281 | 125 |
| 757 | 3300049129 | Ga0501309_036750 | Ga0501309_036750_182_562 | 125 |
| 758 | 3300049129 | Ga0501309_054456 | Ga0501309_054456_237_617 | 125 |
| 759 | 3300049129 | Ga0501309_073816 | Ga0501309_073816_48_425 | 125 |
| 760 | 3300049130 | Ga0501310_001746 | Ga0501310_001746_1150_1530 | 125 |
| 761 | 3300049130 | Ga0501310_003848 | Ga0501310_003848_572_949 | 125 |
| 762 | 3300049130 | Ga0501310_004031 | Ga0501310_004031_226_606 | 125 |
| 763 | 3300049130 | Ga0501310_006036 | Ga0501310_006036_231_608 | 125 |
| 764 | 3300049130 | Ga0501310_023135 | Ga0501310_023135_241_621 | 125 |
| 765 | 3300049130 | Ga0501310_081016 | Ga0501310_081016_99_479 | 125 |
| 766 | 3300049131 | Ga0501341_08052 | Ga0501341_08052_129_506 | 125 |
| 767 | 3300049132 | Ga0501343_001105 | Ga0501343_001105_1030_1410 | 125 |
| 768 | 3300049132 | Ga0501343_001931 | Ga0501343_001931_620_997 | 125 |
| 769 | 3300049132 | Ga0501343_002495 | Ga0501343_002495_373_750 | 125 |
| 770 | 3300049160 | Ga0501304_000029 | Ga0501304_000029_3575_3955 | 125 |
| 771 | 3300049160 | Ga0501304_002473 | Ga0501304_002473_543_920 | 125 |
| 772 | 3300049160 | Ga0501304_010524 | Ga0501304_010524_167_544 | 125 |
| 773 | 3300049161 | Ga0501305_000041 | Ga0501305_000041_3013_3393 | 125 |
| 774 | 3300049161 | Ga0501305_000239 | Ga0501305_000239_1145_1525 | 125 |
| 775 | 3300049161 | Ga0501305_004857 | Ga0501305_004857_451_831 | 125 |
| 776 | 3300049161 | Ga0501305_008405 | Ga0501305_008405_205_582 | 125 |
| 777 | 3300049161 | Ga0501305_014049 | Ga0501305_014049_56_433 | 125 |
| 778 | 3300049161 | Ga0501305_017070 | Ga0501305_017070_405_785 | 125 |
| 779 | 3300049161 | Ga0501305_019261 | Ga0501305_019261_255_635 | 125 |
| 780 | 3300049161 | Ga0501305_041091 | Ga0501305_041091_209_589 | 125 |
| 781 | 3300049161 | Ga0501305_051691 | Ga0501305_051691_293_673 | 125 |
| 782 | 3300049162 | Ga0501307_000237 | Ga0501307_000237_1628_2008 | 125 |
| 783 | 3300049162 | Ga0501307_001795 | Ga0501307_001795_876_1253 | 125 |
| 784 | 3300049162 | Ga0501307_006763 | Ga0501307_006763_425_805 | 125 |
| 785 | 3300049162 | Ga0501307_024105 | Ga0501307_024105_267_644 | 125 |
| 786 | 3300049162 | Ga0501307_030240 | Ga0501307_030240_223_600 | 125 |
| 787 | 3300049162 | Ga0501307_037960 | Ga0501307_037960_25_405 | 125 |
| 788 | 3300049162 | Ga0501307_050062 | Ga0501307_050062_234_614 | 125 |
| 789 | 3300049162 | Ga0501307_075905 | Ga0501307_075905_42_422 | 125 |
| 790 | 3300049519 | Ga0501296_064433 | Ga0501296_064433_96_476 | 125 |
| 791 | 3300049521 | Ga0501298_036258 | Ga0501298_036258_148_525 | 125 |
| 792 | 3300049526 | Ga0501303_026218 | Ga0501303_026218_130_510 | 125 |
| 793 | 3300049527 | Ga0501311_002954 | Ga0501311_002954_524_904 | 125 |
| 794 | 3300049527 | Ga0501311_004120 | Ga0501311_004120_648_1025 | 125 |
| 795 | 3300049527 | Ga0501311_008889 | Ga0501311_008889_576_953 | 125 |
| 796 | 3300049527 | Ga0501311_010378 | Ga0501311_010378_241_618 | 125 |
| 797 | 3300049527 | Ga0501311_037809 | Ga0501311_037809_161_541 | 125 |
| 798 | 3300049528 | Ga0501312_000008 | Ga0501312_000008_3016_3396 | 125 |
| 799 | 3300049528 | Ga0501312_000783 | Ga0501312_000783_2041_2421 | 125 |
| 800 | 3300049528 | Ga0501312_002894 | Ga0501312_002894_1040_1417 | 125 |
| 801 | 3300049528 | Ga0501312_032285 | Ga0501312_032285_149_529 | 125 |
| 802 | 3300049528 | Ga0501312_036971 | Ga0501312_036971_303_683 | 125 |
| 803 | 3300049528 | Ga0501312_039745 | Ga0501312_039745_84_464 | 125 |
| 804 | 3300049528 | Ga0501312_044814 | Ga0501312_044814_167_544 | 125 |
| 805 | 3300049528 | Ga0501312_073382 | Ga0501312_073382_189_569 | 125 |
| 806 | 3300049528 | Ga0501312_077700 | Ga0501312_077700_169_549 | 125 |
| 807 | 3300049528 | Ga0501312_097565 | Ga0501312_097565_43_423 | 125 |
| 808 | 3300049528 | Ga0501312_103276 | Ga0501312_103276_106_486 | 125 |
| 809 | 3300049528 | Ga0501312_116958 | Ga0501312_116958_32_412 | 125 |
| 810 | 3300049529 | Ga0501313_000046 | Ga0501313_000046_3519_3899 | 125 |
| 811 | 3300049529 | Ga0501313_001256 | Ga0501313_001256_189_569 | 125 |
| 812 | 3300049529 | Ga0501313_007305 | Ga0501313_007305_672_1049 | 125 |
| 813 | 3300049529 | Ga0501313_017356 | Ga0501313_017356_384_764 | 125 |
| 814 | 3300049529 | Ga0501313_025790 | Ga0501313_025790_168_548 | 125 |
| 815 | 3300049529 | Ga0501313_028145 | Ga0501313_028145_195_575 | 125 |
| 816 | 3300049530 | Ga0501314_000536 | Ga0501314_000536_1414_1794 | 125 |
| 817 | 3300049530 | Ga0501314_005375 | Ga0501314_005375_87_464 | 125 |
| 818 | 3300049530 | Ga0501314_008115 | Ga0501314_008115_167_544 | 125 |
| 819 | 3300049530 | Ga0501314_021975 | Ga0501314_021975_267_647 | 125 |
| 820 | 3300049531 | Ga0501315_000039 | Ga0501315_000039_1199_1579 | 125 |
| 821 | 3300049531 | Ga0501315_000148 | Ga0501315_000148_1434_1814 | 125 |
| 822 | 3300049531 | Ga0501315_004361 | Ga0501315_004361_467_844 | 125 |
| 823 | 3300049531 | Ga0501315_004396 | Ga0501315_004396_499_879 | 125 |
| 824 | 3300049531 | Ga0501315_005480 | Ga0501315_005480_167_544 | 125 |
| 825 | 3300049531 | Ga0501315_022209 | Ga0501315_022209_141_518 | 125 |
| 826 | 3300049531 | Ga0501315_035949 | Ga0501315_035949_168_548 | 125 |
| 827 | 3300049531 | Ga0501315_038649 | Ga0501315_038649_83_463 | 125 |
| 828 | 3300049531 | Ga0501315_061908 | Ga0501315_061908_165_545 | 125 |
| 829 | 3300049531 | Ga0501315_067059 | Ga0501315_067059_196_576 | 125 |
| 830 | 3300049531 | Ga0501315_077734 | Ga0501315_077734_70_450 | 125 |
| 831 | 3300049531 | Ga0501315_091022 | Ga0501315_091022_138_515 | 125 |
| 832 | 3300049532 | Ga0501316_001307 | Ga0501316_001307_743_1123 | 125 |
| 833 | 3300049532 | Ga0501316_003657 | Ga0501316_003657_81_461 | 125 |
| 834 | 3300049532 | Ga0501316_005326 | Ga0501316_005326_236_616 | 125 |
| 835 | 3300049532 | Ga0501316_008595 | Ga0501316_008595_690_1067 | 125 |
| 836 | 3300049532 | Ga0501316_016604 | Ga0501316_016604_333_713 | 125 |
| 837 | 3300049532 | Ga0501316_047169 | Ga0501316_047169_174_554 | 125 |
| 838 | 3300049532 | Ga0501316_049777 | Ga0501316_049777_190_570 | 125 |
| 839 | 3300049533 | Ga0501317_001819 | Ga0501317_001819_1175_1555 | 125 |
| 840 | 3300049533 | Ga0501317_004254 | Ga0501317_004254_760_1137 | 125 |
| 841 | 3300049533 | Ga0501317_006292 | Ga0501317_006292_894_1274 | 125 |
| 842 | 3300049533 | Ga0501317_045213 | Ga0501317_045213_133_510 | 125 |
| 843 | 3300049533 | Ga0501317_049914 | Ga0501317_049914_167_544 | 125 |
| 844 | 3300049534 | Ga0501318_059368 | Ga0501318_059368_167_544 | 125 |
| 845 | 3300049535 | Ga0501319_011072 | Ga0501319_011072_185_562 | 125 |
| 846 | 3300049536 | Ga0501320_000271 | Ga0501320_000271_1626_2006 | 125 |
| 847 | 3300049536 | Ga0501320_001656 | Ga0501320_001656_492_869 | 125 |
| 848 | 3300049536 | Ga0501320_007328 | Ga0501320_007328_582_959 | 125 |
| 849 | 3300049536 | Ga0501320_012555 | Ga0501320_012555_390_770 | 125 |
| 850 | 3300049536 | Ga0501320_023233 | Ga0501320_023233_13_390 | 125 |
| 851 | 3300049536 | Ga0501320_025490 | Ga0501320_025490_148_528 | 125 |
| 852 | 3300049536 | Ga0501320_027114 | Ga0501320_027114_170_547 | 125 |
| 853 | 3300049536 | Ga0501320_060048 | Ga0501320_060048_64_441 | 125 |
| 854 | 3300049537 | Ga0501321_001022 | Ga0501321_001022_453_833 | 125 |
| 855 | 3300049537 | Ga0501321_012051 | Ga0501321_012051_80_457 | 125 |
| 856 | 3300049537 | Ga0501321_051689 | Ga0501321_051689_51_431 | 125 |
| 857 | 3300049538 | Ga0501322_022094 | Ga0501322_022094_135_515 | 125 |
| 858 | 3300049539 | Ga0501323_000022 | Ga0501323_000022_1845_2225 | 125 |
| 859 | 3300049539 | Ga0501323_000041 | Ga0501323_000041_3030_3410 | 125 |
| 860 | 3300049539 | Ga0501323_002898 | Ga0501323_002898_170_547 | 125 |
| 861 | 3300049539 | Ga0501323_034152 | Ga0501323_034152_159_536 | 125 |
| 862 | 3300049539 | Ga0501323_037123 | Ga0501323_037123_135_515 | 125 |
| 863 | 3300049540 | Ga0501324_001820 | Ga0501324_001820_451_828 | 125 |
| 864 | 3300049540 | Ga0501324_007058 | Ga0501324_007058_301_678 | 125 |
| 865 | 3300049540 | Ga0501324_033942 | Ga0501324_033942_29_409 | 125 |
| 866 | 3300049541 | Ga0501325_000253 | Ga0501325_000253_1806_2183 | 125 |
| 867 | 3300049541 | Ga0501325_001123 | Ga0501325_001123_158_538 | 125 |
| 868 | 3300049541 | Ga0501325_019707 | Ga0501325_019707_14_394 | 125 |
| 869 | 3300049541 | Ga0501325_035921 | Ga0501325_035921_83_463 | 125 |
| 870 | 3300049542 | Ga0501326_00213 | Ga0501326_00213_188_565 | 125 |
| 871 | 3300049542 | Ga0501326_08315 | Ga0501326_08315_186_563 | 125 |
| 872 | 3300049543 | Ga0501327_02818 | Ga0501327_02818_82_459 | 125 |
| 873 | 3300049544 | Ga0501328_00317 | Ga0501328_00317_851_1231 | 125 |
| 874 | 3300049545 | Ga0501329_00473 | Ga0501329_00473_851_1231 | 125 |
| 875 | 3300049547 | Ga0501331_01387 | Ga0501331_01387_529_906 | 125 |
| 876 | 3300049550 | Ga0501334_14375 | Ga0501334_14375_101_481 | 125 |
| 877 | 3300049551 | Ga0501335_003359 | Ga0501335_003359_908_1285 | 125 |
| 878 | 3300049551 | Ga0501335_017583 | Ga0501335_017583_265_645 | 125 |
| 879 | 3300049551 | Ga0501335_023649 | Ga0501335_023649_27_404 | 125 |
| 880 | 3300049552 | Ga0501336_000198 | Ga0501336_000198_97_474 | 125 |
| 881 | 3300049552 | Ga0501336_002156 | Ga0501336_002156_341_718 | 125 |
| 882 | 3300049552 | Ga0501336_009102 | Ga0501336_009102_261_638 | 125 |
| 883 | 3300049553 | Ga0501337_015435 | Ga0501337_015435_167_544 | 125 |
| 884 | 3300049554 | Ga0501338_04356 | Ga0501338_04356_321_701 | 125 |
| 885 | 3300049556 | Ga0501340_002246 | Ga0501340_002246_610_987 | 125 |
| 886 | 3300049568 | Ga0501031_0026756 | Ga0501031_0026756_2164_2541 | 125 |
| 887 | 3300049569 | Ga0501032_0007271 | Ga0501032_0007271_3859_4236 | 125 |
| 888 | 3300049569 | Ga0501032_0030328 | Ga0501032_0030328_1545_1925 | 125 |
| 889 | 3300049569 | Ga0501032_0048968 | Ga0501032_0048968_1277_1654 | 125 |
| 890 | 3300049570 | Ga0501033_0000011 | Ga0501033_0000011_49145_49522 | 125 |
| 891 | 3300049571 | Ga0501034_0001265 | Ga0501034_0001265_5247_5624 | 125 |
| 892 | 3300049571 | Ga0501034_0019142 | Ga0501034_0019142_1814_2194 | 125 |
| 893 | 3300049571 | Ga0501034_0036199 | Ga0501034_0036199_3422_3802 | 125 |
| 894 | 3300049571 | Ga0501034_0178660 | Ga0501034_0178660_1301_1678 | 125 |
| 895 | 3300049572 | Ga0501036_0014424 | Ga0501036_0014424_4715_5095 | 125 |
| 896 | 3300049572 | Ga0501036_0019659 | Ga0501036_0019659_3791_4168 | 125 |
| 897 | 3300049573 | Ga0501037_0013217 | Ga0501037_0013217_1271_1648 | 125 |
| 898 | 3300049573 | Ga0501037_0249427 | Ga0501037_0249427_222_602 | 125 |
| 899 | 3300049574 | Ga0501038_0002395 | Ga0501038_0002395_4642_5019 | 125 |
| 900 | 3300049574 | Ga0501038_0028118 | Ga0501038_0028118_2241_2621 | 125 |
| 901 | 3300049574 | Ga0501038_0075723 | Ga0501038_0075723_1178_1555 | 125 |
| 902 | 3300049575 | Ga0501039_0012686 | Ga0501039_0012686_2774_3154 | 125 |
| 903 | 3300049575 | Ga0501039_0023075 | Ga0501039_0023075_1312_1689 | 125 |
| 904 | 3300049575 | Ga0501039_0263075 | Ga0501039_0263075_859_1239 | 125 |
| 905 | 3300049578 | Ga0501042_0210143 | Ga0501042_0210143_333_713 | 125 |
| 906 | 3300049578 | Ga0501042_0503317 | Ga0501042_0503317_403_783 | 125 |
| 907 | 3300049579 | Ga0501043_0021084 | Ga0501043_0021084_3506_3886 | 125 |
| 908 | 3300049579 | Ga0501043_0024223 | Ga0501043_0024223_656_1033 | 125 |
| 909 | 3300049579 | Ga0501043_0040531 | Ga0501043_0040531_2738_3118 | 125 |
| 910 | 3300049579 | Ga0501043_0183873 | Ga0501043_0183873_533_913 | 125 |
| 911 | 3300049580 | Ga0501046_0099565 | Ga0501046_0099565_527_907 | 125 |
| 912 | 3300049580 | Ga0501046_0150637 | Ga0501046_0150637_899_1279 | 125 |
| 913 | 3300049581 | Ga0501047_0036558 | Ga0501047_0036558_2607_2987 | 125 |
| 914 | 3300049581 | Ga0501047_0288271 | Ga0501047_0288271_28_408 | 125 |
| 915 | 3300049582 | Ga0501048_0015730 | Ga0501048_0015730_2315_2695 | 125 |
| 916 | 3300049583 | Ga0501067_0006402 | Ga0501067_0006402_3745_4125 | 125 |
| 917 | 3300049583 | Ga0501067_0009218 | Ga0501067_0009218_1588_1968 | 125 |
| 918 | 3300049584 | Ga0501068_0014823 | Ga0501068_0014823_1448_1828 | 125 |
| 919 | 3300049584 | Ga0501068_0052122 | Ga0501068_0052122_61_441 | 125 |
| 920 | 3300049585 | Ga0501069_0015284 | Ga0501069_0015284_386_766 | 125 |
| 921 | 3300049586 | Ga0501070_0036727 | Ga0501070_0036727_336_716 | 125 |
| 922 | 3300049586 | Ga0501070_0078325 | Ga0501070_0078325_537_917 | 125 |
| 923 | 3300049586 | Ga0501070_0092295 | Ga0501070_0092295_126_503 | 125 |
| 924 | 3300049587 | Ga0501071_0060047 | Ga0501071_0060047_1982_2362 | 125 |
| 925 | 3300049588 | Ga0501072_0260586 | Ga0501072_0260586_519_899 | 125 |
| 926 | 3300049589 | Ga0501073_0008802 | Ga0501073_0008802_2166_2546 | 125 |
| 927 | 3300049589 | Ga0501073_0011829 | Ga0501073_0011829_3587_3967 | 125 |
| 928 | 3300049589 | Ga0501073_0322131 | Ga0501073_0322131_531_911 | 125 |
| 929 | 3300049590 | Ga0501074_0019774 | Ga0501074_0019774_1025_1405 | 125 |
| 930 | 3300049650 | Ga0501199_036884 | Ga0501199_036884_225_605 | 125 |
| 931 | 3300049652 | Ga0501202_044391 | Ga0501202_044391_423_803 | 125 |
| 932 | 3300049657 | Ga0501210_015241 | Ga0501210_015241_57_437 | 125 |
| 933 | 3300049662 | Ga0501222_037300 | Ga0501222_037300_133_513 | 125 |
| 934 | 3300049669 | Ga0501235_015899 | Ga0501235_015899_173_553 | 125 |
| 935 | 3300049669 | Ga0501235_110303 | Ga0501235_110303_204_581 | 125 |
| 936 | 3300049670 | Ga0501236_000641 | Ga0501236_000641_341_721 | 125 |
| 937 | 3300049671 | Ga0501238_004543 | Ga0501238_004543_1068_1445 | 125 |
| 938 | 3300049671 | Ga0501238_022494 | Ga0501238_022494_496_876 | 125 |
| 939 | 3300049674 | Ga0501242_003494 | Ga0501242_003494_605_985 | 125 |
| 940 | 3300049674 | Ga0501242_073008 | Ga0501242_073008_120_500 | 125 |
| 941 | 3300049677 | Ga0501247_000354 | Ga0501247_000354_2612_2992 | 125 |
| 942 | 3300049679 | Ga0501249_005609 | Ga0501249_005609_1294_1671 | 125 |
| 943 | 3300049683 | Ga0501253_082739 | Ga0501253_082739_247_627 | 125 |
| 944 | 3300049686 | Ga0501257_000897 | Ga0501257_000897_2785_3165 | 125 |
| 945 | 3300049686 | Ga0501257_020542 | Ga0501257_020542_273_653 | 125 |
| 946 | 3300049686 | Ga0501257_145355 | Ga0501257_145355_85_465 | 125 |
| 947 | 3300049686 | Ga0501257_272815 | Ga0501257_272815_37_417 | 125 |
| 948 | 3300049688 | Ga0501259_033220 | Ga0501259_033220_316_693 | 125 |
| 949 | 3300049690 | Ga0501261_033831 | Ga0501261_033831_351_728 | 125 |
| 950 | 3300049705 | Ga0501225_0012695 | Ga0501225_0012695_1692_2069 | 125 |
| 951 | 3300049705 | Ga0501225_0047951 | Ga0501225_0047951_569_949 | 125 |
| 952 | 3300049705 | Ga0501225_0082868 | Ga0501225_0082868_102_479 | 125 |
| 953 | 3300049705 | Ga0501225_0227145 | Ga0501225_0227145_122_499 | 125 |
| 954 | 3300049705 | Ga0501225_0261741 | Ga0501225_0261741_75_452 | 125 |
| 955 | 3300049741 | Ga0501079_0053196 | Ga0501079_0053196_865_1245 | 125 |
| 956 | 3300049741 | Ga0501079_0097817 | Ga0501079_0097817_1606_1986 | 125 |
| 957 | 3300049742 | Ga0501080_0074958 | Ga0501080_0074958_396_776 | 125 |
| 958 | 3300049742 | Ga0501080_0286986 | Ga0501080_0286986_896_1276 | 125 |
| 959 | 3300049742 | Ga0501080_0440282 | Ga0501080_0440282_531_911 | 125 |
| 960 | 3300049742 | Ga0501080_0492962 | Ga0501080_0492962_274_654 | 125 |
| 961 | 3300049744 | Ga0501083_0014034 | Ga0501083_0014034_3514_3894 | 125 |
| 962 | 3300049744 | Ga0501083_0062854 | Ga0501083_0062854_518_898 | 125 |
| 963 | 3300049761 | Ga0501264_003325 | Ga0501264_003325_29_409 | 125 |
| 964 | 3300049761 | Ga0501264_014282 | Ga0501264_014282_228_608 | 125 |
| 965 | 3300049767 | Ga0501270_028395 | Ga0501270_028395_199_576 | 125 |
| 966 | 3300049822 | Ga0501035_0004622 | Ga0501035_0004622_6745_7122 | 125 |
| 967 | 3300049822 | Ga0501035_0019838 | Ga0501035_0019838_3367_3747 | 125 |
| 968 | 3300049822 | Ga0501035_0776913 | Ga0501035_0776913_322_702 | 125 |
| 969 | 3300049823 | Ga0501044_0003551 | Ga0501044_0003551_13975_14355 | 125 |
| 970 | 3300049823 | Ga0501044_0023913 | Ga0501044_0023913_5241_5618 | 125 |
| 971 | 3300049823 | Ga0501044_0097266 | Ga0501044_0097266_884_1264 | 125 |
| 972 | 3300049823 | Ga0501044_0514802 | Ga0501044_0514802_443_823 | 125 |
| 973 | 3300049824 | Ga0501045_0000053 | Ga0501045_0000053_5379_5756 | 125 |
| 974 | 3300049824 | Ga0501045_1051520 | Ga0501045_1051520_115_495 | 125 |
| 975 | 3300049850 | Ga0501204_016306 | Ga0501204_016306_260_640 | 125 |
| 976 | 3300049853 | Ga0501226_015397 | Ga0501226_015397_259_639 | 125 |
| 977 | 3300050493 | nmdc:mga0k408_198900_c1 | nmdc:mga0k408_198900_c1_403_783 | 125 |
| 978 | 3300050493 | nmdc:mga0k408_57809_c2 | nmdc:mga0k408_57809_c2_880_1260 | 125 |
| 979 | 3300050493 | nmdc:mga0k408_693703_c1 | nmdc:mga0k408_693703_c1_162_542 | 125 |
| 980 | 3300050496 | nmdc:mga07m45_126657_c1 | nmdc:mga07m45_126657_c1_544_921 | 125 |
| 981 | 3300050496 | nmdc:mga07m45_89113_c1 | nmdc:mga07m45_89113_c1_1096_1476 | 125 |
| 982 | 3300050507 | nmdc:mga05p37_1510320_c1 | nmdc:mga05p37_1510320_c1_49_429 | 125 |
| 983 | 3300050509 | nmdc:mga0qj67_114691_c1 | nmdc:mga0qj67_114691_c1_1320_1700 | 125 |
| 984 | 3300050509 | nmdc:mga0qj67_1383749_c1 | nmdc:mga0qj67_1383749_c1_38_418 | 125 |
| 985 | 3300050511 | nmdc:mga08y16_19020_c1 | nmdc:mga08y16_19020_c1_4525_4905 | 125 |
| 986 | 3300050511 | nmdc:mga08y16_21751_c1 | nmdc:mga08y16_21751_c1_2492_2872 | 125 |
| 987 | 3300050511 | nmdc:mga08y16_267433_c1 | nmdc:mga08y16_267433_c1_796_1176 | 125 |
| 988 | 3300050511 | nmdc:mga08y16_283195_c1 | nmdc:mga08y16_283195_c1_1235_1615 | 125 |
| 989 | 3300050511 | nmdc:mga08y16_836450_c1 | nmdc:mga08y16_836450_c1_115_495 | 125 |
| 990 | 3300050515 | nmdc:mga0a205_923548_c1 | nmdc:mga0a205_923548_c1_122_502 | 125 |
| 991 | 3300053086 | Ga0500578_0086448 | Ga0500578_0086448_610_987 | 125 |
| 992 | 3300053088 | Ga0500644_0304785 | Ga0500644_0304785_275_655 | 125 |
| 993 | 3300053090 | Ga0500646_0190358 | Ga0500646_0190358_278_658 | 125 |
| 994 | 3300053104 | Ga0500556_0058888 | Ga0500556_0058888_60_440 | 125 |
| 995 | 3300053133 | Ga0500655_007182 | Ga0500655_007182_1304_1684 | 125 |
| 996 | 3300053134 | Ga0500658_0385412 | Ga0500658_0385412_24_401 | 125 |
| 997 | 3300053140 | Ga0500573_0037721 | Ga0500573_0037721_557_934 | 125 |
| 998 | 3300053142 | Ga0500577_0247767 | Ga0500577_0247767_375_755 | 125 |
| 999 | 3300053151 | Ga0500604_0010471 | Ga0500604_0010471_1304_1684 | 125 |
| 1000 | 3300053151 | Ga0500604_0245055 | Ga0500604_0245055_85_465 | 125 |
| 1001 | 3300053153 | Ga0500616_0000013 | Ga0500616_0000013_184869_185249 | 125 |
| 1002 | 3300053153 | Ga0500616_0032309 | Ga0500616_0032309_1335_1715 | 125 |
| 1003 | 3300053153 | Ga0500616_0036710 | Ga0500616_0036710_821_1201 | 125 |
| 1004 | 3300053156 | Ga0500622_0000416 | Ga0500622_0000416_37020_37400 | 125 |
| 1005 | 3300053156 | Ga0500622_0000433 | Ga0500622_0000433_3204_3584 | 125 |
| 1006 | 3300053156 | Ga0500622_0017657 | Ga0500622_0017657_2261_2641 | 125 |
| 1007 | 3300053156 | Ga0500622_0027590 | Ga0500622_0027590_572_952 | 125 |
| 1008 | 3300053730 | Ga0500645_134453 | Ga0500645_134453_77_457 | 125 |
| 1009 | 3300054114 | Ga0501084_0024661 | Ga0501084_0024661_3030_3410 | 125 |
| 1010 | 3300054114 | Ga0501084_0071249 | Ga0501084_0071249_296_676 | 125 |
| 1011 | 3300055283 | Ga0500661_007999 | Ga0500661_007999_833_1213 | 125 |
| 1012 | 3300059491 | Ga0587070_000157 | Ga0587070_000157_1850_2227 | 125 |
| 1013 | 3300059491 | Ga0587070_085573 | Ga0587070_085573_257_637 | 125 |
| 1014 | 3300059493 | Ga0587077_000755 | Ga0587077_000755_86_463 | 125 |
| 1015 | 3300059493 | Ga0587077_147639 | Ga0587077_147639_44_421 | 125 |
| 1016 | 3300059493 | Ga0587077_166700 | Ga0587077_166700_167_544 | 125 |
| 1017 | 3300059505 | Ga0587083_0013391 | Ga0587083_0013391_60_440 | 125 |
| 1018 | 3300059505 | Ga0587083_0127591 | Ga0587083_0127591_212_592 | 125 |
| 1019 | 3300059506 | Ga0587085_013261 | Ga0587085_013261_628_1005 | 125 |
| 1020 | 3300059508 | Ga0587088_011252 | Ga0587088_011252_156_536 | 125 |
| 1021 | 3300059510 | Ga0587090_014198 | Ga0587090_014198_167_544 | 125 |
| 1022 | 3300059510 | Ga0587090_144679 | Ga0587090_144679_81_461 | 125 |
| 1023 | 3300059512 | Ga0587092_008459 | Ga0587092_008459_340_720 | 125 |
| 1024 | 3300059512 | Ga0587092_142144 | Ga0587092_142144_136_516 | 125 |
| 1025 | 3300059513 | Ga0587094_097366 | Ga0587094_097366_110_490 | 125 |
| 1026 | 3300059513 | Ga0587094_117389 | Ga0587094_117389_87_467 | 125 |
| 1027 | 3300059624 | Ga0587109_014349 | Ga0587109_014349_53_433 | 125 |
| 1028 | 3300059624 | Ga0587109_180781 | Ga0587109_180781_93_473 | 125 |
| 1029 | 3300059626 | Ga0587115_106058 | Ga0587115_106058_28_405 | 125 |
| 1030 | 3300059627 | Ga0587117_003203 | Ga0587117_003203_978_1355 | 125 |
| 1031 | 3300059627 | Ga0587117_051852 | Ga0587117_051852_78_455 | 125 |
| 1032 | 3300059630 | Ga0587128_076086 | Ga0587128_076086_122_499 | 125 |
| 1033 | 3300059639 | Ga0587062_000132 | Ga0587062_000132_2271_2648 | 125 |
| 1034 | 3300059639 | Ga0587062_007071 | Ga0587062_007071_167_544 | 125 |
| 1035 | 3300059640 | Ga0587067_067187 | Ga0587067_067187_291_671 | 125 |
| 1036 | 3300059641 | Ga0587068_000547 | Ga0587068_000547_1384_1761 | 125 |
| 1037 | 3300059641 | Ga0587068_042947 | Ga0587068_042947_110_490 | 125 |
| 1038 | 3300059641 | Ga0587068_060734 | Ga0587068_060734_140_520 | 125 |
| 1039 | 3300059641 | Ga0587068_173251 | Ga0587068_173251_42_422 | 125 |
| 1040 | 3300059642 | Ga0587069_002452 | Ga0587069_002452_437_817 | 125 |
| 1041 | 3300059643 | Ga0587072_014962 | Ga0587072_014962_177_554 | 125 |
| 1042 | 3300059644 | Ga0587075_109458 | Ga0587075_109458_98_478 | 125 |
| 1043 | 3300059645 | Ga0587076_003883 | Ga0587076_003883_1056_1436 | 125 |
| 1044 | 3300059645 | Ga0587076_016950 | Ga0587076_016950_167_544 | 125 |
| 1045 | 3300059645 | Ga0587076_063331 | Ga0587076_063331_64_444 | 125 |
| 1046 | 3300059647 | Ga0587079_243368 | Ga0587079_243368_50_430 | 125 |
| 1047 | 3300059653 | Ga0587108_016180 | Ga0587108_016180_167_544 | 125 |
| 1048 | 3300059660 | Ga0587124_018699 | Ga0587124_018699_167_544 | 125 |
| 1049 | 3300060244 | Ga0587061_00333 | Ga0587061_00333_62_439 | 125 |
| 1050 | 3300060246 | Ga0587081_05693 | Ga0587081_05693_167_544 | 125 |
| 1051 | 3300060346 | Ga0587111_0000249 | Ga0587111_0000249_2217_2594 | 125 |
| 1052 | 3300060346 | Ga0587111_0061165 | Ga0587111_0061165_418_798 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rbd-assembly1.cif.gz_S | state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles | 0.9451 | 2 | 62 |
| 4gc5-assembly1.cif.gz_A | crystal structure of murine tfb1m | 0.9339 | 28 | 61 |
| 6zqf-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) | 0.9311 | 1 | 65 |
| 3twk-assembly3.cif.gz_B | crystal structure of arabidopsis thaliana fpg | 0.9267 | 11 | 60 |
| 6zqg-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-c | 0.9208 | 1 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FW30_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9943 | 1 | 70 | 1.10.8.50 |
| af_P9WH61_1_72_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9906 | 1 | 71 | 1.10.8.50 |
| af_A0A1D8PQQ5_1_82_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9842 | 2 | 61 | 1.10.8.50 |
| af_P54019_1_77_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9793 | 2 | 61 | 1.10.8.50 |
| af_Q8HCP0_1_71_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9781 | 1 | 70 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5QEL1-F1-model_v4 | 30S ribosomal protein S13 | 1 | 1 | 76 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A357ZFG2-F1-model_v4 | 30S ribosomal protein S13 | 0.9965 | 1 | 77 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A833G026-F1-model_v4 | 30S ribosomal protein S13 | 0.9964 | 1 | 75 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A1Q6SSA2-F1-model_v4 | 30S ribosomal protein S13 | 0.9947 | 1 | 77 |
GO:0000049
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A4Q3GYA9-F1-model_v4 | deleted | 0.9941 | 1 | 75 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar