F489094
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1052 | 457 | 2104 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300025292|Ga0209676_1000959|Ga0209676_100095917 |
| Length | 380 |
| Sequence | MSEPLLITGYEHVCEKSDVSGLINCLAPKRRVKCRSPRFARGSTMNQSFDIAVIGATGTVGETLVQILEERDFPIANLHLLASSESAGHSVPFRGKNVRVREVDEFDFSKVQLAFFAAGPAVTLSFAPRATAANCAVIDLSGALPSAQAPNLVPEANERVLAGLKKPVQLSSPSAAATSLAVVLAPLQALFEIQRVNLTASLAVSTQGREAVTELARQTAELLNARPLEPRFFDRQMAFNLLAQVGTPDEHGHTLLEKRLVRELREVLAQPLLKISVTCVQAPVFFGDSYSVTLQSATAIDLDAVNAALEAAPGIELVEAGDYPTAVGDAVGQDVVYVGRVRGGIDDPAELNLWLTSDNVRKGAALNAVQLAELLIKDLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 30 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 31 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 32 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 33 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 34 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 83 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 85 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 88 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 89 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 90 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 91 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 92 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 94 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 95 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 96 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 97 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 98 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 99 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 100 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 101 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 102 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 103 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 104 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 105 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 106 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 107 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 108 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 109 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 110 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 111 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 112 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 113 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 114 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 115 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 116 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 117 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 118 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 119 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 120 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 123 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 206 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 207 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 208 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 209 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 221 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 222 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 223 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 225 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 226 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 227 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 228 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 229 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 230 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 231 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 232 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 233 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 234 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 235 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 236 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 237 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 238 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 239 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 240 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 241 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 242 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 243 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 244 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 245 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 246 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 247 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 248 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 249 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 250 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 251 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 252 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 253 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 254 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 255 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 256 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 257 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 258 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 259 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 260 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 261 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 262 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 263 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 264 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 265 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 266 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 267 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 268 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 269 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 270 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 271 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 272 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 273 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 274 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 275 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 276 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 277 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 278 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 279 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 280 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 281 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 282 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 283 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 284 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 285 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 286 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 287 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 288 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 289 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 290 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 291 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 292 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 293 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 294 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 295 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 296 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 297 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 298 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 299 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 300 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 301 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 302 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 303 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 304 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 305 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 306 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 307 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 308 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 309 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 310 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 311 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 312 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 313 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 314 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 315 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 316 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 317 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 318 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 319 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 320 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 321 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 322 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 323 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 324 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 325 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 326 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 327 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 328 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 329 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 330 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 331 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 332 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 333 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 334 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 335 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 336 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 337 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 338 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 339 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 340 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 341 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 342 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 343 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 344 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 345 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 346 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 347 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 348 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 349 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 350 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 351 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 352 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 353 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 354 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 355 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 356 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 357 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 358 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 359 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 360 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 361 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 362 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 363 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 364 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 365 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 366 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 367 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 368 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 369 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 370 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 371 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 372 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 373 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 374 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 375 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 376 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 377 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 378 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 379 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 380 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 381 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 382 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 383 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 384 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 385 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 386 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 387 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 388 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 389 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 390 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 391 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 392 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 393 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 394 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 395 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 396 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 397 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 398 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 399 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 400 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 401 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 402 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 403 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 404 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 405 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 406 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 407 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 408 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 409 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 410 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 411 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 412 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 413 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 414 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 415 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 416 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 417 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 418 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 419 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 420 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 421 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 422 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 423 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 424 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 425 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 426 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 427 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 428 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 429 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 430 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 431 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 432 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 433 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 434 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 435 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 436 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 437 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 438 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 439 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 440 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 441 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 442 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 443 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 444 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 445 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 446 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 447 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 448 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 449 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 450 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 451 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 452 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 453 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 454 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 455 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 456 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 457 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.85 |
| Metatranscriptomes | 0 |
| Isolates | 22.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.8 |
| Nodule | 2.47 |
| Rhizoplane | 6.94 |
| Rhizosphere | 72.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209676_1000959 | 3300025292 | Bacteria | 34915 |
| 2 | SwRhRL2b_contig_2198927 | 2162886007 | Bacteria | 1514 |
| 3 | SwRhRL2b_contig_391535 | 2162886007 | Bacteria | 2256 |
| 4 | JGI25162J39368_1000824 | 3300002737 | Bacteria | 20443 |
| 5 | JGI25163J39215_1000875 | 3300002771 | Bacteria | 7064 |
| 6 | JGI25163J39215_1000897 | 3300002771 | Bacteria | 6898 |
| 7 | JGI25164J39214_1000456 | 3300002772 | Bacteria | 21062 |
| 8 | JGI25164J39214_1000464 | 3300002772 | Bacteria | 20573 |
| 9 | JGI25165J46597_1000888 | 3300003214 | Bacteria | 21062 |
| 10 | JGI25165J46597_1000906 | 3300003214 | Bacteria | 20573 |
| 11 | Ga0055538_1000093 | 3300003751 | Bacteria | 75896 |
| 12 | Ga0055539_1000138 | 3300003752 | Bacteria | 75896 |
| 13 | Ga0055533_1000142 | 3300003756 | Bacteria | 75896 |
| 14 | Ga0055532_1000152 | 3300003758 | Bacteria | 61495 |
| 15 | Ga0055525_1000342 | 3300003759 | Bacteria | 34036 |
| 16 | Ga0055535_1005444 | 3300003761 | Bacteria | 2788 |
| 17 | Ga0055536_1002321 | 3300003781 | Bacteria | 10765 |
| 18 | Ga0055536_1021517 | 3300003781 | Bacteria | 1954 |
| 19 | Ga0055536_1022172 | 3300003781 | Bacteria | 1904 |
| 20 | Ga0055530_10003078 | 3300003791 | Bacteria | 9915 |
| 21 | Ga0055530_10004122 | 3300003791 | Bacteria | 7713 |
| 22 | Ga0055540_1001801 | 3300003792 | Bacteria | 12179 |
| 23 | Ga0055540_1002628 | 3300003792 | Bacteria | 9324 |
| 24 | Ga0055540_1003748 | 3300003792 | Bacteria | 7184 |
| 25 | Ga0055531_10004937 | 3300003794 | Bacteria | 7931 |
| 26 | Ga0055541_1000091 | 3300003841 | Bacteria | 75896 |
| 27 | Ga0065714_10010949 | 3300005288 | Bacteria | 2523 |
| 28 | Ga0065714_10011409 | 3300005288 | Bacteria | 2115 |
| 29 | Ga0065714_10013394 | 3300005288 | Bacteria | 1892 |
| 30 | Ga0065714_10024810 | 3300005288 | Bacteria | 1166 |
| 31 | Ga0065714_10065334 | 3300005288 | Bacteria | 10809 |
| 32 | Ga0065714_10078549 | 3300005288 | Bacteria | 2589 |
| 33 | Ga0065714_10102247 | 3300005288 | Bacteria | 1626 |
| 34 | Ga0065714_10116954 | 3300005288 | Bacteria | 1394 |
| 35 | Ga0065714_10129798 | 3300005288 | Bacteria | 1261 |
| 36 | Ga0065704_10094931 | 3300005289 | Bacteria | 2516 |
| 37 | Ga0065712_10010845 | 3300005290 | Bacteria | 2474 |
| 38 | Ga0065712_10012266 | 3300005290 | Bacteria | 3001 |
| 39 | Ga0065712_10070056 | 3300005290 | Bacteria | 6368 |
| 40 | Ga0070670_100005617 | 3300005331 | Bacteria | 10584 |
| 41 | Ga0070670_100021712 | 3300005331 | Bacteria | 5520 |
| 42 | Ga0070661_100000961 | 3300005344 | Bacteria | 20513 |
| 43 | Ga0070669_100000904 | 3300005353 | Bacteria | 21597 |
| 44 | Ga0070662_100002124 | 3300005457 | Bacteria | 12146 |
| 45 | Ga0070665_100038532 | 3300005548 | Bacteria | 4805 |
| 46 | Ga0070664_100010006 | 3300005564 | Bacteria | 7686 |
| 47 | Ga0068851_10014826 | 3300005834 | Bacteria | 3707 |
| 48 | Ga0075364_10071685 | 3300006051 | Bacteria | 2282 |
| 49 | Ga0075364_10138861 | 3300006051 | Bacteria | 1633 |
| 50 | Ga0075432_10004969 | 3300006058 | Bacteria | 4534 |
| 51 | Ga0075432_10044344 | 3300006058 | Bacteria | 1559 |
| 52 | Ga0075362_10104722 | 3300006177 | Bacteria | 1326 |
| 53 | Ga0075436_100115975 | 3300006914 | Bacteria | 1871 |
| 54 | Ga0075436_100149651 | 3300006914 | Bacteria | 1642 |
| 55 | Ga0079104_1000375 | 3300006946 | Bacteria | 52652 |
| 56 | Ga0099826_10001328 | 3300006948 | Bacteria | 14629 |
| 57 | Ga0105251_10001251 | 3300009011 | Bacteria | 22007 |
| 58 | Ga0105251_10019667 | 3300009011 | Bacteria | 3561 |
| 59 | Ga0105251_10023608 | 3300009011 | Bacteria | 3170 |
| 60 | Ga0105251_10032414 | 3300009011 | Bacteria | 2604 |
| 61 | Ga0105251_10036841 | 3300009011 | Bacteria | 2404 |
| 62 | Ga0105251_10046794 | 3300009011 | Bacteria | 2081 |
| 63 | Ga0105251_10109388 | 3300009011 | Bacteria | 1260 |
| 64 | Ga0105244_10000709 | 3300009036 | Bacteria | 28850 |
| 65 | Ga0105244_10005465 | 3300009036 | Bacteria | 8445 |
| 66 | Ga0105244_10017555 | 3300009036 | Bacteria | 4040 |
| 67 | Ga0105244_10036386 | 3300009036 | Bacteria | 2579 |
| 68 | Ga0105244_10039151 | 3300009036 | Bacteria | 2469 |
| 69 | Ga0105244_10067870 | 3300009036 | Bacteria | 1783 |
| 70 | Ga0105244_10075941 | 3300009036 | Bacteria | 1669 |
| 71 | Ga0105244_10080984 | 3300009036 | Bacteria | 1607 |
| 72 | Ga0105244_10082295 | 3300009036 | Bacteria | 1592 |
| 73 | Ga0105250_10001909 | 3300009092 | Bacteria | 10814 |
| 74 | Ga0105250_10002486 | 3300009092 | Bacteria | 9247 |
| 75 | Ga0105250_10006952 | 3300009092 | Bacteria | 4896 |
| 76 | Ga0105250_10019711 | 3300009092 | Bacteria | 2727 |
| 77 | Ga0105250_10021777 | 3300009092 | Bacteria | 2586 |
| 78 | Ga0105243_10001321 | 3300009148 | Bacteria | 22100 |
| 79 | Ga0105243_10002510 | 3300009148 | Bacteria | 15315 |
| 80 | Ga0105243_10045098 | 3300009148 | Bacteria | 3463 |
| 81 | Ga0105243_10104937 | 3300009148 | Bacteria | 2353 |
| 82 | Ga0105243_10146696 | 3300009148 | Bacteria | 2019 |
| 83 | Ga0105243_10159491 | 3300009148 | Bacteria | 1944 |
| 84 | Ga0105242_10019163 | 3300009176 | Bacteria | 5360 |
| 85 | Ga0105237_10000335 | 3300009545 | Bacteria | 66335 |
| 86 | Ga0105246_10045141 | 3300011119 | Bacteria | 2999 |
| 87 | Ga0105246_10074065 | 3300011119 | Bacteria | 2406 |
| 88 | Ga0157345_1001267 | 3300012498 | Bacteria | 1788 |
| 89 | Ga0157345_1002153 | 3300012498 | Bacteria | 1385 |
| 90 | Ga0157373_10009179 | 3300013100 | Bacteria | 7314 |
| 91 | Ga0157373_10060199 | 3300013100 | Bacteria | 2690 |
| 92 | Ga0157373_10080681 | 3300013100 | Bacteria | 2294 |
| 93 | Ga0157373_10124741 | 3300013100 | Bacteria | 1811 |
| 94 | Ga0157373_10144747 | 3300013100 | Bacteria | 1671 |
| 95 | Ga0157373_10153025 | 3300013100 | Bacteria | 1622 |
| 96 | Ga0157373_10249403 | 3300013100 | Bacteria | 1255 |
| 97 | Ga0157373_10302776 | 3300013100 | Bacteria | 1135 |
| 98 | Ga0157371_10000406 | 3300013102 | Bacteria | 53786 |
| 99 | Ga0157371_10120923 | 3300013102 | Bacteria | 1862 |
| 100 | Ga0157371_10130430 | 3300013102 | Bacteria | 1788 |
| 101 | Ga0157371_10138029 | 3300013102 | Bacteria | 1737 |
| 102 | Ga0157370_10020721 | 3300013104 | Bacteria | 6561 |
| 103 | Ga0157370_10091733 | 3300013104 | Bacteria | 2852 |
| 104 | Ga0157370_10214766 | 3300013104 | Bacteria | 1782 |
| 105 | Ga0157370_10347389 | 3300013104 | Bacteria | 1367 |
| 106 | Ga0157370_10475684 | 3300013104 | Bacteria | 1148 |
| 107 | Ga0157369_10269111 | 3300013105 | Bacteria | 1776 |
| 108 | Ga0157369_10288243 | 3300013105 | Bacteria | 1709 |
| 109 | Ga0157369_10298840 | 3300013105 | Bacteria | 1675 |
| 110 | Ga0157369_10352523 | 3300013105 | Bacteria | 1528 |
| 111 | Ga0157369_10676826 | 3300013105 | Bacteria | 1063 |
| 112 | Ga0157369_10676827 | 3300013105 | Bacteria | 1063 |
| 113 | Ga0163162_10018412 | 3300013306 | Bacteria | 6843 |
| 114 | Ga0163162_10020389 | 3300013306 | Bacteria | 6514 |
| 115 | Ga0163162_10337700 | 3300013306 | Bacteria | 1639 |
| 116 | Ga0157372_10065328 | 3300013307 | Bacteria | 4085 |
| 117 | Ga0157372_10425118 | 3300013307 | Bacteria | 1548 |
| 118 | Ga0157375_10035628 | 3300013308 | Bacteria | 4752 |
| 119 | Ga0157375_10320551 | 3300013308 | Bacteria | 1714 |
| 120 | Ga0157375_10424722 | 3300013308 | Bacteria | 1495 |
| 121 | Ga0182008_10002836 | 3300014497 | Bacteria | 10718 |
| 122 | Ga0182008_10006570 | 3300014497 | Bacteria | 6489 |
| 123 | Ga0182008_10009892 | 3300014497 | Bacteria | 5128 |
| 124 | Ga0182008_10009961 | 3300014497 | Bacteria | 5107 |
| 125 | Ga0182008_10015133 | 3300014497 | Bacteria | 4032 |
| 126 | Ga0182008_10083276 | 3300014497 | Bacteria | 1575 |
| 127 | Ga0182008_10088068 | 3300014497 | Bacteria | 1530 |
| 128 | Ga0182008_10089508 | 3300014497 | Bacteria | 1517 |
| 129 | Ga0182006_1004944 | 3300015261 | Bacteria | 6443 |
| 130 | Ga0182006_1005306 | 3300015261 | Bacteria | 6160 |
| 131 | Ga0182006_1007062 | 3300015261 | Bacteria | 5166 |
| 132 | Ga0182006_1028858 | 3300015261 | Bacteria | 2252 |
| 133 | Ga0182006_1038810 | 3300015261 | Bacteria | 1881 |
| 134 | Ga0182006_1041644 | 3300015261 | Bacteria | 1802 |
| 135 | Ga0182006_1051013 | 3300015261 | Bacteria | 1593 |
| 136 | Ga0182006_1051728 | 3300015261 | Bacteria | 1579 |
| 137 | Ga0182006_1058685 | 3300015261 | Bacteria | 1458 |
| 138 | Ga0182006_1077032 | 3300015261 | Bacteria | 1224 |
| 139 | Ga0182007_10004376 | 3300015262 | Bacteria | 6412 |
| 140 | Ga0182007_10034435 | 3300015262 | Bacteria | 1711 |
| 141 | Ga0182005_1009818 | 3300015265 | Bacteria | 2769 |
| 142 | Ga0163161_10010497 | 3300017792 | Bacteria | 6414 |
| 143 | Ga0163161_10014495 | 3300017792 | Bacteria | 5488 |
| 144 | Ga0163161_10029171 | 3300017792 | Bacteria | 3922 |
| 145 | Ga0163161_10087968 | 3300017792 | Bacteria | 2296 |
| 146 | Ga0163161_10177392 | 3300017792 | Bacteria | 1632 |
| 147 | Ga0163161_10186954 | 3300017792 | Bacteria | 1591 |
| 148 | Ga0209760_100079 | 3300025207 | Bacteria | 77345 |
| 149 | Ga0209760_100211 | 3300025207 | Bacteria | 26630 |
| 150 | Ga0209784_100128 | 3300025224 | Bacteria | 76497 |
| 151 | Ga0209566_100157 | 3300025225 | Bacteria | 76430 |
| 152 | Ga0209674_100180 | 3300025226 | Bacteria | 76497 |
| 153 | Ga0209147_100183 | 3300025229 | Bacteria | 75926 |
| 154 | Ga0209563_100144 | 3300025230 | Bacteria | 76497 |
| 155 | Ga0209563_100667 | 3300025230 | Bacteria | 10926 |
| 156 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 157 | Ga0207427_100048 | 3300025231 | Bacteria | 238464 |
| 158 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 159 | Ga0209437_100094 | 3300025233 | Bacteria | 238465 |
| 160 | Ga0209258_100310 | 3300025242 | Bacteria | 76430 |
| 161 | Ga0209646_1000355 | 3300025246 | Bacteria | 32593 |
| 162 | Ga0209677_100127 | 3300025253 | Bacteria | 76548 |
| 163 | Ga0209759_1004030 | 3300025256 | Bacteria | 5628 |
| 164 | Ga0209759_1009505 | 3300025256 | Bacteria | 2935 |
| 165 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 166 | Ga0209233_1000106 | 3300025261 | Bacteria | 268795 |
| 167 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 168 | Ga0209676_1000950 | 3300025292 | Bacteria | 35488 |
| 169 | Ga0209676_1005690 | 3300025292 | Bacteria | 6411 |
| 170 | Ga0209676_1005768 | 3300025292 | Bacteria | 6342 |
| 171 | Ga0209050_1000079 | 3300025298 | Bacteria | 277803 |
| 172 | Ga0209050_1000606 | 3300025298 | Bacteria | 57003 |
| 173 | Ga0209050_1000941 | 3300025298 | Bacteria | 37976 |
| 174 | Ga0209050_1000970 | 3300025298 | Bacteria | 36710 |
| 175 | Ga0209051_1000054 | 3300025303 | Bacteria | 280804 |
| 176 | Ga0209051_1000083 | 3300025303 | Bacteria | 192732 |
| 177 | Ga0209051_1000429 | 3300025303 | Bacteria | 57551 |
| 178 | Ga0209051_1006446 | 3300025303 | Bacteria | 6605 |
| 179 | Ga0209257_1000175 | 3300025304 | Bacteria | 165070 |
| 180 | Ga0207656_10001116 | 3300025321 | Bacteria | 8827 |
| 181 | Ga0207696_1000175 | 3300025711 | Bacteria | 102142 |
| 182 | Ga0207696_1000426 | 3300025711 | Bacteria | 38552 |
| 183 | Ga0207696_1001872 | 3300025711 | Bacteria | 10780 |
| 184 | Ga0207696_1008252 | 3300025711 | Bacteria | 4006 |
| 185 | Ga0207696_1014646 | 3300025711 | Bacteria | 2683 |
| 186 | Ga0207655_1000019 | 3300025728 | Bacteria | 536324 |
| 187 | Ga0207655_1000434 | 3300025728 | Bacteria | 56142 |
| 188 | Ga0207655_1000972 | 3300025728 | Bacteria | 29527 |
| 189 | Ga0207655_1001801 | 3300025728 | Bacteria | 18589 |
| 190 | Ga0207655_1006273 | 3300025728 | Bacteria | 7906 |
| 191 | Ga0207655_1023065 | 3300025728 | Bacteria | 3098 |
| 192 | Ga0207655_1025232 | 3300025728 | Bacteria | 2891 |
| 193 | Ga0207655_1027485 | 3300025728 | Bacteria | 2709 |
| 194 | Ga0207655_1035409 | 3300025728 | Bacteria | 2229 |
| 195 | Ga0207655_1036326 | 3300025728 | Bacteria | 2186 |
| 196 | Ga0207655_1038777 | 3300025728 | Bacteria | 2078 |
| 197 | Ga0207655_1041165 | 3300025728 | Bacteria | 1982 |
| 198 | Ga0207655_1041298 | 3300025728 | Bacteria | 1978 |
| 199 | Ga0207655_1051689 | 3300025728 | Bacteria | 1659 |
| 200 | Ga0207713_1000207 | 3300025735 | Bacteria | 79895 |
| 201 | Ga0207713_1000299 | 3300025735 | Bacteria | 56880 |
| 202 | Ga0207713_1010436 | 3300025735 | Bacteria | 5138 |
| 203 | Ga0207713_1014958 | 3300025735 | Bacteria | 4002 |
| 204 | Ga0207713_1018119 | 3300025735 | Bacteria | 3496 |
| 205 | Ga0207713_1019469 | 3300025735 | Bacteria | 3319 |
| 206 | Ga0207713_1022978 | 3300025735 | Bacteria | 2946 |
| 207 | Ga0207713_1041210 | 3300025735 | Bacteria | 1929 |
| 208 | Ga0207671_10000018 | 3300025914 | Bacteria | 318130 |
| 209 | Ga0207649_10000008 | 3300025920 | Bacteria | 315683 |
| 210 | Ga0207681_10002297 | 3300025923 | Bacteria | 12156 |
| 211 | Ga0207681_10038297 | 3300025923 | Bacteria | 3176 |
| 212 | Ga0207650_10002243 | 3300025925 | Bacteria | 13495 |
| 213 | Ga0207650_10004740 | 3300025925 | Bacteria | 9292 |
| 214 | Ga0207706_10001633 | 3300025933 | Bacteria | 22226 |
| 215 | Ga0207706_10175056 | 3300025933 | Bacteria | 1885 |
| 216 | Ga0207686_10010975 | 3300025934 | Bacteria | 4943 |
| 217 | Ga0207709_10000089 | 3300025935 | Bacteria | 149139 |
| 218 | Ga0207709_10001814 | 3300025935 | Bacteria | 14255 |
| 219 | Ga0207709_10034506 | 3300025935 | Bacteria | 2982 |
| 220 | Ga0207709_10049233 | 3300025935 | Bacteria | 2571 |
| 221 | Ga0207709_10097434 | 3300025935 | Bacteria | 1937 |
| 222 | Ga0207679_10000008 | 3300025945 | Bacteria | 412057 |
| 223 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 224 | Ga0209281_1000391 | 3300027111 | Bacteria | 68959 |
| 225 | Ga0209281_1002058 | 3300027111 | Bacteria | 9059 |
| 226 | Ga0209371_1002020 | 3300027312 | Bacteria | 12176 |
| 227 | Ga0209371_1006324 | 3300027312 | Bacteria | 4415 |
| 228 | Ga0209282_1053271 | 3300027666 | Bacteria | 2304 |
| 229 | Ga0207428_10017124 | 3300027907 | Bacteria | 6227 |
| 230 | Ga0207428_10036996 | 3300027907 | Bacteria | 3975 |
| 231 | Ga0207428_10048629 | 3300027907 | Bacteria | 3401 |
| 232 | Ga0207428_10088086 | 3300027907 | Bacteria | 2415 |
| 233 | Ga0207428_10141635 | 3300027907 | Bacteria | 1835 |
| 234 | Ga0268266_10018069 | 3300028379 | Bacteria | 6010 |
| 235 | Ga0268266_10409160 | 3300028379 | Bacteria | 1284 |
| 236 | Ga0268256_1000683 | 3300030500 | Bacteria | 25530 |
| 237 | Ga0268256_1006351 | 3300030500 | Bacteria | 4415 |
| 238 | Ga0307511_10146258 | 3300030521 | Bacteria | 1372 |
| 239 | Ga0316178_1087112 | 3300030735 | Bacteria | 7323 |
| 240 | Ga0307509_10350081 | 3300031507 | Bacteria | 1201 |
| 241 | Ga0307408_100032542 | 3300031548 | Bacteria | 3636 |
| 242 | Ga0307408_100168323 | 3300031548 | Bacteria | 1747 |
| 243 | Ga0307408_100210264 | 3300031548 | Bacteria | 1580 |
| 244 | Ga0307408_100277403 | 3300031548 | Bacteria | 1394 |
| 245 | Ga0307405_10005822 | 3300031731 | Bacteria | 5998 |
| 246 | Ga0307405_10326306 | 3300031731 | Bacteria | 1174 |
| 247 | Ga0307405_10338071 | 3300031731 | Bacteria | 1156 |
| 248 | Ga0307413_10033819 | 3300031824 | Bacteria | 2915 |
| 249 | Ga0307412_10043004 | 3300031911 | Bacteria | 2939 |
| 250 | Ga0307411_10105635 | 3300032005 | Bacteria | 2002 |
| 251 | Ga0307411_10216229 | 3300032005 | Bacteria | 1483 |
| 252 | Ga0307411_10398097 | 3300032005 | Bacteria | 1137 |
| 253 | Ga0237819_00787 | 3300038705 | Bacteria | 10146 |
| 254 | Ga0439436_0020880 | 3300041404 | Bacteria | 1948 |
| 255 | Ga0439438_003520 | 3300041405 | Bacteria | 6313 |
| 256 | Ga0439438_003556 | 3300041405 | Bacteria | 6257 |
| 257 | Ga0439438_006717 | 3300041405 | Bacteria | 4015 |
| 258 | Ga0439438_023509 | 3300041405 | Bacteria | 1697 |
| 259 | Ga0439438_044922 | 3300041405 | Bacteria | 1137 |
| 260 | Ga0439438_044925 | 3300041405 | Bacteria | 1137 |
| 261 | Ga0439447_002687 | 3300041407 | Bacteria | 6435 |
| 262 | Ga0439447_006607 | 3300041407 | Bacteria | 3747 |
| 263 | Ga0439447_010193 | 3300041407 | Bacteria | 2801 |
| 264 | Ga0439447_029983 | 3300041407 | Bacteria | 1373 |
| 265 | Ga0439466_0002047 | 3300041411 | Bacteria | 7900 |
| 266 | Ga0439466_0003072 | 3300041411 | Bacteria | 6494 |
| 267 | Ga0439466_0003320 | 3300041411 | Bacteria | 6258 |
| 268 | Ga0439466_0005230 | 3300041411 | Bacteria | 4968 |
| 269 | Ga0439466_0016551 | 3300041411 | Bacteria | 2663 |
| 270 | Ga0439466_0019313 | 3300041411 | Bacteria | 2438 |
| 271 | Ga0439466_0022042 | 3300041411 | Bacteria | 2251 |
| 272 | Ga0439466_0036490 | 3300041411 | Bacteria | 1659 |
| 273 | Ga0439432_002614 | 3300042006 | Bacteria | 6768 |
| 274 | Ga0439432_024748 | 3300042006 | Bacteria | 1973 |
| 275 | Ga0439432_024769 | 3300042006 | Bacteria | 1971 |
| 276 | Ga0439432_028123 | 3300042006 | Bacteria | 1832 |
| 277 | Ga0439432_031194 | 3300042006 | Bacteria | 1725 |
| 278 | Ga0439432_032284 | 3300042006 | Bacteria | 1688 |
| 279 | Ga0439432_035906 | 3300042006 | Bacteria | 1587 |
| 280 | Ga0439451_004081 | 3300042009 | Bacteria | 2965 |
| 281 | Ga0439451_009331 | 3300042009 | Bacteria | 1985 |
| 282 | Ga0439451_013552 | 3300042009 | Bacteria | 1648 |
| 283 | Ga0439452_001971 | 3300042010 | Bacteria | 7849 |
| 284 | Ga0439452_002234 | 3300042010 | Bacteria | 7264 |
| 285 | Ga0439452_002717 | 3300042010 | Bacteria | 6415 |
| 286 | Ga0439452_004105 | 3300042010 | Bacteria | 4951 |
| 287 | Ga0439452_008840 | 3300042010 | Bacteria | 3005 |
| 288 | Ga0439452_021368 | 3300042010 | Bacteria | 1687 |
| 289 | Ga0439456_000724 | 3300042013 | Bacteria | 6771 |
| 290 | Ga0439456_028210 | 3300042013 | Bacteria | 1197 |
| 291 | Ga0439463_018850 | 3300042016 | Bacteria | 1718 |
| 292 | Ga0450911_000989 | 3300042115 | Bacteria | 7366 |
| 293 | Ga0450911_004391 | 3300042115 | Bacteria | 2318 |
| 294 | Ga0450920_000323 | 3300042122 | Bacteria | 7279 |
| 295 | Ga0450922_000233 | 3300042124 | Bacteria | 6000 |
| 296 | Ga0450900_004893 | 3300042136 | Bacteria | 1561 |
| 297 | Ga0450902_001495 | 3300042137 | Bacteria | 3192 |
| 298 | Ga0450902_004873 | 3300042137 | Bacteria | 2009 |
| 299 | Ga0450902_011205 | 3300042137 | Bacteria | 1423 |
| 300 | Ga0450903_007661 | 3300042138 | Bacteria | 1772 |
| 301 | Ga0450903_008463 | 3300042138 | Bacteria | 1681 |
| 302 | Ga0450903_008565 | 3300042138 | Bacteria | 1672 |
| 303 | Ga0450905_000259 | 3300042142 | Bacteria | 6215 |
| 304 | Ga0450905_009588 | 3300042142 | Bacteria | 1333 |
| 305 | Ga0450906_001792 | 3300042145 | Bacteria | 4711 |
| 306 | Ga0450906_002154 | 3300042145 | Bacteria | 4304 |
| 307 | Ga0450906_011162 | 3300042145 | Bacteria | 1684 |
| 308 | Ga0450907_002371 | 3300042146 | Bacteria | 3626 |
| 309 | Ga0450907_007775 | 3300042146 | Bacteria | 1786 |
| 310 | Ga0439446_0002125 | 3300042156 | Bacteria | 4700 |
| 311 | Ga0439446_0036822 | 3300042156 | Bacteria | 1431 |
| 312 | Ga0450909_003369 | 3300042185 | Bacteria | 2279 |
| 313 | Ga0439434_0001684 | 3300042435 | Bacteria | 6404 |
| 314 | Ga0439464_0026244 | 3300042439 | Bacteria | 1615 |
| 315 | Ga0439460_0007945 | 3300042461 | Bacteria | 2669 |
| 316 | Ga0439460_0013457 | 3300042461 | Bacteria | 2140 |
| 317 | Ga0439460_0025082 | 3300042461 | Bacteria | 1657 |
| 318 | Ga0450901_000068 | 3300042533 | Bacteria | 10539 |
| 319 | Ga0450901_005614 | 3300042533 | Bacteria | 1287 |
| 320 | Ga0451577_0128905 | 3300042876 | Bacteria | 2268 |
| 321 | Ga0439440_0013194 | 3300042993 | Bacteria | 1767 |
| 322 | Ga0439440_0014683 | 3300042993 | Bacteria | 1693 |
| 323 | Ga0495617_001724 | 3300046452 | Bacteria | 9363 |
| 324 | Ga0495617_004628 | 3300046452 | Bacteria | 4977 |
| 325 | Ga0495617_029422 | 3300046452 | Bacteria | 1846 |
| 326 | Ga0495617_042260 | 3300046452 | Bacteria | 1523 |
| 327 | Ga0495617_045241 | 3300046452 | Bacteria | 1467 |
| 328 | Ga0495617_058550 | 3300046452 | Bacteria | 1277 |
| 329 | Ga0495627_000423 | 3300046453 | Bacteria | 36816 |
| 330 | Ga0495627_002133 | 3300046453 | Bacteria | 9968 |
| 331 | Ga0495627_003667 | 3300046453 | Bacteria | 6665 |
| 332 | Ga0495627_003943 | 3300046453 | Bacteria | 6346 |
| 333 | Ga0495627_015523 | 3300046453 | Bacteria | 2628 |
| 334 | Ga0495627_018704 | 3300046453 | Bacteria | 2331 |
| 335 | Ga0495627_022260 | 3300046453 | Bacteria | 2087 |
| 336 | Ga0495627_041647 | 3300046453 | Bacteria | 1410 |
| 337 | Ga0495603_0061569 | 3300046455 | Bacteria | 2216 |
| 338 | Ga0495590_0001676 | 3300046457 | Bacteria | 9432 |
| 339 | Ga0495590_0003517 | 3300046457 | Bacteria | 6392 |
| 340 | Ga0495590_0030223 | 3300046457 | Bacteria | 1898 |
| 341 | Ga0495590_0041994 | 3300046457 | Bacteria | 1594 |
| 342 | Ga0495590_0045216 | 3300046457 | Bacteria | 1535 |
| 343 | Ga0495590_0046488 | 3300046457 | Bacteria | 1514 |
| 344 | Ga0495591_000822 | 3300046458 | Bacteria | 21997 |
| 345 | Ga0495591_004666 | 3300046458 | Bacteria | 6587 |
| 346 | Ga0495591_005344 | 3300046458 | Bacteria | 5973 |
| 347 | Ga0495591_007846 | 3300046458 | Bacteria | 4459 |
| 348 | Ga0495591_010629 | 3300046458 | Bacteria | 3550 |
| 349 | Ga0495591_028972 | 3300046458 | Bacteria | 1687 |
| 350 | Ga0495591_038371 | 3300046458 | Bacteria | 1379 |
| 351 | Ga0495591_038867 | 3300046458 | Bacteria | 1367 |
| 352 | Ga0495591_043902 | 3300046458 | Bacteria | 1255 |
| 353 | Ga0495629_0068187 | 3300046459 | Bacteria | 2482 |
| 354 | Ga0495638_0005430 | 3300046460 | Bacteria | 9483 |
| 355 | Ga0495638_0005848 | 3300046460 | Bacteria | 9043 |
| 356 | Ga0495638_0010061 | 3300046460 | Bacteria | 6592 |
| 357 | Ga0495638_0018580 | 3300046460 | Bacteria | 4613 |
| 358 | Ga0495638_0019444 | 3300046460 | Bacteria | 4494 |
| 359 | Ga0495638_0048358 | 3300046460 | Bacteria | 2662 |
| 360 | Ga0495638_0057118 | 3300046460 | Bacteria | 2421 |
| 361 | Ga0495638_0073971 | 3300046460 | Bacteria | 2078 |
| 362 | Ga0495638_0097232 | 3300046460 | Bacteria | 1765 |
| 363 | Ga0495653_0015817 | 3300046463 | Bacteria | 6150 |
| 364 | Ga0495653_0086183 | 3300046463 | Bacteria | 2308 |
| 365 | Ga0495653_0090701 | 3300046463 | Bacteria | 2235 |
| 366 | Ga0495653_0094466 | 3300046463 | Bacteria | 2178 |
| 367 | Ga0495653_0128863 | 3300046463 | Bacteria | 1793 |
| 368 | Ga0495650_0004871 | 3300046471 | Bacteria | 8979 |
| 369 | Ga0495650_0005972 | 3300046471 | Bacteria | 7715 |
| 370 | Ga0495650_0011996 | 3300046471 | Bacteria | 4691 |
| 371 | Ga0495650_0028924 | 3300046471 | Bacteria | 2533 |
| 372 | Ga0495650_0053647 | 3300046471 | Bacteria | 1649 |
| 373 | Ga0495650_0070991 | 3300046471 | Bacteria | 1366 |
| 374 | Ga0495582_0011028 | 3300046473 | Bacteria | 4975 |
| 375 | Ga0495605_0000373 | 3300046474 | Bacteria | 42328 |
| 376 | Ga0495605_0000903 | 3300046474 | Bacteria | 20403 |
| 377 | Ga0495605_0006937 | 3300046474 | Bacteria | 6469 |
| 378 | Ga0495605_0010769 | 3300046474 | Bacteria | 5110 |
| 379 | Ga0495605_0024099 | 3300046474 | Bacteria | 3189 |
| 380 | Ga0495605_0038058 | 3300046474 | Bacteria | 2415 |
| 381 | Ga0495605_0049954 | 3300046474 | Bacteria | 2041 |
| 382 | Ga0495605_0075133 | 3300046474 | Bacteria | 1589 |
| 383 | Ga0495605_0117966 | 3300046474 | Bacteria | 1205 |
| 384 | Ga0495639_0003160 | 3300046475 | Bacteria | 7157 |
| 385 | Ga0495639_0063909 | 3300046475 | Bacteria | 1690 |
| 386 | Ga0495584_0002893 | 3300046491 | Bacteria | 9586 |
| 387 | Ga0495584_0005772 | 3300046491 | Bacteria | 6529 |
| 388 | Ga0495584_0009399 | 3300046491 | Bacteria | 5035 |
| 389 | Ga0495584_0014317 | 3300046491 | Bacteria | 4041 |
| 390 | Ga0495584_0020834 | 3300046491 | Bacteria | 3328 |
| 391 | Ga0495584_0065445 | 3300046491 | Bacteria | 1828 |
| 392 | Ga0495584_0067250 | 3300046491 | Bacteria | 1801 |
| 393 | Ga0495584_0090224 | 3300046491 | Bacteria | 1545 |
| 394 | Ga0495584_0114151 | 3300046491 | Bacteria | 1367 |
| 395 | Ga0495585_0005462 | 3300046492 | Bacteria | 8009 |
| 396 | Ga0495585_0056406 | 3300046492 | Bacteria | 2169 |
| 397 | Ga0495585_0079795 | 3300046492 | Bacteria | 1774 |
| 398 | Ga0495585_0104055 | 3300046492 | Bacteria | 1515 |
| 399 | Ga0495585_0122837 | 3300046492 | Bacteria | 1372 |
| 400 | Ga0495594_0000612 | 3300046499 | Bacteria | 18385 |
| 401 | Ga0495594_0141212 | 3300046499 | Bacteria | 1366 |
| 402 | Ga0495596_0002729 | 3300046500 | Bacteria | 9274 |
| 403 | Ga0495607_0000869 | 3300046501 | Bacteria | 28344 |
| 404 | Ga0495607_0001054 | 3300046501 | Bacteria | 25166 |
| 405 | Ga0495607_0001549 | 3300046501 | Bacteria | 20131 |
| 406 | Ga0495607_0005710 | 3300046501 | Bacteria | 8864 |
| 407 | Ga0495607_0010013 | 3300046501 | Bacteria | 6387 |
| 408 | Ga0495607_0012035 | 3300046501 | Bacteria | 5725 |
| 409 | Ga0495607_0039152 | 3300046501 | Bacteria | 2833 |
| 410 | Ga0495607_0042916 | 3300046501 | Bacteria | 2678 |
| 411 | Ga0495607_0044219 | 3300046501 | Bacteria | 2627 |
| 412 | Ga0495607_0046493 | 3300046501 | Bacteria | 2548 |
| 413 | Ga0495607_0047200 | 3300046501 | Bacteria | 2524 |
| 414 | Ga0495607_0052897 | 3300046501 | Bacteria | 2349 |
| 415 | Ga0495607_0080678 | 3300046501 | Bacteria | 1788 |
| 416 | Ga0495607_0087870 | 3300046501 | Bacteria | 1690 |
| 417 | Ga0495607_0088674 | 3300046501 | Bacteria | 1681 |
| 418 | Ga0495607_0098462 | 3300046501 | Bacteria | 1570 |
| 419 | Ga0495607_0116347 | 3300046501 | Bacteria | 1410 |
| 420 | Ga0495607_0125150 | 3300046501 | Bacteria | 1344 |
| 421 | Ga0495607_0168164 | 3300046501 | Bacteria | 1109 |
| 422 | Ga0495583_0000521 | 3300046506 | Bacteria | 54646 |
| 423 | Ga0495583_0004447 | 3300046506 | Bacteria | 10026 |
| 424 | Ga0495583_0007969 | 3300046506 | Bacteria | 6551 |
| 425 | Ga0495583_0008745 | 3300046506 | Bacteria | 6144 |
| 426 | Ga0495583_0011128 | 3300046506 | Bacteria | 5184 |
| 427 | Ga0495583_0075473 | 3300046506 | Bacteria | 1474 |
| 428 | Ga0495606_0013204 | 3300046507 | Bacteria | 6552 |
| 429 | Ga0495606_0021286 | 3300046507 | Bacteria | 4752 |
| 430 | Ga0495606_0022176 | 3300046507 | Bacteria | 4634 |
| 431 | Ga0495606_0024326 | 3300046507 | Bacteria | 4367 |
| 432 | Ga0495606_0071066 | 3300046507 | Bacteria | 2192 |
| 433 | Ga0495606_0119885 | 3300046507 | Bacteria | 1575 |
| 434 | Ga0495606_0120810 | 3300046507 | Bacteria | 1568 |
| 435 | Ga0495606_0122553 | 3300046507 | Bacteria | 1554 |
| 436 | Ga0495606_0137015 | 3300046507 | Bacteria | 1448 |
| 437 | Ga0495610_0009426 | 3300046512 | Bacteria | 6175 |
| 438 | Ga0495610_0009546 | 3300046512 | Bacteria | 6120 |
| 439 | Ga0495610_0011113 | 3300046512 | Bacteria | 5528 |
| 440 | Ga0495610_0037183 | 3300046512 | Bacteria | 2479 |
| 441 | Ga0495610_0045652 | 3300046512 | Bacteria | 2166 |
| 442 | Ga0495610_0047722 | 3300046512 | Bacteria | 2105 |
| 443 | Ga0495610_0055655 | 3300046512 | Bacteria | 1905 |
| 444 | Ga0495610_0057052 | 3300046512 | Bacteria | 1874 |
| 445 | Ga0495610_0059293 | 3300046512 | Bacteria | 1827 |
| 446 | Ga0495610_0069724 | 3300046512 | Bacteria | 1644 |
| 447 | Ga0495610_0070255 | 3300046512 | Bacteria | 1636 |
| 448 | Ga0495610_0087206 | 3300046512 | Bacteria | 1420 |
| 449 | Ga0495616_0006310 | 3300046513 | Bacteria | 7193 |
| 450 | Ga0495616_0022827 | 3300046513 | Bacteria | 3374 |
| 451 | Ga0495616_0049434 | 3300046513 | Bacteria | 2108 |
| 452 | Ga0495616_0049887 | 3300046513 | Bacteria | 2095 |
| 453 | Ga0495616_0061425 | 3300046513 | Bacteria | 1842 |
| 454 | Ga0495616_0090295 | 3300046513 | Bacteria | 1451 |
| 455 | Ga0495620_0000054 | 3300046515 | Bacteria | 100835 |
| 456 | Ga0495620_0000413 | 3300046515 | Bacteria | 28516 |
| 457 | Ga0495620_0010881 | 3300046515 | Bacteria | 4778 |
| 458 | Ga0495620_0015204 | 3300046515 | Bacteria | 3890 |
| 459 | Ga0495620_0018753 | 3300046515 | Bacteria | 3420 |
| 460 | Ga0495620_0032485 | 3300046515 | Bacteria | 2377 |
| 461 | Ga0495620_0051232 | 3300046515 | Bacteria | 1758 |
| 462 | Ga0495620_0064370 | 3300046515 | Bacteria | 1516 |
| 463 | Ga0495620_0100048 | 3300046515 | Bacteria | 1156 |
| 464 | Ga0495630_0024127 | 3300046517 | Bacteria | 4497 |
| 465 | Ga0495630_0269642 | 3300046517 | Bacteria | 1300 |
| 466 | Ga0495631_0002466 | 3300046518 | Bacteria | 10426 |
| 467 | Ga0495631_0004944 | 3300046518 | Bacteria | 7024 |
| 468 | Ga0495631_0005089 | 3300046518 | Bacteria | 6925 |
| 469 | Ga0495631_0025617 | 3300046518 | Bacteria | 2714 |
| 470 | Ga0495631_0040347 | 3300046518 | Bacteria | 2068 |
| 471 | Ga0495631_0052427 | 3300046518 | Bacteria | 1782 |
| 472 | Ga0495631_0053722 | 3300046518 | Bacteria | 1758 |
| 473 | Ga0495632_0003472 | 3300046519 | Bacteria | 11151 |
| 474 | Ga0495632_0004992 | 3300046519 | Bacteria | 8892 |
| 475 | Ga0495632_0012246 | 3300046519 | Bacteria | 4952 |
| 476 | Ga0495632_0013231 | 3300046519 | Bacteria | 4717 |
| 477 | Ga0495632_0013697 | 3300046519 | Bacteria | 4615 |
| 478 | Ga0495632_0015762 | 3300046519 | Bacteria | 4224 |
| 479 | Ga0495632_0020156 | 3300046519 | Bacteria | 3617 |
| 480 | Ga0495632_0036607 | 3300046519 | Bacteria | 2495 |
| 481 | Ga0495632_0037199 | 3300046519 | Bacteria | 2471 |
| 482 | Ga0495632_0046625 | 3300046519 | Bacteria | 2152 |
| 483 | Ga0495632_0050615 | 3300046519 | Bacteria | 2047 |
| 484 | Ga0495632_0106254 | 3300046519 | Bacteria | 1320 |
| 485 | Ga0495632_0113206 | 3300046519 | Bacteria | 1272 |
| 486 | Ga0495637_0002741 | 3300046520 | Bacteria | 9595 |
| 487 | Ga0495637_0003263 | 3300046520 | Bacteria | 8628 |
| 488 | Ga0495637_0005290 | 3300046520 | Bacteria | 6600 |
| 489 | Ga0495637_0006328 | 3300046520 | Bacteria | 5950 |
| 490 | Ga0495637_0009393 | 3300046520 | Bacteria | 4772 |
| 491 | Ga0495637_0012337 | 3300046520 | Bacteria | 4090 |
| 492 | Ga0495637_0023908 | 3300046520 | Bacteria | 2767 |
| 493 | Ga0495637_0024815 | 3300046520 | Bacteria | 2710 |
| 494 | Ga0495637_0033820 | 3300046520 | Bacteria | 2243 |
| 495 | Ga0495637_0057538 | 3300046520 | Bacteria | 1605 |
| 496 | Ga0495637_0060365 | 3300046520 | Bacteria | 1557 |
| 497 | Ga0495637_0065269 | 3300046520 | Bacteria | 1482 |
| 498 | Ga0495637_0076639 | 3300046520 | Bacteria | 1339 |
| 499 | Ga0495637_0118018 | 3300046520 | Bacteria | 1023 |
| 500 | Ga0495643_0039177 | 3300046522 | Bacteria | 2593 |
| 501 | Ga0495644_0002733 | 3300046523 | Bacteria | 6996 |
| 502 | Ga0495644_0038306 | 3300046523 | Bacteria | 1808 |
| 503 | Ga0495644_0066537 | 3300046523 | Bacteria | 1353 |
| 504 | Ga0495644_0073859 | 3300046523 | Bacteria | 1282 |
| 505 | Ga0495648_0004518 | 3300046524 | Bacteria | 11860 |
| 506 | Ga0495648_0009694 | 3300046524 | Bacteria | 7422 |
| 507 | Ga0495648_0009969 | 3300046524 | Bacteria | 7290 |
| 508 | Ga0495648_0012209 | 3300046524 | Bacteria | 6420 |
| 509 | Ga0495648_0014500 | 3300046524 | Bacteria | 5766 |
| 510 | Ga0495648_0016463 | 3300046524 | Bacteria | 5332 |
| 511 | Ga0495648_0020195 | 3300046524 | Bacteria | 4656 |
| 512 | Ga0495648_0029376 | 3300046524 | Bacteria | 3649 |
| 513 | Ga0495648_0052930 | 3300046524 | Bacteria | 2462 |
| 514 | Ga0495648_0094378 | 3300046524 | Bacteria | 1666 |
| 515 | Ga0495648_0102480 | 3300046524 | Bacteria | 1576 |
| 516 | Ga0495648_0126557 | 3300046524 | Bacteria | 1364 |
| 517 | Ga0495648_0136205 | 3300046524 | Bacteria | 1298 |
| 518 | Ga0495666_0065511 | 3300046526 | Bacteria | 1732 |
| 519 | Ga0495666_0071680 | 3300046526 | Bacteria | 1646 |
| 520 | Ga0495666_0071910 | 3300046526 | Bacteria | 1643 |
| 521 | Ga0495642_0001528 | 3300046528 | Bacteria | 10274 |
| 522 | Ga0495642_0005239 | 3300046528 | Bacteria | 4984 |
| 523 | Ga0495642_0005299 | 3300046528 | Bacteria | 4948 |
| 524 | Ga0495654_0000875 | 3300046530 | Bacteria | 22618 |
| 525 | Ga0495654_0003407 | 3300046530 | Bacteria | 9760 |
| 526 | Ga0495654_0003646 | 3300046530 | Bacteria | 9355 |
| 527 | Ga0495654_0006655 | 3300046530 | Bacteria | 6539 |
| 528 | Ga0495654_0006951 | 3300046530 | Bacteria | 6377 |
| 529 | Ga0495654_0007007 | 3300046530 | Bacteria | 6348 |
| 530 | Ga0495654_0007541 | 3300046530 | Bacteria | 6068 |
| 531 | Ga0495654_0010594 | 3300046530 | Bacteria | 5012 |
| 532 | Ga0495654_0011143 | 3300046530 | Bacteria | 4881 |
| 533 | Ga0495654_0017168 | 3300046530 | Bacteria | 3809 |
| 534 | Ga0495654_0023656 | 3300046530 | Bacteria | 3180 |
| 535 | Ga0495654_0030072 | 3300046530 | Bacteria | 2765 |
| 536 | Ga0495654_0031304 | 3300046530 | Bacteria | 2701 |
| 537 | Ga0495654_0037907 | 3300046530 | Bacteria | 2413 |
| 538 | Ga0495654_0066012 | 3300046530 | Bacteria | 1726 |
| 539 | Ga0495654_0075480 | 3300046530 | Bacteria | 1590 |
| 540 | Ga0495586_0064336 | 3300046535 | Bacteria | 1998 |
| 541 | Ga0495587_0054967 | 3300046536 | Bacteria | 2345 |
| 542 | Ga0495609_0000349 | 3300046538 | Bacteria | 40285 |
| 543 | Ga0495609_0009175 | 3300046538 | Bacteria | 4796 |
| 544 | Ga0495609_0051324 | 3300046538 | Bacteria | 1836 |
| 545 | Ga0495609_0057953 | 3300046538 | Bacteria | 1713 |
| 546 | Ga0495597_0000221 | 3300046542 | Bacteria | 52360 |
| 547 | Ga0495597_0002355 | 3300046542 | Bacteria | 12161 |
| 548 | Ga0495597_0012109 | 3300046542 | Bacteria | 4168 |
| 549 | Ga0495597_0013605 | 3300046542 | Bacteria | 3892 |
| 550 | Ga0495597_0014265 | 3300046542 | Bacteria | 3786 |
| 551 | Ga0495597_0031972 | 3300046542 | Bacteria | 2390 |
| 552 | Ga0495597_0061745 | 3300046542 | Bacteria | 1631 |
| 553 | Ga0495597_0092758 | 3300046542 | Bacteria | 1280 |
| 554 | Ga0495597_0102937 | 3300046542 | Bacteria | 1202 |
| 555 | Ga0495645_0064600 | 3300046543 | Bacteria | 2648 |
| 556 | Ga0495622_0000853 | 3300046557 | Bacteria | 16756 |
| 557 | Ga0495622_0004796 | 3300046557 | Bacteria | 6267 |
| 558 | Ga0495622_0007565 | 3300046557 | Bacteria | 5044 |
| 559 | Ga0495622_0021031 | 3300046557 | Bacteria | 3039 |
| 560 | Ga0495622_0057181 | 3300046557 | Bacteria | 1808 |
| 561 | Ga0495622_0071880 | 3300046557 | Bacteria | 1596 |
| 562 | Ga0495622_0091676 | 3300046557 | Bacteria | 1396 |
| 563 | Ga0495633_0000287 | 3300046558 | Bacteria | 58020 |
| 564 | Ga0495633_0008482 | 3300046558 | Bacteria | 5779 |
| 565 | Ga0495633_0030817 | 3300046558 | Bacteria | 2603 |
| 566 | Ga0495633_0076620 | 3300046558 | Bacteria | 1557 |
| 567 | Ga0495668_0007362 | 3300046616 | Bacteria | 7052 |
| 568 | Ga0495668_0012376 | 3300046616 | Bacteria | 5059 |
| 569 | Ga0495634_0005385 | 3300046642 | Bacteria | 9859 |
| 570 | Ga0495611_0001725 | 3300046648 | Bacteria | 10580 |
| 571 | Ga0495611_0001973 | 3300046648 | Bacteria | 9731 |
| 572 | Ga0495625_0007564 | 3300046660 | Bacteria | 9432 |
| 573 | Ga0495625_0007957 | 3300046660 | Bacteria | 9109 |
| 574 | Ga0495625_0025133 | 3300046660 | Bacteria | 4520 |
| 575 | Ga0495625_0090428 | 3300046660 | Bacteria | 2117 |
| 576 | Ga0495625_0136668 | 3300046660 | Bacteria | 1656 |
| 577 | Ga0495625_0182755 | 3300046660 | Bacteria | 1393 |
| 578 | Ga0495625_0206178 | 3300046660 | Bacteria | 1294 |
| 579 | Ga0495635_0040495 | 3300046663 | Bacteria | 3219 |
| 580 | Ga0495659_0001232 | 3300046664 | Bacteria | 8857 |
| 581 | Ga0495659_0003330 | 3300046664 | Bacteria | 5154 |
| 582 | Ga0495659_0034077 | 3300046664 | Bacteria | 1789 |
| 583 | Ga0495661_0000596 | 3300046665 | Bacteria | 37123 |
| 584 | Ga0495661_0008587 | 3300046665 | Bacteria | 7060 |
| 585 | Ga0495661_0013929 | 3300046665 | Bacteria | 5392 |
| 586 | Ga0495661_0080628 | 3300046665 | Bacteria | 1877 |
| 587 | Ga0495661_0095387 | 3300046665 | Bacteria | 1684 |
| 588 | Ga0495661_0115717 | 3300046665 | Bacteria | 1488 |
| 589 | Ga0495588_0013670 | 3300046674 | Bacteria | 3870 |
| 590 | Ga0495588_0107683 | 3300046674 | Bacteria | 1467 |
| 591 | Ga0495588_0109244 | 3300046674 | Bacteria | 1456 |
| 592 | Ga0495657_0054525 | 3300046675 | Bacteria | 2670 |
| 593 | Ga0495623_0007248 | 3300046679 | Bacteria | 7197 |
| 594 | Ga0495623_0134893 | 3300046679 | Bacteria | 1474 |
| 595 | Ga0495646_0014970 | 3300046680 | Bacteria | 4927 |
| 596 | Ga0495646_0019790 | 3300046680 | Bacteria | 4256 |
| 597 | Ga0495669_0030582 | 3300046684 | Bacteria | 2363 |
| 598 | Ga0495613_0020114 | 3300046689 | Bacteria | 4974 |
| 599 | Ga0495613_0150417 | 3300046689 | Bacteria | 1660 |
| 600 | Ga0495613_0340449 | 3300046689 | Bacteria | 1032 |
| 601 | Ga0495624_0100430 | 3300046690 | Bacteria | 1781 |
| 602 | Ga0495670_0004673 | 3300046691 | Bacteria | 6717 |
| 603 | Ga0495670_0005284 | 3300046691 | Bacteria | 6353 |
| 604 | Ga0495670_0027015 | 3300046691 | Bacteria | 2841 |
| 605 | Ga0495670_0033496 | 3300046691 | Bacteria | 2556 |
| 606 | Ga0495670_0126809 | 3300046691 | Bacteria | 1329 |
| 607 | Ga0495670_0132343 | 3300046691 | Bacteria | 1300 |
| 608 | Ga0495671_0006050 | 3300046692 | Bacteria | 7033 |
| 609 | Ga0495671_0006650 | 3300046692 | Bacteria | 6660 |
| 610 | Ga0495671_0006995 | 3300046692 | Bacteria | 6466 |
| 611 | Ga0495671_0013093 | 3300046692 | Bacteria | 4507 |
| 612 | Ga0495671_0018380 | 3300046692 | Bacteria | 3712 |
| 613 | Ga0495671_0020305 | 3300046692 | Bacteria | 3500 |
| 614 | Ga0495671_0027399 | 3300046692 | Bacteria | 2943 |
| 615 | Ga0495671_0067046 | 3300046692 | Bacteria | 1765 |
| 616 | Ga0495671_0075065 | 3300046692 | Bacteria | 1658 |
| 617 | Ga0495671_0121613 | 3300046692 | Bacteria | 1273 |
| 618 | Ga0495649_0007229 | 3300046694 | Bacteria | 6802 |
| 619 | Ga0495649_0007817 | 3300046694 | Bacteria | 6481 |
| 620 | Ga0495649_0007878 | 3300046694 | Bacteria | 6445 |
| 621 | Ga0495649_0011400 | 3300046694 | Bacteria | 5212 |
| 622 | Ga0495649_0016250 | 3300046694 | Bacteria | 4220 |
| 623 | Ga0495649_0020620 | 3300046694 | Bacteria | 3695 |
| 624 | Ga0495649_0063981 | 3300046694 | Bacteria | 1976 |
| 625 | Ga0495649_0070843 | 3300046694 | Bacteria | 1869 |
| 626 | Ga0495649_0079830 | 3300046694 | Bacteria | 1750 |
| 627 | Ga0495649_0104495 | 3300046694 | Bacteria | 1504 |
| 628 | Ga0495589_0002065 | 3300046794 | Bacteria | 11371 |
| 629 | Ga0495589_0002775 | 3300046794 | Bacteria | 9691 |
| 630 | Ga0495589_0009137 | 3300046794 | Bacteria | 5154 |
| 631 | Ga0495589_0009752 | 3300046794 | Bacteria | 4987 |
| 632 | Ga0495589_0020860 | 3300046794 | Bacteria | 3349 |
| 633 | Ga0495589_0071184 | 3300046794 | Bacteria | 1700 |
| 634 | Ga0495589_0108816 | 3300046794 | Bacteria | 1338 |
| 635 | Ga0495589_0114953 | 3300046794 | Bacteria | 1297 |
| 636 | Ga0495660_0001754 | 3300046810 | Bacteria | 14453 |
| 637 | Ga0495660_0012183 | 3300046810 | Bacteria | 4989 |
| 638 | Ga0495660_0020994 | 3300046810 | Bacteria | 3742 |
| 639 | Ga0495660_0045614 | 3300046810 | Bacteria | 2405 |
| 640 | Ga0495660_0046409 | 3300046810 | Bacteria | 2382 |
| 641 | Ga0495660_0059306 | 3300046810 | Bacteria | 2058 |
| 642 | Ga0495660_0074849 | 3300046810 | Bacteria | 1787 |
| 643 | Ga0495660_0079382 | 3300046810 | Bacteria | 1723 |
| 644 | Ga0495660_0109969 | 3300046810 | Bacteria | 1407 |
| 645 | Ga0495660_0124729 | 3300046810 | Bacteria | 1298 |
| 646 | Ga0495660_0136139 | 3300046810 | Bacteria | 1227 |
| 647 | Ga0495604_0008431 | 3300047317 | Bacteria | 8139 |
| 648 | Ga0495604_0032318 | 3300047317 | Bacteria | 4149 |
| 649 | Ga0495604_0150745 | 3300047317 | Bacteria | 1652 |
| 650 | Ga0495604_0240064 | 3300047317 | Bacteria | 1239 |
| 651 | Ga0495636_0012407 | 3300047318 | Bacteria | 3373 |
| 652 | Ga0495672_0009375 | 3300047320 | Bacteria | 7099 |
| 653 | Ga0495672_0010252 | 3300047320 | Bacteria | 6694 |
| 654 | Ga0495672_0014602 | 3300047320 | Bacteria | 5369 |
| 655 | Ga0495672_0015264 | 3300047320 | Bacteria | 5221 |
| 656 | Ga0495672_0021286 | 3300047320 | Bacteria | 4231 |
| 657 | Ga0495672_0032112 | 3300047320 | Bacteria | 3270 |
| 658 | Ga0495672_0056206 | 3300047320 | Bacteria | 2291 |
| 659 | Ga0495672_0078044 | 3300047320 | Bacteria | 1854 |
| 660 | Ga0495672_0082132 | 3300047320 | Bacteria | 1793 |
| 661 | Ga0495672_0091413 | 3300047320 | Bacteria | 1670 |
| 662 | Ga0495672_0120048 | 3300047320 | Bacteria | 1398 |
| 663 | Ga0495672_0140043 | 3300047320 | Bacteria | 1264 |
| 664 | Ga0495676_0002177 | 3300047321 | Bacteria | 17357 |
| 665 | Ga0495676_0114051 | 3300047321 | Bacteria | 1977 |
| 666 | Ga0495680_0018118 | 3300047322 | Bacteria | 5988 |
| 667 | Ga0495680_0100413 | 3300047322 | Bacteria | 2156 |
| 668 | Ga0495683_0000053 | 3300047323 | Bacteria | 121769 |
| 669 | Ga0495683_0000129 | 3300047323 | Bacteria | 75590 |
| 670 | Ga0495683_0003047 | 3300047323 | Bacteria | 9849 |
| 671 | Ga0495683_0025899 | 3300047323 | Bacteria | 3003 |
| 672 | Ga0495683_0040230 | 3300047323 | Bacteria | 2361 |
| 673 | Ga0495683_0045261 | 3300047323 | Bacteria | 2211 |
| 674 | Ga0495683_0074262 | 3300047323 | Bacteria | 1666 |
| 675 | Ga0495683_0075746 | 3300047323 | Bacteria | 1647 |
| 676 | Ga0495683_0113688 | 3300047323 | Bacteria | 1290 |
| 677 | Ga0495687_004396 | 3300047443 | Bacteria | 9556 |
| 678 | Ga0495687_012633 | 3300047443 | Bacteria | 4451 |
| 679 | Ga0495687_029964 | 3300047443 | Bacteria | 2510 |
| 680 | Ga0495677_0005671 | 3300047445 | Bacteria | 4731 |
| 681 | Ga0495679_000381 | 3300047446 | Bacteria | 34012 |
| 682 | Ga0495679_007117 | 3300047446 | Bacteria | 4711 |
| 683 | Ga0495679_031487 | 3300047446 | Bacteria | 1710 |
| 684 | Ga0495679_033014 | 3300047446 | Bacteria | 1655 |
| 685 | Ga0495685_066942 | 3300047447 | Bacteria | 1206 |
| 686 | Ga0495673_0001495 | 3300047469 | Bacteria | 18488 |
| 687 | Ga0495673_0003834 | 3300047469 | Bacteria | 9708 |
| 688 | Ga0495673_0004508 | 3300047469 | Bacteria | 8694 |
| 689 | Ga0495673_0006177 | 3300047469 | Bacteria | 7094 |
| 690 | Ga0495673_0007246 | 3300047469 | Bacteria | 6407 |
| 691 | Ga0495673_0011850 | 3300047469 | Bacteria | 4659 |
| 692 | Ga0495673_0014045 | 3300047469 | Bacteria | 4178 |
| 693 | Ga0495673_0014292 | 3300047469 | Bacteria | 4131 |
| 694 | Ga0495673_0051462 | 3300047469 | Bacteria | 1803 |
| 695 | Ga0495673_0059813 | 3300047469 | Bacteria | 1636 |
| 696 | Ga0495673_0083476 | 3300047469 | Bacteria | 1318 |
| 697 | Ga0495681_0007254 | 3300047470 | Bacteria | 7124 |
| 698 | Ga0495681_0007399 | 3300047470 | Bacteria | 7023 |
| 699 | Ga0495681_0007889 | 3300047470 | Bacteria | 6731 |
| 700 | Ga0495681_0008428 | 3300047470 | Bacteria | 6468 |
| 701 | Ga0495681_0009708 | 3300047470 | Bacteria | 5898 |
| 702 | Ga0495681_0009797 | 3300047470 | Bacteria | 5860 |
| 703 | Ga0495681_0010583 | 3300047470 | Bacteria | 5576 |
| 704 | Ga0495681_0024197 | 3300047470 | Bacteria | 3207 |
| 705 | Ga0495681_0031033 | 3300047470 | Bacteria | 2712 |
| 706 | Ga0495681_0048603 | 3300047470 | Bacteria | 2009 |
| 707 | Ga0495681_0049170 | 3300047470 | Bacteria | 1994 |
| 708 | Ga0495681_0063619 | 3300047470 | Bacteria | 1692 |
| 709 | Ga0495681_0070803 | 3300047470 | Bacteria | 1580 |
| 710 | Ga0495681_0077408 | 3300047470 | Bacteria | 1492 |
| 711 | Ga0495681_0093330 | 3300047470 | Bacteria | 1325 |
| 712 | Ga0495684_0048621 | 3300047471 | Bacteria | 3242 |
| 713 | Ga0495686_0011491 | 3300047472 | Bacteria | 6235 |
| 714 | Ga0495686_0090130 | 3300047472 | Bacteria | 1863 |
| 715 | Ga0495686_0118000 | 3300047472 | Bacteria | 1584 |
| 716 | Ga0495593_0016169 | 3300047673 | Bacteria | 4211 |
| 717 | Ga0495593_0072910 | 3300047673 | Bacteria | 1781 |
| 718 | Ga0495593_0077797 | 3300047673 | Bacteria | 1718 |
| 719 | Ga0495602_0155161 | 3300048088 | Bacteria | 1794 |
| 720 | Ga0495626_0003380 | 3300048091 | Bacteria | 10269 |
| 721 | Ga0495626_0005884 | 3300048091 | Bacteria | 7063 |
| 722 | Ga0495626_0006281 | 3300048091 | Bacteria | 6783 |
| 723 | Ga0495626_0006409 | 3300048091 | Bacteria | 6700 |
| 724 | Ga0495626_0006683 | 3300048091 | Bacteria | 6535 |
| 725 | Ga0495626_0045371 | 3300048091 | Bacteria | 2052 |
| 726 | Ga0495626_0067379 | 3300048091 | Bacteria | 1616 |
| 727 | Ga0496102_0006510 | 3300048905 | Bacteria | 9963 |
| 728 | Ga0496106_0292765 | 3300048909 | Bacteria | 1305 |
| 729 | Ga0496110_0085009 | 3300048913 | Bacteria | 2824 |
| 730 | Ga0496110_0141939 | 3300048913 | Bacteria | 2171 |
| 731 | Ga0496110_0262335 | 3300048913 | Bacteria | 1572 |
| 732 | Ga0496110_0338370 | 3300048913 | Bacteria | 1371 |
| 733 | Ga0496112_0094542 | 3300048915 | Bacteria | 2959 |
| 734 | Ga0496114_0016215 | 3300048917 | Bacteria | 5999 |
| 735 | Ga0496116_0000677 | 3300048919 | Bacteria | 44238 |
| 736 | Ga0496116_0012788 | 3300048919 | Bacteria | 6818 |
| 737 | Ga0496116_0015011 | 3300048919 | Bacteria | 6145 |
| 738 | Ga0496117_0008203 | 3300048920 | Bacteria | 9961 |
| 739 | Ga0496117_0013703 | 3300048920 | Bacteria | 7046 |
| 740 | Ga0496117_0016210 | 3300048920 | Bacteria | 6297 |
| 741 | Ga0496117_0050588 | 3300048920 | Bacteria | 2945 |
| 742 | Ga0496117_0128213 | 3300048920 | Bacteria | 1543 |
| 743 | Ga0496117_0137191 | 3300048920 | Bacteria | 1471 |
| 744 | Ga0496118_0038509 | 3300048921 | Bacteria | 3830 |
| 745 | Ga0496118_0041108 | 3300048921 | Bacteria | 3665 |
| 746 | Ga0496118_0091756 | 3300048921 | Bacteria | 2087 |
| 747 | Ga0496118_0131595 | 3300048921 | Bacteria | 1605 |
| 748 | Ga0496118_0133596 | 3300048921 | Bacteria | 1587 |
| 749 | Ga0496118_0164863 | 3300048921 | Bacteria | 1363 |
| 750 | Ga0496118_0165040 | 3300048921 | Bacteria | 1362 |
| 751 | Ga0496119_0000943 | 3300048922 | Bacteria | 37460 |
| 752 | Ga0496119_0101893 | 3300048922 | Bacteria | 1610 |
| 753 | Ga0496119_0119559 | 3300048922 | Bacteria | 1450 |
| 754 | Ga0496120_0011781 | 3300048923 | Bacteria | 5985 |
| 755 | Ga0496120_0026440 | 3300048923 | Bacteria | 3583 |
| 756 | Ga0496120_0089472 | 3300048923 | Bacteria | 1648 |
| 757 | Ga0496121_0000299 | 3300048924 | Bacteria | 103000 |
| 758 | Ga0496121_0055715 | 3300048924 | Bacteria | 3290 |
| 759 | Ga0496121_0183679 | 3300048924 | Bacteria | 1506 |
| 760 | Ga0496121_0224722 | 3300048924 | Bacteria | 1319 |
| 761 | Ga0496122_0016635 | 3300048925 | Bacteria | 6939 |
| 762 | Ga0496122_0019422 | 3300048925 | Bacteria | 6208 |
| 763 | Ga0496122_0028672 | 3300048925 | Bacteria | 4715 |
| 764 | Ga0496122_0113805 | 3300048925 | Bacteria | 1766 |
| 765 | Ga0496122_0223678 | 3300048925 | Bacteria | 1077 |
| 766 | Ga0496123_0012802 | 3300048926 | Bacteria | 7112 |
| 767 | Ga0496123_0050022 | 3300048926 | Bacteria | 2796 |
| 768 | Ga0496123_0098187 | 3300048926 | Bacteria | 1713 |
| 769 | Ga0496123_0098744 | 3300048926 | Bacteria | 1706 |
| 770 | Ga0496123_0113632 | 3300048926 | Bacteria | 1541 |
| 771 | Ga0496124_0019636 | 3300048927 | Bacteria | 6279 |
| 772 | Ga0496124_0019995 | 3300048927 | Bacteria | 6206 |
| 773 | Ga0496124_0029500 | 3300048927 | Bacteria | 4886 |
| 774 | Ga0496124_0073159 | 3300048927 | Bacteria | 2836 |
| 775 | Ga0496124_0083573 | 3300048927 | Bacteria | 2619 |
| 776 | Ga0496124_0099998 | 3300048927 | Bacteria | 2351 |
| 777 | Ga0496124_0120560 | 3300048927 | Bacteria | 2096 |
| 778 | Ga0496124_0180725 | 3300048927 | Bacteria | 1623 |
| 779 | Ga0496124_0181964 | 3300048927 | Bacteria | 1616 |
| 780 | Ga0496124_0319419 | 3300048927 | Bacteria | 1112 |
| 781 | Ga0496125_0020199 | 3300048928 | Bacteria | 6260 |
| 782 | Ga0496125_0021517 | 3300048928 | Bacteria | 6014 |
| 783 | Ga0496125_0026196 | 3300048928 | Bacteria | 5320 |
| 784 | Ga0496125_0037940 | 3300048928 | Bacteria | 4181 |
| 785 | Ga0496125_0126058 | 3300048928 | Bacteria | 1814 |
| 786 | Ga0496125_0152334 | 3300048928 | Bacteria | 1585 |
| 787 | Ga0496125_0158973 | 3300048928 | Bacteria | 1538 |
| 788 | Ga0496125_0170707 | 3300048928 | Bacteria | 1462 |
| 789 | Ga0496126_0022913 | 3300048929 | Bacteria | 6063 |
| 790 | Ga0496126_0098318 | 3300048929 | Bacteria | 2564 |
| 791 | Ga0496126_0208875 | 3300048929 | Bacteria | 1644 |
| 792 | Ga0496126_0227378 | 3300048929 | Bacteria | 1564 |
| 793 | Ga0495678_000362 | 3300049459 | Bacteria | 46331 |
| 794 | Ga0495678_003571 | 3300049459 | Bacteria | 9521 |
| 795 | Ga0495678_006194 | 3300049459 | Bacteria | 6399 |
| 796 | Ga0495678_006317 | 3300049459 | Bacteria | 6322 |
| 797 | Ga0495678_010485 | 3300049459 | Bacteria | 4505 |
| 798 | Ga0495678_041162 | 3300049459 | Bacteria | 1851 |
| 799 | Ga0495678_042941 | 3300049459 | Bacteria | 1798 |
| 800 | Ga0495678_046888 | 3300049459 | Bacteria | 1695 |
| 801 | Ga0495678_052247 | 3300049459 | Bacteria | 1574 |
| 802 | Ga0495678_062445 | 3300049459 | Bacteria | 1394 |
| 803 | Ga0495682_0000268 | 3300049460 | Bacteria | 41058 |
| 804 | Ga0495682_0030321 | 3300049460 | Bacteria | 2000 |
| 805 | Ga0495682_0034371 | 3300049460 | Bacteria | 1869 |
| 806 | Ga0495682_0038797 | 3300049460 | Bacteria | 1749 |
| 807 | Ga0495682_0045771 | 3300049460 | Bacteria | 1598 |
| 808 | Ga0495682_0068366 | 3300049460 | Bacteria | 1279 |
| 809 | Ga0501032_0016840 | 3300049569 | Bacteria | 5136 |
| 810 | Ga0501034_0047016 | 3300049571 | Bacteria | 4359 |
| 811 | Ga0501034_0206785 | 3300049571 | Bacteria | 1919 |
| 812 | Ga0501037_0034086 | 3300049573 | Bacteria | 3759 |
| 813 | Ga0501038_0102187 | 3300049574 | Bacteria | 2386 |
| 814 | Ga0501241_000589 | 3300049758 | Bacteria | 7808 |
| 815 | nmdc:mga03683_90883_c1 | 3300050489 | Bacteria | 1331 |
| 816 | nmdc:mga00v17_131060_c1 | 3300050491 | Bacteria | 1602 |
| 817 | nmdc:mga00v17_327807_c1 | 3300050491 | Bacteria | 995 |
| 818 | Ga0500572_036297 | 3300053111 | Bacteria | 1406 |
| 819 | Ga0500634_0055203 | 3300053161 | Bacteria | 2125 |
| 820 | 2511257602 | 2511231004 | Bacteria | 6669789 |
| 821 | 2511263660 | 2511231006 | Bacteria | 6794709 |
| 822 | 2511270262 | 2511231007 | Bacteria | 6306603 |
| 823 | 2511276452 | 2511231008 | Bacteria | 6624100 |
| 824 | 2511291004 | 2511231010 | Bacteria | 6373152 |
| 825 | 2511294249 | 2511231011 | Bacteria | 6149768 |
| 826 | 2511302439 | 2511231012 | Bacteria | 6738011 |
| 827 | 2511314036 | 2511231014 | Bacteria | 6462302 |
| 828 | 2511319995 | 2511231015 | Bacteria | 6598026 |
| 829 | 2511324784 | 2511231016 | Bacteria | 6704427 |
| 830 | 2511330329 | 2511231017 | Bacteria | 6503007 |
| 831 | 2511338017 | 2511231018 | Bacteria | 6436256 |
| 832 | 2511342828 | 2511231019 | Bacteria | 6520662 |
| 833 | 2511348796 | 2511231020 | Bacteria | 6115223 |
| 834 | 2511354864 | 2511231021 | Bacteria | 7302637 |
| 835 | 2511365897 | 2511231022 | Bacteria | 6719296 |
| 836 | 2511369957 | 2511231023 | Bacteria | 6808468 |
| 837 | 2511373237 | 2511231024 | Bacteria | 5835885 |
| 838 | 2511413254 | 2511231031 | Bacteria | 6558529 |
| 839 | 2511823899 | 2511231156 | Bacteria | 6845832 |
| 840 | 2512326842 | 2512047018 | Bacteria | 6663241 |
| 841 | 2554814230 | 2554235132 | Bacteria | 6772433 |
| 842 | 2555244895 | 2554235231 | Bacteria | 5215788 |
| 843 | 2555669058 | 2554235341 | Bacteria | 6867980 |
| 844 | 2583791474 | 2582580891 | Bacteria | 6800976 |
| 845 | 2597857198 | 2597489887 | Bacteria | 6666321 |
| 846 | 2597864879 | 2597489888 | Bacteria | 6179543 |
| 847 | 2597870755 | 2597489889 | Bacteria | 6297495 |
| 848 | 2599328642 | 2599185155 | Bacteria | 5827168 |
| 849 | 2599358050 | 2599185160 | Bacteria | 6844013 |
| 850 | 2599361808 | 2599185161 | Bacteria | 6960462 |
| 851 | 2599368129 | 2599185162 | Bacteria | 6957254 |
| 852 | 2599374918 | 2599185163 | Bacteria | 6995158 |
| 853 | 2599383215 | 2599185164 | Bacteria | 6841688 |
| 854 | 2599389402 | 2599185165 | Bacteria | 6843250 |
| 855 | 2599393776 | 2599185166 | Bacteria | 6959206 |
| 856 | 2599398061 | 2599185167 | Bacteria | 6353609 |
| 857 | 2599405543 | 2599185168 | Bacteria | 6997636 |
| 858 | 2599452518 | 2599185179 | Bacteria | 6611171 |
| 859 | 2599464865 | 2599185181 | Bacteria | 6844519 |
| 860 | 2599468417 | 2599185182 | Bacteria | 6883168 |
| 861 | 2599484220 | 2599185185 | Bacteria | 6652270 |
| 862 | 2599493889 | 2599185186 | Bacteria | 6831633 |
| 863 | 2599503148 | 2599185188 | Bacteria | 6164180 |
| 864 | 2599507064 | 2599185189 | Bacteria | 5862825 |
| 865 | 2599516184 | 2599185190 | Bacteria | 6285678 |
| 866 | 2599518386 | 2599185191 | Bacteria | 6297582 |
| 867 | 2599614834 | 2599185212 | Bacteria | 6765997 |
| 868 | 2599769709 | 2599185248 | Bacteria | 6696816 |
| 869 | 2599801870 | 2599185257 | Bacteria | 6492581 |
| 870 | 2599878220 | 2599185288 | Bacteria | 6666191 |
| 871 | 2599889029 | 2599185289 | Bacteria | 6778765 |
| 872 | 2599895518 | 2599185290 | Bacteria | 6289611 |
| 873 | 2599901609 | 2599185291 | Bacteria | 6775623 |
| 874 | 2599933654 | 2599185300 | Bacteria | 6062622 |
| 875 | 2599947413 | 2599185303 | Bacteria | 6512725 |
| 876 | 2599953582 | 2599185304 | Bacteria | 5951361 |
| 877 | 2599959268 | 2599185305 | Bacteria | 6748700 |
| 878 | 2599967425 | 2599185306 | Bacteria | 6637356 |
| 879 | 2599978665 | 2599185308 | Bacteria | 6621546 |
| 880 | 2599982159 | 2599185309 | Bacteria | 5969593 |
| 881 | 2599988962 | 2599185310 | Bacteria | 6014457 |
| 882 | 2599994715 | 2599185311 | Bacteria | 6354990 |
| 883 | 2599999575 | 2599185312 | Bacteria | 5912071 |
| 884 | 2600007316 | 2599185313 | Bacteria | 6658188 |
| 885 | 2600012733 | 2599185314 | Bacteria | 6621749 |
| 886 | 2600020509 | 2599185315 | Bacteria | 6771107 |
| 887 | 2600025240 | 2599185316 | Bacteria | 6320029 |
| 888 | 2600029749 | 2599185317 | Bacteria | 6435722 |
| 889 | 2600037819 | 2599185318 | Bacteria | 6961590 |
| 890 | 2600042004 | 2599185319 | Bacteria | 6637840 |
| 891 | 2600046911 | 2599185320 | Bacteria | 5963263 |
| 892 | 2600055022 | 2599185321 | Bacteria | 6764560 |
| 893 | 2600057770 | 2599185322 | Bacteria | 6763055 |
| 894 | 2600064785 | 2599185323 | Bacteria | 6688755 |
| 895 | 2600071672 | 2599185324 | Bacteria | 6590677 |
| 896 | 2600076035 | 2599185325 | Bacteria | 6324919 |
| 897 | 2600217596 | 2599185356 | Bacteria | 6843884 |
| 898 | 2600359344 | 2600254930 | Bacteria | 6431253 |
| 899 | 2600365447 | 2600254931 | Bacteria | 6734225 |
| 900 | 2601689844 | 2600255296 | Bacteria | 5784754 |
| 901 | 2601777764 | 2600255313 | Bacteria | 6842543 |
| 902 | 2601795821 | 2600255318 | Bacteria | 6383414 |
| 903 | 2602010047 | 2600255389 | Bacteria | 5275336 |
| 904 | 2606075332 | 2603880185 | Bacteria | 6379190 |
| 905 | 2606128195 | 2603880199 | Bacteria | 6377649 |
| 906 | 2608381629 | 2606217733 | Bacteria | 6360972 |
| 907 | 2621298528 | 2619619299 | Bacteria | 6649820 |
| 908 | 2624479758 | 2623620443 | Bacteria | 6427864 |
| 909 | 2624491413 | 2623620446 | Bacteria | 6500345 |
| 910 | 2643842572 | 2643221565 | Bacteria | 6216018 |
| 911 | 2643871582 | 2643221571 | Bacteria | 6228673 |
| 912 | 2643952951 | 2643221589 | Bacteria | 6250934 |
| 913 | 2644022713 | 2643221602 | Bacteria | 6249926 |
| 914 | 2644188886 | 2643221633 | Bacteria | 6733554 |
| 915 | 2644284961 | 2643221650 | Bacteria | 7029547 |
| 916 | 2644621637 | 2643221713 | Bacteria | 6554480 |
| 917 | 2652543896 | 2651869719 | Bacteria | 6047974 |
| 918 | 2671093480 | 2667528170 | Bacteria | 6786960 |
| 919 | 2671098447 | 2667528171 | Bacteria | 6900659 |
| 920 | 2671128310 | 2667528176 | Bacteria | 6724917 |
| 921 | 2671768819 | 2671180172 | Bacteria | 6495783 |
| 922 | 2677899636 | 2675903420 | Bacteria | 6247433 |
| 923 | 2678264259 | 2675903515 | Bacteria | 6580491 |
| 924 | 2715752529 | 2713897148 | Bacteria | 5883533 |
| 925 | 2715758026 | 2713897149 | Bacteria | 6506249 |
| 926 | 2718633430 | 2718217725 | Bacteria | 5758958 |
| 927 | 2723249636 | 2721755607 | Bacteria | 5841722 |
| 928 | 2729148196 | 2728369097 | Bacteria | 4333476 |
| 929 | 2738674562 | 2738541265 | Bacteria | 6594665 |
| 930 | 2738752955 | 2738541282 | Bacteria | 6593925 |
| 931 | 2738809706 | 2738541294 | Bacteria | 6925949 |
| 932 | 2738861996 | 2738541303 | Bacteria | 6591772 |
| 933 | 2738897066 | 2738541309 | Bacteria | 6926455 |
| 934 | 2739199796 | 2738543004 | Bacteria | 6381073 |
| 935 | 2739259437 | 2738543015 | Bacteria | 6750701 |
| 936 | 2739315785 | 2738543025 | Bacteria | 6600348 |
| 937 | 2743736614 | 2740892503 | Bacteria | 6855563 |
| 938 | 2745004714 | 2744054620 | Bacteria | 6551379 |
| 939 | 2765585224 | 2765235841 | Bacteria | 6137024 |
| 940 | 2774121002 | 2773857670 | Bacteria | 6407454 |
| 941 | 2774137339 | 2773857673 | Bacteria | 6513460 |
| 942 | 2784263649 | 2784132063 | Bacteria | 6262788 |
| 943 | 2784314074 | 2784132072 | Bacteria | 6596533 |
| 944 | 2794596654 | 2791355520 | Bacteria | 5948615 |
| 945 | 2807407432 | 2806310737 | Bacteria | 5751088 |
| 946 | 2807455760 | 2806310745 | Bacteria | 5742165 |
| 947 | 2808857647 | 2808606361 | Bacteria | 6136259 |
| 948 | 2808924737 | 2808606376 | Bacteria | 6248667 |
| 949 | 2808927742 | 2808606377 | Bacteria | 6646337 |
| 950 | 2808937817 | 2808606378 | Bacteria | 6177535 |
| 951 | 2808946839 | 2808606380 | Bacteria | 6248705 |
| 952 | 2808949718 | 2808606381 | Bacteria | 6646461 |
| 953 | 2808960254 | 2808606382 | Bacteria | 6841132 |
| 954 | 2808966131 | 2808606383 | Bacteria | 6138645 |
| 955 | 2808977168 | 2808606385 | Bacteria | 6711065 |
| 956 | 2808992323 | 2808606388 | Bacteria | 6706662 |
| 957 | 2809000979 | 2808606389 | Bacteria | 6138126 |
| 958 | 2809216709 | 2808606445 | Bacteria | 6057339 |
| 959 | 2817492324 | 2816332298 | Bacteria | 6852809 |
| 960 | 2819656459 | 2818991456 | Bacteria | 6123676 |
| 961 | 2819703527 | 2818991464 | Bacteria | 6907494 |
| 962 | 2823424119 | 2823421272 | Bacteria | 5372474 |
| 963 | 2825656801 | 2825651385 | Bacteria | 6715909 |
| 964 | 2826583639 | 2826581358 | Bacteria | 5963467 |
| 965 | 2834033740 | 2834028612 | Bacteria | 6354979 |
| 966 | 2842818135 | 2842815866 | Bacteria | 5947510 |
| 967 | 2842831125 | 2842826826 | Bacteria | 5974129 |
| 968 | 2842832369 | 2842832357 | Bacteria | 5959113 |
| 969 | 2842842384 | 2842837860 | Bacteria | 6066181 |
| 970 | 2842848650 | 2842843487 | Bacteria | 6004777 |
| 971 | 2842849230 | 2842849001 | Bacteria | 5924277 |
| 972 | 2842854794 | 2842854478 | Bacteria | 6143501 |
| 973 | 2844669497 | 2844665904 | Bacteria | 6817974 |
| 974 | 2852613478 | 2852612431 | Bacteria | 6885235 |
| 975 | 2852658275 | 2852657418 | Bacteria | 6472974 |
| 976 | 2852668786 | 2852667396 | Bacteria | 6885555 |
| 977 | 2860339627 | 2860339153 | Bacteria | 6846989 |
| 978 | 2860871389 | 2860867994 | Bacteria | 5645326 |
| 979 | 2878031770 | 2878029506 | Bacteria | 6418441 |
| 980 | 2880234279 | 2880230671 | Bacteria | 6140320 |
| 981 | 2904523605 | 2904518522 | Bacteria | 6068986 |
| 982 | 2904554299 | 2904550169 | Bacteria | 6221258 |
| 983 | 2908450764 | 2908446538 | Bacteria | 6829095 |
| 984 | 2912967488 | 2912963787 | Bacteria | 5646108 |
| 985 | 2913040736 | 2913036834 | Bacteria | 6704877 |
| 986 | 2917072855 | 2917070673 | Bacteria | 6868303 |
| 987 | 2919068244 | 2919063839 | Bacteria | 6302690 |
| 988 | 2919157321 | 2919155634 | Bacteria | 4860545 |
| 989 | 2919386736 | 2919385768 | Bacteria | 5897293 |
| 990 | 2919456719 | 2919456309 | Bacteria | 6586567 |
| 991 | 2919482146 | 2919481497 | Bacteria | 6907839 |
| 992 | 2919491517 | 2919487758 | Bacteria | 5929766 |
| 993 | 2919701028 | 2919697872 | Bacteria | 6553725 |
| 994 | 2923155630 | 2923153595 | Bacteria | 6870622 |
| 995 | 2923587711 | 2923586266 | Bacteria | 6565975 |
| 996 | 2929148232 | 2929144301 | Bacteria | 6622272 |
| 997 | 2929193409 | 2929189879 | Bacteria | 5930554 |
| 998 | 2931374355 | 2931369376 | Bacteria | 6847892 |
| 999 | 2931394719 | 2931390751 | Bacteria | 6273349 |
| 1000 | 2931400488 | 2931396565 | Bacteria | 7251677 |
| 1001 | 2935359283 | 2935353572 | Unclassified | 6955622 |
| 1002 | 2939639268 | 2939636861 | Bacteria | 6297853 |
| 1003 | 2939652996 | 2939651529 | Bacteria | 5895393 |
| 1004 | 2945932570 | 2945928738 | Bacteria | 6053221 |
| 1005 | 2945962477 | 2945961074 | Bacteria | 7342064 |
| 1006 | 2946008813 | 2946006987 | Bacteria | 6705746 |
| 1007 | 2946031883 | 2946027586 | Bacteria | 6049274 |
| 1008 | 2947238711 | 2947233263 | Bacteria | 6439278 |
| 1009 | 2969306564 | 2969304461 | Bacteria | 6601805 |
| 1010 | 2974291749 | 2974289157 | Bacteria | 6080362 |
| 1011 | 2984290389 | 2984286254 | Bacteria | 6702062 |
| 1012 | 2988729879 | 2988728565 | Bacteria | 6124362 |
| 1013 | 2998141950 | 2998139840 | Bacteria | 6073514 |
| 1014 | 3007317717 | 3007315729 | Bacteria | 5076637 |
| 1015 | 3007401214 | 3007395558 | Bacteria | 6755444 |
| 1016 | 3007421600 | 3007419365 | Bacteria | 7026924 |
| 1017 | 3007513370 | 3007511990 | Bacteria | 6481491 |
| 1018 | 3007618395 | 3007614139 | Bacteria | 6053559 |
| 1019 | 3007619864 | 3007619802 | Bacteria | 6411688 |
| 1020 | 3007723778 | 3007718800 | Bacteria | 5971527 |
| 1021 | 3007807821 | 3007803356 | Bacteria | 5931491 |
| 1022 | 3007860668 | 3007855910 | Bacteria | 5637581 |
| 1023 | 3007862823 | 3007861166 | Bacteria | 6045338 |
| 1024 | 3007868309 | 3007866637 | Bacteria | 5899198 |
| 1025 | 637319407 | 637000220 | Bacteria | 7074893 |
| 1026 | 640487728 | 640427133 | Bacteria | 4567418 |
| 1027 | 8015689888 | 8015687852 | Bacteria | 6613826 |
| 1028 | 8019775265 | 8019769354 | Bacteria | 6924660 |
| 1029 | 8019778308 | 8019775933 | Bacteria | 6858656 |
| 1030 | 8029998748 | 8029995093 | Bacteria | 5990776 |
| 1031 | 8034965866 | 8034962539 | Bacteria | 4884839 |
| 1032 | 8054288217 | 8054285046 | Bacteria | 6919322 |
| 1033 | 8054349183 | 8054347763 | Bacteria | 5901107 |
| 1034 | 8054507258 | 8054503363 | Bacteria | 6101651 |
| 1035 | 8054932869 | 8054929484 | Bacteria | 5599761 |
| 1036 | 8055772993 | 8055770955 | Bacteria | 6827675 |
| 1037 | 8055822163 | 8055817908 | Bacteria | 6609162 |
| 1038 | 8055879636 | 8055878733 | Bacteria | 5907058 |
| 1039 | 8056117867 | 8056115690 | Bacteria | 5527654 |
| 1040 | 8056124424 | 8056120720 | Bacteria | 5758328 |
| 1041 | 8056127920 | 8056125926 | Bacteria | 6228218 |
| 1042 | 8056135648 | 8056131705 | Bacteria | 6107031 |
| 1043 | 8056139073 | 8056137416 | Bacteria | 6147080 |
| 1044 | 8056147120 | 8056143049 | Bacteria | 6307666 |
| 1045 | 8056152949 | 8056148874 | Bacteria | 6479865 |
| 1046 | 8056155980 | 8056155041 | Bacteria | 6486948 |
| 1047 | 8056161847 | 8056161164 | Bacteria | 6106669 |
| 1048 | 8056169051 | 8056166840 | Bacteria | 5820959 |
| 1049 | 8056175199 | 8056172158 | Bacteria | 6133900 |
| 1050 | 8056183523 | 8056177738 | Bacteria | 6748268 |
| 1051 | 8056573006 | 8056569372 | Bacteria | 5997322 |
| 1052 | 8057799424 | 8057798959 | Bacteria | 6713499 |
| 1053 | Ga0209676_1000959 | |||
| 1054 | SwRhRL2b_contig_2198927 | |||
| 1055 | SwRhRL2b_contig_391535 | |||
| 1056 | JGI25162J39368_1000824 | |||
| 1057 | JGI25163J39215_1000875 | |||
| 1058 | JGI25163J39215_1000897 | |||
| 1059 | JGI25164J39214_1000456 | |||
| 1060 | JGI25164J39214_1000464 | |||
| 1061 | JGI25165J46597_1000888 | |||
| 1062 | JGI25165J46597_1000906 | |||
| 1063 | Ga0055538_1000093 | |||
| 1064 | Ga0055539_1000138 | |||
| 1065 | Ga0055533_1000142 | |||
| 1066 | Ga0055532_1000152 | |||
| 1067 | Ga0055525_1000342 | |||
| 1068 | Ga0055535_1005444 | |||
| 1069 | Ga0055536_1002321 | |||
| 1070 | Ga0055536_1021517 | |||
| 1071 | Ga0055536_1022172 | |||
| 1072 | Ga0055530_10003078 | |||
| 1073 | Ga0055530_10004122 | |||
| 1074 | Ga0055540_1001801 | |||
| 1075 | Ga0055540_1002628 | |||
| 1076 | Ga0055540_1003748 | |||
| 1077 | Ga0055531_10004937 | |||
| 1078 | Ga0055541_1000091 | |||
| 1079 | Ga0065714_10010949 | |||
| 1080 | Ga0065714_10011409 | |||
| 1081 | Ga0065714_10013394 | |||
| 1082 | Ga0065714_10024810 | |||
| 1083 | Ga0065714_10065334 | |||
| 1084 | Ga0065714_10078549 | |||
| 1085 | Ga0065714_10102247 | |||
| 1086 | Ga0065714_10116954 | |||
| 1087 | Ga0065714_10129798 | |||
| 1088 | Ga0065704_10094931 | |||
| 1089 | Ga0065712_10010845 | |||
| 1090 | Ga0065712_10012266 | |||
| 1091 | Ga0065712_10070056 | |||
| 1092 | Ga0070670_100005617 | |||
| 1093 | Ga0070670_100021712 | |||
| 1094 | Ga0070661_100000961 | |||
| 1095 | Ga0070669_100000904 | |||
| 1096 | Ga0070662_100002124 | |||
| 1097 | Ga0070665_100038532 | |||
| 1098 | Ga0070664_100010006 | |||
| 1099 | Ga0068851_10014826 | |||
| 1100 | Ga0075364_10071685 | |||
| 1101 | Ga0075364_10138861 | |||
| 1102 | Ga0075432_10004969 | |||
| 1103 | Ga0075432_10044344 | |||
| 1104 | Ga0075362_10104722 | |||
| 1105 | Ga0075436_100115975 | |||
| 1106 | Ga0075436_100149651 | |||
| 1107 | Ga0079104_1000375 | |||
| 1108 | Ga0099826_10001328 | |||
| 1109 | Ga0105251_10001251 | |||
| 1110 | Ga0105251_10019667 | |||
| 1111 | Ga0105251_10023608 | |||
| 1112 | Ga0105251_10032414 | |||
| 1113 | Ga0105251_10036841 | |||
| 1114 | Ga0105251_10046794 | |||
| 1115 | Ga0105251_10109388 | |||
| 1116 | Ga0105244_10000709 | |||
| 1117 | Ga0105244_10005465 | |||
| 1118 | Ga0105244_10017555 | |||
| 1119 | Ga0105244_10036386 | |||
| 1120 | Ga0105244_10039151 | |||
| 1121 | Ga0105244_10067870 | |||
| 1122 | Ga0105244_10075941 | |||
| 1123 | Ga0105244_10080984 | |||
| 1124 | Ga0105244_10082295 | |||
| 1125 | Ga0105250_10001909 | |||
| 1126 | Ga0105250_10002486 | |||
| 1127 | Ga0105250_10006952 | |||
| 1128 | Ga0105250_10019711 | |||
| 1129 | Ga0105250_10021777 | |||
| 1130 | Ga0105243_10001321 | |||
| 1131 | Ga0105243_10002510 | |||
| 1132 | Ga0105243_10045098 | |||
| 1133 | Ga0105243_10104937 | |||
| 1134 | Ga0105243_10146696 | |||
| 1135 | Ga0105243_10159491 | |||
| 1136 | Ga0105242_10019163 | |||
| 1137 | Ga0105237_10000335 | |||
| 1138 | Ga0105246_10045141 | |||
| 1139 | Ga0105246_10074065 | |||
| 1140 | Ga0157345_1001267 | |||
| 1141 | Ga0157345_1002153 | |||
| 1142 | Ga0157373_10009179 | |||
| 1143 | Ga0157373_10060199 | |||
| 1144 | Ga0157373_10080681 | |||
| 1145 | Ga0157373_10124741 | |||
| 1146 | Ga0157373_10144747 | |||
| 1147 | Ga0157373_10153025 | |||
| 1148 | Ga0157373_10249403 | |||
| 1149 | Ga0157373_10302776 | |||
| 1150 | Ga0157371_10000406 | |||
| 1151 | Ga0157371_10120923 | |||
| 1152 | Ga0157371_10130430 | |||
| 1153 | Ga0157371_10138029 | |||
| 1154 | Ga0157370_10020721 | |||
| 1155 | Ga0157370_10091733 | |||
| 1156 | Ga0157370_10214766 | |||
| 1157 | Ga0157370_10347389 | |||
| 1158 | Ga0157370_10475684 | |||
| 1159 | Ga0157369_10269111 | |||
| 1160 | Ga0157369_10288243 | |||
| 1161 | Ga0157369_10298840 | |||
| 1162 | Ga0157369_10352523 | |||
| 1163 | Ga0157369_10676826 | |||
| 1164 | Ga0157369_10676827 | |||
| 1165 | Ga0163162_10018412 | |||
| 1166 | Ga0163162_10020389 | |||
| 1167 | Ga0163162_10337700 | |||
| 1168 | Ga0157372_10065328 | |||
| 1169 | Ga0157372_10425118 | |||
| 1170 | Ga0157375_10035628 | |||
| 1171 | Ga0157375_10320551 | |||
| 1172 | Ga0157375_10424722 | |||
| 1173 | Ga0182008_10002836 | |||
| 1174 | Ga0182008_10006570 | |||
| 1175 | Ga0182008_10009892 | |||
| 1176 | Ga0182008_10009961 | |||
| 1177 | Ga0182008_10015133 | |||
| 1178 | Ga0182008_10083276 | |||
| 1179 | Ga0182008_10088068 | |||
| 1180 | Ga0182008_10089508 | |||
| 1181 | Ga0182006_1004944 | |||
| 1182 | Ga0182006_1005306 | |||
| 1183 | Ga0182006_1007062 | |||
| 1184 | Ga0182006_1028858 | |||
| 1185 | Ga0182006_1038810 | |||
| 1186 | Ga0182006_1041644 | |||
| 1187 | Ga0182006_1051013 | |||
| 1188 | Ga0182006_1051728 | |||
| 1189 | Ga0182006_1058685 | |||
| 1190 | Ga0182006_1077032 | |||
| 1191 | Ga0182007_10004376 | |||
| 1192 | Ga0182007_10034435 | |||
| 1193 | Ga0182005_1009818 | |||
| 1194 | Ga0163161_10010497 | |||
| 1195 | Ga0163161_10014495 | |||
| 1196 | Ga0163161_10029171 | |||
| 1197 | Ga0163161_10087968 | |||
| 1198 | Ga0163161_10177392 | |||
| 1199 | Ga0163161_10186954 | |||
| 1200 | Ga0209760_100079 | |||
| 1201 | Ga0209760_100211 | |||
| 1202 | Ga0209784_100128 | |||
| 1203 | Ga0209566_100157 | |||
| 1204 | Ga0209674_100180 | |||
| 1205 | Ga0209147_100183 | |||
| 1206 | Ga0209563_100144 | |||
| 1207 | Ga0209563_100667 | |||
| 1208 | Ga0207427_100001 | |||
| 1209 | Ga0207427_100048 | |||
| 1210 | Ga0209437_100003 | |||
| 1211 | Ga0209437_100094 | |||
| 1212 | Ga0209258_100310 | |||
| 1213 | Ga0209646_1000355 | |||
| 1214 | Ga0209677_100127 | |||
| 1215 | Ga0209759_1004030 | |||
| 1216 | Ga0209759_1009505 | |||
| 1217 | Ga0209233_1000007 | |||
| 1218 | Ga0209233_1000106 | |||
| 1219 | Ga0209676_1000055 | |||
| 1220 | Ga0209676_1000950 | |||
| 1221 | Ga0209676_1005690 | |||
| 1222 | Ga0209676_1005768 | |||
| 1223 | Ga0209050_1000079 | |||
| 1224 | Ga0209050_1000606 | |||
| 1225 | Ga0209050_1000941 | |||
| 1226 | Ga0209050_1000970 | |||
| 1227 | Ga0209051_1000054 | |||
| 1228 | Ga0209051_1000083 | |||
| 1229 | Ga0209051_1000429 | |||
| 1230 | Ga0209051_1006446 | |||
| 1231 | Ga0209257_1000175 | |||
| 1232 | Ga0207656_10001116 | |||
| 1233 | Ga0207696_1000175 | |||
| 1234 | Ga0207696_1000426 | |||
| 1235 | Ga0207696_1001872 | |||
| 1236 | Ga0207696_1008252 | |||
| 1237 | Ga0207696_1014646 | |||
| 1238 | Ga0207655_1000019 | |||
| 1239 | Ga0207655_1000434 | |||
| 1240 | Ga0207655_1000972 | |||
| 1241 | Ga0207655_1001801 | |||
| 1242 | Ga0207655_1006273 | |||
| 1243 | Ga0207655_1023065 | |||
| 1244 | Ga0207655_1025232 | |||
| 1245 | Ga0207655_1027485 | |||
| 1246 | Ga0207655_1035409 | |||
| 1247 | Ga0207655_1036326 | |||
| 1248 | Ga0207655_1038777 | |||
| 1249 | Ga0207655_1041165 | |||
| 1250 | Ga0207655_1041298 | |||
| 1251 | Ga0207655_1051689 | |||
| 1252 | Ga0207713_1000207 | |||
| 1253 | Ga0207713_1000299 | |||
| 1254 | Ga0207713_1010436 | |||
| 1255 | Ga0207713_1014958 | |||
| 1256 | Ga0207713_1018119 | |||
| 1257 | Ga0207713_1019469 | |||
| 1258 | Ga0207713_1022978 | |||
| 1259 | Ga0207713_1041210 | |||
| 1260 | Ga0207671_10000018 | |||
| 1261 | Ga0207649_10000008 | |||
| 1262 | Ga0207681_10002297 | |||
| 1263 | Ga0207681_10038297 | |||
| 1264 | Ga0207650_10002243 | |||
| 1265 | Ga0207650_10004740 | |||
| 1266 | Ga0207706_10001633 | |||
| 1267 | Ga0207706_10175056 | |||
| 1268 | Ga0207686_10010975 | |||
| 1269 | Ga0207709_10000089 | |||
| 1270 | Ga0207709_10001814 | |||
| 1271 | Ga0207709_10034506 | |||
| 1272 | Ga0207709_10049233 | |||
| 1273 | Ga0207709_10097434 | |||
| 1274 | Ga0207679_10000008 | |||
| 1275 | Ga0209281_1000018 | |||
| 1276 | Ga0209281_1000391 | |||
| 1277 | Ga0209281_1002058 | |||
| 1278 | Ga0209371_1002020 | |||
| 1279 | Ga0209371_1006324 | |||
| 1280 | Ga0209282_1053271 | |||
| 1281 | Ga0207428_10017124 | |||
| 1282 | Ga0207428_10036996 | |||
| 1283 | Ga0207428_10048629 | |||
| 1284 | Ga0207428_10088086 | |||
| 1285 | Ga0207428_10141635 | |||
| 1286 | Ga0268266_10018069 | |||
| 1287 | Ga0268266_10409160 | |||
| 1288 | Ga0268256_1000683 | |||
| 1289 | Ga0268256_1006351 | |||
| 1290 | Ga0307511_10146258 | |||
| 1291 | Ga0316178_1087112 | |||
| 1292 | Ga0307509_10350081 | |||
| 1293 | Ga0307408_100032542 | |||
| 1294 | Ga0307408_100168323 | |||
| 1295 | Ga0307408_100210264 | |||
| 1296 | Ga0307408_100277403 | |||
| 1297 | Ga0307405_10005822 | |||
| 1298 | Ga0307405_10326306 | |||
| 1299 | Ga0307405_10338071 | |||
| 1300 | Ga0307413_10033819 | |||
| 1301 | Ga0307412_10043004 | |||
| 1302 | Ga0307411_10105635 | |||
| 1303 | Ga0307411_10216229 | |||
| 1304 | Ga0307411_10398097 | |||
| 1305 | Ga0237819_00787 | |||
| 1306 | Ga0439436_0020880 | |||
| 1307 | Ga0439438_003520 | |||
| 1308 | Ga0439438_003556 | |||
| 1309 | Ga0439438_006717 | |||
| 1310 | Ga0439438_023509 | |||
| 1311 | Ga0439438_044922 | |||
| 1312 | Ga0439438_044925 | |||
| 1313 | Ga0439447_002687 | |||
| 1314 | Ga0439447_006607 | |||
| 1315 | Ga0439447_010193 | |||
| 1316 | Ga0439447_029983 | |||
| 1317 | Ga0439466_0002047 | |||
| 1318 | Ga0439466_0003072 | |||
| 1319 | Ga0439466_0003320 | |||
| 1320 | Ga0439466_0005230 | |||
| 1321 | Ga0439466_0016551 | |||
| 1322 | Ga0439466_0019313 | |||
| 1323 | Ga0439466_0022042 | |||
| 1324 | Ga0439466_0036490 | |||
| 1325 | Ga0439432_002614 | |||
| 1326 | Ga0439432_024748 | |||
| 1327 | Ga0439432_024769 | |||
| 1328 | Ga0439432_028123 | |||
| 1329 | Ga0439432_031194 | |||
| 1330 | Ga0439432_032284 | |||
| 1331 | Ga0439432_035906 | |||
| 1332 | Ga0439451_004081 | |||
| 1333 | Ga0439451_009331 | |||
| 1334 | Ga0439451_013552 | |||
| 1335 | Ga0439452_001971 | |||
| 1336 | Ga0439452_002234 | |||
| 1337 | Ga0439452_002717 | |||
| 1338 | Ga0439452_004105 | |||
| 1339 | Ga0439452_008840 | |||
| 1340 | Ga0439452_021368 | |||
| 1341 | Ga0439456_000724 | |||
| 1342 | Ga0439456_028210 | |||
| 1343 | Ga0439463_018850 | |||
| 1344 | Ga0450911_000989 | |||
| 1345 | Ga0450911_004391 | |||
| 1346 | Ga0450920_000323 | |||
| 1347 | Ga0450922_000233 | |||
| 1348 | Ga0450900_004893 | |||
| 1349 | Ga0450902_001495 | |||
| 1350 | Ga0450902_004873 | |||
| 1351 | Ga0450902_011205 | |||
| 1352 | Ga0450903_007661 | |||
| 1353 | Ga0450903_008463 | |||
| 1354 | Ga0450903_008565 | |||
| 1355 | Ga0450905_000259 | |||
| 1356 | Ga0450905_009588 | |||
| 1357 | Ga0450906_001792 | |||
| 1358 | Ga0450906_002154 | |||
| 1359 | Ga0450906_011162 | |||
| 1360 | Ga0450907_002371 | |||
| 1361 | Ga0450907_007775 | |||
| 1362 | Ga0439446_0002125 | |||
| 1363 | Ga0439446_0036822 | |||
| 1364 | Ga0450909_003369 | |||
| 1365 | Ga0439434_0001684 | |||
| 1366 | Ga0439464_0026244 | |||
| 1367 | Ga0439460_0007945 | |||
| 1368 | Ga0439460_0013457 | |||
| 1369 | Ga0439460_0025082 | |||
| 1370 | Ga0450901_000068 | |||
| 1371 | Ga0450901_005614 | |||
| 1372 | Ga0451577_0128905 | |||
| 1373 | Ga0439440_0013194 | |||
| 1374 | Ga0439440_0014683 | |||
| 1375 | Ga0495617_001724 | |||
| 1376 | Ga0495617_004628 | |||
| 1377 | Ga0495617_029422 | |||
| 1378 | Ga0495617_042260 | |||
| 1379 | Ga0495617_045241 | |||
| 1380 | Ga0495617_058550 | |||
| 1381 | Ga0495627_000423 | |||
| 1382 | Ga0495627_002133 | |||
| 1383 | Ga0495627_003667 | |||
| 1384 | Ga0495627_003943 | |||
| 1385 | Ga0495627_015523 | |||
| 1386 | Ga0495627_018704 | |||
| 1387 | Ga0495627_022260 | |||
| 1388 | Ga0495627_041647 | |||
| 1389 | Ga0495603_0061569 | |||
| 1390 | Ga0495590_0001676 | |||
| 1391 | Ga0495590_0003517 | |||
| 1392 | Ga0495590_0030223 | |||
| 1393 | Ga0495590_0041994 | |||
| 1394 | Ga0495590_0045216 | |||
| 1395 | Ga0495590_0046488 | |||
| 1396 | Ga0495591_000822 | |||
| 1397 | Ga0495591_004666 | |||
| 1398 | Ga0495591_005344 | |||
| 1399 | Ga0495591_007846 | |||
| 1400 | Ga0495591_010629 | |||
| 1401 | Ga0495591_028972 | |||
| 1402 | Ga0495591_038371 | |||
| 1403 | Ga0495591_038867 | |||
| 1404 | Ga0495591_043902 | |||
| 1405 | Ga0495629_0068187 | |||
| 1406 | Ga0495638_0005430 | |||
| 1407 | Ga0495638_0005848 | |||
| 1408 | Ga0495638_0010061 | |||
| 1409 | Ga0495638_0018580 | |||
| 1410 | Ga0495638_0019444 | |||
| 1411 | Ga0495638_0048358 | |||
| 1412 | Ga0495638_0057118 | |||
| 1413 | Ga0495638_0073971 | |||
| 1414 | Ga0495638_0097232 | |||
| 1415 | Ga0495653_0015817 | |||
| 1416 | Ga0495653_0086183 | |||
| 1417 | Ga0495653_0090701 | |||
| 1418 | Ga0495653_0094466 | |||
| 1419 | Ga0495653_0128863 | |||
| 1420 | Ga0495650_0004871 | |||
| 1421 | Ga0495650_0005972 | |||
| 1422 | Ga0495650_0011996 | |||
| 1423 | Ga0495650_0028924 | |||
| 1424 | Ga0495650_0053647 | |||
| 1425 | Ga0495650_0070991 | |||
| 1426 | Ga0495582_0011028 | |||
| 1427 | Ga0495605_0000373 | |||
| 1428 | Ga0495605_0000903 | |||
| 1429 | Ga0495605_0006937 | |||
| 1430 | Ga0495605_0010769 | |||
| 1431 | Ga0495605_0024099 | |||
| 1432 | Ga0495605_0038058 | |||
| 1433 | Ga0495605_0049954 | |||
| 1434 | Ga0495605_0075133 | |||
| 1435 | Ga0495605_0117966 | |||
| 1436 | Ga0495639_0003160 | |||
| 1437 | Ga0495639_0063909 | |||
| 1438 | Ga0495584_0002893 | |||
| 1439 | Ga0495584_0005772 | |||
| 1440 | Ga0495584_0009399 | |||
| 1441 | Ga0495584_0014317 | |||
| 1442 | Ga0495584_0020834 | |||
| 1443 | Ga0495584_0065445 | |||
| 1444 | Ga0495584_0067250 | |||
| 1445 | Ga0495584_0090224 | |||
| 1446 | Ga0495584_0114151 | |||
| 1447 | Ga0495585_0005462 | |||
| 1448 | Ga0495585_0056406 | |||
| 1449 | Ga0495585_0079795 | |||
| 1450 | Ga0495585_0104055 | |||
| 1451 | Ga0495585_0122837 | |||
| 1452 | Ga0495594_0000612 | |||
| 1453 | Ga0495594_0141212 | |||
| 1454 | Ga0495596_0002729 | |||
| 1455 | Ga0495607_0000869 | |||
| 1456 | Ga0495607_0001054 | |||
| 1457 | Ga0495607_0001549 | |||
| 1458 | Ga0495607_0005710 | |||
| 1459 | Ga0495607_0010013 | |||
| 1460 | Ga0495607_0012035 | |||
| 1461 | Ga0495607_0039152 | |||
| 1462 | Ga0495607_0042916 | |||
| 1463 | Ga0495607_0044219 | |||
| 1464 | Ga0495607_0046493 | |||
| 1465 | Ga0495607_0047200 | |||
| 1466 | Ga0495607_0052897 | |||
| 1467 | Ga0495607_0080678 | |||
| 1468 | Ga0495607_0087870 | |||
| 1469 | Ga0495607_0088674 | |||
| 1470 | Ga0495607_0098462 | |||
| 1471 | Ga0495607_0116347 | |||
| 1472 | Ga0495607_0125150 | |||
| 1473 | Ga0495607_0168164 | |||
| 1474 | Ga0495583_0000521 | |||
| 1475 | Ga0495583_0004447 | |||
| 1476 | Ga0495583_0007969 | |||
| 1477 | Ga0495583_0008745 | |||
| 1478 | Ga0495583_0011128 | |||
| 1479 | Ga0495583_0075473 | |||
| 1480 | Ga0495606_0013204 | |||
| 1481 | Ga0495606_0021286 | |||
| 1482 | Ga0495606_0022176 | |||
| 1483 | Ga0495606_0024326 | |||
| 1484 | Ga0495606_0071066 | |||
| 1485 | Ga0495606_0119885 | |||
| 1486 | Ga0495606_0120810 | |||
| 1487 | Ga0495606_0122553 | |||
| 1488 | Ga0495606_0137015 | |||
| 1489 | Ga0495610_0009426 | |||
| 1490 | Ga0495610_0009546 | |||
| 1491 | Ga0495610_0011113 | |||
| 1492 | Ga0495610_0037183 | |||
| 1493 | Ga0495610_0045652 | |||
| 1494 | Ga0495610_0047722 | |||
| 1495 | Ga0495610_0055655 | |||
| 1496 | Ga0495610_0057052 | |||
| 1497 | Ga0495610_0059293 | |||
| 1498 | Ga0495610_0069724 | |||
| 1499 | Ga0495610_0070255 | |||
| 1500 | Ga0495610_0087206 | |||
| 1501 | Ga0495616_0006310 | |||
| 1502 | Ga0495616_0022827 | |||
| 1503 | Ga0495616_0049434 | |||
| 1504 | Ga0495616_0049887 | |||
| 1505 | Ga0495616_0061425 | |||
| 1506 | Ga0495616_0090295 | |||
| 1507 | Ga0495620_0000054 | |||
| 1508 | Ga0495620_0000413 | |||
| 1509 | Ga0495620_0010881 | |||
| 1510 | Ga0495620_0015204 | |||
| 1511 | Ga0495620_0018753 | |||
| 1512 | Ga0495620_0032485 | |||
| 1513 | Ga0495620_0051232 | |||
| 1514 | Ga0495620_0064370 | |||
| 1515 | Ga0495620_0100048 | |||
| 1516 | Ga0495630_0024127 | |||
| 1517 | Ga0495630_0269642 | |||
| 1518 | Ga0495631_0002466 | |||
| 1519 | Ga0495631_0004944 | |||
| 1520 | Ga0495631_0005089 | |||
| 1521 | Ga0495631_0025617 | |||
| 1522 | Ga0495631_0040347 | |||
| 1523 | Ga0495631_0052427 | |||
| 1524 | Ga0495631_0053722 | |||
| 1525 | Ga0495632_0003472 | |||
| 1526 | Ga0495632_0004992 | |||
| 1527 | Ga0495632_0012246 | |||
| 1528 | Ga0495632_0013231 | |||
| 1529 | Ga0495632_0013697 | |||
| 1530 | Ga0495632_0015762 | |||
| 1531 | Ga0495632_0020156 | |||
| 1532 | Ga0495632_0036607 | |||
| 1533 | Ga0495632_0037199 | |||
| 1534 | Ga0495632_0046625 | |||
| 1535 | Ga0495632_0050615 | |||
| 1536 | Ga0495632_0106254 | |||
| 1537 | Ga0495632_0113206 | |||
| 1538 | Ga0495637_0002741 | |||
| 1539 | Ga0495637_0003263 | |||
| 1540 | Ga0495637_0005290 | |||
| 1541 | Ga0495637_0006328 | |||
| 1542 | Ga0495637_0009393 | |||
| 1543 | Ga0495637_0012337 | |||
| 1544 | Ga0495637_0023908 | |||
| 1545 | Ga0495637_0024815 | |||
| 1546 | Ga0495637_0033820 | |||
| 1547 | Ga0495637_0057538 | |||
| 1548 | Ga0495637_0060365 | |||
| 1549 | Ga0495637_0065269 | |||
| 1550 | Ga0495637_0076639 | |||
| 1551 | Ga0495637_0118018 | |||
| 1552 | Ga0495643_0039177 | |||
| 1553 | Ga0495644_0002733 | |||
| 1554 | Ga0495644_0038306 | |||
| 1555 | Ga0495644_0066537 | |||
| 1556 | Ga0495644_0073859 | |||
| 1557 | Ga0495648_0004518 | |||
| 1558 | Ga0495648_0009694 | |||
| 1559 | Ga0495648_0009969 | |||
| 1560 | Ga0495648_0012209 | |||
| 1561 | Ga0495648_0014500 | |||
| 1562 | Ga0495648_0016463 | |||
| 1563 | Ga0495648_0020195 | |||
| 1564 | Ga0495648_0029376 | |||
| 1565 | Ga0495648_0052930 | |||
| 1566 | Ga0495648_0094378 | |||
| 1567 | Ga0495648_0102480 | |||
| 1568 | Ga0495648_0126557 | |||
| 1569 | Ga0495648_0136205 | |||
| 1570 | Ga0495666_0065511 | |||
| 1571 | Ga0495666_0071680 | |||
| 1572 | Ga0495666_0071910 | |||
| 1573 | Ga0495642_0001528 | |||
| 1574 | Ga0495642_0005239 | |||
| 1575 | Ga0495642_0005299 | |||
| 1576 | Ga0495654_0000875 | |||
| 1577 | Ga0495654_0003407 | |||
| 1578 | Ga0495654_0003646 | |||
| 1579 | Ga0495654_0006655 | |||
| 1580 | Ga0495654_0006951 | |||
| 1581 | Ga0495654_0007007 | |||
| 1582 | Ga0495654_0007541 | |||
| 1583 | Ga0495654_0010594 | |||
| 1584 | Ga0495654_0011143 | |||
| 1585 | Ga0495654_0017168 | |||
| 1586 | Ga0495654_0023656 | |||
| 1587 | Ga0495654_0030072 | |||
| 1588 | Ga0495654_0031304 | |||
| 1589 | Ga0495654_0037907 | |||
| 1590 | Ga0495654_0066012 | |||
| 1591 | Ga0495654_0075480 | |||
| 1592 | Ga0495586_0064336 | |||
| 1593 | Ga0495587_0054967 | |||
| 1594 | Ga0495609_0000349 | |||
| 1595 | Ga0495609_0009175 | |||
| 1596 | Ga0495609_0051324 | |||
| 1597 | Ga0495609_0057953 | |||
| 1598 | Ga0495597_0000221 | |||
| 1599 | Ga0495597_0002355 | |||
| 1600 | Ga0495597_0012109 | |||
| 1601 | Ga0495597_0013605 | |||
| 1602 | Ga0495597_0014265 | |||
| 1603 | Ga0495597_0031972 | |||
| 1604 | Ga0495597_0061745 | |||
| 1605 | Ga0495597_0092758 | |||
| 1606 | Ga0495597_0102937 | |||
| 1607 | Ga0495645_0064600 | |||
| 1608 | Ga0495622_0000853 | |||
| 1609 | Ga0495622_0004796 | |||
| 1610 | Ga0495622_0007565 | |||
| 1611 | Ga0495622_0021031 | |||
| 1612 | Ga0495622_0057181 | |||
| 1613 | Ga0495622_0071880 | |||
| 1614 | Ga0495622_0091676 | |||
| 1615 | Ga0495633_0000287 | |||
| 1616 | Ga0495633_0008482 | |||
| 1617 | Ga0495633_0030817 | |||
| 1618 | Ga0495633_0076620 | |||
| 1619 | Ga0495668_0007362 | |||
| 1620 | Ga0495668_0012376 | |||
| 1621 | Ga0495634_0005385 | |||
| 1622 | Ga0495611_0001725 | |||
| 1623 | Ga0495611_0001973 | |||
| 1624 | Ga0495625_0007564 | |||
| 1625 | Ga0495625_0007957 | |||
| 1626 | Ga0495625_0025133 | |||
| 1627 | Ga0495625_0090428 | |||
| 1628 | Ga0495625_0136668 | |||
| 1629 | Ga0495625_0182755 | |||
| 1630 | Ga0495625_0206178 | |||
| 1631 | Ga0495635_0040495 | |||
| 1632 | Ga0495659_0001232 | |||
| 1633 | Ga0495659_0003330 | |||
| 1634 | Ga0495659_0034077 | |||
| 1635 | Ga0495661_0000596 | |||
| 1636 | Ga0495661_0008587 | |||
| 1637 | Ga0495661_0013929 | |||
| 1638 | Ga0495661_0080628 | |||
| 1639 | Ga0495661_0095387 | |||
| 1640 | Ga0495661_0115717 | |||
| 1641 | Ga0495588_0013670 | |||
| 1642 | Ga0495588_0107683 | |||
| 1643 | Ga0495588_0109244 | |||
| 1644 | Ga0495657_0054525 | |||
| 1645 | Ga0495623_0007248 | |||
| 1646 | Ga0495623_0134893 | |||
| 1647 | Ga0495646_0014970 | |||
| 1648 | Ga0495646_0019790 | |||
| 1649 | Ga0495669_0030582 | |||
| 1650 | Ga0495613_0020114 | |||
| 1651 | Ga0495613_0150417 | |||
| 1652 | Ga0495613_0340449 | |||
| 1653 | Ga0495624_0100430 | |||
| 1654 | Ga0495670_0004673 | |||
| 1655 | Ga0495670_0005284 | |||
| 1656 | Ga0495670_0027015 | |||
| 1657 | Ga0495670_0033496 | |||
| 1658 | Ga0495670_0126809 | |||
| 1659 | Ga0495670_0132343 | |||
| 1660 | Ga0495671_0006050 | |||
| 1661 | Ga0495671_0006650 | |||
| 1662 | Ga0495671_0006995 | |||
| 1663 | Ga0495671_0013093 | |||
| 1664 | Ga0495671_0018380 | |||
| 1665 | Ga0495671_0020305 | |||
| 1666 | Ga0495671_0027399 | |||
| 1667 | Ga0495671_0067046 | |||
| 1668 | Ga0495671_0075065 | |||
| 1669 | Ga0495671_0121613 | |||
| 1670 | Ga0495649_0007229 | |||
| 1671 | Ga0495649_0007817 | |||
| 1672 | Ga0495649_0007878 | |||
| 1673 | Ga0495649_0011400 | |||
| 1674 | Ga0495649_0016250 | |||
| 1675 | Ga0495649_0020620 | |||
| 1676 | Ga0495649_0063981 | |||
| 1677 | Ga0495649_0070843 | |||
| 1678 | Ga0495649_0079830 | |||
| 1679 | Ga0495649_0104495 | |||
| 1680 | Ga0495589_0002065 | |||
| 1681 | Ga0495589_0002775 | |||
| 1682 | Ga0495589_0009137 | |||
| 1683 | Ga0495589_0009752 | |||
| 1684 | Ga0495589_0020860 | |||
| 1685 | Ga0495589_0071184 | |||
| 1686 | Ga0495589_0108816 | |||
| 1687 | Ga0495589_0114953 | |||
| 1688 | Ga0495660_0001754 | |||
| 1689 | Ga0495660_0012183 | |||
| 1690 | Ga0495660_0020994 | |||
| 1691 | Ga0495660_0045614 | |||
| 1692 | Ga0495660_0046409 | |||
| 1693 | Ga0495660_0059306 | |||
| 1694 | Ga0495660_0074849 | |||
| 1695 | Ga0495660_0079382 | |||
| 1696 | Ga0495660_0109969 | |||
| 1697 | Ga0495660_0124729 | |||
| 1698 | Ga0495660_0136139 | |||
| 1699 | Ga0495604_0008431 | |||
| 1700 | Ga0495604_0032318 | |||
| 1701 | Ga0495604_0150745 | |||
| 1702 | Ga0495604_0240064 | |||
| 1703 | Ga0495636_0012407 | |||
| 1704 | Ga0495672_0009375 | |||
| 1705 | Ga0495672_0010252 | |||
| 1706 | Ga0495672_0014602 | |||
| 1707 | Ga0495672_0015264 | |||
| 1708 | Ga0495672_0021286 | |||
| 1709 | Ga0495672_0032112 | |||
| 1710 | Ga0495672_0056206 | |||
| 1711 | Ga0495672_0078044 | |||
| 1712 | Ga0495672_0082132 | |||
| 1713 | Ga0495672_0091413 | |||
| 1714 | Ga0495672_0120048 | |||
| 1715 | Ga0495672_0140043 | |||
| 1716 | Ga0495676_0002177 | |||
| 1717 | Ga0495676_0114051 | |||
| 1718 | Ga0495680_0018118 | |||
| 1719 | Ga0495680_0100413 | |||
| 1720 | Ga0495683_0000053 | |||
| 1721 | Ga0495683_0000129 | |||
| 1722 | Ga0495683_0003047 | |||
| 1723 | Ga0495683_0025899 | |||
| 1724 | Ga0495683_0040230 | |||
| 1725 | Ga0495683_0045261 | |||
| 1726 | Ga0495683_0074262 | |||
| 1727 | Ga0495683_0075746 | |||
| 1728 | Ga0495683_0113688 | |||
| 1729 | Ga0495687_004396 | |||
| 1730 | Ga0495687_012633 | |||
| 1731 | Ga0495687_029964 | |||
| 1732 | Ga0495677_0005671 | |||
| 1733 | Ga0495679_000381 | |||
| 1734 | Ga0495679_007117 | |||
| 1735 | Ga0495679_031487 | |||
| 1736 | Ga0495679_033014 | |||
| 1737 | Ga0495685_066942 | |||
| 1738 | Ga0495673_0001495 | |||
| 1739 | Ga0495673_0003834 | |||
| 1740 | Ga0495673_0004508 | |||
| 1741 | Ga0495673_0006177 | |||
| 1742 | Ga0495673_0007246 | |||
| 1743 | Ga0495673_0011850 | |||
| 1744 | Ga0495673_0014045 | |||
| 1745 | Ga0495673_0014292 | |||
| 1746 | Ga0495673_0051462 | |||
| 1747 | Ga0495673_0059813 | |||
| 1748 | Ga0495673_0083476 | |||
| 1749 | Ga0495681_0007254 | |||
| 1750 | Ga0495681_0007399 | |||
| 1751 | Ga0495681_0007889 | |||
| 1752 | Ga0495681_0008428 | |||
| 1753 | Ga0495681_0009708 | |||
| 1754 | Ga0495681_0009797 | |||
| 1755 | Ga0495681_0010583 | |||
| 1756 | Ga0495681_0024197 | |||
| 1757 | Ga0495681_0031033 | |||
| 1758 | Ga0495681_0048603 | |||
| 1759 | Ga0495681_0049170 | |||
| 1760 | Ga0495681_0063619 | |||
| 1761 | Ga0495681_0070803 | |||
| 1762 | Ga0495681_0077408 | |||
| 1763 | Ga0495681_0093330 | |||
| 1764 | Ga0495684_0048621 | |||
| 1765 | Ga0495686_0011491 | |||
| 1766 | Ga0495686_0090130 | |||
| 1767 | Ga0495686_0118000 | |||
| 1768 | Ga0495593_0016169 | |||
| 1769 | Ga0495593_0072910 | |||
| 1770 | Ga0495593_0077797 | |||
| 1771 | Ga0495602_0155161 | |||
| 1772 | Ga0495626_0003380 | |||
| 1773 | Ga0495626_0005884 | |||
| 1774 | Ga0495626_0006281 | |||
| 1775 | Ga0495626_0006409 | |||
| 1776 | Ga0495626_0006683 | |||
| 1777 | Ga0495626_0045371 | |||
| 1778 | Ga0495626_0067379 | |||
| 1779 | Ga0496102_0006510 | |||
| 1780 | Ga0496106_0292765 | |||
| 1781 | Ga0496110_0085009 | |||
| 1782 | Ga0496110_0141939 | |||
| 1783 | Ga0496110_0262335 | |||
| 1784 | Ga0496110_0338370 | |||
| 1785 | Ga0496112_0094542 | |||
| 1786 | Ga0496114_0016215 | |||
| 1787 | Ga0496116_0000677 | |||
| 1788 | Ga0496116_0012788 | |||
| 1789 | Ga0496116_0015011 | |||
| 1790 | Ga0496117_0008203 | |||
| 1791 | Ga0496117_0013703 | |||
| 1792 | Ga0496117_0016210 | |||
| 1793 | Ga0496117_0050588 | |||
| 1794 | Ga0496117_0128213 | |||
| 1795 | Ga0496117_0137191 | |||
| 1796 | Ga0496118_0038509 | |||
| 1797 | Ga0496118_0041108 | |||
| 1798 | Ga0496118_0091756 | |||
| 1799 | Ga0496118_0131595 | |||
| 1800 | Ga0496118_0133596 | |||
| 1801 | Ga0496118_0164863 | |||
| 1802 | Ga0496118_0165040 | |||
| 1803 | Ga0496119_0000943 | |||
| 1804 | Ga0496119_0101893 | |||
| 1805 | Ga0496119_0119559 | |||
| 1806 | Ga0496120_0011781 | |||
| 1807 | Ga0496120_0026440 | |||
| 1808 | Ga0496120_0089472 | |||
| 1809 | Ga0496121_0000299 | |||
| 1810 | Ga0496121_0055715 | |||
| 1811 | Ga0496121_0183679 | |||
| 1812 | Ga0496121_0224722 | |||
| 1813 | Ga0496122_0016635 | |||
| 1814 | Ga0496122_0019422 | |||
| 1815 | Ga0496122_0028672 | |||
| 1816 | Ga0496122_0113805 | |||
| 1817 | Ga0496122_0223678 | |||
| 1818 | Ga0496123_0012802 | |||
| 1819 | Ga0496123_0050022 | |||
| 1820 | Ga0496123_0098187 | |||
| 1821 | Ga0496123_0098744 | |||
| 1822 | Ga0496123_0113632 | |||
| 1823 | Ga0496124_0019636 | |||
| 1824 | Ga0496124_0019995 | |||
| 1825 | Ga0496124_0029500 | |||
| 1826 | Ga0496124_0073159 | |||
| 1827 | Ga0496124_0083573 | |||
| 1828 | Ga0496124_0099998 | |||
| 1829 | Ga0496124_0120560 | |||
| 1830 | Ga0496124_0180725 | |||
| 1831 | Ga0496124_0181964 | |||
| 1832 | Ga0496124_0319419 | |||
| 1833 | Ga0496125_0020199 | |||
| 1834 | Ga0496125_0021517 | |||
| 1835 | Ga0496125_0026196 | |||
| 1836 | Ga0496125_0037940 | |||
| 1837 | Ga0496125_0126058 | |||
| 1838 | Ga0496125_0152334 | |||
| 1839 | Ga0496125_0158973 | |||
| 1840 | Ga0496125_0170707 | |||
| 1841 | Ga0496126_0022913 | |||
| 1842 | Ga0496126_0098318 | |||
| 1843 | Ga0496126_0208875 | |||
| 1844 | Ga0496126_0227378 | |||
| 1845 | Ga0495678_000362 | |||
| 1846 | Ga0495678_003571 | |||
| 1847 | Ga0495678_006194 | |||
| 1848 | Ga0495678_006317 | |||
| 1849 | Ga0495678_010485 | |||
| 1850 | Ga0495678_041162 | |||
| 1851 | Ga0495678_042941 | |||
| 1852 | Ga0495678_046888 | |||
| 1853 | Ga0495678_052247 | |||
| 1854 | Ga0495678_062445 | |||
| 1855 | Ga0495682_0000268 | |||
| 1856 | Ga0495682_0030321 | |||
| 1857 | Ga0495682_0034371 | |||
| 1858 | Ga0495682_0038797 | |||
| 1859 | Ga0495682_0045771 | |||
| 1860 | Ga0495682_0068366 | |||
| 1861 | Ga0501032_0016840 | |||
| 1862 | Ga0501034_0047016 | |||
| 1863 | Ga0501034_0206785 | |||
| 1864 | Ga0501037_0034086 | |||
| 1865 | Ga0501038_0102187 | |||
| 1866 | Ga0501241_000589 | |||
| 1867 | nmdc:mga03683_90883_c1 | |||
| 1868 | nmdc:mga00v17_131060_c1 | |||
| 1869 | nmdc:mga00v17_327807_c1 | |||
| 1870 | Ga0500572_036297 | |||
| 1871 | Ga0500634_0055203 | |||
| 1872 | 2511257602 | |||
| 1873 | 2511263660 | |||
| 1874 | 2511270262 | |||
| 1875 | 2511276452 | |||
| 1876 | 2511291004 | |||
| 1877 | 2511294249 | |||
| 1878 | 2511302439 | |||
| 1879 | 2511314036 | |||
| 1880 | 2511319995 | |||
| 1881 | 2511324784 | |||
| 1882 | 2511330329 | |||
| 1883 | 2511338017 | |||
| 1884 | 2511342828 | |||
| 1885 | 2511348796 | |||
| 1886 | 2511354864 | |||
| 1887 | 2511365897 | |||
| 1888 | 2511369957 | |||
| 1889 | 2511373237 | |||
| 1890 | 2511413254 | |||
| 1891 | 2511823899 | |||
| 1892 | 2512326842 | |||
| 1893 | 2554814230 | |||
| 1894 | 2555244895 | |||
| 1895 | 2555669058 | |||
| 1896 | 2583791474 | |||
| 1897 | 2597857198 | |||
| 1898 | 2597864879 | |||
| 1899 | 2597870755 | |||
| 1900 | 2599328642 | |||
| 1901 | 2599358050 | |||
| 1902 | 2599361808 | |||
| 1903 | 2599368129 | |||
| 1904 | 2599374918 | |||
| 1905 | 2599383215 | |||
| 1906 | 2599389402 | |||
| 1907 | 2599393776 | |||
| 1908 | 2599398061 | |||
| 1909 | 2599405543 | |||
| 1910 | 2599452518 | |||
| 1911 | 2599464865 | |||
| 1912 | 2599468417 | |||
| 1913 | 2599484220 | |||
| 1914 | 2599493889 | |||
| 1915 | 2599503148 | |||
| 1916 | 2599507064 | |||
| 1917 | 2599516184 | |||
| 1918 | 2599518386 | |||
| 1919 | 2599614834 | |||
| 1920 | 2599769709 | |||
| 1921 | 2599801870 | |||
| 1922 | 2599878220 | |||
| 1923 | 2599889029 | |||
| 1924 | 2599895518 | |||
| 1925 | 2599901609 | |||
| 1926 | 2599933654 | |||
| 1927 | 2599947413 | |||
| 1928 | 2599953582 | |||
| 1929 | 2599959268 | |||
| 1930 | 2599967425 | |||
| 1931 | 2599978665 | |||
| 1932 | 2599982159 | |||
| 1933 | 2599988962 | |||
| 1934 | 2599994715 | |||
| 1935 | 2599999575 | |||
| 1936 | 2600007316 | |||
| 1937 | 2600012733 | |||
| 1938 | 2600020509 | |||
| 1939 | 2600025240 | |||
| 1940 | 2600029749 | |||
| 1941 | 2600037819 | |||
| 1942 | 2600042004 | |||
| 1943 | 2600046911 | |||
| 1944 | 2600055022 | |||
| 1945 | 2600057770 | |||
| 1946 | 2600064785 | |||
| 1947 | 2600071672 | |||
| 1948 | 2600076035 | |||
| 1949 | 2600217596 | |||
| 1950 | 2600359344 | |||
| 1951 | 2600365447 | |||
| 1952 | 2601689844 | |||
| 1953 | 2601777764 | |||
| 1954 | 2601795821 | |||
| 1955 | 2602010047 | |||
| 1956 | 2606075332 | |||
| 1957 | 2606128195 | |||
| 1958 | 2608381629 | |||
| 1959 | 2621298528 | |||
| 1960 | 2624479758 | |||
| 1961 | 2624491413 | |||
| 1962 | 2643842572 | |||
| 1963 | 2643871582 | |||
| 1964 | 2643952951 | |||
| 1965 | 2644022713 | |||
| 1966 | 2644188886 | |||
| 1967 | 2644284961 | |||
| 1968 | 2644621637 | |||
| 1969 | 2652543896 | |||
| 1970 | 2671093480 | |||
| 1971 | 2671098447 | |||
| 1972 | 2671128310 | |||
| 1973 | 2671768819 | |||
| 1974 | 2677899636 | |||
| 1975 | 2678264259 | |||
| 1976 | 2715752529 | |||
| 1977 | 2715758026 | |||
| 1978 | 2718633430 | |||
| 1979 | 2723249636 | |||
| 1980 | 2729148196 | |||
| 1981 | 2738674562 | |||
| 1982 | 2738752955 | |||
| 1983 | 2738809706 | |||
| 1984 | 2738861996 | |||
| 1985 | 2738897066 | |||
| 1986 | 2739199796 | |||
| 1987 | 2739259437 | |||
| 1988 | 2739315785 | |||
| 1989 | 2743736614 | |||
| 1990 | 2745004714 | |||
| 1991 | 2765585224 | |||
| 1992 | 2774121002 | |||
| 1993 | 2774137339 | |||
| 1994 | 2784263649 | |||
| 1995 | 2784314074 | |||
| 1996 | 2794596654 | |||
| 1997 | 2807407432 | |||
| 1998 | 2807455760 | |||
| 1999 | 2808857647 | |||
| 2000 | 2808924737 | |||
| 2001 | 2808927742 | |||
| 2002 | 2808937817 | |||
| 2003 | 2808946839 | |||
| 2004 | 2808949718 | |||
| 2005 | 2808960254 | |||
| 2006 | 2808966131 | |||
| 2007 | 2808977168 | |||
| 2008 | 2808992323 | |||
| 2009 | 2809000979 | |||
| 2010 | 2809216709 | |||
| 2011 | 2817492324 | |||
| 2012 | 2819656459 | |||
| 2013 | 2819703527 | |||
| 2014 | 2823424119 | |||
| 2015 | 2825656801 | |||
| 2016 | 2826583639 | |||
| 2017 | 2834033740 | |||
| 2018 | 2842818135 | |||
| 2019 | 2842831125 | |||
| 2020 | 2842832369 | |||
| 2021 | 2842842384 | |||
| 2022 | 2842848650 | |||
| 2023 | 2842849230 | |||
| 2024 | 2842854794 | |||
| 2025 | 2844669497 | |||
| 2026 | 2852613478 | |||
| 2027 | 2852658275 | |||
| 2028 | 2852668786 | |||
| 2029 | 2860339627 | |||
| 2030 | 2860871389 | |||
| 2031 | 2878031770 | |||
| 2032 | 2880234279 | |||
| 2033 | 2904523605 | |||
| 2034 | 2904554299 | |||
| 2035 | 2908450764 | |||
| 2036 | 2912967488 | |||
| 2037 | 2913040736 | |||
| 2038 | 2917072855 | |||
| 2039 | 2919068244 | |||
| 2040 | 2919157321 | |||
| 2041 | 2919386736 | |||
| 2042 | 2919456719 | |||
| 2043 | 2919482146 | |||
| 2044 | 2919491517 | |||
| 2045 | 2919701028 | |||
| 2046 | 2923155630 | |||
| 2047 | 2923587711 | |||
| 2048 | 2929148232 | |||
| 2049 | 2929193409 | |||
| 2050 | 2931374355 | |||
| 2051 | 2931394719 | |||
| 2052 | 2931400488 | |||
| 2053 | 2935359283 | |||
| 2054 | 2939639268 | |||
| 2055 | 2939652996 | |||
| 2056 | 2945932570 | |||
| 2057 | 2945962477 | |||
| 2058 | 2946008813 | |||
| 2059 | 2946031883 | |||
| 2060 | 2947238711 | |||
| 2061 | 2969306564 | |||
| 2062 | 2974291749 | |||
| 2063 | 2984290389 | |||
| 2064 | 2988729879 | |||
| 2065 | 2998141950 | |||
| 2066 | 3007317717 | |||
| 2067 | 3007401214 | |||
| 2068 | 3007421600 | |||
| 2069 | 3007513370 | |||
| 2070 | 3007618395 | |||
| 2071 | 3007619864 | |||
| 2072 | 3007723778 | |||
| 2073 | 3007807821 | |||
| 2074 | 3007860668 | |||
| 2075 | 3007862823 | |||
| 2076 | 3007868309 | |||
| 2077 | 637319407 | |||
| 2078 | 640487728 | |||
| 2079 | 8015689888 | |||
| 2080 | 8019775265 | |||
| 2081 | 8019778308 | |||
| 2082 | 8029998748 | |||
| 2083 | 8034965866 | |||
| 2084 | 8054288217 | |||
| 2085 | 8054349183 | |||
| 2086 | 8054507258 | |||
| 2087 | 8054932869 | |||
| 2088 | 8055772993 | |||
| 2089 | 8055822163 | |||
| 2090 | 8055879636 | |||
| 2091 | 8056117867 | |||
| 2092 | 8056124424 | |||
| 2093 | 8056127920 | |||
| 2094 | 8056135648 | |||
| 2095 | 8056139073 | |||
| 2096 | 8056147120 | |||
| 2097 | 8056152949 | |||
| 2098 | 8056155980 | |||
| 2099 | 8056161847 | |||
| 2100 | 8056169051 | |||
| 2101 | 8056175199 | |||
| 2102 | 8056183523 | |||
| 2103 | 8056573006 | |||
| 2104 | 8057799424 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hjs-assembly1.cif.gz_A-2 | the structure of a probable aspartate-semialdehyde dehydrogenase from pseudomonas aeruginosa | 0.9796 | 3 | 336 |
| 2hjs-assembly1.cif.gz_A-2 | the structure of a probable aspartate-semialdehyde dehydrogenase from pseudomonas aeruginosa | 0.9768 | 3 | 336 |
| 2qz9-assembly2.cif.gz_B-2 | crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae | 0.9679 | 3 | 336 |
| 2qz9-assembly2.cif.gz_B-2 | crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae | 0.9623 | 3 | 336 |
| 2r00-assembly2.cif.gz_C-2 | crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae | 0.9587 | 2 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hjsA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9704 | 3 | 129 | 3.40.50.720 |
| 2hjsA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9649 | 132 | 314 | 3.30.360.10 |
| 2r00C02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9548 | 129 | 315 | 3.30.360.10 |
| 2hjsA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9546 | 132 | 314 | 3.30.360.10 |
| af_P08390_5_140_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9524 | 6 | 137 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S6UPA0-F1-model_v4 | Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) | 0.9998 | 1 | 91 |
GO:0004073
GO:0051287 |
| AF-A0A850QRE1-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9984 | 1 | 74 |
GO:0016620
GO:0051287 |
| AF-A0A7Y8B711-F1-model_v4 | deleted | 0.9947 | 50 | 336 |
|
| AF-A0A3M4H714-F1-model_v4 | deleted | 0.9939 | 154 | 336 |
|
| AF-U3MIP2-F1-model_v4 | Aspartate semialdehyde dehydrogenase | 0.993 | 1 | 123 |
GO:0016620
GO:0051287 |