F489091

General Info

Members Datasets Scaffolds Average Seq Length
1052 427 1044 126

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100747762|Ga0070694_1007477621
Length 142
Sequence MLTKRIQGLNKDKDNIMARIQGVDIPDNKRGEISLTYIYGIGRRRAQQILTKAGVNWDKKAKDWNDEESNAIRSIISESFKVEGTLRSEVQLSIKRLMDIGSYRGLRHRKGLPVRGQTTKNNARTRKGKRKTVANKKKVTKG

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
5 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
6 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
7 2914759650 Rhizosphaericola mali Isolate Rhizosphere
8 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
89 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
198 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
199 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
220 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
225 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
226 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
227 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
228 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
232 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
233 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
234 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
235 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
236 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
239 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
240 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
241 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
242 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
243 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
244 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
245 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
246 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
249 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
250 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
251 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
254 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
255 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
256 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
257 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
258 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
291 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
306 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
307 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
308 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
356 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
357 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
358 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
359 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
360 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
361 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
362 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
363 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
364 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
365 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
366 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
367 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
368 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
369 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
370 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
375 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
380 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
390 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
391 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
392 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
393 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
394 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
395 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
396 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
402 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.1
Metatranscriptomes 24.14
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 2.95
Rhizosphere 87.74
Stem 0
Stem Tuber 0
Unclassified 5.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10080733 3300003316 Bacteria 3504
2 rootH1_10114576 3300003316 Bacteria 1636
3 rootL2_10010167 3300003322 Bacteria 22542
4 rootL2_10023239 3300003322 Bacteria 4007
5 rootL2_10094850 3300003322 Bacteria 2750
6 rootL2_10101710 3300003322 Bacteria 4114
7 rootH1_10006036 3300003323 Bacteria 32132
8 rootH1_10006987 3300003323 Bacteria 3526
9 rootH1_10006988 3300003323 Bacteria 47616
10 rootH1_10012787 3300003323 Bacteria 4305
11 Ga0007417J51691_1057812 3300003544 Bacteria 1952
12 Ga0055536_1001261 3300003781 Bacteria 15585
13 Ga0055531_10000409 3300003794 Bacteria 41322
14 Ga0055543_1051443 3300004625 Bacteria 674
15 Ga0058859_10072763 3300004798 Bacteria 813
16 Ga0058859_11480586 3300004798 Bacteria 2098
17 Ga0058860_10016344 3300004801 Bacteria 1770
18 Ga0058860_11946433 3300004801 Bacteria 984
19 Ga0065165_1000131 3300005262 Bacteria 128880
20 Ga0065165_1000831 3300005262 Bacteria 40595
21 Ga0065714_10024660 3300005288 Bacteria 1118
22 Ga0065704_10124782 3300005289 Bacteria 1712
23 Ga0065712_10322046 3300005290 Bacteria 814
24 Ga0065712_10399976 3300005290 Bacteria 732
25 Ga0065715_10088958 3300005293 Bacteria 20336
26 Ga0065707_10148021 3300005295 Bacteria 1690
27 Ga0070658_10099188 3300005327 Bacteria 2407
28 Ga0070658_10141402 3300005327 Bacteria 2011
29 Ga0070683_100094294 3300005329 Bacteria 2813
30 Ga0070683_101602232 3300005329 Bacteria 626
31 Ga0070670_100203096 3300005331 Bacteria 1722
32 Ga0070670_101702085 3300005331 Bacteria 580
33 Ga0070677_10102463 3300005333 Bacteria 1264
34 Ga0070677_10938540 3300005333 Bacteria 502
35 Ga0068869_100672086 3300005334 Bacteria 881
36 Ga0068869_100682944 3300005334 Bacteria 874
37 Ga0068869_101312662 3300005334 Bacteria 638
38 Ga0070682_100181774 3300005337 Bacteria 1470
39 Ga0070682_101095219 3300005337 Bacteria 667
40 Ga0070682_101996772 3300005337 Bacteria 510
41 Ga0070682_102062090 3300005337 Bacteria 503
42 Ga0068868_100118877 3300005338 Bacteria 2154
43 Ga0068868_101200705 3300005338 Bacteria 701
44 Ga0068868_101554126 3300005338 Bacteria 621
45 Ga0070660_100106781 3300005339 Bacteria 2224
46 Ga0070689_100197354 3300005340 Bacteria 1641
47 Ga0070689_100456971 3300005340 Bacteria 1087
48 Ga0070689_100805392 3300005340 Bacteria 826
49 Ga0070689_101892379 3300005340 Bacteria 545
50 Ga0070687_100503723 3300005343 Bacteria 815
51 Ga0070661_101086899 3300005344 Bacteria 666
52 Ga0070661_101753018 3300005344 Bacteria 527
53 Ga0070692_10481297 3300005345 Bacteria 800
54 Ga0070692_10517558 3300005345 Bacteria 776
55 Ga0070692_11402868 3300005345 Bacteria 504
56 Ga0070669_100236924 3300005353 Bacteria 1448
57 Ga0070669_100399931 3300005353 Bacteria 1123
58 Ga0070669_100691635 3300005353 Bacteria 860
59 Ga0070669_100852054 3300005353 Bacteria 777
60 Ga0070675_100098425 3300005354 Bacteria 2460
61 Ga0070675_100589660 3300005354 Bacteria 1007
62 Ga0070675_100849389 3300005354 Bacteria 835
63 Ga0070674_100584487 3300005356 Bacteria 941
64 Ga0070673_100139381 3300005364 Bacteria 2044
65 Ga0070688_100455218 3300005365 Bacteria 957
66 Ga0070659_100004313 3300005366 Bacteria 10156
67 Ga0070667_101250206 3300005367 Bacteria 695
68 Ga0070700_100869580 3300005441 Bacteria 731
69 Ga0070694_100747762 3300005444 Bacteria 798
70 Ga0070678_100169113 3300005456 Bacteria 1778
71 Ga0070662_100723238 3300005457 Bacteria 843
72 Ga0068867_100422091 3300005459 Bacteria 1130
73 Ga0068867_100751649 3300005459 Bacteria 865
74 Ga0068867_101203509 3300005459 Bacteria 696
75 Ga0070685_10190454 3300005466 Bacteria 1326
76 Ga0070685_10535775 3300005466 Bacteria 834
77 Ga0070698_100226337 3300005471 Bacteria 1803
78 Ga0070679_100029815 3300005530 Bacteria 5383
79 Ga0070684_100251908 3300005535 Bacteria 1614
80 Ga0068853_100205382 3300005539 Bacteria 1794
81 Ga0068853_100771141 3300005539 Bacteria 920
82 Ga0070672_100147361 3300005543 Bacteria 1945
83 Ga0070686_100028804 3300005544 Bacteria 3371
84 Ga0070665_100000442 3300005548 Bacteria 60619
85 Ga0070665_100215306 3300005548 Bacteria 1922
86 Ga0068855_100071240 3300005563 Bacteria 4043
87 Ga0068855_100279474 3300005563 Bacteria 1854
88 Ga0068855_100690901 3300005563 Bacteria 1093
89 Ga0068855_100922798 3300005563 Bacteria 921
90 Ga0068855_101481603 3300005563 Bacteria 697
91 Ga0068855_101984854 3300005563 Bacteria 588
92 Ga0070664_100586946 3300005564 Bacteria 1033
93 Ga0068857_100062430 3300005577 Bacteria 3312
94 Ga0068857_100809874 3300005577 Bacteria 895
95 Ga0068857_102140696 3300005577 Bacteria 549
96 Ga0068854_100877885 3300005578 Bacteria 787
97 Ga0068854_101620838 3300005578 Bacteria 590
98 Ga0068856_100147792 3300005614 Bacteria 2358
99 Ga0068856_100340133 3300005614 Bacteria 1519
100 Ga0068856_100414628 3300005614 Bacteria 1367
101 Ga0068856_101392516 3300005614 Bacteria 716
102 Ga0068852_100113127 3300005616 Bacteria 2471
103 Ga0068852_100372550 3300005616 Bacteria 1399
104 Ga0068852_100898449 3300005616 Bacteria 903
105 Ga0068852_101144888 3300005616 Bacteria 799
106 Ga0068852_101328805 3300005616 Bacteria 741
107 Ga0068859_100254340 3300005617 Bacteria 1847
108 Ga0068859_101280075 3300005617 Bacteria 808
109 Ga0068859_102629967 3300005617 Bacteria 553
110 Ga0068864_100016890 3300005618 Bacteria 6082
111 Ga0068864_100610733 3300005618 Bacteria 1059
112 Ga0068861_100005628 3300005719 Bacteria 8500
113 Ga0068861_100572872 3300005719 Bacteria 1032
114 Ga0068861_101591346 3300005719 Bacteria 643
115 Ga0068870_10241879 3300005840 Bacteria 1114
116 Ga0068863_100288457 3300005841 Bacteria 1591
117 Ga0068863_100949786 3300005841 Bacteria 861
118 Ga0068858_100805855 3300005842 Bacteria 916
119 Ga0068858_101795383 3300005842 Bacteria 606
120 Ga0068862_100264784 3300005844 Bacteria 1570
121 Ga0070715_10765109 3300006163 Bacteria 583
122 Ga0070715_10877222 3300006163 Bacteria 550
123 Ga0075366_10025131 3300006195 Bacteria 3477
124 Ga0075366_10160154 3300006195 Unclassified 1364
125 Ga0097621_100015405 3300006237 Bacteria 5751
126 Ga0097621_100250778 3300006237 Bacteria 1550
127 Ga0097621_101183439 3300006237 Bacteria 719
128 Ga0075370_10041721 3300006353 Bacteria 2591
129 Ga0068871_100000354 3300006358 Bacteria 31915
130 Ga0068871_101258025 3300006358 Bacteria 695
131 Ga0075428_100022554 3300006844 Bacteria 6969
132 Ga0075428_100327241 3300006844 Bacteria 1646
133 Ga0075430_100102450 3300006846 Bacteria 2390
134 Ga0075430_100867684 3300006846 Bacteria 744
135 Ga0075431_101009177 3300006847 Bacteria 799
136 Ga0068865_101004942 3300006881 Bacteria 730
137 Ga0097620_100254354 3300006931 Bacteria 1847
138 Ga0097620_101280234 3300006931 Bacteria 808
139 Ga0097620_102629975 3300006931 Bacteria 553
140 Ga0105240_10043033 3300009093 Bacteria 5750
141 Ga0111539_10001098 3300009094 Bacteria 35755
142 Ga0111539_10066150 3300009094 Bacteria 4269
143 Ga0111539_10184231 3300009094 Bacteria 2438
144 Ga0111539_10587329 3300009094 Bacteria 1297
145 Ga0111539_11801897 3300009094 Bacteria 710
146 Ga0111539_12006044 3300009094 Bacteria 671
147 Ga0114129_11333703 3300009147 Bacteria 888
148 Ga0105243_11926519 3300009148 Bacteria 624
149 Ga0105242_10196886 3300009176 Bacteria 1787
150 Ga0105242_10541980 3300009176 Bacteria 1114
151 Ga0105242_11752146 3300009176 Bacteria 658
152 Ga0105237_10078649 3300009545 Bacteria 3287
153 Ga0105237_10126608 3300009545 Bacteria 2549
154 Ga0105237_10417718 3300009545 Bacteria 1347
155 Ga0105238_10207266 3300009551 Bacteria 1936
156 Ga0105238_11801165 3300009551 Bacteria 644
157 Ga0105249_10005625 3300009553 Bacteria 10842
158 Ga0105249_11257557 3300009553 Bacteria 812
159 Ga0105249_11533657 3300009553 Bacteria 739
160 Ga0105239_10176868 3300010375 Bacteria 2387
161 Ga0105239_10722488 3300010375 Bacteria 1139
162 Ga0105239_12227894 3300010375 Bacteria 637
163 Ga0157337_1035664 3300012483 Bacteria 529
164 Ga0157315_1052551 3300012508 Bacteria 552
165 Ga0157373_10059430 3300013100 Bacteria 2709
166 Ga0157373_10065390 3300013100 Bacteria 2573
167 Ga0157373_10075797 3300013100 Bacteria 2373
168 Ga0157373_10161673 3300013100 Bacteria 1576
169 Ga0157371_10035324 3300013102 Bacteria 3582
170 Ga0157371_10407032 3300013102 Bacteria 996
171 Ga0157371_10491410 3300013102 Bacteria 906
172 Ga0157371_10586614 3300013102 Bacteria 828
173 Ga0157371_10610722 3300013102 Bacteria 812
174 Ga0157371_10766457 3300013102 Bacteria 725
175 Ga0157370_10054126 3300013104 Bacteria 3826
176 Ga0157370_10085830 3300013104 Bacteria 2957
177 Ga0157370_10209209 3300013104 Bacteria 1808
178 Ga0157370_10217664 3300013104 Bacteria 1769
179 Ga0157370_10476306 3300013104 Bacteria 1147
180 Ga0157370_10749305 3300013104 Bacteria 890
181 Ga0157370_11101024 3300013104 Bacteria 718
182 Ga0157370_11918181 3300013104 Bacteria 531
183 Ga0157369_10062018 3300013105 Bacteria 4030
184 Ga0157369_10235969 3300013105 Bacteria 1911
185 Ga0157369_10292053 3300013105 Bacteria 1697
186 Ga0157369_10340301 3300013105 Bacteria 1558
187 Ga0157369_10408180 3300013105 Bacteria 1409
188 Ga0157369_11515515 3300013105 Bacteria 682
189 Ga0157369_11822901 3300013105 Bacteria 618
190 Ga0157374_10103611 3300013296 Bacteria 2730
191 Ga0157374_10320265 3300013296 Bacteria 1536
192 Ga0157374_10395088 3300013296 Bacteria 1379
193 Ga0157374_11848062 3300013296 Bacteria 630
194 Ga0157378_10000333 3300013297 Bacteria 46410
195 Ga0157378_10515618 3300013297 Bacteria 1196
196 Ga0163162_10000525 3300013306 Bacteria 35526
197 Ga0163162_10004198 3300013306 Bacteria 13853
198 Ga0163162_10272120 3300013306 Bacteria 1826
199 Ga0163162_10752406 3300013306 Bacteria 1094
200 Ga0157372_10000332 3300013307 Bacteria 51907
201 Ga0157372_10033754 3300013307 Bacteria 5623
202 Ga0157372_10052106 3300013307 Bacteria 4556
203 Ga0157372_10124074 3300013307 Bacteria 2969
204 Ga0157372_10217417 3300013307 Bacteria 2215
205 Ga0157372_10417423 3300013307 Bacteria 1564
206 Ga0157372_11136247 3300013307 Bacteria 903
207 Ga0157372_11235425 3300013307 Bacteria 863
208 Ga0157375_10174959 3300013308 Bacteria 2296
209 Ga0157375_11000068 3300013308 Bacteria 976
210 Ga0163163_10812204 3300014325 Bacteria 999
211 Ga0163163_11617325 3300014325 Bacteria 709
212 Ga0163163_13033058 3300014325 Bacteria 524
213 Ga0157380_10231312 3300014326 Bacteria 1660
214 Ga0157380_10816156 3300014326 Bacteria 951
215 Ga0157377_10445935 3300014745 Bacteria 892
216 Ga0157377_11187804 3300014745 Bacteria 590
217 Ga0157377_11213655 3300014745 Bacteria 585
218 Ga0157379_10078252 3300014968 Bacteria 2961
219 Ga0157379_10604201 3300014968 Bacteria 1024
220 Ga0157379_10648015 3300014968 Bacteria 989
221 Ga0157379_11096619 3300014968 Bacteria 762
222 Ga0157376_10018195 3300014969 Bacteria 5379
223 Ga0157376_10076734 3300014969 Bacteria 2856
224 Ga0157376_10630720 3300014969 Bacteria 1070
225 Ga0157376_10669329 3300014969 Bacteria 1040
226 Ga0157376_11507598 3300014969 Bacteria 705
227 Ga0163161_10031164 3300017792 Bacteria 3798
228 Ga0163161_10997712 3300017792 Bacteria 715
229 Ga0163161_11060844 3300017792 Bacteria 695
230 Ga0206356_10977936 3300020070 Bacteria 874
231 Ga0206356_11894588 3300020070 Bacteria 1147
232 Ga0206355_1245730 3300020076 Bacteria 516
233 Ga0206351_10875467 3300020077 Bacteria 922
234 Ga0206352_10531954 3300020078 Unclassified 1143
235 Ga0206352_10833769 3300020078 Bacteria 946
236 Ga0206354_10045676 3300020081 Bacteria 965
237 Ga0206354_10659544 3300020081 Bacteria 896
238 Ga0206354_10881077 3300020081 Bacteria 1179
239 Ga0213876_10044608 3300021384 Bacteria 2343
240 Ga0224712_10000155 3300022467 Bacteria 11497
241 Ga0207666_1015241 3300025271 Bacteria 1092
242 Ga0209455_1001884 3300025272 Bacteria 8718
243 Ga0209676_1000332 3300025292 Bacteria 90798
244 Ga0209050_1002964 3300025298 Bacteria 13262
245 Ga0209050_1033615 3300025298 Bacteria 1551
246 Ga0209050_1046505 3300025298 Bacteria 1140
247 Ga0207426_1099924 3300025302 Bacteria 751
248 Ga0209257_1000007 3300025304 Bacteria 1564415
249 Ga0209257_1012184 3300025304 Bacteria 4017
250 Ga0207697_10026925 3300025315 Bacteria 2351
251 Ga0207682_10066073 3300025893 Bacteria 1524
252 Ga0207682_10075858 3300025893 Bacteria 1432
253 Ga0207688_10887863 3300025901 Bacteria 564
254 Ga0207647_10000054 3300025904 Bacteria 86704
255 Ga0207647_10019623 3300025904 Bacteria 4544
256 Ga0207645_10035476 3300025907 Bacteria 3202
257 Ga0207643_10005441 3300025908 Bacteria 6810
258 Ga0207684_11040652 3300025910 Bacteria 683
259 Ga0207695_10005702 3300025913 Bacteria 16420
260 Ga0207671_10000030 3300025914 Bacteria 248197
261 Ga0207671_10335610 3300025914 Bacteria 1197
262 Ga0207671_10437008 3300025914 Bacteria 1042
263 Ga0207660_10885820 3300025917 Bacteria 728
264 Ga0207662_10030041 3300025918 Bacteria 3152
265 Ga0207662_10917504 3300025918 Bacteria 620
266 Ga0207649_10906369 3300025920 Bacteria 691
267 Ga0207652_10059424 3300025921 Bacteria 3295
268 Ga0207652_11015828 3300025921 Bacteria 728
269 Ga0207646_10734576 3300025922 Bacteria 881
270 Ga0207681_10185717 3300025923 Bacteria 1587
271 Ga0207681_11017919 3300025923 Bacteria 695
272 Ga0207681_11187502 3300025923 Bacteria 641
273 Ga0207694_10175224 3300025924 Bacteria 1738
274 Ga0207650_10325652 3300025925 Bacteria 1259
275 Ga0207650_11114176 3300025925 Bacteria 672
276 Ga0207650_11790085 3300025925 Bacteria 520
277 Ga0207659_10242738 3300025926 Bacteria 1458
278 Ga0207644_10264422 3300025931 Bacteria 1377
279 Ga0207690_10003583 3300025932 Bacteria 9247
280 Ga0207686_10292818 3300025934 Bacteria 1206
281 Ga0207670_10032455 3300025936 Bacteria 3358
282 Ga0207670_10698976 3300025936 Bacteria 839
283 Ga0207669_11178282 3300025937 Bacteria 649
284 Ga0207704_10327458 3300025938 Bacteria 1184
285 Ga0207691_10036749 3300025940 Bacteria 4538
286 Ga0207691_10477200 3300025940 Bacteria 1060
287 Ga0207689_10008845 3300025942 Bacteria 8745
288 Ga0207689_10643383 3300025942 Bacteria 893
289 Ga0207689_10770109 3300025942 Bacteria 812
290 Ga0207661_10064144 3300025944 Bacteria 2977
291 Ga0207661_10073534 3300025944 Bacteria 2800
292 Ga0207661_11118965 3300025944 Bacteria 725
293 Ga0207679_10437629 3300025945 Bacteria 1157
294 Ga0207679_11086121 3300025945 Bacteria 734
295 Ga0207679_11510420 3300025945 Bacteria 616
296 Ga0207667_10163214 3300025949 Bacteria 2291
297 Ga0207667_10265903 3300025949 Bacteria 1753
298 Ga0207667_10379268 3300025949 Bacteria 1441
299 Ga0207651_10363737 3300025960 Bacteria 1222
300 Ga0207712_10035246 3300025961 Bacteria 3398
301 Ga0207712_10294118 3300025961 Bacteria 1330
302 Ga0207668_11180269 3300025972 Bacteria 688
303 Ga0207668_11900150 3300025972 Bacteria 537
304 Ga0207640_10371855 3300025981 Bacteria 1155
305 Ga0207640_11470767 3300025981 Bacteria 612
306 Ga0207640_11472386 3300025981 Bacteria 611
307 Ga0207677_10140375 3300026023 Bacteria 1849
308 Ga0207677_10483948 3300026023 Bacteria 1067
309 Ga0207677_11143544 3300026023 Bacteria 711
310 Ga0207703_11270456 3300026035 Bacteria 708
311 Ga0207703_11292834 3300026035 Bacteria 701
312 Ga0207639_10486623 3300026041 Bacteria 1125
313 Ga0207639_10537802 3300026041 Bacteria 1072
314 Ga0207639_10771704 3300026041 Bacteria 895
315 Ga0207639_11085442 3300026041 Bacteria 750
316 Ga0207678_10089854 3300026067 Bacteria 2625
317 Ga0207678_10125218 3300026067 Bacteria 2192
318 Ga0207708_10085358 3300026075 Bacteria 2428
319 Ga0207708_11156814 3300026075 Bacteria 676
320 Ga0207702_10068465 3300026078 Bacteria 3050
321 Ga0207702_10217569 3300026078 Bacteria 1779
322 Ga0207702_10318830 3300026078 Bacteria 1480
323 Ga0207702_11601103 3300026078 Bacteria 645
324 Ga0207702_11973600 3300026078 Bacteria 574
325 Ga0207641_11393968 3300026088 Bacteria 702
326 Ga0207641_11467465 3300026088 Bacteria 683
327 Ga0207648_10077148 3300026089 Bacteria 2904
328 Ga0207648_10636761 3300026089 Bacteria 985
329 Ga0207648_10662195 3300026089 Bacteria 965
330 Ga0207648_10787707 3300026089 Bacteria 884
331 Ga0207676_10561767 3300026095 Bacteria 1091
332 Ga0207676_10905614 3300026095 Bacteria 865
333 Ga0207674_10071461 3300026116 Bacteria 3487
334 Ga0207674_10084524 3300026116 Bacteria 3171
335 Ga0207674_10090260 3300026116 Bacteria 3055
336 Ga0207674_10560319 3300026116 Bacteria 1104
337 Ga0207674_10857040 3300026116 Bacteria 876
338 Ga0207675_100515504 3300026118 Bacteria 1191
339 Ga0207675_101921344 3300026118 Bacteria 610
340 Ga0207683_11340189 3300026121 Bacteria 662
341 Ga0207698_10163778 3300026142 Bacteria 1949
342 Ga0207698_10254961 3300026142 Bacteria 1608
343 Ga0207698_10545686 3300026142 Bacteria 1135
344 Ga0207698_11312354 3300026142 Bacteria 738
345 Ga0209995_1014936 3300027471 Bacteria 1273
346 Ga0209970_1022004 3300027614 Bacteria 1081
347 Ga0207428_10019856 3300027907 Bacteria 5724
348 Ga0207428_10823469 3300027907 Bacteria 659
349 Ga0268266_10000845 3300028379 Bacteria 39924
350 Ga0268265_10470075 3300028380 Bacteria 1179
351 Ga0268265_11101547 3300028380 Bacteria 788
352 Ga0268264_10006248 3300028381 Bacteria 10050
353 Ga0265334_10025950 3300028573 Bacteria 2369
354 Ga0307515_10000009 3300028794 Bacteria 653206
355 Ga0307515_10112100 3300028794 Bacteria 3175
356 Ga0307515_10713857 3300028794 Bacteria 619
357 Ga0265338_10357708 3300028800 Bacteria 1048
358 Ga0265324_10081379 3300029957 Bacteria 1101
359 Ga0265325_10462389 3300031241 Bacteria 552
360 Ga0265327_10000026 3300031251 Bacteria 379288
361 Ga0265327_10000146 3300031251 Bacteria 154436
362 Ga0265327_10000370 3300031251 Bacteria 84921
363 Ga0265327_10004316 3300031251 Bacteria 12681
364 Ga0265327_10090034 3300031251 Bacteria 1498
365 Ga0265327_10117506 3300031251 Bacteria 1264
366 Ga0265327_10141793 3300031251 Bacteria 1123
367 Ga0265327_10145841 3300031251 Bacteria 1102
368 Ga0265316_10363451 3300031344 Bacteria 1046
369 Ga0307513_10045434 3300031456 Bacteria 4801
370 Ga0307513_10045488 3300031456 Bacteria 4797
371 Ga0307509_10104738 3300031507 Bacteria 2852
372 Ga0307509_10368690 3300031507 Bacteria 1153
373 Ga0307408_100133847 3300031548 Bacteria 1937
374 Ga0307408_100349403 3300031548 Bacteria 1254
375 Ga0307408_100682910 3300031548 Bacteria 921
376 Ga0307408_100817856 3300031548 Bacteria 847
377 Ga0307514_10233533 3300031649 Bacteria 1111
378 Ga0316579_10126698 3300031691 Bacteria 1229
379 Ga0265342_10069939 3300031712 Bacteria 2049
380 Ga0316576_10001081 3300031727 Bacteria 14158
381 Ga0316576_10017698 3300031727 Bacteria 4849
382 Ga0316576_10018128 3300031727 Bacteria 4799
383 Ga0316576_10021761 3300031727 Bacteria 4440
384 Ga0316576_10027616 3300031727 Bacteria 3992
385 Ga0316576_10032421 3300031727 Bacteria 3713
386 Ga0316576_10039513 3300031727 Bacteria 3387
387 Ga0316576_10048308 3300031727 Unclassified 3086
388 Ga0316576_10109448 3300031727 Bacteria 2070
389 Ga0316576_10146107 3300031727 Bacteria 1781
390 Ga0316576_10152932 3300031727 Bacteria 1739
391 Ga0316576_10332258 3300031727 Bacteria 1133
392 Ga0316576_10754560 3300031727 Bacteria 702
393 Ga0316578_10004394 3300031728 Bacteria 6652
394 Ga0316578_10023848 3300031728 Bacteria 3427
395 Ga0316578_10042897 3300031728 Bacteria 2625
396 Ga0316578_10081543 3300031728 Bacteria 1925
397 Ga0316578_10312557 3300031728 Bacteria 939
398 Ga0307405_10015203 3300031731 Bacteria 4161
399 Ga0316577_10022920 3300031733 Bacteria 3468
400 Ga0307413_10577032 3300031824 Bacteria 917
401 Ga0307410_10235600 3300031852 Bacteria 1416
402 Ga0307410_10701487 3300031852 Bacteria 853
403 Ga0307406_10857065 3300031901 Bacteria 771
404 Ga0307407_10024117 3300031903 Bacteria 3185
405 Ga0307412_10925627 3300031911 Bacteria 765
406 Ga0307412_11489309 3300031911 Bacteria 615
407 Ga0307409_100169562 3300031995 Bacteria 1920
408 Ga0307409_102713699 3300031995 Unclassified 523
409 Ga0307409_102865106 3300031995 Bacteria 510
410 Ga0307416_100000249 3300032002 Bacteria 28628
411 Ga0307416_100904686 3300032002 Bacteria 983
412 Ga0307416_100938564 3300032002 Bacteria 967
413 Ga0307416_101115206 3300032002 Bacteria 894
414 Ga0307414_10014085 3300032004 Bacteria 4779
415 Ga0307414_10039831 3300032004 Bacteria 3169
416 Ga0307414_10168572 3300032004 Bacteria 1748
417 Ga0307414_10281684 3300032004 Bacteria 1397
418 Ga0307414_10531834 3300032004 Bacteria 1045
419 Ga0307411_10001861 3300032005 Bacteria 8973
420 Ga0307411_10496548 3300032005 Bacteria 1031
421 Ga0307415_100002166 3300032126 Bacteria 9736
422 Ga0307415_100439468 3300032126 Bacteria 1125
423 Ga0307415_100560677 3300032126 Bacteria 1010
424 Ga0316585_10053022 3300032137 Bacteria 1304
425 Ga0316580_10031872 3300032139 Bacteria 1632
426 Ga0316593_10000201 3300032168 Bacteria 9314
427 Ga0316593_10003954 3300032168 Bacteria 3746
428 Ga0316593_10040978 3300032168 Bacteria 1540
429 Ga0316593_10094169 3300032168 Bacteria 1057
430 Ga0316593_10165963 3300032168 Bacteria 808
431 Ga0316593_10191908 3300032168 Bacteria 753
432 Ga0316593_10193777 3300032168 Bacteria 750
433 Ga0316593_10284069 3300032168 Bacteria 624
434 Ga0316592_1000945 3300033524 Bacteria 4451
435 Ga0316592_1014787 3300033524 Bacteria 1621
436 Ga0316592_1064916 3300033524 Bacteria 822
437 Ga0316592_1078447 3300033524 Bacteria 750
438 Ga0316586_1108850 3300033527 Bacteria 534
439 Ga0316588_1028900 3300033528 Bacteria 1295
440 Ga0316588_1049774 3300033528 Bacteria 1015
441 Ga0316588_1103022 3300033528 Bacteria 715
442 Ga0316588_1127486 3300033528 Bacteria 646
443 Ga0316596_1000575 3300033541 Bacteria 6430
444 Ga0316596_1002512 3300033541 Bacteria 3927
445 Ga0316596_1003747 3300033541 Bacteria 3360
446 Ga0316596_1003898 3300033541 Bacteria 3305
447 Ga0316596_1004236 3300033541 Bacteria 3203
448 Ga0316596_1007610 3300033541 Bacteria 2565
449 Ga0316596_1015736 3300033541 Bacteria 1888
450 Ga0316596_1031647 3300033541 Bacteria 1375
451 Ga0316596_1037945 3300033541 Bacteria 1261
452 Ga0316596_1052248 3300033541 Bacteria 1083
453 Ga0316596_1086653 3300033541 Bacteria 843
454 Ga0316596_1131683 3300033541 Bacteria 683
455 Ga0316596_1133994 3300033541 Bacteria 677
456 Ga0316596_1155611 3300033541 Bacteria 628
457 Ga0316596_1178508 3300033541 Unclassified 587
458 Ga0316596_1216739 3300033541 Bacteria 535
459 Ga0316596_1230401 3300033541 Bacteria 520
460 Ga0316596_1246828 3300033541 Bacteria 503
461 Ga0373939_0155015 3300035114 Bacteria 837
462 Ga0373953_0213853 3300035117 Bacteria 835
463 Ga0373946_0450082 3300035171 Bacteria 656
464 Ga0373955_0173310 3300035172 Bacteria 1278
465 Ga0373955_0398680 3300035172 Bacteria 836
466 Ga0316574_0027184 3300035398 Bacteria 3445
467 Ga0316574_0070134 3300035398 Bacteria 2213
468 Ga0316574_0879146 3300035398 Bacteria 543
469 Ga0373931_0120868 3300035691 Bacteria 1497
470 Ga0373931_1163690 3300035691 Bacteria 527
471 Ga0373935_0060159 3300035692 Bacteria 2430
472 Ga0373927_0079676 3300035695 Bacteria 2122
473 Ga0373937_0037881 3300036401 Bacteria 4395
474 Ga0373937_0568783 3300036401 Bacteria 1077
475 Ga0373937_1744908 3300036401 Unclassified 569
476 Ga0373937_1862027 3300036401 Bacteria 548
477 Ga0316582_0014930 3300036647 Bacteria 4424
478 Ga0316582_0063175 3300036647 Bacteria 2379
479 Ga0316582_0345011 3300036647 Bacteria 1024
480 Ga0316582_0384732 3300036647 Bacteria 966
481 Ga0316582_0402713 3300036647 Bacteria 943
482 Ga0316582_0474089 3300036647 Bacteria 863
483 Ga0316584_0005378 3300036712 Bacteria 8592
484 Ga0316584_0007005 3300036712 Bacteria 7674
485 Ga0316584_0021141 3300036712 Bacteria 4725
486 Ga0316584_0087726 3300036712 Bacteria 2329
487 Ga0316584_0228188 3300036712 Bacteria 1366
488 Ga0316584_0284516 3300036712 Bacteria 1201
489 Ga0316584_0333907 3300036712 Bacteria 1091
490 Ga0316584_0469360 3300036712 Bacteria 888
491 Ga0316584_0762991 3300036712 Bacteria 659
492 Ga0395899_0172428 3300037312 Bacteria 1523
493 Ga0395899_0437442 3300037312 Unclassified 859
494 Ga0395900_0009171 3300037418 Bacteria 10139
495 Ga0395900_0208359 3300037418 Bacteria 1975
496 Ga0395905_0000001 3300037471 Bacteria 2037079
497 Ga0395905_0006283 3300037471 Bacteria 11982
498 Ga0395905_0277254 3300037471 Bacteria 1563
499 Ga0395905_0607028 3300037471 Bacteria 996
500 Ga0395901_0000654 3300038443 Bacteria 39925
501 Ga0395901_0003122 3300038443 Bacteria 16635
502 Ga0400483_035362 3300039062 Bacteria 41412
503 Ga0400489_18980 3300039093 Bacteria 1041
504 Ga0436365_0305539 3300039437 Bacteria 1622
505 Ga0436365_0676798 3300039437 Bacteria 1215
506 Ga0436365_0968552 3300039437 Unclassified 596
507 Ga0436365_1194723 3300039437 Bacteria 3001
508 Ga0436363_0513489 3300039450 Bacteria 576
509 Ga0439465_0094319 3300041413 Bacteria 1027
510 Ga0439465_0289974 3300041413 Bacteria 611
511 Ga0451787_079098 3300041441 Bacteria 799
512 Ga0451789_1092803 3300041443 Bacteria 548
513 Ga0451790_13840 3300041444 Bacteria 1039
514 Ga0451790_41939 3300041444 Bacteria 779
515 Ga0451790_47771 3300041444 Bacteria 576
516 Ga0451794_03323 3300041446 Bacteria 681
517 Ga0451794_06250 3300041446 Bacteria 577
518 Ga0451791_0115989 3300041451 Bacteria 766
519 Ga0451793_0885796 3300041452 Bacteria 673
520 Ga0451793_1886256 3300041452 Bacteria 896
521 Ga0451797_1262852 3300041453 Bacteria 515
522 Ga0451795_0000788 3300041456 Bacteria 1628
523 Ga0451795_0069802 3300041456 Bacteria 1163
524 Ga0451795_0271097 3300041456 Bacteria 779
525 Ga0451795_0389135 3300041456 Bacteria 1028
526 Ga0451795_0817895 3300041456 Bacteria 1398
527 Ga0451795_1033178 3300041456 Bacteria 565
528 Ga0451795_1256897 3300041456 Bacteria 766
529 Ga0451798_0431874 3300041458 Bacteria 589
530 Ga0451800_0749243 3300041459 Bacteria 1308
531 Ga0451802_0357152 3300041460 Bacteria 773
532 Ga0451802_2183209 3300041460 Bacteria 592
533 Ga0451804_0982978 3300041463 Bacteria 1166
534 Ga0451808_28645 3300041464 Bacteria 510
535 Ga0451807_1052428 3300041486 Bacteria 681
536 Ga0451807_1974311 3300041486 Bacteria 1133
537 Ga0451833_0948996 3300041491 Bacteria 621
538 Ga0451837_0557409 3300041494 Bacteria 579
539 Ga0451837_0757746 3300041494 Bacteria 709
540 Ga0451841_0481137 3300041498 Bacteria 644
541 Ga0451846_24529 3300041502 Bacteria 589
542 Ga0451847_0304467 3300041503 Bacteria 901
543 Ga0451849_1019517 3300041505 Bacteria 586
544 Ga0451851_0610101 3300041507 Bacteria 1231
545 Ga0451851_1332631 3300041507 Bacteria 854
546 Ga0451852_09946 3300041508 Bacteria 554
547 Ga0451852_13332 3300041508 Bacteria 9060
548 Ga0451852_38882 3300041508 Bacteria 1616
549 Ga0451855_0171797 3300041511 Bacteria 551
550 Ga0451855_0427028 3300041511 Bacteria 630
551 Ga0451855_0484682 3300041511 Bacteria 851
552 Ga0451855_0497909 3300041511 Bacteria 3019
553 Ga0451855_0824732 3300041511 Bacteria 1060
554 Ga0451855_0918148 3300041511 Bacteria 580
555 Ga0451855_1038422 3300041511 Bacteria 786
556 Ga0451855_1240003 3300041511 Bacteria 2272
557 Ga0451855_1928680 3300041511 Bacteria 536
558 Ga0451853_0182524 3300041512 Bacteria 1259
559 Ga0451853_3993765 3300041512 Bacteria 780
560 Ga0439431_0118691 3300041997 Bacteria 737
561 Ga0439441_030480 3300042001 Bacteria 1043
562 Ga0439445_0003220 3300042004 Bacteria 3659
563 Ga0439449_0002213 3300042007 Bacteria 7655
564 Ga0439449_0067389 3300042007 Bacteria 1320
565 Ga0439462_0257479 3300042015 Bacteria 503
566 Ga0450890_042374 3300042127 Bacteria 677
567 Ga0439446_0167257 3300042156 Bacteria 730
568 Ga0439458_0210270 3300042157 Bacteria 534
569 Ga0439434_0110484 3300042435 Bacteria 890
570 Ga0439444_0062706 3300042437 Bacteria 780
571 Ga0450893_0001114 3300042532 Bacteria 4056
572 Ga0451577_0000092 3300042876 Bacteria 198898
573 Ga0451577_0000433 3300042876 Bacteria 74789
574 Ga0451577_0000690 3300042876 Bacteria 52905
575 Ga0451577_0005144 3300042876 Bacteria 13458
576 Ga0451577_0009644 3300042876 Bacteria 9267
577 Ga0451577_0022022 3300042876 Bacteria 5823
578 Ga0451577_0023389 3300042876 Bacteria 5637
579 Ga0451577_0024955 3300042876 Bacteria 5429
580 Ga0451577_0025303 3300042876 Bacteria 5388
581 Ga0451577_0026335 3300042876 Bacteria 5268
582 Ga0451577_0047949 3300042876 Bacteria 3818
583 Ga0451577_0107299 3300042876 Bacteria 2496
584 Ga0451577_0179508 3300042876 Bacteria 1908
585 Ga0451577_0258725 3300042876 Bacteria 1576
586 Ga0451577_0262956 3300042876 Bacteria 1562
587 Ga0451577_0300325 3300042876 Bacteria 1455
588 Ga0451577_0350301 3300042876 Bacteria 1340
589 Ga0451577_0389652 3300042876 Bacteria 1264
590 Ga0451577_0476389 3300042876 Bacteria 1133
591 Ga0451577_0480707 3300042876 Unclassified 1128
592 Ga0451577_0812103 3300042876 Bacteria 844
593 Ga0451577_0931162 3300042876 Bacteria 782
594 Ga0451577_1253466 3300042876 Bacteria 660
595 Ga0451577_1631566 3300042876 Bacteria 568
596 Ga0466972_0276976 3300044658 Bacteria 784
597 Ga0453683_0000055 3300044673 Bacteria 192588
598 Ga0453683_0000066 3300044673 Bacteria 164788
599 Ga0453683_0000522 3300044673 Bacteria 43145
600 Ga0453683_0005928 3300044673 Bacteria 8435
601 Ga0453683_0006727 3300044673 Bacteria 7859
602 Ga0453683_0010256 3300044673 Bacteria 6213
603 Ga0453683_0015630 3300044673 Bacteria 4912
604 Ga0453683_0019499 3300044673 Bacteria 4342
605 Ga0453683_0044943 3300044673 Bacteria 2770
606 Ga0453683_0099173 3300044673 Bacteria 1829
607 Ga0453683_0114221 3300044673 Bacteria 1699
608 Ga0453683_0118753 3300044673 Bacteria 1664
609 Ga0453683_0138833 3300044673 Bacteria 1533
610 Ga0453683_0139064 3300044673 Bacteria 1532
611 Ga0453683_0162196 3300044673 Bacteria 1414
612 Ga0453683_0215687 3300044673 Bacteria 1219
613 Ga0453683_0216051 3300044673 Bacteria 1218
614 Ga0453683_0336710 3300044673 Bacteria 968
615 Ga0453684_0000440 3300044712 Bacteria 169397
616 Ga0453684_0000506 3300044712 Bacteria 152143
617 Ga0453684_0001121 3300044712 Bacteria 83919
618 Ga0453684_0001193 3300044712 Bacteria 80343
619 Ga0453684_0001382 3300044712 Bacteria 70292
620 Ga0453684_0001549 3300044712 Bacteria 64220
621 Ga0453684_0002895 3300044712 Bacteria 40244
622 Ga0453684_0004492 3300044712 Bacteria 29332
623 Ga0453684_0009769 3300044712 Bacteria 16659
624 Ga0453684_0012002 3300044712 Bacteria 14406
625 Ga0453684_0012437 3300044712 Bacteria 14033
626 Ga0453684_0012544 3300044712 Bacteria 13952
627 Ga0453684_0012598 3300044712 Bacteria 13911
628 Ga0453684_0024288 3300044712 Bacteria 8867
629 Ga0453684_0035092 3300044712 Bacteria 6941
630 Ga0453684_0049674 3300044712 Bacteria 5527
631 Ga0453684_0057385 3300044712 Bacteria 5039
632 Ga0453684_0064505 3300044712 Bacteria 4678
633 Ga0453684_0076172 3300044712 Bacteria 4212
634 Ga0453684_0104626 3300044712 Bacteria 3455
635 Ga0453684_0122847 3300044712 Bacteria 3132
636 Ga0453684_0133450 3300044712 Bacteria 2976
637 Ga0453684_0143337 3300044712 Bacteria 2849
638 Ga0453684_0145941 3300044712 Bacteria 2819
639 Ga0453684_0200799 3300044712 Bacteria 2324
640 Ga0453684_0213872 3300044712 Bacteria 2238
641 Ga0453684_0267728 3300044712 Bacteria 1954
642 Ga0453684_0322460 3300044712 Bacteria 1749
643 Ga0453684_0385184 3300044712 Bacteria 1573
644 Ga0453684_0431129 3300044712 Bacteria 1471
645 Ga0453684_0494236 3300044712 Bacteria 1355
646 Ga0453684_0577897 3300044712 Bacteria 1234
647 Ga0453684_0601526 3300044712 Bacteria 1205
648 Ga0453684_0719378 3300044712 Bacteria 1083
649 Ga0453684_0897059 3300044712 Bacteria 950
650 Ga0453684_0992680 3300044712 Bacteria 893
651 Ga0453684_1318108 3300044712 Bacteria 752
652 Ga0453684_1428135 3300044712 Bacteria 716
653 Ga0453684_1815219 3300044712 Bacteria 619
654 Ga0466957_0664174 3300044842 Bacteria 734
655 Ga0451576_0000113 3300045051 Bacteria 208644
656 Ga0451576_0000204 3300045051 Bacteria 149459
657 Ga0451576_0000689 3300045051 Bacteria 68784
658 Ga0451576_0000783 3300045051 Bacteria 62485
659 Ga0451576_0003461 3300045051 Bacteria 21644
660 Ga0451576_0003652 3300045051 Bacteria 20883
661 Ga0451576_0011102 3300045051 Bacteria 10274
662 Ga0451576_0012395 3300045051 Bacteria 9577
663 Ga0451576_0013908 3300045051 Bacteria 8986
664 Ga0451576_0047592 3300045051 Bacteria 4507
665 Ga0451576_0083654 3300045051 Bacteria 3319
666 Ga0451576_0088919 3300045051 Bacteria 3212
667 Ga0451576_0121529 3300045051 Bacteria 2719
668 Ga0451576_0124949 3300045051 Bacteria 2680
669 Ga0451576_0133725 3300045051 Bacteria 2586
670 Ga0451576_0165783 3300045051 Bacteria 2306
671 Ga0451576_0176056 3300045051 Bacteria 2233
672 Ga0451576_0277421 3300045051 Bacteria 1753
673 Ga0451576_0291923 3300045051 Bacteria 1705
674 Ga0451576_0374307 3300045051 Bacteria 1492
675 Ga0451576_0848375 3300045051 Bacteria 959
676 Ga0451576_0937455 3300045051 Bacteria 908
677 Ga0451576_0996934 3300045051 Bacteria 878
678 Ga0451576_1432327 3300045051 Bacteria 718
679 Ga0451576_1466520 3300045051 Unclassified 709
680 Ga0451576_1772569 3300045051 Bacteria 638
681 Ga0495592_0841048 3300046454 Bacteria 543
682 Ga0495638_0000040 3300046460 Bacteria 241883
683 Ga0495580_0138723 3300046472 Bacteria 1686
684 Ga0495639_0292676 3300046475 Bacteria 811
685 Ga0495662_0337290 3300046476 Bacteria 741
686 Ga0495664_0720892 3300046477 Bacteria 589
687 Ga0495608_0369474 3300046511 Bacteria 881
688 Ga0495618_0449267 3300046514 Bacteria 783
689 Ga0495628_0963096 3300046516 Bacteria 589
690 Ga0495630_0252558 3300046517 Bacteria 1347
691 Ga0495586_0205973 3300046535 Bacteria 1116
692 Ga0495586_0641382 3300046535 Bacteria 614
693 Ga0495645_0077970 3300046543 Bacteria 2382
694 Ga0495625_0719846 3300046660 Bacteria 588
695 Ga0495659_0354380 3300046664 Bacteria 628
696 Ga0495661_0107289 3300046665 Bacteria 1561
697 Ga0495588_0196215 3300046674 Bacteria 1066
698 Ga0495588_0386751 3300046674 Bacteria 735
699 Ga0495657_0227691 3300046675 Bacteria 1129
700 Ga0495646_0348904 3300046680 Bacteria 776
701 Ga0495658_0714549 3300046683 Bacteria 642
702 Ga0495670_0002356 3300046691 Bacteria 9299
703 Ga0495670_0242597 3300046691 Bacteria 959
704 Ga0495670_0353582 3300046691 Bacteria 791
705 Ga0495649_0152895 3300046694 Bacteria 1212
706 Ga0495600_0686773 3300046809 Bacteria 617
707 Ga0495581_0823918 3300047315 Bacteria 532
708 Ga0495636_0000049 3300047318 Bacteria 51760
709 Ga0495636_0396842 3300047318 Bacteria 657
710 Ga0495674_0504313 3300047319 Bacteria 968
711 Ga0495677_0280987 3300047445 Bacteria 653
712 Ga0495677_0445352 3300047445 Bacteria 513
713 Ga0495615_0157670 3300048090 Bacteria 680
714 Ga0496105_0895376 3300048908 Bacteria 669
715 Ga0496114_0165201 3300048917 Bacteria 1927
716 Ga0496114_0836726 3300048917 Bacteria 800
717 Ga0496115_0213459 3300048918 Bacteria 1594
718 Ga0496115_1277852 3300048918 Bacteria 548
719 Ga0496122_0443410 3300048925 Bacteria 646
720 Ga0501306_000044 3300049127 Bacteria 6530
721 Ga0501306_000698 3300049127 Bacteria 2749
722 Ga0501306_004708 3300049127 Bacteria 1539
723 Ga0501306_037461 3300049127 Bacteria 742
724 Ga0501306_048747 3300049127 Bacteria 675
725 Ga0501306_049046 3300049127 Bacteria 673
726 Ga0501306_054487 3300049127 Bacteria 648
727 Ga0501308_000036 3300049128 Bacteria 5406
728 Ga0501308_001435 3300049128 Bacteria 1902
729 Ga0501308_011162 3300049128 Bacteria 1008
730 Ga0501308_019380 3300049128 Bacteria 839
731 Ga0501308_028121 3300049128 Bacteria 742
732 Ga0501308_028905 3300049128 Bacteria 735
733 Ga0501308_029073 3300049128 Bacteria 733
734 Ga0501308_060046 3300049128 Bacteria 572
735 Ga0501309_000005 3300049129 Bacteria 11119
736 Ga0501309_000848 3300049129 Bacteria 2726
737 Ga0501309_001731 3300049129 Bacteria 2218
738 Ga0501309_007200 3300049129 Bacteria 1374
739 Ga0501309_036750 3300049129 Bacteria 738
740 Ga0501309_054456 3300049129 Bacteria 634
741 Ga0501309_073816 3300049129 Bacteria 564
742 Ga0501310_001746 3300049130 Bacteria 2006
743 Ga0501310_003848 3300049130 Bacteria 1482
744 Ga0501310_004031 3300049130 Bacteria 1458
745 Ga0501310_006036 3300049130 Bacteria 1260
746 Ga0501310_023135 3300049130 Bacteria 789
747 Ga0501310_081016 3300049130 Bacteria 510
748 Ga0501341_08052 3300049131 Bacteria 668
749 Ga0501343_001105 3300049132 Bacteria 1770
750 Ga0501343_001931 3300049132 Bacteria 1446
751 Ga0501343_002495 3300049132 Bacteria 1312
752 Ga0501343_012079 3300049132 Bacteria 715
753 Ga0501304_000029 3300049160 Bacteria 5401
754 Ga0501304_002473 3300049160 Bacteria 1287
755 Ga0501304_004835 3300049160 Bacteria 1035
756 Ga0501304_010524 3300049160 Bacteria 810
757 Ga0501305_000041 3300049161 Bacteria 7353
758 Ga0501305_000239 3300049161 Bacteria 4036
759 Ga0501305_004857 3300049161 Bacteria 1601
760 Ga0501305_008405 3300049161 Bacteria 1335
761 Ga0501305_014049 3300049161 Bacteria 1116
762 Ga0501305_017070 3300049161 Bacteria 1041
763 Ga0501305_019261 3300049161 Bacteria 994
764 Ga0501305_041091 3300049161 Bacteria 752
765 Ga0501305_051691 3300049161 Bacteria 691
766 Ga0501307_000237 3300049162 Bacteria 3276
767 Ga0501307_001795 3300049162 Bacteria 1896
768 Ga0501307_006763 3300049162 Bacteria 1248
769 Ga0501307_015091 3300049162 Bacteria 951
770 Ga0501307_024105 3300049162 Bacteria 810
771 Ga0501307_030240 3300049162 Bacteria 748
772 Ga0501307_037960 3300049162 Bacteria 691
773 Ga0501307_050062 3300049162 Bacteria 626
774 Ga0501307_075905 3300049162 Bacteria 542
775 Ga0501296_064433 3300049519 Bacteria 559
776 Ga0501298_036258 3300049521 Bacteria 986
777 Ga0501303_026218 3300049526 Bacteria 653
778 Ga0501311_002954 3300049527 Bacteria 1686
779 Ga0501311_004120 3300049527 Bacteria 1531
780 Ga0501311_008889 3300049527 Bacteria 1189
781 Ga0501311_010378 3300049527 Bacteria 1129
782 Ga0501311_037809 3300049527 Bacteria 722
783 Ga0501312_000008 3300049528 Bacteria 9722
784 Ga0501312_000783 3300049528 Bacteria 2791
785 Ga0501312_002894 3300049528 Bacteria 1894
786 Ga0501312_032285 3300049528 Bacteria 826
787 Ga0501312_036971 3300049528 Bacteria 786
788 Ga0501312_039745 3300049528 Bacteria 765
789 Ga0501312_044814 3300049528 Bacteria 732
790 Ga0501312_073382 3300049528 Bacteria 610
791 Ga0501312_077700 3300049528 Bacteria 597
792 Ga0501312_097565 3300049528 Bacteria 548
793 Ga0501312_103276 3300049528 Bacteria 537
794 Ga0501312_116958 3300049528 Bacteria 513
795 Ga0501313_000046 3300049529 Bacteria 5461
796 Ga0501313_001256 3300049529 Bacteria 2140
797 Ga0501313_007305 3300049529 Bacteria 1215
798 Ga0501313_017356 3300049529 Bacteria 869
799 Ga0501313_025790 3300049529 Bacteria 745
800 Ga0501313_028145 3300049529 Bacteria 720
801 Ga0501314_000536 3300049530 Bacteria 2398
802 Ga0501314_005375 3300049530 Bacteria 1089
803 Ga0501314_008115 3300049530 Bacteria 943
804 Ga0501314_021975 3300049530 Bacteria 669
805 Ga0501315_000039 3300049531 Bacteria 5463
806 Ga0501315_000148 3300049531 Bacteria 3959
807 Ga0501315_004361 3300049531 Bacteria 1475
808 Ga0501315_004396 3300049531 Bacteria 1473
809 Ga0501315_005480 3300049531 Bacteria 1375
810 Ga0501315_022209 3300049531 Bacteria 864
811 Ga0501315_035949 3300049531 Bacteria 733
812 Ga0501315_038649 3300049531 Bacteria 715
813 Ga0501315_061908 3300049531 Bacteria 607
814 Ga0501315_067059 3300049531 Bacteria 589
815 Ga0501315_077734 3300049531 Bacteria 559
816 Ga0501315_091022 3300049531 Bacteria 529
817 Ga0501316_001307 3300049532 Bacteria 2085
818 Ga0501316_003657 3300049532 Bacteria 1507
819 Ga0501316_005326 3300049532 Bacteria 1330
820 Ga0501316_008595 3300049532 Bacteria 1131
821 Ga0501316_016604 3300049532 Bacteria 896
822 Ga0501316_047169 3300049532 Bacteria 613
823 Ga0501316_049777 3300049532 Bacteria 601
824 Ga0501316_057040 3300049532 Bacteria 572
825 Ga0501317_001819 3300049533 Bacteria 1918
826 Ga0501317_004254 3300049533 Bacteria 1480
827 Ga0501317_006292 3300049533 Bacteria 1301
828 Ga0501317_045213 3300049533 Bacteria 684
829 Ga0501317_049914 3300049533 Bacteria 662
830 Ga0501318_059368 3300049534 Bacteria 584
831 Ga0501319_011072 3300049535 Bacteria 725
832 Ga0501320_000271 3300049536 Bacteria 2794
833 Ga0501320_001656 3300049536 Bacteria 1674
834 Ga0501320_007328 3300049536 Bacteria 1059
835 Ga0501320_011441 3300049536 Bacteria 919
836 Ga0501320_012555 3300049536 Bacteria 893
837 Ga0501320_023233 3300049536 Bacteria 732
838 Ga0501320_025490 3300049536 Bacteria 709
839 Ga0501320_027114 3300049536 Bacteria 695
840 Ga0501320_060048 3300049536 Bacteria 533
841 Ga0501321_001022 3300049537 Bacteria 2090
842 Ga0501321_012051 3300049537 Bacteria 974
843 Ga0501321_051689 3300049537 Bacteria 602
844 Ga0501322_022094 3300049538 Bacteria 564
845 Ga0501323_000022 3300049539 Bacteria 7278
846 Ga0501323_000041 3300049539 Bacteria 6045
847 Ga0501323_002898 3300049539 Bacteria 1707
848 Ga0501323_034152 3300049539 Bacteria 725
849 Ga0501323_037123 3300049539 Bacteria 703
850 Ga0501324_001820 3300049540 Bacteria 1477
851 Ga0501324_007058 3300049540 Bacteria 961
852 Ga0501324_033942 3300049540 Bacteria 565
853 Ga0501325_000253 3300049541 Bacteria 2263
854 Ga0501325_001123 3300049541 Bacteria 1559
855 Ga0501325_019707 3300049541 Bacteria 702
856 Ga0501325_035921 3300049541 Bacteria 586
857 Ga0501326_00213 3300049542 Bacteria 2132
858 Ga0501326_08315 3300049542 Bacteria 602
859 Ga0501327_02818 3300049543 Bacteria 924
860 Ga0501328_00317 3300049544 Bacteria 1542
861 Ga0501329_00473 3300049545 Bacteria 1426
862 Ga0501331_01387 3300049547 Bacteria 1173
863 Ga0501334_14375 3300049550 Bacteria 600
864 Ga0501335_003359 3300049551 Bacteria 1353
865 Ga0501335_003643 3300049551 Bacteria 1314
866 Ga0501335_017583 3300049551 Bacteria 743
867 Ga0501335_023649 3300049551 Bacteria 667
868 Ga0501336_000198 3300049552 Bacteria 2598
869 Ga0501336_002156 3300049552 Bacteria 1247
870 Ga0501336_009102 3300049552 Bacteria 779
871 Ga0501337_015435 3300049553 Bacteria 590
872 Ga0501338_04356 3300049554 Bacteria 857
873 Ga0501340_002246 3300049556 Bacteria 1105
874 Ga0501031_0026756 3300049568 Bacteria 3760
875 Ga0501032_0007271 3300049569 Bacteria 8100
876 Ga0501032_0030328 3300049569 Bacteria 3710
877 Ga0501032_0048968 3300049569 Bacteria 2852
878 Ga0501033_0000011 3300049570 Bacteria 259130
879 Ga0501034_0001265 3300049571 Bacteria 34324
880 Ga0501034_0019142 3300049571 Bacteria 7009
881 Ga0501034_0036199 3300049571 Bacteria 5001
882 Ga0501034_0178660 3300049571 Bacteria 2088
883 Ga0501036_0014424 3300049572 Bacteria 6581
884 Ga0501036_0019659 3300049572 Bacteria 5670
885 Ga0501037_0013217 3300049573 Bacteria 6084
886 Ga0501037_0249427 3300049573 Bacteria 1242
887 Ga0501038_0002395 3300049574 Bacteria 17463
888 Ga0501038_0028118 3300049574 Bacteria 4995
889 Ga0501038_0075723 3300049574 Bacteria 2844
890 Ga0501039_0012686 3300049575 Bacteria 6441
891 Ga0501039_0023075 3300049575 Bacteria 4773
892 Ga0501039_0263075 3300049575 Bacteria 1356
893 Ga0501042_0210143 3300049578 Bacteria 1404
894 Ga0501042_0503317 3300049578 Bacteria 880
895 Ga0501043_0021084 3300049579 Bacteria 5108
896 Ga0501043_0024223 3300049579 Bacteria 4762
897 Ga0501043_0040531 3300049579 Bacteria 3661
898 Ga0501043_0183873 3300049579 Bacteria 1628
899 Ga0501046_0099565 3300049580 Bacteria 2231
900 Ga0501046_0150637 3300049580 Bacteria 1755
901 Ga0501047_0036558 3300049581 Bacteria 4747
902 Ga0501047_0288271 3300049581 Bacteria 1485
903 Ga0501048_0015730 3300049582 Bacteria 5582
904 Ga0501067_0006402 3300049583 Bacteria 6522
905 Ga0501067_0009218 3300049583 Bacteria 5466
906 Ga0501068_0014823 3300049584 Bacteria 4463
907 Ga0501068_0052122 3300049584 Bacteria 2476
908 Ga0501069_0015284 3300049585 Bacteria 4113
909 Ga0501070_0036727 3300049586 Bacteria 4092
910 Ga0501070_0078325 3300049586 Bacteria 2735
911 Ga0501070_0092295 3300049586 Bacteria 2506
912 Ga0501071_0060047 3300049587 Bacteria 2752
913 Ga0501072_0260586 3300049588 Bacteria 1380
914 Ga0501073_0008802 3300049589 Bacteria 7464
915 Ga0501073_0011829 3300049589 Bacteria 6369
916 Ga0501073_0322131 3300049589 Bacteria 1067
917 Ga0501074_0019774 3300049590 Bacteria 4891
918 Ga0501199_036884 3300049650 Bacteria 622
919 Ga0501202_044391 3300049652 Bacteria 969
920 Ga0501210_015241 3300049657 Bacteria 671
921 Ga0501217_009364 3300049661 Bacteria 2129
922 Ga0501222_037300 3300049662 Bacteria 682
923 Ga0501235_015899 3300049669 Bacteria 1660
924 Ga0501235_110303 3300049669 Bacteria 680
925 Ga0501236_000641 3300049670 Bacteria 3894
926 Ga0501238_004543 3300049671 Bacteria 1739
927 Ga0501238_022494 3300049671 Bacteria 896
928 Ga0501242_003494 3300049674 Bacteria 1703
929 Ga0501242_073008 3300049674 Bacteria 540
930 Ga0501247_000354 3300049677 Bacteria 3467
931 Ga0501249_005609 3300049679 Bacteria 2565
932 Ga0501253_082739 3300049683 Bacteria 727
933 Ga0501257_000897 3300049686 Bacteria 6014
934 Ga0501257_020542 3300049686 Bacteria 1552
935 Ga0501257_145355 3300049686 Bacteria 650
936 Ga0501257_272815 3300049686 Bacteria 507
937 Ga0501259_033220 3300049688 Bacteria 984
938 Ga0501261_033831 3300049690 Bacteria 782
939 Ga0501225_0012695 3300049705 Bacteria 2364
940 Ga0501225_0047951 3300049705 Bacteria 1186
941 Ga0501225_0082868 3300049705 Bacteria 922
942 Ga0501225_0227145 3300049705 Bacteria 604
943 Ga0501225_0261741 3300049705 Bacteria 573
944 Ga0501079_0053196 3300049741 Bacteria 3124
945 Ga0501079_0097817 3300049741 Bacteria 2275
946 Ga0501080_0074958 3300049742 Bacteria 3147
947 Ga0501080_0286986 3300049742 Bacteria 1495
948 Ga0501080_0440282 3300049742 Bacteria 1169
949 Ga0501080_0492962 3300049742 Bacteria 1095
950 Ga0501083_0014034 3300049744 Bacteria 5600
951 Ga0501083_0062854 3300049744 Bacteria 2476
952 Ga0501264_003325 3300049761 Bacteria 1465
953 Ga0501264_014282 3300049761 Bacteria 793
954 Ga0501270_028395 3300049767 Bacteria 906
955 Ga0501035_0004622 3300049822 Bacteria 13050
956 Ga0501035_0019838 3300049822 Bacteria 6176
957 Ga0501035_0776913 3300049822 Bacteria 767
958 Ga0501044_0003551 3300049823 Bacteria 17548
959 Ga0501044_0023913 3300049823 Bacteria 6493
960 Ga0501044_0097266 3300049823 Bacteria 2965
961 Ga0501044_0514802 3300049823 Bacteria 1097
962 Ga0501045_0000053 3300049824 Bacteria 51403
963 Ga0501045_1051520 3300049824 Bacteria 596
964 Ga0501204_016306 3300049850 Bacteria 930
965 Ga0501226_015397 3300049853 Bacteria 843
966 nmdc:mga0k408_198900_c1 3300050493 Unclassified 1196
967 nmdc:mga0k408_57809_c2 3300050493 Bacteria 1481
968 nmdc:mga0k408_693703_c1 3300050493 Bacteria 597
969 nmdc:mga07m45_126657_c1 3300050496 Bacteria 1477
970 nmdc:mga07m45_89113_c1 3300050496 Bacteria 1766
971 nmdc:mga05p37_1510320_c1 3300050507 Bacteria 668
972 nmdc:mga0qj67_114691_c1 3300050509 Bacteria 2176
973 nmdc:mga0qj67_1383749_c1 3300050509 Bacteria 543
974 nmdc:mga06r32_83968_c1 3300050510 Bacteria 3103
975 nmdc:mga08y16_19020_c1 3300050511 Bacteria 7234
976 nmdc:mga08y16_21751_c1 3300050511 Bacteria 6769
977 nmdc:mga08y16_267433_c1 3300050511 Bacteria 1765
978 nmdc:mga08y16_283195_c1 3300050511 Bacteria 1709
979 nmdc:mga08y16_836450_c1 3300050511 Bacteria 911
980 nmdc:mga0a205_923548_c1 3300050515 Bacteria 719
981 Ga0500578_0086448 3300053086 Bacteria 1992
982 Ga0500644_0304785 3300053088 Bacteria 682
983 Ga0500646_0190358 3300053090 Bacteria 699
984 Ga0500556_0058888 3300053104 Bacteria 1410
985 Ga0500655_007182 3300053133 Bacteria 2003
986 Ga0500658_0385412 3300053134 Bacteria 642
987 Ga0500573_0037721 3300053140 Bacteria 2793
988 Ga0500577_0247767 3300053142 Bacteria 774
989 Ga0500604_0010471 3300053151 Bacteria 2482
990 Ga0500604_0245055 3300053151 Bacteria 620
991 Ga0500616_0000013 3300053153 Bacteria 674172
992 Ga0500616_0032309 3300053153 Bacteria 2862
993 Ga0500616_0036710 3300053153 Bacteria 2658
994 Ga0500622_0000416 3300053156 Bacteria 40603
995 Ga0500622_0000433 3300053156 Bacteria 39766
996 Ga0500622_0017657 3300053156 Bacteria 3797
997 Ga0500622_0027590 3300053156 Bacteria 2993
998 Ga0500645_134453 3300053730 Bacteria 686
999 Ga0501084_0024661 3300054114 Bacteria 5019
1000 Ga0501084_0071249 3300054114 Bacteria 2910
1001 Ga0500661_007999 3300055283 Bacteria 1948
1002 Ga0587070_000157 3300059491 Bacteria 4307
1003 Ga0587070_085573 3300059491 Bacteria 700
1004 Ga0587077_000755 3300059493 Bacteria 3065
1005 Ga0587077_147639 3300059493 Bacteria 611
1006 Ga0587077_166700 3300059493 Bacteria 587
1007 Ga0587083_0013391 3300059505 Bacteria 1396
1008 Ga0587083_0127591 3300059505 Bacteria 664
1009 Ga0587085_013261 3300059506 Bacteria 1144
1010 Ga0587088_011252 3300059508 Bacteria 1329
1011 Ga0587090_014198 3300059510 Bacteria 1162
1012 Ga0587090_144679 3300059510 Bacteria 534
1013 Ga0587091_035053 3300059511 Bacteria 963
1014 Ga0587092_008459 3300059512 Bacteria 1359
1015 Ga0587092_142144 3300059512 Bacteria 530
1016 Ga0587094_097366 3300059513 Bacteria 564
1017 Ga0587094_117389 3300059513 Bacteria 530
1018 Ga0587109_000421 3300059624 Bacteria 3954
1019 Ga0587109_014349 3300059624 Bacteria 1328
1020 Ga0587109_180781 3300059624 Bacteria 539
1021 Ga0587115_106058 3300059626 Bacteria 526
1022 Ga0587117_003203 3300059627 Bacteria 1611
1023 Ga0587117_051852 3300059627 Bacteria 683
1024 Ga0587128_076086 3300059630 Bacteria 663
1025 Ga0587062_000132 3300059639 Bacteria 3952
1026 Ga0587062_007071 3300059639 Bacteria 1297
1027 Ga0587067_067187 3300059640 Bacteria 766
1028 Ga0587068_000547 3300059641 Bacteria 3540
1029 Ga0587068_042947 3300059641 Bacteria 824
1030 Ga0587068_060734 3300059641 Bacteria 726
1031 Ga0587068_173251 3300059641 Bacteria 500
1032 Ga0587069_002452 3300059642 Bacteria 1871
1033 Ga0587072_014962 3300059643 Bacteria 1312
1034 Ga0587075_109458 3300059644 Bacteria 560
1035 Ga0587076_003883 3300059645 Bacteria 1822
1036 Ga0587076_016950 3300059645 Bacteria 1156
1037 Ga0587076_063331 3300059645 Bacteria 751
1038 Ga0587079_243368 3300059647 Bacteria 509
1039 Ga0587108_016180 3300059653 Bacteria 676
1040 Ga0587124_018699 3300059660 Bacteria 692
1041 Ga0587061_00333 3300060244 Bacteria 1540
1042 Ga0587081_05693 3300060246 Bacteria 831
1043 Ga0587111_0000249 3300060346 Bacteria 4487
1044 Ga0587111_0061165 3300060346 Bacteria 857

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005544 Ga0070686_100028804 Ga0070686_1000288045 115
2 3300032004 Ga0307414_10039831 Ga0307414_100398312 115
3 3300049536 Ga0501320_011441 Ga0501320_011441_137_517 115
4 3300003322 rootL2_10101710 rootL2_101017106 116
5 3300041505 Ga0451849_1019517 Ga0451849_1019517_114_494 116
6 3300049661 Ga0501217_009364 Ga0501217_009364_1269_1619 116
7 3300059511 Ga0587091_035053 Ga0587091_035053_238_618 118
8 3300005842 Ga0068858_100805855 Ga0068858_1008058552 119
9 3300013297 Ga0157378_10000333 Ga0157378_100003332 119
10 3300041464 Ga0451808_28645 Ga0451808_28645_41_421 119
11 3300049160 Ga0501304_004835 Ga0501304_004835_547_927 119
12 3300049162 Ga0501307_015091 Ga0501307_015091_391_771 119
13 3300049551 Ga0501335_003643 Ga0501335_003643_82_462 119
14 3300050510 nmdc:mga06r32_83968_c1 nmdc:mga06r32_83968_c1_2369_2752 119
15 3300014969 Ga0157376_11507598 Ga0157376_115075982 120
16 3300049132 Ga0501343_012079 Ga0501343_012079_312_692 120
17 3300049532 Ga0501316_057040 Ga0501316_057040_93_473 120
18 iso_pu_bacteria 2522125168 2522549437 121
19 iso_pu_bacteria 2739367866 2740031480 121
20 iso_pu_bacteria 2818991444 2819590934 121
21 iso_pu_bacteria 2839989709 2839990104 121
22 iso_pu_bacteria 2910245624 2910249737 121
23 iso_pu_bacteria 2911138879 2911143807 121
24 iso_pu_bacteria 2914759650 2914763356 121
25 iso_pu_bacteria 2929154850 2929156053 121
26 3300025926 Ga0207659_10242738 Ga0207659_102427384 122
27 3300032168 Ga0316593_10000201 Ga0316593_1000020119 122
28 3300032168 Ga0316593_10193777 Ga0316593_101937771 122
29 3300033541 Ga0316596_1133994 Ga0316596_11339942 122
30 3300005563 Ga0068855_101481603 Ga0068855_1014816032 124
31 3300032005 Ga0307411_10001861 Ga0307411_100018614 124
32 3300033528 Ga0316588_1127486 Ga0316588_11274861 124
33 3300042876 Ga0451577_0300325 Ga0451577_0300325_535_909 124
34 3300044712 Ga0453684_0009769 Ga0453684_0009769_10522_10896 124
35 3300059624 Ga0587109_000421 Ga0587109_000421_2445_2819 124
36 3300003316 rootH1_10080733 rootH1_100807334 125
37 3300003316 rootH1_10114576 rootH1_101145763 125
38 3300003322 rootL2_10010167 rootL2_100101675 125
39 3300003322 rootL2_10023239 rootL2_100232395 125
40 3300003322 rootL2_10094850 rootL2_100948505 125
41 3300003323 rootH1_10006036 rootH1_100060362 125
42 3300003323 rootH1_10006987 rootH1_100069874 125
43 3300003323 rootH1_10006988 rootH1_1000698842 125
44 3300003323 rootH1_10012787 rootH1_100127873 125
45 3300003544 Ga0007417J51691_1057812 Ga0007417J51691_10578123 125
46 3300003781 Ga0055536_1001261 Ga0055536_100126111 125
47 3300003794 Ga0055531_10000409 Ga0055531_1000040933 125
48 3300004625 Ga0055543_1051443 Ga0055543_10514432 125
49 3300004798 Ga0058859_10072763 Ga0058859_100727631 125
50 3300004798 Ga0058859_11480586 Ga0058859_114805862 125
51 3300004801 Ga0058860_10016344 Ga0058860_100163443 125
52 3300004801 Ga0058860_11946433 Ga0058860_119464332 125
53 3300005262 Ga0065165_1000131 Ga0065165_100013163 125
54 3300005262 Ga0065165_1000831 Ga0065165_100083127 125
55 3300005288 Ga0065714_10024660 Ga0065714_100246603 125
56 3300005289 Ga0065704_10124782 Ga0065704_101247824 125
57 3300005290 Ga0065712_10322046 Ga0065712_103220461 125
58 3300005290 Ga0065712_10399976 Ga0065712_103999761 125
59 3300005293 Ga0065715_10088958 Ga0065715_100889589 125
60 3300005295 Ga0065707_10148021 Ga0065707_101480212 125
61 3300005327 Ga0070658_10099188 Ga0070658_100991883 125
62 3300005327 Ga0070658_10141402 Ga0070658_101414023 125
63 3300005329 Ga0070683_100094294 Ga0070683_1000942943 125
64 3300005329 Ga0070683_101602232 Ga0070683_1016022321 125
65 3300005331 Ga0070670_100203096 Ga0070670_1002030962 125
66 3300005331 Ga0070670_101702085 Ga0070670_1017020851 125
67 3300005333 Ga0070677_10102463 Ga0070677_101024632 125
68 3300005333 Ga0070677_10938540 Ga0070677_109385401 125
69 3300005334 Ga0068869_100672086 Ga0068869_1006720861 125
70 3300005334 Ga0068869_100682944 Ga0068869_1006829441 125
71 3300005334 Ga0068869_101312662 Ga0068869_1013126621 125
72 3300005337 Ga0070682_100181774 Ga0070682_1001817743 125
73 3300005337 Ga0070682_101095219 Ga0070682_1010952191 125
74 3300005337 Ga0070682_101996772 Ga0070682_1019967721 125
75 3300005337 Ga0070682_102062090 Ga0070682_1020620901 125
76 3300005338 Ga0068868_100118877 Ga0068868_1001188772 125
77 3300005338 Ga0068868_101200705 Ga0068868_1012007052 125
78 3300005338 Ga0068868_101554126 Ga0068868_1015541261 125
79 3300005339 Ga0070660_100106781 Ga0070660_1001067811 125
80 3300005340 Ga0070689_100197354 Ga0070689_1001973543 125
81 3300005340 Ga0070689_100456971 Ga0070689_1004569712 125
82 3300005340 Ga0070689_100805392 Ga0070689_1008053922 125
83 3300005340 Ga0070689_101892379 Ga0070689_1018923792 125
84 3300005343 Ga0070687_100503723 Ga0070687_1005037232 125
85 3300005344 Ga0070661_101086899 Ga0070661_1010868992 125
86 3300005344 Ga0070661_101753018 Ga0070661_1017530181 125
87 3300005345 Ga0070692_10481297 Ga0070692_104812972 125
88 3300005345 Ga0070692_10517558 Ga0070692_105175581 125
89 3300005345 Ga0070692_11402868 Ga0070692_114028681 125
90 3300005353 Ga0070669_100236924 Ga0070669_1002369244 125
91 3300005353 Ga0070669_100399931 Ga0070669_1003999312 125
92 3300005353 Ga0070669_100691635 Ga0070669_1006916351 125
93 3300005353 Ga0070669_100852054 Ga0070669_1008520541 125
94 3300005354 Ga0070675_100098425 Ga0070675_1000984253 125
95 3300005354 Ga0070675_100589660 Ga0070675_1005896601 125
96 3300005354 Ga0070675_100849389 Ga0070675_1008493891 125
97 3300005356 Ga0070674_100584487 Ga0070674_1005844871 125
98 3300005364 Ga0070673_100139381 Ga0070673_1001393812 125
99 3300005365 Ga0070688_100455218 Ga0070688_1004552181 125
100 3300005366 Ga0070659_100004313 Ga0070659_10000431313 125
101 3300005367 Ga0070667_101250206 Ga0070667_1012502061 125
102 3300005441 Ga0070700_100869580 Ga0070700_1008695802 125
103 3300005444 Ga0070694_100747762 Ga0070694_1007477621 125
104 3300005456 Ga0070678_100169113 Ga0070678_1001691132 125
105 3300005457 Ga0070662_100723238 Ga0070662_1007232381 125
106 3300005459 Ga0068867_100422091 Ga0068867_1004220911 125
107 3300005459 Ga0068867_100751649 Ga0068867_1007516491 125
108 3300005459 Ga0068867_101203509 Ga0068867_1012035092 125
109 3300005466 Ga0070685_10190454 Ga0070685_101904541 125
110 3300005466 Ga0070685_10535775 Ga0070685_105357752 125
111 3300005471 Ga0070698_100226337 Ga0070698_1002263372 125
112 3300005530 Ga0070679_100029815 Ga0070679_1000298156 125
113 3300005535 Ga0070684_100251908 Ga0070684_1002519082 125
114 3300005539 Ga0068853_100205382 Ga0068853_1002053822 125
115 3300005539 Ga0068853_100771141 Ga0068853_1007711411 125
116 3300005543 Ga0070672_100147361 Ga0070672_1001473613 125
117 3300005548 Ga0070665_100000442 Ga0070665_10000044231 125
118 3300005548 Ga0070665_100215306 Ga0070665_1002153063 125
119 3300005563 Ga0068855_100071240 Ga0068855_1000712407 125
120 3300005563 Ga0068855_100279474 Ga0068855_1002794742 125
121 3300005563 Ga0068855_100690901 Ga0068855_1006909012 125
122 3300005563 Ga0068855_100922798 Ga0068855_1009227982 125
123 3300005563 Ga0068855_101984854 Ga0068855_1019848542 125
124 3300005564 Ga0070664_100586946 Ga0070664_1005869462 125
125 3300005577 Ga0068857_100062430 Ga0068857_1000624302 125
126 3300005577 Ga0068857_100809874 Ga0068857_1008098741 125
127 3300005577 Ga0068857_102140696 Ga0068857_1021406961 125
128 3300005578 Ga0068854_100877885 Ga0068854_1008778851 125
129 3300005578 Ga0068854_101620838 Ga0068854_1016208381 125
130 3300005614 Ga0068856_100147792 Ga0068856_1001477923 125
131 3300005614 Ga0068856_100340133 Ga0068856_1003401332 125
132 3300005614 Ga0068856_100414628 Ga0068856_1004146283 125
133 3300005614 Ga0068856_101392516 Ga0068856_1013925161 125
134 3300005616 Ga0068852_100113127 Ga0068852_1001131273 125
135 3300005616 Ga0068852_100372550 Ga0068852_1003725502 125
136 3300005616 Ga0068852_100898449 Ga0068852_1008984492 125
137 3300005616 Ga0068852_101144888 Ga0068852_1011448881 125
138 3300005616 Ga0068852_101328805 Ga0068852_1013288052 125
139 3300005617 Ga0068859_100254340 Ga0068859_1002543402 125
140 3300005617 Ga0068859_101280075 Ga0068859_1012800752 125
141 3300005617 Ga0068859_102629967 Ga0068859_1026299672 125
142 3300005618 Ga0068864_100016890 Ga0068864_1000168905 125
143 3300005618 Ga0068864_100610733 Ga0068864_1006107332 125
144 3300005719 Ga0068861_100005628 Ga0068861_1000056287 125
145 3300005719 Ga0068861_100572872 Ga0068861_1005728722 125
146 3300005719 Ga0068861_101591346 Ga0068861_1015913461 125
147 3300005840 Ga0068870_10241879 Ga0068870_102418792 125
148 3300005841 Ga0068863_100288457 Ga0068863_1002884573 125
149 3300005841 Ga0068863_100949786 Ga0068863_1009497862 125
150 3300005842 Ga0068858_101795383 Ga0068858_1017953831 125
151 3300005844 Ga0068862_100264784 Ga0068862_1002647842 125
152 3300006163 Ga0070715_10765109 Ga0070715_107651091 125
153 3300006163 Ga0070715_10877222 Ga0070715_108772221 125
154 3300006195 Ga0075366_10025131 Ga0075366_100251314 125
155 3300006195 Ga0075366_10160154 Ga0075366_101601542 125
156 3300006237 Ga0097621_100015405 Ga0097621_1000154054 125
157 3300006237 Ga0097621_100250778 Ga0097621_1002507782 125
158 3300006237 Ga0097621_101183439 Ga0097621_1011834392 125
159 3300006353 Ga0075370_10041721 Ga0075370_100417214 125
160 3300006358 Ga0068871_100000354 Ga0068871_10000035427 125
161 3300006358 Ga0068871_101258025 Ga0068871_1012580252 125
162 3300006844 Ga0075428_100022554 Ga0075428_1000225547 125
163 3300006844 Ga0075428_100327241 Ga0075428_1003272413 125
164 3300006846 Ga0075430_100102450 Ga0075430_1001024503 125
165 3300006846 Ga0075430_100867684 Ga0075430_1008676842 125
166 3300006847 Ga0075431_101009177 Ga0075431_1010091773 125
167 3300006881 Ga0068865_101004942 Ga0068865_1010049422 125
168 3300006931 Ga0097620_100254354 Ga0097620_1002543542 125
169 3300006931 Ga0097620_101280234 Ga0097620_1012802341 125
170 3300006931 Ga0097620_102629975 Ga0097620_1026299752 125
171 3300009093 Ga0105240_10043033 Ga0105240_100430338 125
172 3300009094 Ga0111539_10001098 Ga0111539_100010984 125
173 3300009094 Ga0111539_10066150 Ga0111539_100661506 125
174 3300009094 Ga0111539_10184231 Ga0111539_101842311 125
175 3300009094 Ga0111539_10587329 Ga0111539_105873293 125
176 3300009094 Ga0111539_11801897 Ga0111539_118018971 125
177 3300009094 Ga0111539_12006044 Ga0111539_120060442 125
178 3300009147 Ga0114129_11333703 Ga0114129_113337031 125
179 3300009148 Ga0105243_11926519 Ga0105243_119265191 125
180 3300009176 Ga0105242_10196886 Ga0105242_101968863 125
181 3300009176 Ga0105242_10541980 Ga0105242_105419803 125
182 3300009176 Ga0105242_11752146 Ga0105242_117521461 125
183 3300009545 Ga0105237_10078649 Ga0105237_100786492 125
184 3300009545 Ga0105237_10126608 Ga0105237_101266084 125
185 3300009545 Ga0105237_10417718 Ga0105237_104177183 125
186 3300009551 Ga0105238_10207266 Ga0105238_102072663 125
187 3300009551 Ga0105238_11801165 Ga0105238_118011651 125
188 3300009553 Ga0105249_10005625 Ga0105249_100056256 125
189 3300009553 Ga0105249_11257557 Ga0105249_112575571 125
190 3300009553 Ga0105249_11533657 Ga0105249_115336572 125
191 3300010375 Ga0105239_10176868 Ga0105239_101768683 125
192 3300010375 Ga0105239_10722488 Ga0105239_107224882 125
193 3300010375 Ga0105239_12227894 Ga0105239_122278941 125
194 3300012483 Ga0157337_1035664 Ga0157337_10356641 125
195 3300012508 Ga0157315_1052551 Ga0157315_10525511 125
196 3300013100 Ga0157373_10059430 Ga0157373_100594302 125
197 3300013100 Ga0157373_10065390 Ga0157373_100653903 125
198 3300013100 Ga0157373_10075797 Ga0157373_100757972 125
199 3300013100 Ga0157373_10161673 Ga0157373_101616732 125
200 3300013102 Ga0157371_10035324 Ga0157371_100353242 125
201 3300013102 Ga0157371_10407032 Ga0157371_104070323 125
202 3300013102 Ga0157371_10491410 Ga0157371_104914102 125
203 3300013102 Ga0157371_10586614 Ga0157371_105866142 125
204 3300013102 Ga0157371_10610722 Ga0157371_106107222 125
205 3300013102 Ga0157371_10766457 Ga0157371_107664572 125
206 3300013104 Ga0157370_10054126 Ga0157370_100541265 125
207 3300013104 Ga0157370_10085830 Ga0157370_100858304 125
208 3300013104 Ga0157370_10209209 Ga0157370_102092093 125
209 3300013104 Ga0157370_10217664 Ga0157370_102176644 125
210 3300013104 Ga0157370_10476306 Ga0157370_104763062 125
211 3300013104 Ga0157370_10749305 Ga0157370_107493052 125
212 3300013104 Ga0157370_11101024 Ga0157370_111010241 125
213 3300013104 Ga0157370_11918181 Ga0157370_119181811 125
214 3300013105 Ga0157369_10062018 Ga0157369_100620186 125
215 3300013105 Ga0157369_10235969 Ga0157369_102359692 125
216 3300013105 Ga0157369_10292053 Ga0157369_102920531 125
217 3300013105 Ga0157369_10340301 Ga0157369_103403012 125
218 3300013105 Ga0157369_10408180 Ga0157369_104081802 125
219 3300013105 Ga0157369_11515515 Ga0157369_115155151 125
220 3300013105 Ga0157369_11822901 Ga0157369_118229011 125
221 3300013296 Ga0157374_10103611 Ga0157374_101036114 125
222 3300013296 Ga0157374_10320265 Ga0157374_103202652 125
223 3300013296 Ga0157374_10395088 Ga0157374_103950882 125
224 3300013296 Ga0157374_11848062 Ga0157374_118480621 125
225 3300013297 Ga0157378_10515618 Ga0157378_105156181 125
226 3300013306 Ga0163162_10000525 Ga0163162_1000052514 125
227 3300013306 Ga0163162_10004198 Ga0163162_1000419811 125
228 3300013306 Ga0163162_10272120 Ga0163162_102721204 125
229 3300013306 Ga0163162_10752406 Ga0163162_107524062 125
230 3300013307 Ga0157372_10000332 Ga0157372_1000033212 125
231 3300013307 Ga0157372_10033754 Ga0157372_100337545 125
232 3300013307 Ga0157372_10052106 Ga0157372_100521064 125
233 3300013307 Ga0157372_10124074 Ga0157372_101240744 125
234 3300013307 Ga0157372_10217417 Ga0157372_102174171 125
235 3300013307 Ga0157372_10417423 Ga0157372_104174231 125
236 3300013307 Ga0157372_11136247 Ga0157372_111362472 125
237 3300013307 Ga0157372_11235425 Ga0157372_112354252 125
238 3300013308 Ga0157375_10174959 Ga0157375_101749592 125
239 3300013308 Ga0157375_11000068 Ga0157375_110000682 125
240 3300014325 Ga0163163_10812204 Ga0163163_108122041 125
241 3300014325 Ga0163163_11617325 Ga0163163_116173251 125
242 3300014325 Ga0163163_13033058 Ga0163163_130330581 125
243 3300014326 Ga0157380_10231312 Ga0157380_102313123 125
244 3300014326 Ga0157380_10816156 Ga0157380_108161564 125
245 3300014745 Ga0157377_10445935 Ga0157377_104459352 125
246 3300014745 Ga0157377_11187804 Ga0157377_111878041 125
247 3300014745 Ga0157377_11213655 Ga0157377_112136552 125
248 3300014968 Ga0157379_10078252 Ga0157379_100782525 125
249 3300014968 Ga0157379_10604201 Ga0157379_106042012 125
250 3300014968 Ga0157379_10648015 Ga0157379_106480153 125
251 3300014968 Ga0157379_11096619 Ga0157379_110966192 125
252 3300014969 Ga0157376_10018195 Ga0157376_100181952 125
253 3300014969 Ga0157376_10076734 Ga0157376_100767343 125
254 3300014969 Ga0157376_10630720 Ga0157376_106307201 125
255 3300014969 Ga0157376_10669329 Ga0157376_106693292 125
256 3300017792 Ga0163161_10031164 Ga0163161_100311645 125
257 3300017792 Ga0163161_10997712 Ga0163161_109977121 125
258 3300017792 Ga0163161_11060844 Ga0163161_110608441 125
259 3300020070 Ga0206356_10977936 Ga0206356_109779362 125
260 3300020070 Ga0206356_11894588 Ga0206356_118945882 125
261 3300020076 Ga0206355_1245730 Ga0206355_12457301 125
262 3300020077 Ga0206351_10875467 Ga0206351_108754672 125
263 3300020078 Ga0206352_10531954 Ga0206352_105319542 125
264 3300020078 Ga0206352_10833769 Ga0206352_108337692 125
265 3300020081 Ga0206354_10045676 Ga0206354_100456761 125
266 3300020081 Ga0206354_10659544 Ga0206354_106595441 125
267 3300020081 Ga0206354_10881077 Ga0206354_108810772 125
268 3300021384 Ga0213876_10044608 Ga0213876_100446083 125
269 3300022467 Ga0224712_10000155 Ga0224712_100001555 125
270 3300025271 Ga0207666_1015241 Ga0207666_10152412 125
271 3300025272 Ga0209455_1001884 Ga0209455_100188418 125
272 3300025292 Ga0209676_1000332 Ga0209676_100033257 125
273 3300025298 Ga0209050_1002964 Ga0209050_100296417 125
274 3300025298 Ga0209050_1033615 Ga0209050_10336152 125
275 3300025298 Ga0209050_1046505 Ga0209050_10465053 125
276 3300025302 Ga0207426_1099924 Ga0207426_10999241 125
277 3300025304 Ga0209257_1000007 Ga0209257_1000007318 125
278 3300025304 Ga0209257_1012184 Ga0209257_10121842 125
279 3300025315 Ga0207697_10026925 Ga0207697_100269253 125
280 3300025893 Ga0207682_10066073 Ga0207682_100660732 125
281 3300025893 Ga0207682_10075858 Ga0207682_100758582 125
282 3300025901 Ga0207688_10887863 Ga0207688_108878631 125
283 3300025904 Ga0207647_10000054 Ga0207647_1000005413 125
284 3300025904 Ga0207647_10019623 Ga0207647_100196237 125
285 3300025907 Ga0207645_10035476 Ga0207645_100354764 125
286 3300025908 Ga0207643_10005441 Ga0207643_100054415 125
287 3300025910 Ga0207684_11040652 Ga0207684_110406521 125
288 3300025913 Ga0207695_10005702 Ga0207695_1000570215 125
289 3300025914 Ga0207671_10000030 Ga0207671_1000003055 125
290 3300025914 Ga0207671_10335610 Ga0207671_103356103 125
291 3300025914 Ga0207671_10437008 Ga0207671_104370082 125
292 3300025917 Ga0207660_10885820 Ga0207660_108858201 125
293 3300025918 Ga0207662_10030041 Ga0207662_100300413 125
294 3300025918 Ga0207662_10917504 Ga0207662_109175041 125
295 3300025920 Ga0207649_10906369 Ga0207649_109063692 125
296 3300025921 Ga0207652_10059424 Ga0207652_100594242 125
297 3300025921 Ga0207652_11015828 Ga0207652_110158282 125
298 3300025922 Ga0207646_10734576 Ga0207646_107345761 125
299 3300025923 Ga0207681_10185717 Ga0207681_101857174 125
300 3300025923 Ga0207681_11017919 Ga0207681_110179192 125
301 3300025923 Ga0207681_11187502 Ga0207681_111875021 125
302 3300025924 Ga0207694_10175224 Ga0207694_101752244 125
303 3300025925 Ga0207650_10325652 Ga0207650_103256522 125
304 3300025925 Ga0207650_11114176 Ga0207650_111141761 125
305 3300025925 Ga0207650_11790085 Ga0207650_117900851 125
306 3300025931 Ga0207644_10264422 Ga0207644_102644222 125
307 3300025932 Ga0207690_10003583 Ga0207690_1000358310 125
308 3300025934 Ga0207686_10292818 Ga0207686_102928183 125
309 3300025936 Ga0207670_10032455 Ga0207670_100324556 125
310 3300025936 Ga0207670_10698976 Ga0207670_106989762 125
311 3300025937 Ga0207669_11178282 Ga0207669_111782821 125
312 3300025938 Ga0207704_10327458 Ga0207704_103274582 125
313 3300025940 Ga0207691_10036749 Ga0207691_100367495 125
314 3300025940 Ga0207691_10477200 Ga0207691_104772002 125
315 3300025942 Ga0207689_10008845 Ga0207689_100088451 125
316 3300025942 Ga0207689_10643383 Ga0207689_106433831 125
317 3300025942 Ga0207689_10770109 Ga0207689_107701091 125
318 3300025944 Ga0207661_10064144 Ga0207661_100641444 125
319 3300025944 Ga0207661_10073534 Ga0207661_100735344 125
320 3300025944 Ga0207661_11118965 Ga0207661_111189652 125
321 3300025945 Ga0207679_10437629 Ga0207679_104376291 125
322 3300025945 Ga0207679_11086121 Ga0207679_110861211 125
323 3300025945 Ga0207679_11510420 Ga0207679_115104202 125
324 3300025949 Ga0207667_10163214 Ga0207667_101632144 125
325 3300025949 Ga0207667_10265903 Ga0207667_102659032 125
326 3300025949 Ga0207667_10379268 Ga0207667_103792682 125
327 3300025960 Ga0207651_10363737 Ga0207651_103637372 125
328 3300025961 Ga0207712_10035246 Ga0207712_100352463 125
329 3300025961 Ga0207712_10294118 Ga0207712_102941182 125
330 3300025972 Ga0207668_11180269 Ga0207668_111802691 125
331 3300025972 Ga0207668_11900150 Ga0207668_119001501 125
332 3300025981 Ga0207640_10371855 Ga0207640_103718552 125
333 3300025981 Ga0207640_11470767 Ga0207640_114707671 125
334 3300025981 Ga0207640_11472386 Ga0207640_114723861 125
335 3300026023 Ga0207677_10140375 Ga0207677_101403753 125
336 3300026023 Ga0207677_10483948 Ga0207677_104839481 125
337 3300026023 Ga0207677_11143544 Ga0207677_111435441 125
338 3300026035 Ga0207703_11270456 Ga0207703_112704562 125
339 3300026035 Ga0207703_11292834 Ga0207703_112928341 125
340 3300026041 Ga0207639_10486623 Ga0207639_104866232 125
341 3300026041 Ga0207639_10537802 Ga0207639_105378022 125
342 3300026041 Ga0207639_10771704 Ga0207639_107717043 125
343 3300026041 Ga0207639_11085442 Ga0207639_110854421 125
344 3300026067 Ga0207678_10089854 Ga0207678_100898544 125
345 3300026067 Ga0207678_10125218 Ga0207678_101252182 125
346 3300026075 Ga0207708_10085358 Ga0207708_100853582 125
347 3300026075 Ga0207708_11156814 Ga0207708_111568141 125
348 3300026078 Ga0207702_10068465 Ga0207702_100684653 125
349 3300026078 Ga0207702_10217569 Ga0207702_102175693 125
350 3300026078 Ga0207702_10318830 Ga0207702_103188302 125
351 3300026078 Ga0207702_11601103 Ga0207702_116011031 125
352 3300026078 Ga0207702_11973600 Ga0207702_119736001 125
353 3300026088 Ga0207641_11393968 Ga0207641_113939681 125
354 3300026088 Ga0207641_11467465 Ga0207641_114674652 125
355 3300026089 Ga0207648_10077148 Ga0207648_100771484 125
356 3300026089 Ga0207648_10636761 Ga0207648_106367612 125
357 3300026089 Ga0207648_10662195 Ga0207648_106621952 125
358 3300026089 Ga0207648_10787707 Ga0207648_107877072 125
359 3300026095 Ga0207676_10561767 Ga0207676_105617672 125
360 3300026095 Ga0207676_10905614 Ga0207676_109056141 125
361 3300026116 Ga0207674_10071461 Ga0207674_100714614 125
362 3300026116 Ga0207674_10084524 Ga0207674_100845244 125
363 3300026116 Ga0207674_10090260 Ga0207674_100902602 125
364 3300026116 Ga0207674_10560319 Ga0207674_105603192 125
365 3300026116 Ga0207674_10857040 Ga0207674_108570403 125
366 3300026118 Ga0207675_100515504 Ga0207675_1005155042 125
367 3300026118 Ga0207675_101921344 Ga0207675_1019213441 125
368 3300026121 Ga0207683_11340189 Ga0207683_113401891 125
369 3300026142 Ga0207698_10163778 Ga0207698_101637782 125
370 3300026142 Ga0207698_10254961 Ga0207698_102549612 125
371 3300026142 Ga0207698_10545686 Ga0207698_105456862 125
372 3300026142 Ga0207698_11312354 Ga0207698_113123541 125
373 3300027471 Ga0209995_1014936 Ga0209995_10149362 125
374 3300027614 Ga0209970_1022004 Ga0209970_10220042 125
375 3300027907 Ga0207428_10019856 Ga0207428_100198563 125
376 3300027907 Ga0207428_10823469 Ga0207428_108234692 125
377 3300028379 Ga0268266_10000845 Ga0268266_100008459 125
378 3300028380 Ga0268265_10470075 Ga0268265_104700752 125
379 3300028380 Ga0268265_11101547 Ga0268265_111015472 125
380 3300028381 Ga0268264_10006248 Ga0268264_1000624813 125
381 3300028573 Ga0265334_10025950 Ga0265334_100259504 125
382 3300028794 Ga0307515_10000009 Ga0307515_10000009379 125
383 3300028794 Ga0307515_10112100 Ga0307515_101121005 125
384 3300028794 Ga0307515_10713857 Ga0307515_107138571 125
385 3300028800 Ga0265338_10357708 Ga0265338_103577082 125
386 3300029957 Ga0265324_10081379 Ga0265324_100813791 125
387 3300031241 Ga0265325_10462389 Ga0265325_104623891 125
388 3300031251 Ga0265327_10000026 Ga0265327_10000026244 125
389 3300031251 Ga0265327_10000146 Ga0265327_1000014686 125
390 3300031251 Ga0265327_10000370 Ga0265327_1000037054 125
391 3300031251 Ga0265327_10004316 Ga0265327_1000431612 125
392 3300031251 Ga0265327_10090034 Ga0265327_100900342 125
393 3300031251 Ga0265327_10117506 Ga0265327_101175064 125
394 3300031251 Ga0265327_10141793 Ga0265327_101417932 125
395 3300031251 Ga0265327_10145841 Ga0265327_101458413 125
396 3300031344 Ga0265316_10363451 Ga0265316_103634512 125
397 3300031456 Ga0307513_10045434 Ga0307513_100454342 125
398 3300031456 Ga0307513_10045488 Ga0307513_100454885 125
399 3300031507 Ga0307509_10104738 Ga0307509_101047382 125
400 3300031507 Ga0307509_10368690 Ga0307509_103686903 125
401 3300031548 Ga0307408_100133847 Ga0307408_1001338474 125
402 3300031548 Ga0307408_100349403 Ga0307408_1003494033 125
403 3300031548 Ga0307408_100682910 Ga0307408_1006829102 125
404 3300031548 Ga0307408_100817856 Ga0307408_1008178561 125
405 3300031649 Ga0307514_10233533 Ga0307514_102335332 125
406 3300031691 Ga0316579_10126698 Ga0316579_101266982 125
407 3300031712 Ga0265342_10069939 Ga0265342_100699394 125
408 3300031727 Ga0316576_10001081 Ga0316576_1000108126 125
409 3300031727 Ga0316576_10017698 Ga0316576_100176984 125
410 3300031727 Ga0316576_10018128 Ga0316576_100181284 125
411 3300031727 Ga0316576_10021761 Ga0316576_100217614 125
412 3300031727 Ga0316576_10027616 Ga0316576_100276166 125
413 3300031727 Ga0316576_10032421 Ga0316576_100324216 125
414 3300031727 Ga0316576_10039513 Ga0316576_100395135 125
415 3300031727 Ga0316576_10048308 Ga0316576_100483084 125
416 3300031727 Ga0316576_10109448 Ga0316576_101094484 125
417 3300031727 Ga0316576_10146107 Ga0316576_101461072 125
418 3300031727 Ga0316576_10152932 Ga0316576_101529321 125
419 3300031727 Ga0316576_10332258 Ga0316576_103322584 125
420 3300031727 Ga0316576_10754560 Ga0316576_107545601 125
421 3300031728 Ga0316578_10004394 Ga0316578_100043944 125
422 3300031728 Ga0316578_10023848 Ga0316578_100238481 125
423 3300031728 Ga0316578_10042897 Ga0316578_100428974 125
424 3300031728 Ga0316578_10081543 Ga0316578_100815434 125
425 3300031728 Ga0316578_10312557 Ga0316578_103125573 125
426 3300031731 Ga0307405_10015203 Ga0307405_100152036 125
427 3300031733 Ga0316577_10022920 Ga0316577_100229204 125
428 3300031824 Ga0307413_10577032 Ga0307413_105770322 125
429 3300031852 Ga0307410_10235600 Ga0307410_102356001 125
430 3300031852 Ga0307410_10701487 Ga0307410_107014872 125
431 3300031901 Ga0307406_10857065 Ga0307406_108570651 125
432 3300031903 Ga0307407_10024117 Ga0307407_100241174 125
433 3300031911 Ga0307412_10925627 Ga0307412_109256271 125
434 3300031911 Ga0307412_11489309 Ga0307412_114893092 125
435 3300031995 Ga0307409_100169562 Ga0307409_1001695622 125
436 3300031995 Ga0307409_102713699 Ga0307409_1027136991 125
437 3300031995 Ga0307409_102865106 Ga0307409_1028651061 125
438 3300032002 Ga0307416_100000249 Ga0307416_1000002498 125
439 3300032002 Ga0307416_100904686 Ga0307416_1009046862 125
440 3300032002 Ga0307416_100938564 Ga0307416_1009385641 125
441 3300032002 Ga0307416_101115206 Ga0307416_1011152061 125
442 3300032004 Ga0307414_10014085 Ga0307414_100140852 125
443 3300032004 Ga0307414_10168572 Ga0307414_101685723 125
444 3300032004 Ga0307414_10281684 Ga0307414_102816843 125
445 3300032004 Ga0307414_10531834 Ga0307414_105318342 125
446 3300032005 Ga0307411_10496548 Ga0307411_104965483 125
447 3300032126 Ga0307415_100002166 Ga0307415_10000216613 125
448 3300032126 Ga0307415_100439468 Ga0307415_1004394683 125
449 3300032126 Ga0307415_100560677 Ga0307415_1005606773 125
450 3300032137 Ga0316585_10053022 Ga0316585_100530223 125
451 3300032139 Ga0316580_10031872 Ga0316580_100318721 125
452 3300032168 Ga0316593_10003954 Ga0316593_100039545 125
453 3300032168 Ga0316593_10040978 Ga0316593_100409784 125
454 3300032168 Ga0316593_10094169 Ga0316593_100941692 125
455 3300032168 Ga0316593_10165963 Ga0316593_101659631 125
456 3300032168 Ga0316593_10191908 Ga0316593_101919082 125
457 3300032168 Ga0316593_10284069 Ga0316593_102840691 125
458 3300033524 Ga0316592_1000945 Ga0316592_10009454 125
459 3300033524 Ga0316592_1014787 Ga0316592_10147872 125
460 3300033524 Ga0316592_1064916 Ga0316592_10649162 125
461 3300033524 Ga0316592_1078447 Ga0316592_10784472 125
462 3300033527 Ga0316586_1108850 Ga0316586_11088502 125
463 3300033528 Ga0316588_1028900 Ga0316588_10289002 125
464 3300033528 Ga0316588_1049774 Ga0316588_10497743 125
465 3300033528 Ga0316588_1103022 Ga0316588_11030222 125
466 3300033541 Ga0316596_1000575 Ga0316596_10005758 125
467 3300033541 Ga0316596_1002512 Ga0316596_10025124 125
468 3300033541 Ga0316596_1003747 Ga0316596_10037472 125
469 3300033541 Ga0316596_1003898 Ga0316596_10038985 125
470 3300033541 Ga0316596_1004236 Ga0316596_10042367 125
471 3300033541 Ga0316596_1007610 Ga0316596_10076104 125
472 3300033541 Ga0316596_1015736 Ga0316596_10157364 125
473 3300033541 Ga0316596_1031647 Ga0316596_10316473 125
474 3300033541 Ga0316596_1037945 Ga0316596_10379452 125
475 3300033541 Ga0316596_1052248 Ga0316596_10522482 125
476 3300033541 Ga0316596_1086653 Ga0316596_10866531 125
477 3300033541 Ga0316596_1131683 Ga0316596_11316832 125
478 3300033541 Ga0316596_1155611 Ga0316596_11556112 125
479 3300033541 Ga0316596_1178508 Ga0316596_11785082 125
480 3300033541 Ga0316596_1216739 Ga0316596_12167391 125
481 3300033541 Ga0316596_1230401 Ga0316596_12304011 125
482 3300033541 Ga0316596_1246828 Ga0316596_12468281 125
483 3300035114 Ga0373939_0155015 Ga0373939_0155015_445_825 125
484 3300035117 Ga0373953_0213853 Ga0373953_0213853_379_759 125
485 3300035171 Ga0373946_0450082 Ga0373946_0450082_88_468 125
486 3300035172 Ga0373955_0173310 Ga0373955_0173310_493_873 125
487 3300035172 Ga0373955_0398680 Ga0373955_0398680_420_800 125
488 3300035398 Ga0316574_0027184 Ga0316574_0027184_1328_1705 125
489 3300035398 Ga0316574_0070134 Ga0316574_0070134_1631_2008 125
490 3300035398 Ga0316574_0879146 Ga0316574_0879146_35_412 125
491 3300035691 Ga0373931_0120868 Ga0373931_0120868_533_913 125
492 3300035691 Ga0373931_1163690 Ga0373931_1163690_112_492 125
493 3300035692 Ga0373935_0060159 Ga0373935_0060159_1962_2342 125
494 3300035695 Ga0373927_0079676 Ga0373927_0079676_643_1023 125
495 3300036401 Ga0373937_0037881 Ga0373937_0037881_2858_3238 125
496 3300036401 Ga0373937_0568783 Ga0373937_0568783_610_990 125
497 3300036401 Ga0373937_1744908 Ga0373937_1744908_101_481 125
498 3300036401 Ga0373937_1862027 Ga0373937_1862027_40_420 125
499 3300036647 Ga0316582_0014930 Ga0316582_0014930_3082_3459 125
500 3300036647 Ga0316582_0063175 Ga0316582_0063175_1682_2059 125
501 3300036647 Ga0316582_0345011 Ga0316582_0345011_120_497 125
502 3300036647 Ga0316582_0384732 Ga0316582_0384732_360_737 125
503 3300036647 Ga0316582_0402713 Ga0316582_0402713_101_478 125
504 3300036647 Ga0316582_0474089 Ga0316582_0474089_79_456 125
505 3300036712 Ga0316584_0005378 Ga0316584_0005378_5298_5675 125
506 3300036712 Ga0316584_0007005 Ga0316584_0007005_2315_2692 125
507 3300036712 Ga0316584_0021141 Ga0316584_0021141_251_628 125
508 3300036712 Ga0316584_0087726 Ga0316584_0087726_1749_2126 125
509 3300036712 Ga0316584_0228188 Ga0316584_0228188_587_964 125
510 3300036712 Ga0316584_0284516 Ga0316584_0284516_16_393 125
511 3300036712 Ga0316584_0333907 Ga0316584_0333907_306_683 125
512 3300036712 Ga0316584_0469360 Ga0316584_0469360_318_695 125
513 3300036712 Ga0316584_0762991 Ga0316584_0762991_78_458 125
514 3300037312 Ga0395899_0172428 Ga0395899_0172428_759_1136 125
515 3300037312 Ga0395899_0437442 Ga0395899_0437442_211_588 125
516 3300037418 Ga0395900_0009171 Ga0395900_0009171_2151_2531 125
517 3300037418 Ga0395900_0208359 Ga0395900_0208359_1186_1563 125
518 3300037471 Ga0395905_0000001 Ga0395905_0000001_263652_264029 125
519 3300037471 Ga0395905_0006283 Ga0395905_0006283_2875_3255 125
520 3300037471 Ga0395905_0277254 Ga0395905_0277254_600_980 125
521 3300037471 Ga0395905_0607028 Ga0395905_0607028_471_851 125
522 3300038443 Ga0395901_0000654 Ga0395901_0000654_27172_27549 125
523 3300038443 Ga0395901_0003122 Ga0395901_0003122_1677_2054 125
524 3300039062 Ga0400483_035362 Ga0400483_035362_11989_12366 125
525 3300039093 Ga0400489_18980 Ga0400489_18980_35_412 125
526 3300039437 Ga0436365_0305539 Ga0436365_0305539_1021_1401 125
527 3300039437 Ga0436365_0676798 Ga0436365_0676798_57_437 125
528 3300039437 Ga0436365_0968552 Ga0436365_0968552_126_506 125
529 3300039437 Ga0436365_1194723 Ga0436365_1194723_1663_2043 125
530 3300039450 Ga0436363_0513489 Ga0436363_0513489_30_410 125
531 3300041413 Ga0439465_0094319 Ga0439465_0094319_233_613 125
532 3300041413 Ga0439465_0289974 Ga0439465_0289974_123_503 125
533 3300041441 Ga0451787_079098 Ga0451787_079098_150_527 125
534 3300041443 Ga0451789_1092803 Ga0451789_1092803_111_491 125
535 3300041444 Ga0451790_13840 Ga0451790_13840_210_590 125
536 3300041444 Ga0451790_41939 Ga0451790_41939_168_545 125
537 3300041444 Ga0451790_47771 Ga0451790_47771_70_450 125
538 3300041446 Ga0451794_03323 Ga0451794_03323_94_474 125
539 3300041446 Ga0451794_06250 Ga0451794_06250_127_507 125
540 3300041451 Ga0451791_0115989 Ga0451791_0115989_197_577 125
541 3300041452 Ga0451793_0885796 Ga0451793_0885796_124_504 125
542 3300041452 Ga0451793_1886256 Ga0451793_1886256_403_783 125
543 3300041453 Ga0451797_1262852 Ga0451797_1262852_47_427 125
544 3300041456 Ga0451795_0000788 Ga0451795_0000788_733_1113 125
545 3300041456 Ga0451795_0069802 Ga0451795_0069802_74_454 125
546 3300041456 Ga0451795_0271097 Ga0451795_0271097_386_763 125
547 3300041456 Ga0451795_0389135 Ga0451795_0389135_106_486 125
548 3300041456 Ga0451795_0817895 Ga0451795_0817895_886_1266 125
549 3300041456 Ga0451795_1033178 Ga0451795_1033178_58_438 125
550 3300041456 Ga0451795_1256897 Ga0451795_1256897_306_686 125
551 3300041458 Ga0451798_0431874 Ga0451798_0431874_16_396 125
552 3300041459 Ga0451800_0749243 Ga0451800_0749243_278_658 125
553 3300041460 Ga0451802_0357152 Ga0451802_0357152_349_729 125
554 3300041460 Ga0451802_2183209 Ga0451802_2183209_124_504 125
555 3300041463 Ga0451804_0982978 Ga0451804_0982978_55_435 125
556 3300041486 Ga0451807_1052428 Ga0451807_1052428_99_479 125
557 3300041486 Ga0451807_1974311 Ga0451807_1974311_167_547 125
558 3300041491 Ga0451833_0948996 Ga0451833_0948996_187_567 125
559 3300041494 Ga0451837_0557409 Ga0451837_0557409_189_569 125
560 3300041494 Ga0451837_0757746 Ga0451837_0757746_195_572 125
561 3300041498 Ga0451841_0481137 Ga0451841_0481137_198_575 125
562 3300041502 Ga0451846_24529 Ga0451846_24529_22_402 125
563 3300041503 Ga0451847_0304467 Ga0451847_0304467_185_562 125
564 3300041507 Ga0451851_0610101 Ga0451851_0610101_177_557 125
565 3300041507 Ga0451851_1332631 Ga0451851_1332631_16_396 125
566 3300041508 Ga0451852_09946 Ga0451852_09946_157_537 125
567 3300041508 Ga0451852_13332 Ga0451852_13332_2659_3039 125
568 3300041508 Ga0451852_38882 Ga0451852_38882_303_683 125
569 3300041511 Ga0451855_0171797 Ga0451855_0171797_18_398 125
570 3300041511 Ga0451855_0427028 Ga0451855_0427028_147_527 125
571 3300041511 Ga0451855_0484682 Ga0451855_0484682_449_826 125
572 3300041511 Ga0451855_0497909 Ga0451855_0497909_981_1358 125
573 3300041511 Ga0451855_0824732 Ga0451855_0824732_443_823 125
574 3300041511 Ga0451855_0918148 Ga0451855_0918148_94_471 125
575 3300041511 Ga0451855_1038422 Ga0451855_1038422_251_631 125
576 3300041511 Ga0451855_1240003 Ga0451855_1240003_615_992 125
577 3300041511 Ga0451855_1928680 Ga0451855_1928680_27_407 125
578 3300041512 Ga0451853_0182524 Ga0451853_0182524_260_640 125
579 3300041512 Ga0451853_3993765 Ga0451853_3993765_32_412 125
580 3300041997 Ga0439431_0118691 Ga0439431_0118691_274_654 125
581 3300042001 Ga0439441_030480 Ga0439441_030480_363_743 125
582 3300042004 Ga0439445_0003220 Ga0439445_0003220_2693_3073 125
583 3300042007 Ga0439449_0002213 Ga0439449_0002213_6303_6683 125
584 3300042007 Ga0439449_0067389 Ga0439449_0067389_691_1068 125
585 3300042015 Ga0439462_0257479 Ga0439462_0257479_68_448 125
586 3300042127 Ga0450890_042374 Ga0450890_042374_210_590 125
587 3300042156 Ga0439446_0167257 Ga0439446_0167257_322_702 125
588 3300042157 Ga0439458_0210270 Ga0439458_0210270_16_396 125
589 3300042435 Ga0439434_0110484 Ga0439434_0110484_324_704 125
590 3300042437 Ga0439444_0062706 Ga0439444_0062706_218_598 125
591 3300042532 Ga0450893_0001114 Ga0450893_0001114_2635_3015 125
592 3300042876 Ga0451577_0000092 Ga0451577_0000092_140947_141324 125
593 3300042876 Ga0451577_0000433 Ga0451577_0000433_65785_66162 125
594 3300042876 Ga0451577_0000690 Ga0451577_0000690_4569_4946 125
595 3300042876 Ga0451577_0005144 Ga0451577_0005144_5429_5806 125
596 3300042876 Ga0451577_0009644 Ga0451577_0009644_25_402 125
597 3300042876 Ga0451577_0022022 Ga0451577_0022022_2056_2433 125
598 3300042876 Ga0451577_0023389 Ga0451577_0023389_1312_1689 125
599 3300042876 Ga0451577_0024955 Ga0451577_0024955_2825_3202 125
600 3300042876 Ga0451577_0025303 Ga0451577_0025303_106_483 125
601 3300042876 Ga0451577_0026335 Ga0451577_0026335_4402_4782 125
602 3300042876 Ga0451577_0047949 Ga0451577_0047949_73_450 125
603 3300042876 Ga0451577_0107299 Ga0451577_0107299_1044_1421 125
604 3300042876 Ga0451577_0179508 Ga0451577_0179508_1430_1810 125
605 3300042876 Ga0451577_0258725 Ga0451577_0258725_1098_1475 125
606 3300042876 Ga0451577_0262956 Ga0451577_0262956_570_950 125
607 3300042876 Ga0451577_0350301 Ga0451577_0350301_534_914 125
608 3300042876 Ga0451577_0389652 Ga0451577_0389652_808_1185 125
609 3300042876 Ga0451577_0476389 Ga0451577_0476389_14_391 125
610 3300042876 Ga0451577_0480707 Ga0451577_0480707_234_611 125
611 3300042876 Ga0451577_0812103 Ga0451577_0812103_170_547 125
612 3300042876 Ga0451577_0931162 Ga0451577_0931162_263_643 125
613 3300042876 Ga0451577_1253466 Ga0451577_1253466_198_575 125
614 3300042876 Ga0451577_1631566 Ga0451577_1631566_148_525 125
615 3300044658 Ga0466972_0276976 Ga0466972_0276976_350_730 125
616 3300044673 Ga0453683_0000055 Ga0453683_0000055_66996_67373 125
617 3300044673 Ga0453683_0000066 Ga0453683_0000066_164397_164774 125
618 3300044673 Ga0453683_0000522 Ga0453683_0000522_18307_18684 125
619 3300044673 Ga0453683_0005928 Ga0453683_0005928_8025_8402 125
620 3300044673 Ga0453683_0006727 Ga0453683_0006727_2168_2545 125
621 3300044673 Ga0453683_0010256 Ga0453683_0010256_3946_4323 125
622 3300044673 Ga0453683_0015630 Ga0453683_0015630_2218_2598 125
623 3300044673 Ga0453683_0019499 Ga0453683_0019499_947_1324 125
624 3300044673 Ga0453683_0044943 Ga0453683_0044943_125_505 125
625 3300044673 Ga0453683_0099173 Ga0453683_0099173_1095_1472 125
626 3300044673 Ga0453683_0114221 Ga0453683_0114221_153_533 125
627 3300044673 Ga0453683_0118753 Ga0453683_0118753_1028_1405 125
628 3300044673 Ga0453683_0138833 Ga0453683_0138833_13_390 125
629 3300044673 Ga0453683_0139064 Ga0453683_0139064_579_956 125
630 3300044673 Ga0453683_0162196 Ga0453683_0162196_924_1301 125
631 3300044673 Ga0453683_0215687 Ga0453683_0215687_385_762 125
632 3300044673 Ga0453683_0216051 Ga0453683_0216051_15_392 125
633 3300044673 Ga0453683_0336710 Ga0453683_0336710_392_772 125
634 3300044712 Ga0453684_0000440 Ga0453684_0000440_96648_97025 125
635 3300044712 Ga0453684_0000506 Ga0453684_0000506_10820_11197 125
636 3300044712 Ga0453684_0001121 Ga0453684_0001121_46080_46457 125
637 3300044712 Ga0453684_0001193 Ga0453684_0001193_62169_62546 125
638 3300044712 Ga0453684_0001382 Ga0453684_0001382_10731_11108 125
639 3300044712 Ga0453684_0001549 Ga0453684_0001549_42327_42704 125
640 3300044712 Ga0453684_0002895 Ga0453684_0002895_4755_5132 125
641 3300044712 Ga0453684_0004492 Ga0453684_0004492_3100_3477 125
642 3300044712 Ga0453684_0012002 Ga0453684_0012002_11755_12132 125
643 3300044712 Ga0453684_0012437 Ga0453684_0012437_8768_9145 125
644 3300044712 Ga0453684_0012544 Ga0453684_0012544_6828_7208 125
645 3300044712 Ga0453684_0012598 Ga0453684_0012598_7937_8314 125
646 3300044712 Ga0453684_0024288 Ga0453684_0024288_4861_5238 125
647 3300044712 Ga0453684_0035092 Ga0453684_0035092_1329_1706 125
648 3300044712 Ga0453684_0049674 Ga0453684_0049674_2561_2938 125
649 3300044712 Ga0453684_0057385 Ga0453684_0057385_188_565 125
650 3300044712 Ga0453684_0064505 Ga0453684_0064505_2142_2519 125
651 3300044712 Ga0453684_0076172 Ga0453684_0076172_3025_3402 125
652 3300044712 Ga0453684_0104626 Ga0453684_0104626_2728_3108 125
653 3300044712 Ga0453684_0122847 Ga0453684_0122847_2524_2901 125
654 3300044712 Ga0453684_0133450 Ga0453684_0133450_739_1119 125
655 3300044712 Ga0453684_0143337 Ga0453684_0143337_214_591 125
656 3300044712 Ga0453684_0145941 Ga0453684_0145941_1912_2289 125
657 3300044712 Ga0453684_0200799 Ga0453684_0200799_722_1102 125
658 3300044712 Ga0453684_0213872 Ga0453684_0213872_1126_1503 125
659 3300044712 Ga0453684_0267728 Ga0453684_0267728_1124_1501 125
660 3300044712 Ga0453684_0322460 Ga0453684_0322460_352_729 125
661 3300044712 Ga0453684_0385184 Ga0453684_0385184_525_902 125
662 3300044712 Ga0453684_0431129 Ga0453684_0431129_367_744 125
663 3300044712 Ga0453684_0494236 Ga0453684_0494236_436_813 125
664 3300044712 Ga0453684_0577897 Ga0453684_0577897_505_882 125
665 3300044712 Ga0453684_0601526 Ga0453684_0601526_33_410 125
666 3300044712 Ga0453684_0719378 Ga0453684_0719378_650_1027 125
667 3300044712 Ga0453684_0897059 Ga0453684_0897059_198_578 125
668 3300044712 Ga0453684_0992680 Ga0453684_0992680_362_739 125
669 3300044712 Ga0453684_1318108 Ga0453684_1318108_73_450 125
670 3300044712 Ga0453684_1428135 Ga0453684_1428135_140_517 125
671 3300044712 Ga0453684_1815219 Ga0453684_1815219_196_573 125
672 3300044842 Ga0466957_0664174 Ga0466957_0664174_52_432 125
673 3300045051 Ga0451576_0000113 Ga0451576_0000113_181728_182105 125
674 3300045051 Ga0451576_0000204 Ga0451576_0000204_140947_141324 125
675 3300045051 Ga0451576_0000689 Ga0451576_0000689_4741_5118 125
676 3300045051 Ga0451576_0000783 Ga0451576_0000783_15_392 125
677 3300045051 Ga0451576_0003461 Ga0451576_0003461_7183_7560 125
678 3300045051 Ga0451576_0003652 Ga0451576_0003652_4055_4432 125
679 3300045051 Ga0451576_0011102 Ga0451576_0011102_6518_6895 125
680 3300045051 Ga0451576_0012395 Ga0451576_0012395_4933_5313 125
681 3300045051 Ga0451576_0013908 Ga0451576_0013908_5632_6009 125
682 3300045051 Ga0451576_0047592 Ga0451576_0047592_3054_3434 125
683 3300045051 Ga0451576_0083654 Ga0451576_0083654_15_392 125
684 3300045051 Ga0451576_0088919 Ga0451576_0088919_1036_1413 125
685 3300045051 Ga0451576_0121529 Ga0451576_0121529_788_1165 125
686 3300045051 Ga0451576_0124949 Ga0451576_0124949_363_740 125
687 3300045051 Ga0451576_0133725 Ga0451576_0133725_433_813 125
688 3300045051 Ga0451576_0165783 Ga0451576_0165783_1104_1484 125
689 3300045051 Ga0451576_0176056 Ga0451576_0176056_194_571 125
690 3300045051 Ga0451576_0277421 Ga0451576_0277421_780_1157 125
691 3300045051 Ga0451576_0291923 Ga0451576_0291923_607_984 125
692 3300045051 Ga0451576_0374307 Ga0451576_0374307_56_436 125
693 3300045051 Ga0451576_0848375 Ga0451576_0848375_24_404 125
694 3300045051 Ga0451576_0937455 Ga0451576_0937455_423_800 125
695 3300045051 Ga0451576_0996934 Ga0451576_0996934_439_816 125
696 3300045051 Ga0451576_1432327 Ga0451576_1432327_289_666 125
697 3300045051 Ga0451576_1466520 Ga0451576_1466520_205_582 125
698 3300045051 Ga0451576_1772569 Ga0451576_1772569_232_609 125
699 3300046454 Ga0495592_0841048 Ga0495592_0841048_47_427 125
700 3300046460 Ga0495638_0000040 Ga0495638_0000040_127373_127753 125
701 3300046472 Ga0495580_0138723 Ga0495580_0138723_31_411 125
702 3300046475 Ga0495639_0292676 Ga0495639_0292676_192_572 125
703 3300046476 Ga0495662_0337290 Ga0495662_0337290_128_508 125
704 3300046477 Ga0495664_0720892 Ga0495664_0720892_173_553 125
705 3300046511 Ga0495608_0369474 Ga0495608_0369474_202_582 125
706 3300046514 Ga0495618_0449267 Ga0495618_0449267_351_731 125
707 3300046516 Ga0495628_0963096 Ga0495628_0963096_133_513 125
708 3300046517 Ga0495630_0252558 Ga0495630_0252558_652_1032 125
709 3300046535 Ga0495586_0205973 Ga0495586_0205973_485_865 125
710 3300046535 Ga0495586_0641382 Ga0495586_0641382_210_590 125
711 3300046543 Ga0495645_0077970 Ga0495645_0077970_1223_1603 125
712 3300046660 Ga0495625_0719846 Ga0495625_0719846_75_455 125
713 3300046664 Ga0495659_0354380 Ga0495659_0354380_138_518 125
714 3300046665 Ga0495661_0107289 Ga0495661_0107289_525_902 125
715 3300046674 Ga0495588_0196215 Ga0495588_0196215_385_765 125
716 3300046674 Ga0495588_0386751 Ga0495588_0386751_247_627 125
717 3300046675 Ga0495657_0227691 Ga0495657_0227691_700_1080 125
718 3300046680 Ga0495646_0348904 Ga0495646_0348904_99_479 125
719 3300046683 Ga0495658_0714549 Ga0495658_0714549_155_535 125
720 3300046691 Ga0495670_0002356 Ga0495670_0002356_4918_5298 125
721 3300046691 Ga0495670_0242597 Ga0495670_0242597_382_762 125
722 3300046691 Ga0495670_0353582 Ga0495670_0353582_256_633 125
723 3300046694 Ga0495649_0152895 Ga0495649_0152895_176_556 125
724 3300046809 Ga0495600_0686773 Ga0495600_0686773_58_438 125
725 3300047315 Ga0495581_0823918 Ga0495581_0823918_44_424 125
726 3300047318 Ga0495636_0000049 Ga0495636_0000049_31459_31839 125
727 3300047318 Ga0495636_0396842 Ga0495636_0396842_222_602 125
728 3300047319 Ga0495674_0504313 Ga0495674_0504313_354_734 125
729 3300047445 Ga0495677_0280987 Ga0495677_0280987_50_430 125
730 3300047445 Ga0495677_0445352 Ga0495677_0445352_85_465 125
731 3300048090 Ga0495615_0157670 Ga0495615_0157670_138_518 125
732 3300048908 Ga0496105_0895376 Ga0496105_0895376_33_413 125
733 3300048917 Ga0496114_0165201 Ga0496114_0165201_170_550 125
734 3300048917 Ga0496114_0836726 Ga0496114_0836726_334_714 125
735 3300048918 Ga0496115_0213459 Ga0496115_0213459_127_507 125
736 3300048918 Ga0496115_1277852 Ga0496115_1277852_55_435 125
737 3300048925 Ga0496122_0443410 Ga0496122_0443410_168_545 125
738 3300049127 Ga0501306_000044 Ga0501306_000044_2656_3036 125
739 3300049127 Ga0501306_000698 Ga0501306_000698_490_870 125
740 3300049127 Ga0501306_004708 Ga0501306_004708_554_931 125
741 3300049127 Ga0501306_037461 Ga0501306_037461_228_605 125
742 3300049127 Ga0501306_048747 Ga0501306_048747_141_521 125
743 3300049127 Ga0501306_049046 Ga0501306_049046_155_532 125
744 3300049127 Ga0501306_054487 Ga0501306_054487_163_543 125
745 3300049128 Ga0501308_000036 Ga0501308_000036_3615_3995 125
746 3300049128 Ga0501308_001435 Ga0501308_001435_1301_1678 125
747 3300049128 Ga0501308_011162 Ga0501308_011162_144_521 125
748 3300049128 Ga0501308_019380 Ga0501308_019380_292_672 125
749 3300049128 Ga0501308_028121 Ga0501308_028121_59_436 125
750 3300049128 Ga0501308_028905 Ga0501308_028905_230_610 125
751 3300049128 Ga0501308_029073 Ga0501308_029073_188_565 125
752 3300049128 Ga0501308_060046 Ga0501308_060046_166_546 125
753 3300049129 Ga0501309_000005 Ga0501309_000005_8103_8483 125
754 3300049129 Ga0501309_000848 Ga0501309_000848_1677_2057 125
755 3300049129 Ga0501309_001731 Ga0501309_001731_1193_1570 125
756 3300049129 Ga0501309_007200 Ga0501309_007200_901_1281 125
757 3300049129 Ga0501309_036750 Ga0501309_036750_182_562 125
758 3300049129 Ga0501309_054456 Ga0501309_054456_237_617 125
759 3300049129 Ga0501309_073816 Ga0501309_073816_48_425 125
760 3300049130 Ga0501310_001746 Ga0501310_001746_1150_1530 125
761 3300049130 Ga0501310_003848 Ga0501310_003848_572_949 125
762 3300049130 Ga0501310_004031 Ga0501310_004031_226_606 125
763 3300049130 Ga0501310_006036 Ga0501310_006036_231_608 125
764 3300049130 Ga0501310_023135 Ga0501310_023135_241_621 125
765 3300049130 Ga0501310_081016 Ga0501310_081016_99_479 125
766 3300049131 Ga0501341_08052 Ga0501341_08052_129_506 125
767 3300049132 Ga0501343_001105 Ga0501343_001105_1030_1410 125
768 3300049132 Ga0501343_001931 Ga0501343_001931_620_997 125
769 3300049132 Ga0501343_002495 Ga0501343_002495_373_750 125
770 3300049160 Ga0501304_000029 Ga0501304_000029_3575_3955 125
771 3300049160 Ga0501304_002473 Ga0501304_002473_543_920 125
772 3300049160 Ga0501304_010524 Ga0501304_010524_167_544 125
773 3300049161 Ga0501305_000041 Ga0501305_000041_3013_3393 125
774 3300049161 Ga0501305_000239 Ga0501305_000239_1145_1525 125
775 3300049161 Ga0501305_004857 Ga0501305_004857_451_831 125
776 3300049161 Ga0501305_008405 Ga0501305_008405_205_582 125
777 3300049161 Ga0501305_014049 Ga0501305_014049_56_433 125
778 3300049161 Ga0501305_017070 Ga0501305_017070_405_785 125
779 3300049161 Ga0501305_019261 Ga0501305_019261_255_635 125
780 3300049161 Ga0501305_041091 Ga0501305_041091_209_589 125
781 3300049161 Ga0501305_051691 Ga0501305_051691_293_673 125
782 3300049162 Ga0501307_000237 Ga0501307_000237_1628_2008 125
783 3300049162 Ga0501307_001795 Ga0501307_001795_876_1253 125
784 3300049162 Ga0501307_006763 Ga0501307_006763_425_805 125
785 3300049162 Ga0501307_024105 Ga0501307_024105_267_644 125
786 3300049162 Ga0501307_030240 Ga0501307_030240_223_600 125
787 3300049162 Ga0501307_037960 Ga0501307_037960_25_405 125
788 3300049162 Ga0501307_050062 Ga0501307_050062_234_614 125
789 3300049162 Ga0501307_075905 Ga0501307_075905_42_422 125
790 3300049519 Ga0501296_064433 Ga0501296_064433_96_476 125
791 3300049521 Ga0501298_036258 Ga0501298_036258_148_525 125
792 3300049526 Ga0501303_026218 Ga0501303_026218_130_510 125
793 3300049527 Ga0501311_002954 Ga0501311_002954_524_904 125
794 3300049527 Ga0501311_004120 Ga0501311_004120_648_1025 125
795 3300049527 Ga0501311_008889 Ga0501311_008889_576_953 125
796 3300049527 Ga0501311_010378 Ga0501311_010378_241_618 125
797 3300049527 Ga0501311_037809 Ga0501311_037809_161_541 125
798 3300049528 Ga0501312_000008 Ga0501312_000008_3016_3396 125
799 3300049528 Ga0501312_000783 Ga0501312_000783_2041_2421 125
800 3300049528 Ga0501312_002894 Ga0501312_002894_1040_1417 125
801 3300049528 Ga0501312_032285 Ga0501312_032285_149_529 125
802 3300049528 Ga0501312_036971 Ga0501312_036971_303_683 125
803 3300049528 Ga0501312_039745 Ga0501312_039745_84_464 125
804 3300049528 Ga0501312_044814 Ga0501312_044814_167_544 125
805 3300049528 Ga0501312_073382 Ga0501312_073382_189_569 125
806 3300049528 Ga0501312_077700 Ga0501312_077700_169_549 125
807 3300049528 Ga0501312_097565 Ga0501312_097565_43_423 125
808 3300049528 Ga0501312_103276 Ga0501312_103276_106_486 125
809 3300049528 Ga0501312_116958 Ga0501312_116958_32_412 125
810 3300049529 Ga0501313_000046 Ga0501313_000046_3519_3899 125
811 3300049529 Ga0501313_001256 Ga0501313_001256_189_569 125
812 3300049529 Ga0501313_007305 Ga0501313_007305_672_1049 125
813 3300049529 Ga0501313_017356 Ga0501313_017356_384_764 125
814 3300049529 Ga0501313_025790 Ga0501313_025790_168_548 125
815 3300049529 Ga0501313_028145 Ga0501313_028145_195_575 125
816 3300049530 Ga0501314_000536 Ga0501314_000536_1414_1794 125
817 3300049530 Ga0501314_005375 Ga0501314_005375_87_464 125
818 3300049530 Ga0501314_008115 Ga0501314_008115_167_544 125
819 3300049530 Ga0501314_021975 Ga0501314_021975_267_647 125
820 3300049531 Ga0501315_000039 Ga0501315_000039_1199_1579 125
821 3300049531 Ga0501315_000148 Ga0501315_000148_1434_1814 125
822 3300049531 Ga0501315_004361 Ga0501315_004361_467_844 125
823 3300049531 Ga0501315_004396 Ga0501315_004396_499_879 125
824 3300049531 Ga0501315_005480 Ga0501315_005480_167_544 125
825 3300049531 Ga0501315_022209 Ga0501315_022209_141_518 125
826 3300049531 Ga0501315_035949 Ga0501315_035949_168_548 125
827 3300049531 Ga0501315_038649 Ga0501315_038649_83_463 125
828 3300049531 Ga0501315_061908 Ga0501315_061908_165_545 125
829 3300049531 Ga0501315_067059 Ga0501315_067059_196_576 125
830 3300049531 Ga0501315_077734 Ga0501315_077734_70_450 125
831 3300049531 Ga0501315_091022 Ga0501315_091022_138_515 125
832 3300049532 Ga0501316_001307 Ga0501316_001307_743_1123 125
833 3300049532 Ga0501316_003657 Ga0501316_003657_81_461 125
834 3300049532 Ga0501316_005326 Ga0501316_005326_236_616 125
835 3300049532 Ga0501316_008595 Ga0501316_008595_690_1067 125
836 3300049532 Ga0501316_016604 Ga0501316_016604_333_713 125
837 3300049532 Ga0501316_047169 Ga0501316_047169_174_554 125
838 3300049532 Ga0501316_049777 Ga0501316_049777_190_570 125
839 3300049533 Ga0501317_001819 Ga0501317_001819_1175_1555 125
840 3300049533 Ga0501317_004254 Ga0501317_004254_760_1137 125
841 3300049533 Ga0501317_006292 Ga0501317_006292_894_1274 125
842 3300049533 Ga0501317_045213 Ga0501317_045213_133_510 125
843 3300049533 Ga0501317_049914 Ga0501317_049914_167_544 125
844 3300049534 Ga0501318_059368 Ga0501318_059368_167_544 125
845 3300049535 Ga0501319_011072 Ga0501319_011072_185_562 125
846 3300049536 Ga0501320_000271 Ga0501320_000271_1626_2006 125
847 3300049536 Ga0501320_001656 Ga0501320_001656_492_869 125
848 3300049536 Ga0501320_007328 Ga0501320_007328_582_959 125
849 3300049536 Ga0501320_012555 Ga0501320_012555_390_770 125
850 3300049536 Ga0501320_023233 Ga0501320_023233_13_390 125
851 3300049536 Ga0501320_025490 Ga0501320_025490_148_528 125
852 3300049536 Ga0501320_027114 Ga0501320_027114_170_547 125
853 3300049536 Ga0501320_060048 Ga0501320_060048_64_441 125
854 3300049537 Ga0501321_001022 Ga0501321_001022_453_833 125
855 3300049537 Ga0501321_012051 Ga0501321_012051_80_457 125
856 3300049537 Ga0501321_051689 Ga0501321_051689_51_431 125
857 3300049538 Ga0501322_022094 Ga0501322_022094_135_515 125
858 3300049539 Ga0501323_000022 Ga0501323_000022_1845_2225 125
859 3300049539 Ga0501323_000041 Ga0501323_000041_3030_3410 125
860 3300049539 Ga0501323_002898 Ga0501323_002898_170_547 125
861 3300049539 Ga0501323_034152 Ga0501323_034152_159_536 125
862 3300049539 Ga0501323_037123 Ga0501323_037123_135_515 125
863 3300049540 Ga0501324_001820 Ga0501324_001820_451_828 125
864 3300049540 Ga0501324_007058 Ga0501324_007058_301_678 125
865 3300049540 Ga0501324_033942 Ga0501324_033942_29_409 125
866 3300049541 Ga0501325_000253 Ga0501325_000253_1806_2183 125
867 3300049541 Ga0501325_001123 Ga0501325_001123_158_538 125
868 3300049541 Ga0501325_019707 Ga0501325_019707_14_394 125
869 3300049541 Ga0501325_035921 Ga0501325_035921_83_463 125
870 3300049542 Ga0501326_00213 Ga0501326_00213_188_565 125
871 3300049542 Ga0501326_08315 Ga0501326_08315_186_563 125
872 3300049543 Ga0501327_02818 Ga0501327_02818_82_459 125
873 3300049544 Ga0501328_00317 Ga0501328_00317_851_1231 125
874 3300049545 Ga0501329_00473 Ga0501329_00473_851_1231 125
875 3300049547 Ga0501331_01387 Ga0501331_01387_529_906 125
876 3300049550 Ga0501334_14375 Ga0501334_14375_101_481 125
877 3300049551 Ga0501335_003359 Ga0501335_003359_908_1285 125
878 3300049551 Ga0501335_017583 Ga0501335_017583_265_645 125
879 3300049551 Ga0501335_023649 Ga0501335_023649_27_404 125
880 3300049552 Ga0501336_000198 Ga0501336_000198_97_474 125
881 3300049552 Ga0501336_002156 Ga0501336_002156_341_718 125
882 3300049552 Ga0501336_009102 Ga0501336_009102_261_638 125
883 3300049553 Ga0501337_015435 Ga0501337_015435_167_544 125
884 3300049554 Ga0501338_04356 Ga0501338_04356_321_701 125
885 3300049556 Ga0501340_002246 Ga0501340_002246_610_987 125
886 3300049568 Ga0501031_0026756 Ga0501031_0026756_2164_2541 125
887 3300049569 Ga0501032_0007271 Ga0501032_0007271_3859_4236 125
888 3300049569 Ga0501032_0030328 Ga0501032_0030328_1545_1925 125
889 3300049569 Ga0501032_0048968 Ga0501032_0048968_1277_1654 125
890 3300049570 Ga0501033_0000011 Ga0501033_0000011_49145_49522 125
891 3300049571 Ga0501034_0001265 Ga0501034_0001265_5247_5624 125
892 3300049571 Ga0501034_0019142 Ga0501034_0019142_1814_2194 125
893 3300049571 Ga0501034_0036199 Ga0501034_0036199_3422_3802 125
894 3300049571 Ga0501034_0178660 Ga0501034_0178660_1301_1678 125
895 3300049572 Ga0501036_0014424 Ga0501036_0014424_4715_5095 125
896 3300049572 Ga0501036_0019659 Ga0501036_0019659_3791_4168 125
897 3300049573 Ga0501037_0013217 Ga0501037_0013217_1271_1648 125
898 3300049573 Ga0501037_0249427 Ga0501037_0249427_222_602 125
899 3300049574 Ga0501038_0002395 Ga0501038_0002395_4642_5019 125
900 3300049574 Ga0501038_0028118 Ga0501038_0028118_2241_2621 125
901 3300049574 Ga0501038_0075723 Ga0501038_0075723_1178_1555 125
902 3300049575 Ga0501039_0012686 Ga0501039_0012686_2774_3154 125
903 3300049575 Ga0501039_0023075 Ga0501039_0023075_1312_1689 125
904 3300049575 Ga0501039_0263075 Ga0501039_0263075_859_1239 125
905 3300049578 Ga0501042_0210143 Ga0501042_0210143_333_713 125
906 3300049578 Ga0501042_0503317 Ga0501042_0503317_403_783 125
907 3300049579 Ga0501043_0021084 Ga0501043_0021084_3506_3886 125
908 3300049579 Ga0501043_0024223 Ga0501043_0024223_656_1033 125
909 3300049579 Ga0501043_0040531 Ga0501043_0040531_2738_3118 125
910 3300049579 Ga0501043_0183873 Ga0501043_0183873_533_913 125
911 3300049580 Ga0501046_0099565 Ga0501046_0099565_527_907 125
912 3300049580 Ga0501046_0150637 Ga0501046_0150637_899_1279 125
913 3300049581 Ga0501047_0036558 Ga0501047_0036558_2607_2987 125
914 3300049581 Ga0501047_0288271 Ga0501047_0288271_28_408 125
915 3300049582 Ga0501048_0015730 Ga0501048_0015730_2315_2695 125
916 3300049583 Ga0501067_0006402 Ga0501067_0006402_3745_4125 125
917 3300049583 Ga0501067_0009218 Ga0501067_0009218_1588_1968 125
918 3300049584 Ga0501068_0014823 Ga0501068_0014823_1448_1828 125
919 3300049584 Ga0501068_0052122 Ga0501068_0052122_61_441 125
920 3300049585 Ga0501069_0015284 Ga0501069_0015284_386_766 125
921 3300049586 Ga0501070_0036727 Ga0501070_0036727_336_716 125
922 3300049586 Ga0501070_0078325 Ga0501070_0078325_537_917 125
923 3300049586 Ga0501070_0092295 Ga0501070_0092295_126_503 125
924 3300049587 Ga0501071_0060047 Ga0501071_0060047_1982_2362 125
925 3300049588 Ga0501072_0260586 Ga0501072_0260586_519_899 125
926 3300049589 Ga0501073_0008802 Ga0501073_0008802_2166_2546 125
927 3300049589 Ga0501073_0011829 Ga0501073_0011829_3587_3967 125
928 3300049589 Ga0501073_0322131 Ga0501073_0322131_531_911 125
929 3300049590 Ga0501074_0019774 Ga0501074_0019774_1025_1405 125
930 3300049650 Ga0501199_036884 Ga0501199_036884_225_605 125
931 3300049652 Ga0501202_044391 Ga0501202_044391_423_803 125
932 3300049657 Ga0501210_015241 Ga0501210_015241_57_437 125
933 3300049662 Ga0501222_037300 Ga0501222_037300_133_513 125
934 3300049669 Ga0501235_015899 Ga0501235_015899_173_553 125
935 3300049669 Ga0501235_110303 Ga0501235_110303_204_581 125
936 3300049670 Ga0501236_000641 Ga0501236_000641_341_721 125
937 3300049671 Ga0501238_004543 Ga0501238_004543_1068_1445 125
938 3300049671 Ga0501238_022494 Ga0501238_022494_496_876 125
939 3300049674 Ga0501242_003494 Ga0501242_003494_605_985 125
940 3300049674 Ga0501242_073008 Ga0501242_073008_120_500 125
941 3300049677 Ga0501247_000354 Ga0501247_000354_2612_2992 125
942 3300049679 Ga0501249_005609 Ga0501249_005609_1294_1671 125
943 3300049683 Ga0501253_082739 Ga0501253_082739_247_627 125
944 3300049686 Ga0501257_000897 Ga0501257_000897_2785_3165 125
945 3300049686 Ga0501257_020542 Ga0501257_020542_273_653 125
946 3300049686 Ga0501257_145355 Ga0501257_145355_85_465 125
947 3300049686 Ga0501257_272815 Ga0501257_272815_37_417 125
948 3300049688 Ga0501259_033220 Ga0501259_033220_316_693 125
949 3300049690 Ga0501261_033831 Ga0501261_033831_351_728 125
950 3300049705 Ga0501225_0012695 Ga0501225_0012695_1692_2069 125
951 3300049705 Ga0501225_0047951 Ga0501225_0047951_569_949 125
952 3300049705 Ga0501225_0082868 Ga0501225_0082868_102_479 125
953 3300049705 Ga0501225_0227145 Ga0501225_0227145_122_499 125
954 3300049705 Ga0501225_0261741 Ga0501225_0261741_75_452 125
955 3300049741 Ga0501079_0053196 Ga0501079_0053196_865_1245 125
956 3300049741 Ga0501079_0097817 Ga0501079_0097817_1606_1986 125
957 3300049742 Ga0501080_0074958 Ga0501080_0074958_396_776 125
958 3300049742 Ga0501080_0286986 Ga0501080_0286986_896_1276 125
959 3300049742 Ga0501080_0440282 Ga0501080_0440282_531_911 125
960 3300049742 Ga0501080_0492962 Ga0501080_0492962_274_654 125
961 3300049744 Ga0501083_0014034 Ga0501083_0014034_3514_3894 125
962 3300049744 Ga0501083_0062854 Ga0501083_0062854_518_898 125
963 3300049761 Ga0501264_003325 Ga0501264_003325_29_409 125
964 3300049761 Ga0501264_014282 Ga0501264_014282_228_608 125
965 3300049767 Ga0501270_028395 Ga0501270_028395_199_576 125
966 3300049822 Ga0501035_0004622 Ga0501035_0004622_6745_7122 125
967 3300049822 Ga0501035_0019838 Ga0501035_0019838_3367_3747 125
968 3300049822 Ga0501035_0776913 Ga0501035_0776913_322_702 125
969 3300049823 Ga0501044_0003551 Ga0501044_0003551_13975_14355 125
970 3300049823 Ga0501044_0023913 Ga0501044_0023913_5241_5618 125
971 3300049823 Ga0501044_0097266 Ga0501044_0097266_884_1264 125
972 3300049823 Ga0501044_0514802 Ga0501044_0514802_443_823 125
973 3300049824 Ga0501045_0000053 Ga0501045_0000053_5379_5756 125
974 3300049824 Ga0501045_1051520 Ga0501045_1051520_115_495 125
975 3300049850 Ga0501204_016306 Ga0501204_016306_260_640 125
976 3300049853 Ga0501226_015397 Ga0501226_015397_259_639 125
977 3300050493 nmdc:mga0k408_198900_c1 nmdc:mga0k408_198900_c1_403_783 125
978 3300050493 nmdc:mga0k408_57809_c2 nmdc:mga0k408_57809_c2_880_1260 125
979 3300050493 nmdc:mga0k408_693703_c1 nmdc:mga0k408_693703_c1_162_542 125
980 3300050496 nmdc:mga07m45_126657_c1 nmdc:mga07m45_126657_c1_544_921 125
981 3300050496 nmdc:mga07m45_89113_c1 nmdc:mga07m45_89113_c1_1096_1476 125
982 3300050507 nmdc:mga05p37_1510320_c1 nmdc:mga05p37_1510320_c1_49_429 125
983 3300050509 nmdc:mga0qj67_114691_c1 nmdc:mga0qj67_114691_c1_1320_1700 125
984 3300050509 nmdc:mga0qj67_1383749_c1 nmdc:mga0qj67_1383749_c1_38_418 125
985 3300050511 nmdc:mga08y16_19020_c1 nmdc:mga08y16_19020_c1_4525_4905 125
986 3300050511 nmdc:mga08y16_21751_c1 nmdc:mga08y16_21751_c1_2492_2872 125
987 3300050511 nmdc:mga08y16_267433_c1 nmdc:mga08y16_267433_c1_796_1176 125
988 3300050511 nmdc:mga08y16_283195_c1 nmdc:mga08y16_283195_c1_1235_1615 125
989 3300050511 nmdc:mga08y16_836450_c1 nmdc:mga08y16_836450_c1_115_495 125
990 3300050515 nmdc:mga0a205_923548_c1 nmdc:mga0a205_923548_c1_122_502 125
991 3300053086 Ga0500578_0086448 Ga0500578_0086448_610_987 125
992 3300053088 Ga0500644_0304785 Ga0500644_0304785_275_655 125
993 3300053090 Ga0500646_0190358 Ga0500646_0190358_278_658 125
994 3300053104 Ga0500556_0058888 Ga0500556_0058888_60_440 125
995 3300053133 Ga0500655_007182 Ga0500655_007182_1304_1684 125
996 3300053134 Ga0500658_0385412 Ga0500658_0385412_24_401 125
997 3300053140 Ga0500573_0037721 Ga0500573_0037721_557_934 125
998 3300053142 Ga0500577_0247767 Ga0500577_0247767_375_755 125
999 3300053151 Ga0500604_0010471 Ga0500604_0010471_1304_1684 125
1000 3300053151 Ga0500604_0245055 Ga0500604_0245055_85_465 125
1001 3300053153 Ga0500616_0000013 Ga0500616_0000013_184869_185249 125
1002 3300053153 Ga0500616_0032309 Ga0500616_0032309_1335_1715 125
1003 3300053153 Ga0500616_0036710 Ga0500616_0036710_821_1201 125
1004 3300053156 Ga0500622_0000416 Ga0500622_0000416_37020_37400 125
1005 3300053156 Ga0500622_0000433 Ga0500622_0000433_3204_3584 125
1006 3300053156 Ga0500622_0017657 Ga0500622_0017657_2261_2641 125
1007 3300053156 Ga0500622_0027590 Ga0500622_0027590_572_952 125
1008 3300053730 Ga0500645_134453 Ga0500645_134453_77_457 125
1009 3300054114 Ga0501084_0024661 Ga0501084_0024661_3030_3410 125
1010 3300054114 Ga0501084_0071249 Ga0501084_0071249_296_676 125
1011 3300055283 Ga0500661_007999 Ga0500661_007999_833_1213 125
1012 3300059491 Ga0587070_000157 Ga0587070_000157_1850_2227 125
1013 3300059491 Ga0587070_085573 Ga0587070_085573_257_637 125
1014 3300059493 Ga0587077_000755 Ga0587077_000755_86_463 125
1015 3300059493 Ga0587077_147639 Ga0587077_147639_44_421 125
1016 3300059493 Ga0587077_166700 Ga0587077_166700_167_544 125
1017 3300059505 Ga0587083_0013391 Ga0587083_0013391_60_440 125
1018 3300059505 Ga0587083_0127591 Ga0587083_0127591_212_592 125
1019 3300059506 Ga0587085_013261 Ga0587085_013261_628_1005 125
1020 3300059508 Ga0587088_011252 Ga0587088_011252_156_536 125
1021 3300059510 Ga0587090_014198 Ga0587090_014198_167_544 125
1022 3300059510 Ga0587090_144679 Ga0587090_144679_81_461 125
1023 3300059512 Ga0587092_008459 Ga0587092_008459_340_720 125
1024 3300059512 Ga0587092_142144 Ga0587092_142144_136_516 125
1025 3300059513 Ga0587094_097366 Ga0587094_097366_110_490 125
1026 3300059513 Ga0587094_117389 Ga0587094_117389_87_467 125
1027 3300059624 Ga0587109_014349 Ga0587109_014349_53_433 125
1028 3300059624 Ga0587109_180781 Ga0587109_180781_93_473 125
1029 3300059626 Ga0587115_106058 Ga0587115_106058_28_405 125
1030 3300059627 Ga0587117_003203 Ga0587117_003203_978_1355 125
1031 3300059627 Ga0587117_051852 Ga0587117_051852_78_455 125
1032 3300059630 Ga0587128_076086 Ga0587128_076086_122_499 125
1033 3300059639 Ga0587062_000132 Ga0587062_000132_2271_2648 125
1034 3300059639 Ga0587062_007071 Ga0587062_007071_167_544 125
1035 3300059640 Ga0587067_067187 Ga0587067_067187_291_671 125
1036 3300059641 Ga0587068_000547 Ga0587068_000547_1384_1761 125
1037 3300059641 Ga0587068_042947 Ga0587068_042947_110_490 125
1038 3300059641 Ga0587068_060734 Ga0587068_060734_140_520 125
1039 3300059641 Ga0587068_173251 Ga0587068_173251_42_422 125
1040 3300059642 Ga0587069_002452 Ga0587069_002452_437_817 125
1041 3300059643 Ga0587072_014962 Ga0587072_014962_177_554 125
1042 3300059644 Ga0587075_109458 Ga0587075_109458_98_478 125
1043 3300059645 Ga0587076_003883 Ga0587076_003883_1056_1436 125
1044 3300059645 Ga0587076_016950 Ga0587076_016950_167_544 125
1045 3300059645 Ga0587076_063331 Ga0587076_063331_64_444 125
1046 3300059647 Ga0587079_243368 Ga0587079_243368_50_430 125
1047 3300059653 Ga0587108_016180 Ga0587108_016180_167_544 125
1048 3300059660 Ga0587124_018699 Ga0587124_018699_167_544 125
1049 3300060244 Ga0587061_00333 Ga0587061_00333_62_439 125
1050 3300060246 Ga0587081_05693 Ga0587081_05693_167_544 125
1051 3300060346 Ga0587111_0000249 Ga0587111_0000249_2217_2594 125
1052 3300060346 Ga0587111_0061165 Ga0587111_0061165_418_798 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

19

125

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rbd-assembly1.cif.gz_S state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles 0.9451 2 62
4gc5-assembly1.cif.gz_A crystal structure of murine tfb1m 0.9339 28 61
6zqf-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) 0.9311 1 65
3twk-assembly3.cif.gz_B crystal structure of arabidopsis thaliana fpg 0.9267 11 60
6zqg-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-c 0.9208 1 62
ID Description Score Start End Superfamily
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9943 1 70 1.10.8.50
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9906 1 71 1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9842 2 61 1.10.8.50
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9793 2 61 1.10.8.50
af_Q8HCP0_1_71_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9781 1 70 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A3D5QEL1-F1-model_v4 30S ribosomal protein S13 1 1 76 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A357ZFG2-F1-model_v4 30S ribosomal protein S13 0.9965 1 77 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A833G026-F1-model_v4 30S ribosomal protein S13 0.9964 1 75 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A1Q6SSA2-F1-model_v4 30S ribosomal protein S13 0.9947 1 77 GO:0000049
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A4Q3GYA9-F1-model_v4 deleted 0.9941 1 75

Feature Viewer

pLDDT pTM Quality
77.99 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map